3CCVF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccvF00
2QI2A 3OBWA 3NVIB 2OTJF 2WALA 1K9MH 1K8AH 3LWPC 1Q7YH 4NUTA 3CC7F 1QVGF 5A2QM 3ON1A 5G4UC 3I55F 3E20B 3CCLF 3G4SF 1KD1H 5IT9M 3AGKA 1YI2F 3G71F 3O85A 3N4YA 3FFMA 3JAMM 1X52A 4LCKA 3SIUA 1N8RH 3LWOC 1RLGA 1W41A 1YJWF 2HVYD 3HJWC 3CXCF 1VQOF 3GYQA 1KC8H 2AIFA 2BO1A 3VMFB 5DCVA 3WXMB 1CK2A 1VQ9F 1GO1A 3LWRC 3SIVA 2KTVA 1VQMF 1VQLF 2OZBA 3CMAF 5GIOC 2KG4A 3CPWF 1KQSF 1M90H 2FC3A 3CPQA 2KTUA 3LFOA 4X3LA 5GINC 3RA5A 1RA4A 1VQPF 3LWVC 3CC4F 3PAFA 1YJNF 2I6DA 1H7MA 5G4VC 5GIPC 3CG6A 1Q81H 1NJIH 3CCVF 2CZWA 3CC2F 2QA4F 2LBXA 3PLAC 1VQNF 1QVFF 1YIJF 3OBYA 3E1YA 2VGMA 2LBWA 5FJ4C 4BW0B 3CCUF 3LWQC 3JCMM 3CCQF 3I56F 3NK7A 1T0KB 2JNBA 1W42A 2OTLF 3J7AR 3VI6A 3OW2F 1SDSA 3G6EF 3N4ZA 3CCJF 3V7EA 1ZWZA 4TZZA 1VQ4F 1XBIA 1S72F 3CCEF 3J81M 1X7OA 5GANK 1YHQF 3IR9A 5EO3A 1M1KH 1YITF 5FLXM 3CMEF 3CCMF 1K73H 2ALEA 1GZ0A 3NK6A 1NMUB 3MCAB 3RA6A 3CCSF 3HAXD 1Q82H 1YJ9F 3NVKE 1DT9A 1X7PA 5GAPK 3CD6F 4BY9D 1W40A 1VQ7F 3CCRF 1VQ8F 1CN7A 1Q86H 1VQ5F 1E7KA 4C4WC 1JJ2F 1VQKF 1VQ6F 1W2BF 4X3MA 1W3EX 1GO0A 1IPAA 1PXWA 3NMUC 3V7QA 2QEXF 5EWRA 2VGNA 3J80M 2OHWA
chains in the Genus database with same CATH superfamily
5LP6C 2Z1FA 3HWUA 3OBWA 5JVDB 2OTJF 3RYHA 4G4VA 1K9MH 5EIBD 4BVRA 3LWPC 5IJ0A 1PF5A 4NUTA 2Z1UA 3HKDB 3JAKB 5A2QM 5JQGB 5G4UC 2N48A 3E20B 5LYJB 2RHLA 2UYPA 2HS3A 3C9UA 3QUWA 4O4HB 3G4SF 5C8YA 1VQVA 3AGKA 3F6MA 4YJ3A 4LNUA 3E22A 1X52A 3KIZA 5MN6A 4O2BB 1RLGA 1W41A 5EZYB 2HVYD 3HJWC 1RLUA 2AIFA 3JALA 1DBFA 3VO8A 1GO1A 5MN5A 3LWRC 3RYFA 3L7QA 4ZHWA 1IV3A 5GIOC 1QAHA 2KG4A 3IKEA 2HP0A 4O4IB 4R40B 3CPWF 4YJ2A 3WGNA 4BT6A 3LFOA 1JN1A 4ZOLA 5EAZA 3RA5A 3LWVC 3PAFA 4O4LA 1H7MA 5G4VC 3FD6A 4X1KB 3CG6A 3QHDA 1NJIH 4G4WA 2BTUA 2LBXA 4X1IB 5BMVB 3S0HA 1GX1A 5MN4A 3ZO8A 3N2KB 3PLAC 3OBYA 3HKEB 2VGMA 2DYYA 1Q8RA 3UT5A 3TD3A 3CCUF 5HXUA 1VK3A 2PMPA 1T0KB 3MBMA 2OTLF 3N2GB 3VI6A 2MQEA 2F9ZC 1J7HA 1XBIA 2CHSA 3HKCB 3IEQA 3J81M 3FD5A 5GANK 2GVIA 3JASA 3IR9A 3VYTC 1UFYA 5C8YB 4BT3A 3WJRA 3K0TA 1K73H 3U0OA 