3CCVF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccvF00
3CCJF 3OBYA 2OHWA 1ZWZA 3CMEF 3E1YA 1VQ6F 1E7KA 1Q82H 1CN7A 1PXWA 3J81M 3CCQF 1KD1H 3G71F 1DT9A 3CCEF 5GIPC 1KC8H 3CMAF 3CCLF 3CCMF 2QA4F 3N4ZA 5FLXM 1K9MH 1VQ5F 1W40A 1W3EX 3OBWA 3CCVF 1KQSF 4BY9D 1M90H 3RA5A 3GYQA 1W42A 2CZWA 2LBXA 1VQPF 3JAMM 1CK2A 3CPQA 3WXMB 2QI2A 1VQMF 3LWOC 1YHQF 3SIVA 2VGNA 1VQKF 3J80M 3LWQC 3I55F 1VQ7F 3IR9A 1GO1A 2ALEA 1YJ9F 3HAXD 1XBIA 3G6EF 1RA4A 3ON1A 1NMUB 3LWVC 1YJWF 4NUTA 1X7OA 2I6DA 1YIJF 3MCAB 3CPWF 3OW2F 5GANK 4C4WC 3CC4F 5EWRA 3VI6A 5GIOC 2FC3A 5A2QM 1X7PA 3J7AR 4BW0B 4X3MA 1GO0A 2OZBA 1Q86H 2KTUA 1YITF 1JJ2F 5G4UC 1Q7YH 1GZ0A 3NVKE 3PAFA 1VQ8F 1W41A 5DCVA 1VQOF 5G4VC 1Q81H 1VQ9F 3G4SF 1M1KH 3I56F 2KTVA 1X52A 3NMUC 2QEXF 3CG6A 4TZZA 1QVFF 3V7QA 1N8RH 3RA6A 4X3LA 3SIUA 3NK6A 3HJWC 1VQ4F 3JCMM 2OTLF 3PLAC 5IT9M 3AGKA 3CC2F 2AIFA 2BO1A 3CD6F 5EO3A 3E20B 5GINC 3LWRC 1W2BF 1S72F 1NJIH 1VQLF 3CCUF 1QVGF 3V7EA 5FJ4C 3O85A 3LFOA 1VQNF 2JNBA 2HVYD 1YJNF 2VGMA 1SDSA 3CXCF 2KG4A 2WALA 1IPAA 3VMFB 4LCKA 3FFMA 3NVIB 1RLGA 5GAPK 3NK7A 2OTJF 1K73H 3LWPC 3CCRF 3CCSF 1K8AH 2LBWA 1T0KB 1H7MA 3CC7F 3N4YA 1YI2F
chains in the Genus database with same CATH superfamily
3E22B 1ZWZA 3CMEF 5MN5A 3LMEA 3HKDA 3KIZA 1ONIA 5HP7A 3VO8A 1JN1A 5BMVB 2YYEA 3FBAA 3JATA 1CN7A 1FFXA 3BYQA 5FNVB 1PXWA 2HRUA 3J81M 3CCQF 3R0PA 4C81A 3JASA 3RYFA 5LOVA 3N4ZA 3CCMF 1VQ5F 1YGYA 3CCVF 2Z01A 3VIUA 5EYPB 3RA5A 1W42A 2LBXA 3C9RA 1W5FA 4YJ2A 3WGLA 4O4JA 3UT5B 4DXDA 2UYJA 4O4LA 2QI2A 3WXMB 2RHOA 1VQMF 3RYHA 1W55A 4F6RA 3IR9A 1Z5WA 2VAPA 5EAZA 1YJ9F 1IV3A 1W581 5LP6C 3G6EF 2Q1XA 4IIJA 2VAMA 3ON1A 3MBMA 5HY4A 3N2GB 4TV9A 3LWVC 4TUYB 2I6DA 1RQ2A 3ZOPA 1YIJF 2HS3A 3L7QA 3V4DA 3RYHB 4TV8B 5LYJA 4I55A 4EI8A 3S02A 4BVRA 2ZODA 5GIOC 4ZOLB 4ZHWA 1X7PA 1PF5A 4BW0B 3ERNA 1Q86H 2KTUA 5JH7A 1JJ2F 3U0OA 1ODEA 2R6R1 1GZ0A 2ZVZA 5LYJB 5G4VC 5J2UB 3WJRA 4R40B 2ZOVA 4I55B 3JALA 2V9YA 1QU9A 4NWOB 2HS0A 3CG6A 5EZYB 4BT6A 5EB1B 2F9ZC 1CLIA 2RB9A 5ITZB 4LNUA 3WJPA 2BO1A 2Z1FA 3GHZA 4F6RB 4G4VA 4XCQA 