3CCVF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccvF00
5G4VC 3G4SF 2WALA 3JCMM 2VGNA 3LWVC 1K9MH 3CMEF 3CC7F 5IT9M 2KG4A 4X3LA 1PXWA 4C4WC 1N8RH 3LFOA 3NMUC 1CK2A 3ON1A 5GIPC 1VQ6F 2KTUA 3CCSF 1VQNF 1KC8H 5G4UC 1KQSF 1RA4A 4NUTA 3CPQA 1SDSA 3J80M 3CXCF 5GINC 1YJNF 1YJWF 3J7AR 3CC2F 3E20B 3WXMB 1QVFF 1W42A 1JJ2F 4BW0B 5GANK 1YIJF 3G71F 1YI2F 3RA6A 1VQPF 3SIUA 1K8AH 1M90H 2LBWA 3NVIB 2I6DA 1X52A 1DT9A 3PAFA 2VGMA 2KTVA 3LWRC 1H7MA 3O85A 3JAMM 3AGKA 3N4ZA 5EO3A 3LWQC 1Q7YH 3V7QA 3CPWF 3IR9A 2JNBA 3OBYA 3CCJF 1GO0A 5FLXM 1W3EX 1VQOF 1W2BF 3CCLF 3NK7A 1YJ9F 1VQMF 1Q81H 3CCUF 3CCEF 1YHQF 1VQLF 3CMAF 1Q86H 3I56F 1GZ0A 1W40A 1X7PA 2OHWA 1M1KH 3V7EA 3HAXD 3NK6A 4TZZA 2QA4F 2QI2A 1W41A 3CG6A 3CCMF 1K73H 1IPAA 1RLGA 3J81M 4BY9D 3CCRF 2AIFA 1VQ8F 3CCQF 5DCVA 3OW2F 1QVGF 1VQ5F 2LBXA 3LWPC 2OZBA 1GO1A 3CCVF 3SIVA 5FJ4C 1VQ9F 3HJWC 3E1YA 3FFMA 1ZWZA 1Q82H 1VQ7F 5EWRA 3G6EF 2OTLF 3I55F 5GAPK 3CC4F 3N4YA 3OBWA 1VQ4F 3PLAC 1KD1H 5GIOC 1VQKF 1NMUB 3VMFB 3RA5A 1XBIA 5A2QM 1X7OA 2BO1A 2ALEA 3MCAB 1E7KA 3GYQA 3NVKE 1YITF 2HVYD 2QEXF 4X3MA 3VI6A 2FC3A 1S72F 3CD6F 1CN7A 2OTJF 1T0KB 4LCKA 3LWOC 2CZWA 1NJIH
chains in the Genus database with same CATH superfamily
3T80A 3LYBA 3MCQA 1JN1A 2DYYA 5HP8A 2NMUA 3NMUC 4I4TB 4DRXB 4HNAB 5IYZB 1U3LA 2ZOVA 3ERNA 1Z5WA 3CCSF 4HNAA 1RA4A 5MN5A 5FNVA 5HY4A 5HY2A 3J80M 4XCQA 3N2GB 4BVRA 3JAWA 1UI9A 4G4ZA 4R40B 4BW0B 1YIJF 5J2UB 3G71F 1JJ2F 1JD1A 5HP7A 5JCOC 3K0TA 3JATB 2I6DA 1SA0B 3PAFA 2KTVA 3LWRC 2I6RA 1H7MA 3V4DA 4O4IB 5EAZA 3JAMM 5JQGB 3K2XA 5LP6C 2H8EA 1TVKA 4I55A 4EI7A 3KE1A 1YQNA 2EWCA 3NK7A 3KJKA 4I50A 5KX5B 2ZAUA 2KGWA 5LXTB 5C8YA 1VQLF 1U40A 5LXTA 2MQEA 3S0WA 2HP0B 3I56F 3S06A 5JH7A 4O4HA 3MDOA 1COMA 2W8BC 5GONB 3CCMF 1VHAA 5CA1B 3J81M 2UYNA 2Z01A 3EORA 3WPWA 5CA1A 3FD6A 3WJPA 3DDNA 