1GZ0A 4C82A 1NMUB 1U3LA 4EI8A 1T0AA 5EZYA 3RYHB 4X20A 1DT9A 1X7PA 3VOAA 3V3TA 1W40A 4ZK7A 4DRXA 1VQ7F 3WJPA 3I7TA 4EI7A 4ERHA 1VQ5F 2ZAUA 2HRYA 4C4WC 1XRGA 5LA6A 1JJ2F 2CHTA 2BTOA 2UZHA 1FNKA 3CYPB 4X3MA 1GO0A 3V7QA 2QEXF 3P0ZA 3TD5A 4B5CA 2ZOVA 2PHNA 3J80M 4O2AB 2HP0B 2VAPA 3NVIB 1TUBB 3MQWA 3D01A 3IKFA 1K8AH 4EB6A 4ZOLB 1QVGF 5KMGB 3I55F 2HP3A 2RHOA 3K12A 5LXTA 4WBNA 1KD1H 3C9RA 4G4XA 3WGJA 5HWEA 2UYNA 4X1IA 5BMVA 3G71F 1XV2A 3C8LA 3FFMA 5JCOA 3SIUA 1N8RH 2B33A 3LWOC 4KWEA 3M4SA 3JARB 1W5AA 3JAKA 2HQSC 3T80A 2RHHA 3GYQA 1KC8H 2BO1A 2IAFA 2ZVZA 1QD9A 5ITZA 5DCVA 1JFFA 1CK2A 1VQ9F 4G88A 3N2GA 4ZI7A 1VQLF 2H8CA 2YXZA 3N2KA 5CA1A 2CVLA 1M90H 3D00A 5J2TB 4X3LA 1COMA 3F0EA 2GLZA 5GINC 3HKDA 1RA4A 1VQPF 3CC4F 1U3PA 3KJJA 1YJNF 1ONIA 4TV8B 5HY0A 2UYJA 1Q81H 3RYIA 2H8EA 2Z01A 5FJ4C 2V9YA 2VXYA 3S06A 3LWQC 2OTMA 1TVKB 3P10A 3CCQF 3I56F 3F0GA 1IV2A 3KJKA 4O4LB 4BT7A 5LA6B 4O4JA 1NQ3A 3WGMA 3J7AR 1X25A 3OW2F 5HXZA 3G6EF 4ZHQB 2FGYA 5FNVB 2CWJA 1R1MA 3S03A 1S72F 3CCEF 1X7OA 4I4TB 4YJ2B 2VAWA 4C81A 2I6RA 3F0DA 3BYQA 5LOVB 3ZP4A 2UYNB 5FLXM 3CMEF 2Q1XA 3KE1A 4U3JB 5EB0A 3I3FA 3JAWA 1IV1A 3HKCA 3CCSF 4O2AA 3MCQA 3JARA 3RA6A 5CB4B 4BVTA 4XCQA 2IG8A 3CD6F 4NQ3A 4BY9D 4TV9A 1SA0A 2AMTA 2AIZP 2R751 3KHNA 1CN7A 3V4DA 3WJQA 1E7KA 5IYZB 1VQKF 1W3EX 3WPWA 2HS4A 3GTZA 2OHWA 2QI2A 5HP8A 1RQ7A 2WALA 4X1YA 2L26A 4X20B 1Q7YH 3CC7F 4BT4A 3ON1A 5EYPB 4TV8A 1FFXB 3M84A 5ITZB 1JFFB 5IT9M 3HKBB 4IHJB 1VHAA 3VYUC 3JAMM 1H48A 4FFBA 4G4YA 3CXCF 5J2TA 1XHOA 3JATB 5J2UB 4TUYA 3FPIA 4NWOB 2YYEA 4WBNB 5HY2A 1W5FA 2KTVA 1OAPA 4HNAB 3VCZA 3CMAF 2OZBA 2CW4A 3LYBA 1QU9A 3M1XA 1Z5VA 3RYIB 1W57A 5IJ9B 4B62A 3CPQA 4EI9A 2UYKA 2HX0A 5KMGA 2K1SA 3IEWA 1ODEA 3K14A 2I6DA 5GIPC 4ZI7B 1KNKA 3CC2F 3CCVF 2QA4F 4I50A 4PWTA 4BVQA 3CB2A 4IIJA 1YIJF 4ZHQA 3GHZA 3ELCA 3E1YA 5CA1B 2LCAA 5JH7A 1W55A 4BW0B 4I55A 4TV9B 5KX5A 5IYZA 1W42A 3VIUA 2ZVYA 5GONA 1U43A 1FNJA 3EORA 3TD4A 3CCJF 3C9TA 1ZWZA 5JVDA 5HY1A 3RYCB 1JY8A 5LP6A 2VAMA 5CA0B 1YHQF 3VOBA 1FFXA 1SA0B 5EO3A 5LYJA 4O4JB 4C8IA 