1VQVA 4EB6A 1X25A 4NQ3A 5JQGB 3HKEB 4BT3A 4YJ3A 3S06A 3CCUF 1QVGF 1KNJA 3JVHA 1JD1A 2UZHA 3LFOA 1J7HA 2JNBA 4TV8A 3CXCF 3VMFB 4I50A 4DRXA 5IJ0B 2UYNB 3MDOA 5GAPK 2IQQA 2BTQB 3KHNA 1K73H 2DT4A 1QD9A 5C8YA 3HKBA 2LBWA 2PMPA 2GZLA 4IHJA 1H7MA 3N4YA 4C82A 3I7TA 2OHWA 2AMTA 4DRXB 1W59A 3VCZA 4BT7A 1E7KA 3N2KB 5EIBD 3VOBA 2H8CA 4EI7A 1UFYA 5B8FA 3G71F 5IYZB 3CMAF 1SA0B 5JCOC 5FLXM 1W40A 1W57A 1KQSF 4BY9D 2HQSC 3GYQA 3K2XA 3F0EA 2CZWA 3D00A 5EIBC 1CK2A 5HP8A 3CPQA 1UI9A 3HKCB 4X1KB 4O4IA 2VGNA 3N2GA 1FNKA 3E22A 3C9UA 1VQKF 3KE1A 2CVLA 1U3PA 5LA6A 3I55F 3HKDB 1DBFA 5AVMA 5JVDB 3ZP4A 4LNUB 2RHJA 3K12A 1IV4A 1QAHA 1NMUB 3MCQA 3JALB 3HTNA 3JAWB 5GANK 4C4WC 3CC4F 3TD4A 4X20B 3S0HA 3VI6A 4YJ2B 3C8LA 2VXYA 3IEWA 3J7AR 3WGNA 5J2UA 4X3MA 1GO0A 3HWUA 3JAKB 2GLZA 4O2BA 5HXZA 1JY8A 2Z1TA 3JASB 3RYFB 5LOVB 5HY1A 5IJ0A 4U3JA 5JQGA 1VQOF 1Q81H 4ZHYB 4BVSA 1FNJA 2HP0B 3ZP7A 3G4SF 1M1KH 3I56F 2KTVA 3NMUC 2R751 3LDTA 4O2BB 4TZZA 1QVFF 1YQNA 2KGWA 3SIUA 4B62A 1TVKB 2ZVYA 4EB6B 3WGKA 3K0TA 4B5CA 2PHNA 3JCMM 2OTLF 2YXZA 4O4IB 3IKFA 3E20B 5GINC 2LCAA 5LP6B 1W2BF 1S72F 1TVKA 4G4ZA 4X1IB 3VYTC 3RYIA 2G9IA 4ZHQA 5FJ4C 2ZAUA 3C9SA 2IG8A 4X1KA 3ZO8A 1VHAA 5IYZA 3B6NA 3K14A 3CYQA 3KJJA 1SDSA 1IPAA 5BMVA 3FFMA 2QTPA 1VK3A 1RLGA 2B33A 2OTMA 3QTYA 3NK7A 1TUBA 5J2TA 1W5BA 3JAKA 3LWPC 3CCRF 1K8AH 1T0KB 3CC7F 4HNAB 3CCJF 3OBYA 3P10A 3E1YA 4ZI7B 1VQ6F 3WJQA 4C8IA 3UT5A 1Q82H 4G88A 3WPXA 1T0AA 2BTUA 4IHJB 2VAWA 1DT9A 3CCEF 1KC8H 1XHOA 4EI9A 1W3EX 4U39A 1KNKA 3DC2A 2UYNA 5EYPA 5LXTA 1M90H 3QHDA 3VTIC 3JATB 3JAMM 2MQEA 3D01A 4O4LB 2HS4A 2Z1EA 4B45A 5MN4A 5FNVA 3SIVA 5KX5A 1OAPA 3QUWA 2NMUA 4ERHA 4I4TB 5KMGA 1GO1A 2ALEA 4X1IA 3HAXD 3F0FA 1XBIA 3D54A 3WGJA 3M1XA 3C9TA 3DDNA 2HRYA 2GVIA 4PWTA 4O2AA 3MCAB 4G4WA 1SZQA 3P0ZA 4M8IA 2L26A 2FC3A 4WBNA 5A2QM 5CA1B 2RHHA 1U3LA 3IKEA 5C8YB 3F6MA 3NVKE 1VQ8F 1W41A 5DCVA 2W8BC 3KJKA 2P6YA 1VQ9F 3S0WA 3F0DA 4WBNB 5CA0A 2CHSA 1NQ3A 2QEXF 3V3TA 5HXUA 1W5EA 3V7QA 4YJ3B 5JH7B 3HKEA 3NK6A 2UYPA 4X20A 2DYYA 5IT9M 2HP3A 1VH8A 3CC2F 2AIFA 