4E6EA 2N48A 3OW2F 2OZBA 3IKFA 1ONIA 3TD4A 5FJ4C 4NWOB 3C9SA 5BMVB 3RYCB 1ZWZA 3B6NA 1W5AA 3I7TA 4G4VA 2FGYA 3OBWA 2RHLA 2UYKA 1VQKF 4B5CA 1W59A 2UYJA 1QD9A 1XBIA 3RYHB 5LA6A 4EB6B 2ALEA 1E7KA 1VQVA 2RB9A 5CA0B 1FFXA 2AMTA 5CA0A 2H6LA 4X3MA 4TV9A 1CN7A 2RHOA 3QTYA 5EYPB 2OTJF 3LWOC 4X1KB 2CZWA 3V7EA 5G4VC 3G4SF 3JCMM 3ZOPA 2HS0A 2KG4A 5EIBC 4C4WC 3LFOA 3S02A 3ZP4A 1CK2A 2IAFA 4TUYB 2UYPA 5KMGA 3ELCA 3F0EA 4BT2A 2GLZA 4G4WA 3CPQA 5GINC 2ZF8A 4X1YB 1YJNF 3IKEA 3CC2F 4BT6A 3WXMB 5EZYB 1FSZA 2Q1XA 3VYTC 5GANK 2LBTA 4X1IA 2HX0A 2HRYA 3WGNA 4ERHA 4C8EA 1QAHA 4M8IA 5JVDB 4IIJB 3TD5A 3JVHA 3VOBA 5EB0A 3JARB 3O85A 5JVDA 3HWUA 2VAMA 3S0HA 3V7QA 3CPWF 3IR9A 2JNBA 3CCJF 4I4TA 4DRXA 4BVQA 2Z1TA 3WJRA 5IYZA 4F6RB 5J2TB 3CCUF 1YHQF 3U0OA 3CYPB 3N2GA 4X20B 3VYSC 4O2AB 4YJ2B 1M1KH 5MN4A 4U3JB 5J2UA 3E22B 1Z5VA 3Q8HA 4TZZA 2QA4F 5MN6A 3VCZA 1K73H 3LMEA 1IPAA 1RLGA 3JATA 3CCRF 1SA0A 1JFFB 4YJ3B 2HS4A 4O4IA 3F0FA 2LBXA 5JQGA 4YJ3A 3LWPC 2R751 4BVSA 3M1XA 4ZHQB 5ITZB 3C9UA 5IJ0B 5LYJB 1VQ9F 3S03A 3HJWC 2VAPA 1RQ2A 1VK3A 4ZOLB 3JASB 5KX5A 4ZI7B 1OAPA 3PLAC 3JASA 5GIOC 2HP0A 3VMFB 3HTNA 1XRGA 3RA5A 3ZP7A 2IQQA 5A2QM 1X7OA 2HQSC 1KNJA 3M84A 3JAKB 3MCAB 5GONA 3NVKE 4WBNB 1YITF 1QU9A 2YXZA 3C9RA 5AVMA 3V3TA 2Z1EA 1H48A 3VI6A 1NQ3A 1Q8RA 2VXYA 3QHDA 1T0AA 2Q1YA 3R0PA 3JALB 4U39A 1SZQA 3FBAA 5BMVA 3RYFB 3WPXA 2ZVZA 2ZODA 3P4EA 3RYCA 3VOAA 1FNJA 2WALA 2VGNA 3LWVC 1X25A 4FFBB 3CMEF 1RLUA 3RYIB 3CC7F 4LNUB 5IT9M 4TV8B 2F9ZC 3RYIA 3P0ZA 2L26A 4G88A 3RYHA 3ON1A 4EI8A 4EB6A 1KC8H 3VIUA 4RHAA 3CXCF 1YJWF 3J7AR 3KJJA 1IV4A 1W57A 5EYPA 4C8IA 3C9TA 3WGKA 4B45A 3UT5B 1XV2A 5CB4B 1M90H 4X1KA 2LBWA 3NVIB 1X52A 5CB4A 2LCAA 1OFUA 3N4ZA 5EO3A 3LWQC 1ODEA 4O4JB 3WGMA 2V9YA 5LP6B 2VAWA 5FLXM 1XHOA 1W3EX 1VQOF 4TUYA 3HKEB 5IJ9B 5EB1B 1YJ9F 1VQMF 1Q81H 