2GZLA 4G4ZA 4YJ3B 3QTYA 5FNVA 3E22B 2QTPA 3RE3A 3JVHA 3LMEA 2ZODA 4F6RA 3NK6A 3MCAB 1Q82H 3LDTA 2H6LA 1TVKA 2EWCA 3CCRF 2NMUA 5EYPA 5LOVA 2BTQB 2G9IA 4DXDA 1VQ6F 4O4HA 4M8IA 4ZHVA 4U3JA 5AVMA 3IMPA 4IHJA 3NMUC 1FSZA 5EWRA 3JAWB 3ERNA 4BVSA 5IJ9A 3P4EA 1RQ2A 2HS0A 2RB9A 4I4TA 3WGKA 3S02A 2RHJA 3JATA 5J2UA 1W581 3JALB 3CCLF 4BT2A 1YGYA 1YI2F 4I50B 3O85A 3N4YA 5EB1B 4IIJB 2CSLA 4LCKA 4X1YB 5IJ0B 5CB4A 1YJWF 5JQGA 1VQOF 2ZF8A 3VMFB 1SZQA 3WXMB 3HKBA 3SIVA 2HRUA 1VQMF 3WGLA 3DC2A 1KNJA 3HKEA 4O2BA 1KQSF 2FC3A 2W8BC 5LP6B 3ESJA 2KTUA 3UT5B 1UI9A 3JASB 2IQQA 2P6YA 5KX5B 2R6R1 4RHAA 1W5EA 1U40A 3MDOA 4BT5A 4B46A 3OONA 3FBAA 5HP7A 4HNAA 2CZWA 4LNUB 1VQNF 1QVFF 3F0FA 4F6RB 4B45A 1Z5WA 4FFBB 2LBWA 3C9SA 3JCMM 4DRXB 3ZP7A 5CA0A 3VTIC 4TUYB 3NK7A 2JNBA 4X1KA 5B8FA 3S0WA 3R0PA 2LBTA 1SDSA 2Z1TA 3N4ZA 3V7EA 3RYFB 4RQOA 4TZZA 1VQ4F 4U39A 1JD1A 4O4IA 3VYSC 4EB6B 1YQNA 3K2XA 3Q8HA 5LXTB 1W5BA 2KGWA 3WPXA 3B6NA 1M1KH 5GONB 3DDNA 1YITF 4E6EA 1VH8A 3D54A 4ZHYB 3CCMF 3ZOPA 5HY4A 5JCOC 3S0YA 1OFUA 3RYCA 2ALEA 2DT4A 4C8EA 3HAXD 5EIBC 5JH7B 1TUBA 3HTNA 1YJ9F 1CLIA 2Z1EA 4I55B 5GAPK 3NVKE 1IV4A 1VQ8F 1Q86H 1H47A 2Q1YA 1W2BF 1W59A 1IPAA 1PXWA 3CYQA 2VGNA 4C8GA
chains in the Genus database with same CATH topology
2QI2A 3OBWA 4BVSA 3NVIB 2OTJF 2WALA 1K9MH 4BVRA 1K8AH 3LWPC 1Q7YH 4NUTA 3CC7F 1QVGF 5A2QM 3ON1A 5G4UC 3I55F 3E20B 3CCLF 3G4SF 1KD1H 5IT9M 3AGKA 1YI2F 5HWEA 3G71F 3O85A 3N4YA 3FFMA 3JAMM 1X52A 4LCKA 3SIUA 1N8RH 3LWOC 1RLGA 1W41A 1YJWF 2HVYD 3HJWC 3CXCF 1VQOF 3GYQA 1KC8H 2AIFA 2BO1A 3VMFB 5DCVA 3WXMB 1CK2A 1VQ9F 1GO1A 3LWRC 3SIVA 5HY2A 2KTVA 1VQMF 1VQLF 2OZBA 3CMAF 5GIOC 2KG4A 3CPWF 1KQSF 1M90H 2FC3A 3CPQA 4EI9A 2KTUA 3D00A 3LFOA 4X3LA 2GLZA 5GINC 3RA5A 1RA4A 1VQPF 3LWVC 3CC4F 3PAFA 1YJNF 2I6DA 1H7MA 5G4VC 5GIPC 5HY0A 3CG6A 1Q81H 1NJIH 3CCVF 2CZWA 3CC2F 2QA4F 2LBXA 4BVQA 3PLAC 1VQNF 1QVFF 1YIJF 3OBYA 3E1YA 2VGMA 2LBWA 5FJ4C 4BW0B 3CCUF 3LWQC 5HXUA 3JCMM 3CCQF 3I56F 3NK7A 1T0KB 2JNBA 1W42A 2OTLF 3J7AR 3VI6A 3OW2F 1SDSA 5HXZA 3G6EF 2FGYA 3N4ZA 3CCJF 