3TD5A 4X1YA 3P4EA 5HY0A 1FSZA 4G4YA 5MN6A 4HNAA 3LWRC 1RLUA 1W5AA 3Q8HA 3RE3A 3FD6A 4IIJB 5JVDA 3V7EA 3M4SA 5HWEA 5JCOA 3HKBB 2BTOA 2VGMA 2EWCA 3S03A 3RYCB 4I50B 2K1SA 3NVIB 3I3FA 1OFUA 3VOAA 1GX1A 4G4XA 1SA0A 2RHLA 3CCSF 4BT5A 2AIZP 2LBTA 3RYCA 2H8EA 2Q1YA 4RQOA 4FFBA 1H48A 1JFFA 4O4HA 1KD1H 2CSLA 2CWJA 5GIPC 3CCLF 3FPIA 2FGYA 5EZYA 4ZK7A 2QA4F 1K9MH 3OBWA 5LP6A 2H6LA 5EB0A 3M84A 3IEQA 2N48A 2HX0A 1VQPF 3RYIB 2CHTA 4FFBB 4X1YB 1JFFB 4O4HB 3HKCA 3JAWA 3LWOC 1YHQF 3J80M 3LWQC 1VQ7F 1XV2A 3WPWA 3TD3A 4O4JB 1RA4A 2CW4A 3ELCA 1Q8RA 1FFXB 1YJWF 4NUTA 4I4TA 1X7OA 4BT4A 3MQWA 3CPWF 4E6EA 3OW2F 3IMPA 4U3JB 3FD5A 5EWRA 5LXTB 3CYPB 4TV9B 2ZF8A 1Z5VA 5HY2A 1U40A 5IJ9B 2OZBA 4B46A 1YITF 2I6RA 5G4UC 1Q7YH 3T80A 1IV1A 4KWEA 3PAFA 1H47A 4BVTA 1U43A 2UYKA 1X52A 3S0YA 5IJ9A 4BT2A 1N8RH 3RA6A 4X3LA 5KMGB 3HJWC 1VQ4F 3PLAC 3AGKA 5CB4A 5CB4B 5EO3A 3WGMA 4C8EA 4RHAA 3CD6F 4TUYA 4ZHVA 2HP0A 3F0GA 5GONB 5GONA 1R1MA 5KX5B 3OONA 3ESJA 1XRGA 3GTZA 1NJIH 1VQLF 3CB2A 4ZHQB 3JARA 3O85A 5CA1A 3N2KA 5CA0B 1VQNF 4C8GA 2Z1UA 2HVYD 4BVQA 1YJNF 3LYBA 2KG4A 2WALA 4O2AB 4LCKA 3VYUC 4ZI7A 1COMA 5ITZA 1TUBB 5J2TB 3JARB 2OTJF 2IAFA 4ZOLA 3EORA 1RQ7A 1IV2A 3VYSC 5LA6B 1YI2F
chains in the Genus database with same CATH topology
3CCJF 3OBYA 2OHWA 1ZWZA 3CMEF 3E1YA 1VQ6F 1E7KA 1Q82H 1CN7A 1PXWA 3J81M 3CCQF 4EI7A 1KD1H 3G71F 1DT9A 3CCEF 5GIPC 1KC8H 3CMAF 3CCLF 4EI9A 2FGYA 3CCMF 3N4ZA 5FLXM 2QA4F 1K9MH 1VQ5F 1W40A 1W3EX 3OBWA 3CCVF 1KQSF 4BY9D 1M90H 3RA5A 3GYQA 1W42A 2CZWA 2LBXA 3D00A 1VQPF 3JAMM 1CK2A 3CPQA 3WXMB 2QI2A 1VQMF 3LWOC 1YHQF 3SIVA 2VGNA 1VQKF 3J80M 3LWQC 3I55F 1VQ7F 3IR9A 1GO1A 2ALEA 1YJ9F 3HAXD 1XBIA 3G6EF 1RA4A 3ON1A 5HY4A 1NMUB 3LWVC 1YJWF 4NUTA 1X7OA 2I6DA 1YIJF 3MCAB 3CPWF 3OW2F 5GANK 4C4WC 3CC4F 5EWRA 3VI6A 4EI8A 5GIOC 4BVRA 2FC3A 5A2QM 1X7PA 5HY2A 3J7AR 4BW0B 4X3MA 1GO0A 2OZBA 1Q86H 2KTUA 1YITF 2GLZA 1JJ2F 5G4UC 5HXZA 1Q7YH 1GZ0A 3NVKE 3PAFA 5HY1A 1VQ8F 1W41A 5DCVA 1VQOF 5G4VC 1Q81H 4BVSA 1VQ9F 4BVTA 3G4SF 1M1KH 3I56F 2KTVA 1X52A 3NMUC 2QEXF 3V3TA 3CG6A 