3F0DA 3CMAF 4X1YA 1Q86H 4NQ3A 1GZ0A 1X7PA 5EZYA 1W5BA 4IHJB 3NK6A 3OONA 3FPIA 2QI2A 2CHTA 1W41A 3HKDB 4EI9A 3WGLA 3QUWA 2H8CA 3HKBB 4IIJA 2AIFA 1W5EA 3D54A 1VQ8F 3CCQF 3JARA 3HKBA 1YGYA 1VQ5F 1W5FA 4PWTA 1UFYA 3CCVF 3SIVA 2CW4A 3S0YA 2ZVYA 3E1YA 3FFMA 4F6RA 5J2TA 4B62A 5B8FA 1Q82H 3G6EF 4O4LB 4BT4A 5GAPK 3P10A 3CC4F 1PF5A 2BTUA 4O4LA 3TD3A 1KD1H 4C8GA 4X20A 1NMUB 4O2AA 4YJ2A 4BVTA 4U3JA 3E22A 3M4SA 3VYUC 2YYEA 2CHSA 5HWEA 3GYQA 2GZLA 2PHNA 2CVLA 5FNVB 5EIBD 2HVYD 1JFFA 1W581 2FC3A 3JAWB 2HP3A 2Z1FA 4G4YA 3KIZA 4ZHQA 5ITZA 4G4XA 3HKCB 5IJ0A 4ZHVA 5LYJA 1KNKA 3HKCA 1U3PA 3K14A 5LOVB 2AIZP 5LOVA 4ZOLA 1K9MH 3VO8A 4ZI7A 3DC2A 3WGJA 4ZHYB 4X3LA 1PXWA 1VH8A 1R1MA 1TVKB 3F0GA 4I55B 1N8RH 2DT4A 4BT7A 1IV2A 5GIPC 1VQ6F 2KTUA 3JAKA 1VQNF 1GX1A 4WBNA 5HY1A 5G4UC 1KQSF 2QTPA 2RHHA 2R6R1 4I50B 4NUTA 4BT5A 3MBMA 4ZHWA 3F6MA 1SDSA 5C8YB 1JY8A 3D01A 1U43A 3E20B 1QVFF 5JH7B 1W42A 3IEWA 4O4HB 3JALA 3L7QA 3RA6A 2OTMA 4C81A 3ZO8A 1VQPF 1YI2F 1K8AH 2HRUA 3SIUA 5HY0A 3RYFA 2UYNB 3VTIC 1DT9A 2VGMA 3C8LA 3RE3A 1W55A 1H47A 4FFBA 3AGKA 4LNUA 4TV8A 2CWJA 1Q7YH 1J7HA 2P6YA 3OBYA 1GO0A 2CSLA 3N2KB 4B46A 1W2BF 3CCLF 3IEQA 3GHZA 3N2KA 4RQOA 3CCEF 1FNKA 1DBFA 1W40A 3CB2A 2OHWA 2BTOA 2UZHA 3GTZA 3HAXD 3CYQA 4O2BB 5LA6B 3UT5A 3CG6A 3K12A 4O2BA 4BY9D 1FFXB 5HXZA 5JCOA 1TUBB 5DCVA 1QVGF 1RQ7A 1TUBA 2B33A 2HS3A 3I3FA 4TV9B 3LDTA 1GO1A 4O4JA 3IMPA 2GVIA 5LP6A 2IG8A 1IV1A 3HKEA 5IJ9A 2RHJA 2K1SA 1VQ7F 5EWRA 2OTLF 3I55F 3WJQA 3N4YA 1VQ4F 3ESJA 4KWEA 2Z1UA 4IHJA 4ZK7A 2BO1A 2G9IA 3HKDA 5KMGB 3KHNA 3FD5A 1CLIA 2BTQB 5HXUA 3D00A 2QEXF 1S72F 1IV3A 3CD6F 2PMPA 1T0KB 4C82A 4X1IB 4LCKA 3BYQA 3MQWA 4BT3A 4DXDA 1NJIH
chains in the Genus database with same CATH topology