3V7EA 1ZWZA 2F9ZC 4TZZA 5HY1A 1XBIA 1VQ4F 1S72F 3CCEF 3J81M 1X7OA 5GANK 1YHQF 3IR9A 5EO3A 1M1KH 1YITF 5FLXM 3CMEF 3CCMF 5HY4A 1K73H 2ALEA 1GZ0A 3NK6A 1NMUB 3MCAB 3RA6A 3CCSF 3HAXD 4EI8A 4BVTA 4XCQA 1Q82H 1YJ9F 3NVKE 1DT9A 1X7PA 5GAPK 4NQ3A 3CD6F 3V3TA 4BY9D 1W40A 1VQ7F 3CCRF 1VQ8F 4EI7A 1Q86H 1VQ5F 1CN7A 1E7KA 4C4WC 1JJ2F 1VQKF 1VQ6F 1W2BF 4X3MA 1W3EX 1GO0A 1IPAA 1PXWA 3NMUC 3V7QA 2QEXF 5EWRA 2VGNA 3J80M 2OHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QI2 A;  3OBW A;  3NVI B;  2OTJ F;  2WAL A;  1K9M H;  1K8A H;  3LWP C;  1Q7Y H;  4NUT A;  3CC7 F;  1QVG F;  5A2Q M;  3ON1 A;  5G4U C;  3I55 F;  3E20 B;  3CCL F;  3G4S F;  1KD1 H;  5IT9 M;  3AGK A;  1YI2 F;  3G71 F;  3O85 A;  3N4Y A;  3FFM A;  3JAM M;  1X52 A;  4LCK A;  3SIU A;  1N8R H;  3LWO C;  1RLG A;  1W41 A;  1YJW F;  2HVY D;  3HJW C;  3CXC F;  1VQO F;  3GYQ A;  1KC8 H;  2AIF A;  2BO1 A;  3VMF B;  5DCV A;  3WXM B;  1CK2 A;  1VQ9 F;  1GO1 A;  3LWR C;  3SIV A;  2KTV A;  1VQM F;  1VQL F;  2OZB A;  3CMA F;  5GIO C;  2KG4 A;  3CPW F;  1KQS F;  1M90 H;  2FC3 A;  3CPQ A;  2KTU A;  3LFO A;  4X3L A;  5GIN C;  3RA5 A;  1RA4 A;  1VQP F;  3LWV C;  3CC4 F;  3PAF A;  1YJN F;  2I6D A;  1H7M A;  5G4V C;  5GIP C;  3CG6 A;  1Q81 H;  1NJI H;  3CCV F;  2CZW A;  3CC2 F;  2QA4 F;  2LBX A;  3PLA C;  1VQN F;  1QVF F;  1YIJ F;  3OBY A;  3E1Y A;  2VGM A;  2LBW A;  5FJ4 C;  4BW0 B;  3CCU F;  3LWQ C;  3JCM M;  3CCQ F;  3I56 F;  3NK7 A;  1T0K B;  2JNB A;  1W42 A;  2OTL F;  3J7A R;  3VI6 A;  3OW2 F;  1SDS A;  3G6E F;  3N4Z A;  3CCJ F;  3V7E A;  1ZWZ A;  4TZZ A;  1VQ4 F;  1XBI A;  1S72 F;  3CCE F;  3J81 M;  1X7O A;  5GAN K;  1YHQ F;  3IR9 A;  5EO3 A;  1M1K H;  1YIT F;  5FLX M;  3CME F;  3CCM F;  1K73 H;  2ALE A;  1GZ0 A;  3NK6 A;  1NMU B;  3MCA B;  3RA6 A;  3CCS F;  3HAX D;  1Q82 H;  1YJ9 F;  3NVK E;  1DT9 A;  1X7P A;  5GAP K;  3CD6 F;  4BY9 D;  1W40 A;  1VQ7 F;  3CCR F;  1VQ8 F;  1CN7 A;  1Q86 H;  1VQ5 F;  1E7K A;  4C4W C;  1JJ2 F;  1VQK F;  1VQ6 F;  1W2B F;  4X3M A;  1W3E X;  1GO0 A;  1IPA A;  1PXW A;  3NMU C;  3V7Q A;  2QEX F;  5EWR A;  2VGN A;  3J80 M;  2OHW A; 