5HXUA 4TZZA 1QVFF 3V7QA 1N8RH 3RA6A 4X3LA 3SIUA 2F9ZC 3NK6A 3HJWC 1VQ4F 3JCMM 2OTLF 3PLAC 5IT9M 3AGKA 3CC2F 2AIFA 2BO1A 3CD6F 5EO3A 3E20B 5GINC 5HY0A 4XCQA 3LWRC 4NQ3A 1W2BF 1S72F 1NJIH 1VQLF 3CCUF 1QVGF 3V7EA 5FJ4C 3O85A 5HWEA 3LFOA 1VQNF 2JNBA 2HVYD 4BVQA 2VGMA 1YJNF 1SDSA 3CXCF 2KG4A 2WALA 1IPAA 3VMFB 4LCKA 3FFMA 3NVIB 1RLGA 5GAPK 3NK7A 2OTJF 1K73H 3LWPC 3CCRF 3CCSF 1K8AH 2LBWA 1T0KB 1H7MA 3CC7F 3N4YA 1YI2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ F;  3OBY A;  2OHW A;  1ZWZ A;  3CME F;  3E1Y A;  1VQ6 F;  1E7K A;  1Q82 H;  1CN7 A;  1PXW A;  3J81 M;  3CCQ F;  1KD1 H;  3G71 F;  1DT9 A;  3CCE F;  5GIP C;  1KC8 H;  3CMA F;  3CCL F;  3CCM F;  2QA4 F;  3N4Z A;  5FLX M;  1K9M H;  1VQ5 F;  1W40 A;  1W3E X;  3OBW A;  3CCV F;  1KQS F;  4BY9 D;  1M90 H;  3RA5 A;  3GYQ A;  1W42 A;  2CZW A;  2LBX A;  1VQP F;  3JAM M;  1CK2 A;  3CPQ A;  3WXM B;  2QI2 A;  1VQM F;  3LWO C;  1YHQ F;  3SIV A;  2VGN A;  1VQK F;  3J80 M;  3LWQ C;  3I55 F;  1VQ7 F;  3IR9 A;  1GO1 A;  2ALE A;  1YJ9 F;  3HAX D;  1XBI A;  3G6E F;  1RA4 A;  3ON1 A;  1NMU B;  3LWV C;  1YJW F;  4NUT A;  1X7O A;  2I6D A;  1YIJ F;  3MCA B;  3CPW F;  3OW2 F;  5GAN K;  4C4W C;  3CC4 F;  5EWR A;  3VI6 A;  5GIO C;  2FC3 A;  5A2Q M;  1X7P A;  3J7A R;  4BW0 B;  4X3M A;  1GO0 A;  2OZB A;  1Q86 H;  2KTU A;  1YIT F;  1JJ2 F;  5G4U C;  1Q7Y H;  1GZ0 A;  3NVK E;  3PAF A;  1VQ8 F;  1W41 A;  5DCV A;  1VQO F;  5G4V C;  1Q81 H;  1VQ9 F;  3G4S F;  1M1K H;  3I56 F;  2KTV A;  1X52 A;  3NMU C;  2QEX F;  3CG6 A;  4TZZ A;  1QVF F;  3V7Q A;  1N8R H;  3RA6 A;  4X3L A;  3SIU A;  3NK6 A;  3HJW C;  1VQ4 F;  3JCM M;  2OTL F;  3PLA C;  5IT9 M;  3AGK A;  3CC2 F;  2AIF A;  2BO1 A;  3CD6 F;  5EO3 A;  3E20 B;  5GIN C;  3LWR C;  1W2B F;  1S72 F;  1NJI H;  1VQL F;  3CCU F;  1QVG F;  3V7E A;  5FJ4 C;  3O85 A;  3LFO A;  1VQN F;  2JNB A;  2HVY D;  1YJN F;  2VGM A;  1SDS A;  3CXC F;  2KG4 A;  2WAL A;  1IPA A;  3VMF B;  4LCK A;  3FFM A;  3NVI B;  1RLG A;  5GAP K;  3NK7 A;  2OTJ F;  1K73 H;  3LWP C;  3CCR F;  3CCS F;  1K8A H;  2LBW A;  1T0K B;  1H7M A;  3CC7 F;  3N4Y A;  1YI2 F; 