5G4VC 3G4SF 2WALA 3JCMM 2VGNA 3LWVC 1K9MH 3CMEF 3CC7F 5IT9M 2KG4A 4X3LA 2F9ZC 1PXWA 4C4WC 1N8RH 3LFOA 3NMUC 1CK2A 3ON1A 5GIPC 1VQ6F 2KTUA 4EI8A 3CCSF 1VQNF 5HY1A 1KC8H 5G4UC 1KQSF 1RA4A 2GLZA 4NUTA 3CPQA 5HY4A 5HY2A 3J80M 4XCQA 5GINC 3CXCF 1SDSA 1YJNF 4BVRA 1YJWF 3J7AR 3CC2F 3E20B 3WXMB 1QVFF 1W42A 1JJ2F 4BW0B 5GANK 1YIJF 3G71F 1YI2F 3RA6A 1VQPF 3SIUA 1K8AH 5HY0A 1M90H 2LBWA 3NVIB 2I6DA 1X52A 1DT9A 3PAFA 2VGMA 2KTVA 3LWRC 1H7MA 3O85A 3JAMM 3AGKA 3N4ZA 5EO3A 3LWQC 1Q7YH 3V7QA 3CPWF 3IR9A 2JNBA 3OBYA 3CCJF 1GO0A 4BVQA 5FLXM 4EI7A 1W3EX 1VQOF 1W2BF 3CCLF 3NK7A 1YJ9F 1VQMF 1Q81H 3CCUF 3CCEF 1YHQF 1VQLF 3CMAF 1Q86H 3I56F 4NQ3A 1GZ0A 1W40A 1X7PA 2OHWA 1M1KH 3V7EA 3HAXD 3NK6A 4TZZA 2QA4F 2QI2A 1W41A 3CG6A 3CCMF 1K73H 1IPAA 4EI9A 1RLGA 3J81M 4BY9D 3CCRF 5HXZA 2AIFA 1VQ8F 3CCQF 5DCVA 3OW2F 1QVGF 1VQ5F 2LBXA 3LWPC 2OZBA 4BVSA 1GO1A 3CCVF 3SIVA 5FJ4C 1VQ9F 3HJWC 3E1YA 3FFMA 1ZWZA 1Q82H 1VQ7F 5EWRA 3G6EF 2OTLF 3I55F 5GAPK 2FGYA 3CC4F 3N4YA 3OBWA 1VQ4F 3PLAC 1KD1H 5GIOC 1VQKF 1NMUB 3VMFB 4BVTA 3RA5A 1XBIA 5A2QM 1X7OA 2BO1A 2ALEA 3MCAB 5HWEA 3GYQA 1E7KA 3NVKE 1YITF 5HXUA 2HVYD 3V3TA 3D00A 2QEXF 4X3MA 3VI6A 2FC3A 1S72F 3CD6F 1CN7A 2OTJF 1T0KB 4LCKA 3LWOC 2CZWA 1NJIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4V C;  3G4S F;  2WAL A;  3JCM M;  2VGN A;  3LWV C;  1K9M H;  3CME F;  3CC7 F;  5IT9 M;  2KG4 A;  4X3L A;  1PXW A;  4C4W C;  1N8R H;  3LFO A;  3NMU C;  1CK2 A;  3ON1 A;  5GIP C;  1VQ6 F;  2KTU A;  3CCS F;  1VQN F;  1KC8 H;  5G4U C;  1KQS F;  1RA4 A;  4NUT A;  3CPQ A;  1SDS A;  3J80 M;  3CXC F;  5GIN C;  1YJN F;  1YJW F;  3J7A R;  3CC2 F;  3E20 B;  3WXM B;  1QVF F;  1W42 A;  1JJ2 F;  4BW0 B;  5GAN K;  1YIJ F;  3G71 F;  1YI2 F;  3RA6 A;  1VQP F;  3SIU A;  1K8A H;  1M90 H;  2LBW A;  3NVI B;  2I6D A;  1X52 A;  1DT9 A;  3PAF A;  2VGM A;  2KTV A;  3LWR C;  1H7M A;  3O85 A;  3JAM M;  3AGK A;  3N4Z A;  5EO3 A;  