#chains in the Genus database with same CATH topology
 5LP6 C;  2Z1F A;  3HWU A;  3OBW A;  5JVD B;  2OTJ F;  3RYH A;  4G4V A;  1K9M H;  5EIB D;  4BVR A;  3LWP C;  5IJ0 A;  1PF5 A;  4NUT A;  2Z1U A;  3HKD B;  3JAK B;  5A2Q M;  5JQG B;  5G4U C;  2N48 A;  3E20 B;  5LYJ B;  2RHL A;  2UYP A;  2HS3 A;  3C9U A;  3QUW A;  4O4H B;  3G4S F;  5C8Y A;  1VQV A;  3AGK A;  3F6M A;  4YJ3 A;  4LNU A;  3E22 A;  1X52 A;  3KIZ A;  5MN6 A;  4O2B B;  1RLG A;  1W41 A;  5EZY B;  2HVY D;  3HJW C;  1RLU A;  2AIF A;  3JAL A;  1DBF A;  3VO8 A;  1GO1 A;  5MN5 A;  3LWR C;  3RYF A;  3L7Q A;  4ZHW A;  1IV3 A;  5GIO C;  1QAH A;  2KG4 A;  3IKE A;  2HP0 A;  4O4I B;  4R40 B;  3CPW F;  4YJ2 A;  3WGN A;  4BT6 A;  3LFO A;  1JN1 A;  4ZOL A;  5EAZ A;  3RA5 A;  3LWV C;  3PAF A;  4O4L A;  1H7M A;  5G4V C;  3FD6 A;  4X1K B;  3CG6 A;  3QHD A;  1NJI H;  4G4W A;  2BTU A;  2LBX A;  4X1I B;  5BMV B;  3S0H A;  1GX1 A;  5MN4 A;  3ZO8 A;  3N2K B;  3PLA C;  3OBY A;  3HKE B;  2VGM A;  2DYY A;  1Q8R A;  3UT5 A;  3TD3 A;  3CCU F;  5HXU A;  1VK3 A;  2PMP A;  1T0K B;  3MBM A;  2OTL F;  3N2G B;  3VI6 A;  2MQE A;  2F9Z C;  1J7H A;  1XBI A;  2CHS A;  3HKC B;  3IEQ A;  3J81 M;  3FD5 A;  5GAN K;  2GVI A;  3JAS A;  3IR9 A;  3VYT C;  1UFY A;  5C8Y B;  4BT3 A;  3WJR A;  3K0T A;  1K73 H;  3U0O A;  1GZ0 A;  4C82 A;  1NMU B;  1U3L A;  4EI8 A;  1T0A A;  5EZY A;  3RYH B;  4X20 A;  1DT9 A;  1X7P A;  3VOA A;  3V3T A;  1W40 A;  4ZK7 A;  4DRX A;  1VQ7 F;  3WJP A;  3I7T A;  4EI7 A;  4ERH A;  1VQ5 F;  2ZAU A;  2HRY A;  4C4W C;  1XRG A;  5LA6 A;  1JJ2 F;  2CHT A;  2BTO A;  2UZH A;  1FNK A;  3CYP B;  4X3M A;  1GO0 A;  3V7Q A;  2QEX F;  3P0Z A;  3TD5 A;  4B5C A;  2ZOV A;  2PHN A;  3J80 M;  4O2A B;  2HP0 B;  2VAP A;  3NVI B;  1TUB B;  3MQW A;  3D01 A;  3IKF A;  1K8A H;  4EB6 A;  4ZOL B;  1QVG F;  5KMG B;  3I55 F;  2HP3 A;  2RHO A;  3K12 A;  5LXT A;  4WBN A;  1KD1 H;  3C9R A;  4G4X A;  3WGJ A;  5HWE A;  2UYN A;  4X1I A;  5BMV A;  3G71 F;  