#chains in the Genus database with same CATH topology
 3E22 B;  1ZWZ A;  3CME F;  5MN5 A;  3LME A;  3HKD A;  3KIZ A;  1ONI A;  5HP7 A;  3VO8 A;  1JN1 A;  5BMV B;  2YYE A;  3FBA A;  3JAT A;  1CN7 A;  1FFX A;  3BYQ A;  5FNV B;  1PXW A;  2HRU A;  3J81 M;  3CCQ F;  3R0P A;  4C81 A;  3JAS A;  3RYF A;  5LOV A;  3N4Z A;  3CCM F;  1VQ5 F;  1YGY A;  3CCV F;  2Z01 A;  3VIU A;  5EYP B;  3RA5 A;  1W42 A;  2LBX A;  3C9R A;  1W5F A;  4YJ2 A;  3WGL A;  4O4J A;  3UT5 B;  4DXD A;  2UYJ A;  4O4L A;  2QI2 A;  3WXM B;  2RHO A;  1VQM F;  3RYH A;  1W55 A;  4F6R A;  3IR9 A;  1Z5W A;  2VAP A;  5EAZ A;  1YJ9 F;  1IV3 A;  1W58 1;  5LP6 C;  3G6E F;  2Q1X A;  4IIJ A;  2VAM A;  3ON1 A;  3MBM A;  5HY4 A;  3N2G B;  4TV9 A;  3LWV C;  4TUY B;  2I6D A;  1RQ2 A;  3ZOP A;  1YIJ F;  2HS3 A;  3L7Q A;  3V4D A;  3RYH B;  4TV8 B;  5LYJ A;  4I55 A;  4EI8 A;  3S02 A;  4BVR A;  2ZOD A;  5GIO C;  4ZOL B;  4ZHW A;  1X7P A;  1PF5 A;  4BW0 B;  3ERN A;  1Q86 H;  2KTU A;  5JH7 A;  1JJ2 F;  3U0O A;  1ODE A;  2R6R 1;  1GZ0 A;  2ZVZ A;  5LYJ B;  5G4V C;  5J2U B;  3WJR A;  4R40 B;  2ZOV A;  4I55 B;  3JAL A;  2V9Y A;  1QU9 A;  4NWO B;  2HS0 A;  3CG6 A;  5EZY B;  4BT6 A;  5EB1 B;  2F9Z C;  1CLI A;  2RB9 A;  5ITZ B;  4LNU A;  3WJP A;  2BO1 A;  2Z1F A;  3GHZ A;  4F6R B;  4G4V A;  4XCQ A;  1VQV A;  4EB6 A;  1X25 A;  4NQ3 A;  5JQG B;  3HKE B;  4BT3 A;  4YJ3 A;  3S06 A;  3CCU F;  1QVG F;  1KNJ A;  3JVH A;  1JD1 A;  2UZH A;  3LFO A;  1J7H A;  2JNB A;  4TV8 A;  3CXC F;  3VMF B;  4I50 A;  4DRX A;  5IJ0 B;  2UYN B;  3MDO A;  5GAP K;  2IQQ A;  2BTQ B;  3KHN A;  1K73 H;  2DT4 A;  1QD9 A;  5C8Y A;  3HKB A;  2LBW A;  2PMP A;  2GZL A;  4IHJ A;  1H7M A;  3N4Y A;  4C82 A;  3I7T A;  2OHW A;  2AMT A;  4DRX B;  1W59 A;  3VCZ A;  4BT7 A;  1E7K A;  3N2K B;  5EIB D;  3VOB A;  2H8C A;  4EI7 A;  1UFY A;  5B8F A;  3G71 F;  5IYZ B;  3CMA F;  1SA0 B;  5JCO C;  5FLX M;  1W40 A;  1W57 A;  1KQS F;  4BY9 D;  2HQS C;  3GYQ A;  3K2X A;  3F0E A;  2CZW