3LWQ C;  1Q7Y H;  3V7Q A;  3CPW F;  3IR9 A;  2JNB A;  3OBY A;  3CCJ F;  1GO0 A;  5FLX M;  1W3E X;  1VQO F;  1W2B F;  3CCL F;  3NK7 A;  1YJ9 F;  1VQM F;  1Q81 H;  3CCU F;  3CCE F;  1YHQ F;  1VQL F;  3CMA F;  1Q86 H;  3I56 F;  1GZ0 A;  1W40 A;  1X7P A;  2OHW A;  1M1K H;  3V7E A;  3HAX D;  3NK6 A;  4TZZ A;  2QA4 F;  2QI2 A;  1W41 A;  3CG6 A;  3CCM F;  1K73 H;  1IPA A;  1RLG A;  3J81 M;  4BY9 D;  3CCR F;  2AIF A;  1VQ8 F;  3CCQ F;  5DCV A;  3OW2 F;  1QVG F;  1VQ5 F;  2LBX A;  3LWP C;  2OZB A;  1GO1 A;  3CCV F;  3SIV A;  5FJ4 C;  1VQ9 F;  3HJW C;  3E1Y A;  3FFM A;  1ZWZ A;  1Q82 H;  1VQ7 F;  5EWR A;  3G6E F;  2OTL F;  3I55 F;  5GAP K;  3CC4 F;  3N4Y A;  3OBW A;  1VQ4 F;  3PLA C;  1KD1 H;  5GIO C;  1VQK F;  1NMU B;  3VMF B;  3RA5 A;  1XBI A;  5A2Q M;  1X7O A;  2BO1 A;  2ALE A;  3MCA B;  1E7K A;  3GYQ A;  3NVK E;  1YIT F;  2HVY D;  2QEX F;  4X3M A;  3VI6 A;  2FC3 A;  1S72 F;  3CD6 F;  1CN7 A;  2OTJ F;  1T0K B;  4LCK A;  3LWO C;  2CZW A;  1NJI H; 
#chains in the Genus database with same CATH topology
 3T80 A;  3LYB A;  3MCQ A;  1JN1 A;  2DYY A;  5HP8 A;  2NMU A;  3NMU C;  4I4T B;  4DRX B;  4HNA B;  5IYZ B;  1U3L A;  2ZOV A;  3ERN A;  1Z5W A;  3CCS F;  4HNA A;  1RA4 A;  5MN5 A;  5FNV A;  5HY4 A;  5HY2 A;  3J80 M;  4XCQ A;  3N2G B;  4BVR A;  3JAW A;  1UI9 A;  4G4Z A;  4R40 B;  4BW0 B;  1YIJ F;  5J2U B;  3G71 F;  1JJ2 F;  1JD1 A;  5HP7 A;  5JCO C;  3K0T A;  3JAT B;  2I6D A;  1SA0 B;  3PAF A;  2KTV A;  3LWR C;  2I6R A;  1H7M A;  3V4D A;  4O4I B;  5EAZ A;  3JAM M;  5JQG B;  3K2X A;  5LP6 C;  2H8E A;  1TVK A;  4I55 A;  4EI7 A;  3KE1 A;  1YQN A;  2EWC A;  3NK7 A;  3KJK A;  4I50 A;  5KX5 B;  2ZAU A;  2KGW A;  5LXT B;  5C8Y A;  1VQL F;  1U40 A;  5LXT A;  2MQE A;  3S0W A;  2HP0 B;  3I56 F;  3S06 A;  5JH7 A;  4O4H A;  3MDO A;  