1XV2 A;  3C8L A;  3FFM A;  5JCO A;  3SIU A;  1N8R H;  2B33 A;  3LWO C;  4KWE A;  3M4S A;  3JAR B;  1W5A A;  3JAK A;  2HQS C;  3T80 A;  2RHH A;  3GYQ A;  1KC8 H;  2BO1 A;  2IAF A;  2ZVZ A;  1QD9 A;  5ITZ A;  5DCV A;  1JFF A;  1CK2 A;  1VQ9 F;  4G88 A;  3N2G A;  4ZI7 A;  1VQL F;  2H8C A;  2YXZ A;  3N2K A;  5CA1 A;  2CVL A;  1M90 H;  3D00 A;  5J2T B;  4X3L A;  1COM A;  3F0E A;  2GLZ A;  5GIN C;  3HKD A;  1RA4 A;  1VQP F;  3CC4 F;  1U3P A;  3KJJ A;  1YJN F;  1ONI A;  4TV8 B;  5HY0 A;  2UYJ A;  1Q81 H;  3RYI A;  2H8E A;  2Z01 A;  5FJ4 C;  2V9Y A;  2VXY A;  3S06 A;  3LWQ C;  2OTM A;  1TVK B;  3P10 A;  3CCQ F;  3I56 F;  3F0G A;  1IV2 A;  3KJK A;  4O4L B;  4BT7 A;  5LA6 B;  4O4J A;  1NQ3 A;  3WGM A;  3J7A R;  1X25 A;  3OW2 F;  5HXZ A;  3G6E F;  4ZHQ B;  2FGY A;  5FNV B;  2CWJ A;  1R1M A;  3S03 A;  1S72 F;  3CCE F;  1X7O A;  4I4T B;  4YJ2 B;  2VAW A;  4C81 A;  2I6R A;  3F0D A;  3BYQ A;  5LOV B;  3ZP4 A;  2UYN B;  5FLX M;  3CME F;  2Q1X A;  3KE1 A;  4U3J B;  5EB0 A;  3I3F A;  3JAW A;  1IV1 A;  3HKC A;  3CCS F;  4O2A A;  3MCQ A;  3JAR A;  3RA6 A;  5CB4 B;  4BVT A;  4XCQ A;  2IG8 A;  3CD6 F;  4NQ3 A;  4BY9 D;  4TV9 A;  1SA0 A;  2AMT A;  2AIZ P;  2R75 1;  3KHN A;  1CN7 A;  3V4D A;  3WJQ A;  1E7K A;  5IYZ B;  1VQK F;  1W3E X;  3WPW A;  2HS4 A;  3GTZ A;  2OHW A;  2QI2 A;  5HP8 A;  1RQ7 A;  2WAL A;  4X1Y A;  2L26 A;  4X20 B;  1Q7Y H;  3CC7 F;  4BT4 A;  3ON1 A;  5EYP B;  4TV8 A;  1FFX B;  3M84 A;  5ITZ B;  1JFF B;  5IT9 M;  3HKB B;  4IHJ B;  1VHA A;  3VYU C;  3JAM M;  1H48 A;  4FFB A;  4G4Y A;  3CXC F;  5J2T A;  1XHO A;  3JAT B;  5J2U B;  4TUY A;  3FPI A;  4NWO B;  2YYE A;  4WBN B;  5HY2 A;  1W5F A;  2KTV A;  1OAP A;  4HNA B;  3VCZ A;  3CMA F;  2OZB A;  2CW4 A;  3LYB A;  1QU9 A;  3M1X A;  1Z5V A;  3RYI B;  1W57 A;  5IJ9 B;  4B62 A;  3CPQ A;  4EI9 A;  2UYK A;  2HX0 A;  5KMG A;  2K1S A;  3IEW A;  1ODE A;  3K14 A;  2I6D A;  5GIP C;  4ZI7 B;  1KNK A;  3CC2 F;  3CCV F;  2QA4 F;  4I50 A;  4PWT A;  4BVQ A;  3CB2 A;  4IIJ A;  1YIJ F;  4ZHQ A;  3GHZ A;  