A;  3D00 A;  5EIB C;  1CK2 A;  5HP8 A;  3CPQ A;  1UI9 A;  3HKC B;  4X1K B;  4O4I A;  2VGN A;  3N2G A;  1FNK A;  3E22 A;  3C9U A;  1VQK F;  3KE1 A;  2CVL A;  1U3P A;  5LA6 A;  3I55 F;  3HKD B;  1DBF A;  5AVM A;  5JVD B;  3ZP4 A;  4LNU B;  2RHJ A;  3K12 A;  1IV4 A;  1QAH A;  1NMU B;  3MCQ A;  3JAL B;  3HTN A;  3JAW B;  5GAN K;  4C4W C;  3CC4 F;  3TD4 A;  4X20 B;  3S0H A;  3VI6 A;  4YJ2 B;  3C8L A;  2VXY A;  3IEW A;  3J7A R;  3WGN A;  5J2U A;  4X3M A;  1GO0 A;  3HWU A;  3JAK B;  2GLZ A;  4O2B A;  5HXZ A;  1JY8 A;  2Z1T A;  3JAS B;  3RYF B;  5LOV B;  5HY1 A;  5IJ0 A;  4U3J A;  5JQG A;  1VQO F;  1Q81 H;  4ZHY B;  4BVS A;  1FNJ A;  2HP0 B;  3ZP7 A;  3G4S F;  1M1K H;  3I56 F;  2KTV A;  3NMU C;  2R75 1;  3LDT A;  4O2B B;  4TZZ A;  1QVF F;  1YQN A;  2KGW A;  3SIU A;  4B62 A;  1TVK B;  2ZVY A;  4EB6 B;  3WGK A;  3K0T A;  4B5C A;  2PHN A;  3JCM M;  2OTL F;  2YXZ A;  4O4I B;  3IKF A;  3E20 B;  5GIN C;  2LCA A;  5LP6 B;  1W2B F;  1S72 F;  1TVK A;  4G4Z A;  4X1I B;  3VYT C;  3RYI A;  2G9I A;  4ZHQ A;  5FJ4 C;  2ZAU A;  3C9S A;  2IG8 A;  4X1K A;  3ZO8 A;  1VHA A;  5IYZ A;  3B6N A;  3K14 A;  3CYQ A;  3KJJ A;  1SDS A;  1IPA A;  5BMV A;  3FFM A;  2QTP A;  1VK3 A;  1RLG A;  2B33 A;  2OTM A;  3QTY A;  3NK7 A;  1TUB A;  5J2T A;  1W5B A;  3JAK A;  3LWP C;  3CCR F;  1K8A H;  1T0K B;  3CC7 F;  4HNA B;  3CCJ F;  3OBY A;  3P10 A;  3E1Y A;  4ZI7 B;  1VQ6 F;  3WJQ A;  4C8I A;  3UT5 A;  1Q82 H;  4G88 A;  3WPX A;  1T0A A;  2BTU A;  4IHJ B;  2VAW A;  1DT9 A;  3CCE F;  1KC8 H;  1XHO A;  4EI9 A;  1W3E X;  4U39 A;  1KNK A;  3DC2 A;  2UYN A;  5EYP A;  5LXT A;  1M90 H;  3QHD A;  3VTI C;  3JAT B;  3JAM M;  2MQE A;  3D01 A;  4O4L B;  2HS4 A;  2Z1E A;  4B45 A;  5MN4 A;  5FNV A;  3SIV A;  5KX5 A;  1OAP A;  3QUW A;  2NMU A;  4ERH A;  4I4T B;  5KMG A;  1GO1 A;  2ALE A;  4X1I A;  3HAX D;  3F0F A;  1XBI A;  3D54 A;  3WGJ A;  3M1X A;  3C9T A;  3DDN A;  2HRY A;  2GVI A;  4PWT A;  4O2A A;  3MCA B;  4G4W A;  1SZQ A;  3P0Z A;  4M8I A;  2L26 A;  2FC3 A;  4WBN A;  5A2Q M;  