1COM A;  2W8B C;  5GON B;  3CCM F;  1VHA A;  5CA1 B;  3J81 M;  2UYN A;  2Z01 A;  3EOR A;  3WPW A;  5CA1 A;  3FD6 A;  3WJP A;  3DDN A;  4E6E A;  2N48 A;  3OW2 F;  2OZB A;  3IKF A;  1ONI A;  3TD4 A;  5FJ4 C;  4NWO B;  3C9S A;  5BMV B;  3RYC B;  1ZWZ A;  3B6N A;  1W5A A;  3I7T A;  4G4V A;  2FGY A;  3OBW A;  2RHL A;  2UYK A;  1VQK F;  4B5C A;  1W59 A;  2UYJ A;  1QD9 A;  1XBI A;  3RYH B;  5LA6 A;  4EB6 B;  2ALE A;  1E7K A;  1VQV A;  2RB9 A;  5CA0 B;  1FFX A;  2AMT A;  5CA0 A;  2H6L A;  4X3M A;  4TV9 A;  1CN7 A;  2RHO A;  3QTY A;  5EYP B;  2OTJ F;  3LWO C;  4X1K B;  2CZW A;  3V7E A;  5G4V C;  3G4S F;  3JCM M;  3ZOP A;  2HS0 A;  2KG4 A;  5EIB C;  4C4W C;  3LFO A;  3S02 A;  3ZP4 A;  1CK2 A;  2IAF A;  4TUY B;  2UYP A;  5KMG A;  3ELC A;  3F0E A;  4BT2 A;  2GLZ A;  4G4W A;  3CPQ A;  5GIN C;  2ZF8 A;  4X1Y B;  1YJN F;  3IKE A;  3CC2 F;  4BT6 A;  3WXM B;  5EZY B;  1FSZ A;  2Q1X A;  3VYT C;  5GAN K;  2LBT A;  4X1I A;  2HX0 A;  2HRY A;  3WGN A;  4ERH A;  4C8E A;  1QAH A;  4M8I A;  5JVD B;  4IIJ B;  3TD5 A;  3JVH A;  3VOB A;  5EB0 A;  3JAR B;  3O85 A;  5JVD A;  3HWU A;  2VAM A;  3S0H A;  3V7Q A;  3CPW F;  3IR9 A;  2JNB A;  3CCJ F;  4I4T A;  4DRX A;  4BVQ A;  2Z1T A;  3WJR A;  5IYZ A;  4F6R B;  5J2T B;  3CCU F;  1YHQ F;  3U0O A;  3CYP B;  3N2G A;  4X20 B;  3VYS C;  4O2A B;  4YJ2 B;  1M1K H;  5MN4 A;  4U3J B;  5J2U A;  3E22 B;  1Z5V A;  3Q8H A;  4TZZ A;  2QA4 F;  5MN6 A;  3VCZ A;  1K73 H;  3LME A;  1IPA A;  1RLG A;  3JAT A;  3CCR F;  1SA0 A;  1JFF B;  4YJ3 B;  2HS4 A;  4O4I A;  3F0F A;  2LBX A;  5JQG A;  4YJ3 A;  3LWP C;  2R75 1;  4BVS A;  3M1X A;  4ZHQ B;  5ITZ B;  3C9U A;  5IJ0 B;  5LYJ B;  1VQ9 F;  3S03 A;  3HJW C;  2VAP A;  1RQ2 A;  1VK3 A;  4ZOL B;  3JAS B;  5KX5 A;  4ZI7 B;  1OAP A;  3PLA C;  3JAS A;  5GIO C;  2HP0 A;  