3ELC A;  3E1Y A;  5CA1 B;  2LCA A;  5JH7 A;  1W55 A;  4BW0 B;  4I55 A;  4TV9 B;  5KX5 A;  5IYZ A;  1W42 A;  3VIU A;  2ZVY A;  5GON A;  1U43 A;  1FNJ A;  3EOR A;  3TD4 A;  3CCJ F;  3C9T A;  1ZWZ A;  5JVD A;  5HY1 A;  3RYC B;  1JY8 A;  5LP6 A;  2VAM A;  5CA0 B;  1YHQ F;  3VOB A;  1FFX A;  1SA0 B;  5EO3 A;  5LYJ A;  4O4J B;  4C8I A;  2GZL A;  4G4Z A;  4YJ3 B;  3QTY A;  5FNV A;  3E22 B;  2QTP A;  3RE3 A;  3JVH A;  3LME A;  2ZOD A;  4F6R A;  3NK6 A;  3MCA B;  1Q82 H;  3LDT A;  2H6L A;  1TVK A;  2EWC A;  3CCR F;  2NMU A;  5EYP A;  5LOV A;  2BTQ B;  2G9I A;  4DXD A;  1VQ6 F;  4O4H A;  4M8I A;  4ZHV A;  4U3J A;  5AVM A;  3IMP A;  4IHJ A;  3NMU C;  1FSZ A;  5EWR A;  3JAW B;  3ERN A;  4BVS A;  5IJ9 A;  3P4E A;  1RQ2 A;  2HS0 A;  2RB9 A;  4I4T A;  3WGK A;  3S02 A;  2RHJ A;  3JAT A;  5J2U A;  1W58 1;  3JAL B;  3CCL F;  4BT2 A;  1YGY A;  1YI2 F;  4I50 B;  3O85 A;  3N4Y A;  5EB1 B;  4IIJ B;  2CSL A;  4LCK A;  4X1Y B;  5IJ0 B;  5CB4 A;  1YJW F;  5JQG A;  1VQO F;  2ZF8 A;  3VMF B;  1SZQ A;  3WXM B;  3HKB A;  3SIV A;  2HRU A;  1VQM F;  3WGL A;  3DC2 A;  1KNJ A;  3HKE A;  4O2B A;  1KQS F;  2FC3 A;  2W8B C;  5LP6 B;  3ESJ A;  2KTU A;  3UT5 B;  1UI9 A;  3JAS B;  2IQQ A;  2P6Y A;  5KX5 B;  2R6R 1;  4RHA A;  1W5E A;  1U40 A;  3MDO A;  4BT5 A;  4B46 A;  3OON A;  3FBA A;  5HP7 A;  4HNA A;  2CZW A;  4LNU B;  1VQN F;  1QVF F;  3F0F A;  4F6R B;  4B45 A;  1Z5W A;  4FFB B;  2LBW A;  3C9S A;  3JCM M;  4DRX B;  3ZP7 A;  5CA0 A;  3VTI C;  4TUY B;  3NK7 A;  2JNB A;  4X1K A;  5B8F A;  3S0W A;  3R0P A;  2LBT A;  1SDS A;  2Z1T A;  3N4Z A;  3V7E A;  3RYF B;  4RQO A;  4TZZ A;  1VQ4 F;  4U39 A;  1JD1 A;  4O4I A;  3VYS C;  4EB6 B;  1YQN A;  3K2X A;  3Q8H A;  5LXT B;  1W5B A;  2KGW A;  3WPX A;  3B6N A;  1M1K H;  5GON B;  3DDN A;  1YIT F;  4E6E A;  1VH8 A;  3D54 A;  4ZHY B;  3CCM F;  3ZOP A;  5HY4 A;  5JCO C;  3S0Y A;  1OFU A;  3RYC A;  2ALE A;  2DT4 A;  4C8E A;  3HAX D;  5EIB C;  5JH7 B;  1TUB A;  3HTN A;  1YJ9 F;  1CLI A;  2Z1E A;  4I55 B;  5GAP K;  3NVK E;  1IV4 A;  1VQ8 F;  1Q86 H;  1H47 A;  2Q1Y A;  1W2B F;  1W59 A;  1IPA A;  1PXW A;  3CYQ A;  2VGN A;  4C8G A; 