5CA1 B;  2RHH A;  1U3L A;  3IKE A;  5C8Y B;  3F6M A;  3NVK E;  1VQ8 F;  1W41 A;  5DCV A;  2W8B C;  3KJK A;  2P6Y A;  1VQ9 F;  3S0W A;  3F0D A;  4WBN B;  5CA0 A;  2CHS A;  1NQ3 A;  2QEX F;  3V3T A;  5HXU A;  1W5E A;  3V7Q A;  4YJ3 B;  5JH7 B;  3HKE A;  3NK6 A;  2UYP A;  4X20 A;  2DYY A;  5IT9 M;  2HP3 A;  1VH8 A;  3CC2 F;  2AIF A;  3TD5 A;  4X1Y A;  3P4E A;  5HY0 A;  1FSZ A;  4G4Y A;  5MN6 A;  4HNA A;  3LWR C;  1RLU A;  1W5A A;  3Q8H A;  3RE3 A;  3FD6 A;  4IIJ B;  5JVD A;  3V7E A;  3M4S A;  5HWE A;  5JCO A;  3HKB B;  2BTO A;  2VGM A;  2EWC A;  3S03 A;  3RYC B;  4I50 B;  2K1S A;  3NVI B;  3I3F A;  1OFU A;  3VOA A;  1GX1 A;  4G4X A;  1SA0 A;  2RHL A;  3CCS F;  4BT5 A;  2AIZ P;  2LBT A;  3RYC A;  2H8E A;  2Q1Y A;  4RQO A;  4FFB A;  1H48 A;  1JFF A;  4O4H A;  1KD1 H;  2CSL A;  2CWJ A;  5GIP C;  3CCL F;  3FPI A;  2FGY A;  5EZY A;  4ZK7 A;  2QA4 F;  1K9M H;  3OBW A;  5LP6 A;  2H6L A;  5EB0 A;  3M84 A;  3IEQ A;  2N48 A;  2HX0 A;  1VQP F;  3RYI B;  2CHT A;  4FFB B;  4X1Y B;  1JFF B;  4O4H B;  3HKC A;  3JAW A;  3LWO C;  1YHQ F;  3J80 M;  3LWQ C;  1VQ7 F;  1XV2 A;  3WPW A;  3TD3 A;  4O4J B;  1RA4 A;  2CW4 A;  3ELC A;  1Q8R A;  1FFX B;  1YJW F;  4NUT A;  4I4T A;  1X7O A;  4BT4 A;  3MQW A;  3CPW F;  4E6E A;  3OW2 F;  3IMP A;  4U3J B;  3FD5 A;  5EWR A;  5LXT B;  3CYP B;  4TV9 B;  2ZF8 A;  1Z5V A;  5HY2 A;  1U40 A;  5IJ9 B;  2OZB A;  4B46 A;  1YIT F;  2I6R A;  5G4U C;  1Q7Y H;  3T80 A;  1IV1 A;  4KWE A;  3PAF A;  1H47 A;  4BVT A;  1U43 A;  2UYK A;  1X52 A;  3S0Y A;  5IJ9 A;  4BT2 A;  1N8R H;  3RA6 A;  4X3L A;  5KMG B;  3HJW C;  1VQ4 F;  3PLA C;  3AGK A;  5CB4 A;  5CB4 B;  5EO3 A;  3WGM A;  4C8E A;  4RHA A;  3CD6 F;  4TUY A;  4ZHV A;  2HP0 A;  3F0G A;  5GON B;  5GON A;  1R1M A;  5KX5 B;  3OON A;  3ESJ A;  1XRG A;  3GTZ A;  1NJI H;  1VQL F;  3CB2 A;  4ZHQ B;  3JAR A;  3O85 A;  5CA1 A;  3N2K A;  5CA0 B;  1VQN F;  4C8G A;  2Z1U A;  2HVY D;  4BVQ A;  1YJN F;  3LYB A;  2KG4 A;  2WAL A;  4O2A B;  4LCK A;  3VYU C;  4ZI7 A;  1COM A;  5ITZ A;  1TUB B;  5J2T B;  3JAR B;  2OTJ F;  2IAF A;  4ZOL A;  3EOR A;  1RQ7 A;  1IV2 A;  3VYS C;  5LA6 B;  1YI2 F; 