#chains in the Genus database with same CATH homology
 2QI2 A;  3OBW A;  4BVS A;  3NVI B;  2OTJ F;  2WAL A;  1K9M H;  4BVR A;  1K8A H;  3LWP C;  1Q7Y H;  4NUT A;  3CC7 F;  1QVG F;  5A2Q M;  3ON1 A;  5G4U C;  3I55 F;  3E20 B;  3CCL F;  3G4S F;  1KD1 H;  5IT9 M;  3AGK A;  1YI2 F;  5HWE A;  3G71 F;  3O85 A;  3N4Y A;  3FFM A;  3JAM M;  1X52 A;  4LCK A;  3SIU A;  1N8R H;  3LWO C;  1RLG A;  1W41 A;  1YJW F;  2HVY D;  3HJW C;  3CXC F;  1VQO F;  3GYQ A;  1KC8 H;  2AIF A;  2BO1 A;  3VMF B;  5DCV A;  3WXM B;  1CK2 A;  1VQ9 F;  1GO1 A;  3LWR C;  3SIV A;  5HY2 A;  2KTV A;  1VQM F;  1VQL F;  2OZB A;  3CMA F;  5GIO C;  2KG4 A;  3CPW F;  1KQS F;  1M90 H;  2FC3 A;  3CPQ A;  4EI9 A;  2KTU A;  3D00 A;  3LFO A;  4X3L A;  2GLZ A;  5GIN C;  3RA5 A;  1RA4 A;  1VQP F;  3LWV C;  3CC4 F;  3PAF A;  1YJN F;  2I6D A;  1H7M A;  5G4V C;  5GIP C;  5HY0 A;  3CG6 A;  1Q81 H;  1NJI H;  3CCV F;  2CZW A;  3CC2 F;  2QA4 F;  2LBX A;  4BVQ A;  3PLA C;  1VQN F;  1QVF F;  1YIJ F;  3OBY A;  3E1Y A;  2VGM A;  2LBW A;  5FJ4 C;  4BW0 B;  3CCU F;  3LWQ C;  5HXU A;  3JCM M;  3CCQ F;  3I56 F;  3NK7 A;  1T0K B;  2JNB A;  1W42 A;  2OTL F;  3J7A R;  3VI6 A;  3OW2 F;  1SDS A;  5HXZ A;  3G6E F;  2FGY A;  3N4Z A;  3CCJ F;  3V7E A;  1ZWZ A;  2F9Z C;  4TZZ A;  5HY1 A;  1XBI A;  1VQ4 F;  1S72 F;  3CCE F;  3J81 M;  1X7O A;  5GAN K;  1YHQ F;  3IR9 A;  5EO3 A;  1M1K H;  1YIT F;  5FLX M;  3CME F;  3CCM F;  5HY4 A;  1K73 H;  2ALE A;  1GZ0 A;  3NK6 A;  1NMU B;  3MCA B;  3RA6 A;  3CCS F;  3HAX D;  4EI8 A;  4BVT A;  4XCQ A;  1Q82 H;  1YJ9 F;  3NVK E;  1DT9 A;  1X7P A;  5GAP K;  4NQ3 A;  3CD6 F;  3V3T A;  4BY9 D;  1W40 A;  1VQ7 F;  3CCR F;  1VQ8 F;  4EI7 A;  1Q86 H;  1VQ5 F;  1CN7 A;  1E7K A;  4C4W C;  1JJ2 F;  1VQK F;  1VQ6 F;  1W2B F;  4X3M A;  1W3E X;  1GO0 A;  1IPA A;  1PXW A;  3NMU C;  3V7Q A;  2QEX F;  5EWR A;  2VGN A;  3J80 M;  2OHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...