#chains in the Genus database with same CATH homology
 3CCJ F;  3OBY A;  2OHW A;  1ZWZ A;  3CME F;  3E1Y A;  1VQ6 F;  1E7K A;  1Q82 H;  1CN7 A;  1PXW A;  3J81 M;  3CCQ F;  4EI7 A;  1KD1 H;  3G71 F;  1DT9 A;  3CCE F;  5GIP C;  1KC8 H;  3CMA F;  3CCL F;  4EI9 A;  2FGY A;  3CCM F;  3N4Z A;  5FLX M;  2QA4 F;  1K9M H;  1VQ5 F;  1W40 A;  1W3E X;  3OBW A;  3CCV F;  1KQS F;  4BY9 D;  1M90 H;  3RA5 A;  3GYQ A;  1W42 A;  2CZW A;  2LBX A;  3D00 A;  1VQP F;  3JAM M;  1CK2 A;  3CPQ A;  3WXM B;  2QI2 A;  1VQM F;  3LWO C;  1YHQ F;  3SIV A;  2VGN A;  1VQK F;  3J80 M;  3LWQ C;  3I55 F;  1VQ7 F;  3IR9 A;  1GO1 A;  2ALE A;  1YJ9 F;  3HAX D;  1XBI A;  3G6E F;  1RA4 A;  3ON1 A;  5HY4 A;  1NMU B;  3LWV C;  1YJW F;  4NUT A;  1X7O A;  2I6D A;  1YIJ F;  3MCA B;  3CPW F;  3OW2 F;  5GAN K;  4C4W C;  3CC4 F;  5EWR A;  3VI6 A;  4EI8 A;  5GIO C;  4BVR A;  2FC3 A;  5A2Q M;  1X7P A;  5HY2 A;  3J7A R;  4BW0 B;  4X3M A;  1GO0 A;  2OZB A;  1Q86 H;  2KTU A;  1YIT F;  2GLZ A;  1JJ2 F;  5G4U C;  5HXZ A;  1Q7Y H;  1GZ0 A;  3NVK E;  3PAF A;  5HY1 A;  1VQ8 F;  1W41 A;  5DCV A;  1VQO F;  5G4V C;  1Q81 H;  4BVS A;  1VQ9 F;  4BVT A;  3G4S F;  1M1K H;  3I56 F;  2KTV A;  1X52 A;  3NMU C;  2QEX F;  3V3T A;  3CG6 A;  5HXU A;  4TZZ A;  1QVF F;  3V7Q A;  1N8R H;  3RA6 A;  4X3L A;  3SIU A;  2F9Z C;  3NK6 A;  3HJW C;  1VQ4 F;  3JCM M;  2OTL F;  3PLA C;  5IT9 M;  3AGK A;  3CC2 F;  2AIF A;  2BO1 A;  3CD6 F;  5EO3 A;  3E20 B;  5GIN C;  5HY0 A;  4XCQ A;  3LWR C;  4NQ3 A;  1W2B F;  1S72 F;  1NJI H;  1VQL F;  3CCU F;  1QVG F;  3V7E A;  5FJ4 C;  3O85 A;  5HWE A;  3LFO A;  1VQN F;  2JNB A;  2HVY D;  4BVQ A;  2VGM A;  1YJN F;  1SDS A;  3CXC F;  2KG4 A;  2WAL A;  1IPA A;  3VMF B;  4LCK A;  3FFM A;  3NVI B;  1RLG A;  5GAP K;  3NK7 A;  2OTJ F;  1K73 H;  3LWP C;  3CCR F;  3CCS F;  1K8A H;  2LBW A;  1T0K B;  1H7M A;  3CC7 F;  3N4Y A;  1YI2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...