3VMF B;  3HTN A;  1XRG A;  3RA5 A;  3ZP7 A;  2IQQ A;  5A2Q M;  1X7O A;  2HQS C;  1KNJ A;  3M84 A;  3JAK B;  3MCA B;  5GON A;  3NVK E;  4WBN B;  1YIT F;  1QU9 A;  2YXZ A;  3C9R A;  5AVM A;  3V3T A;  2Z1E A;  1H48 A;  3VI6 A;  1NQ3 A;  1Q8R A;  2VXY A;  3QHD A;  1T0A A;  2Q1Y A;  3R0P A;  3JAL B;  4U39 A;  1SZQ A;  3FBA A;  5BMV A;  3RYF B;  3WPX A;  2ZVZ A;  2ZOD A;  3P4E A;  3RYC A;  3VOA A;  1FNJ A;  2WAL A;  2VGN A;  3LWV C;  1X25 A;  4FFB B;  3CME F;  1RLU A;  3RYI B;  3CC7 F;  4LNU B;  5IT9 M;  4TV8 B;  2F9Z C;  3RYI A;  3P0Z A;  2L26 A;  4G88 A;  3RYH A;  3ON1 A;  4EI8 A;  4EB6 A;  1KC8 H;  3VIU A;  4RHA A;  3CXC F;  1YJW F;  3J7A R;  3KJJ A;  1IV4 A;  1W57 A;  5EYP A;  4C8I A;  3C9T A;  3WGK A;  4B45 A;  3UT5 B;  1XV2 A;  5CB4 B;  1M90 H;  4X1K A;  2LBW A;  3NVI B;  1X52 A;  5CB4 A;  2LCA A;  1OFU A;  3N4Z A;  5EO3 A;  3LWQ C;  1ODE A;  4O4J B;  3WGM A;  2V9Y A;  5LP6 B;  2VAW A;  5FLX M;  1XHO A;  1W3E X;  1VQO F;  4TUY A;  3HKE B;  5IJ9 B;  5EB1 B;  1YJ9 F;  1VQM F;  1Q81 H;  3F0D A;  3CMA F;  4X1Y A;  1Q86 H;  4NQ3 A;  1GZ0 A;  1X7P A;  5EZY A;  1W5B A;  4IHJ B;  3NK6 A;  3OON A;  3FPI A;  2QI2 A;  2CHT A;  1W41 A;  3HKD B;  4EI9 A;  3WGL A;  3QUW A;  2H8C A;  3HKB B;  4IIJ A;  2AIF A;  1W5E A;  3D54 A;  1VQ8 F;  3CCQ F;  3JAR A;  3HKB A;  1YGY A;  1VQ5 F;  1W5F A;  4PWT A;  1UFY A;  3CCV F;  3SIV A;  2CW4 A;  3S0Y A;  2ZVY A;  3E1Y A;  3FFM A;  4F6R A;  5J2T A;  4B62 A;  5B8F A;  1Q82 H;  3G6E F;  4O4L B;  4BT4 A;  5GAP K;  3P10 A;  3CC4 F;  1PF5 A;  2BTU A;  4O4L A;  3TD3 A;  1KD1 H;  4C8G A;  4X20 A;  1NMU B;  4O2A A;  4YJ2 A;  4BVT A;  4U3J A;  3E22 A;  3M4S A;  3VYU C;  2YYE A;  2CHS A;  5HWE A;  3GYQ A;  2GZL A;  2PHN A;  2CVL A;  5FNV B;  5EIB D;  2HVY D;  1JFF A;  1W58 1;  2FC3 A;  3JAW B;  2HP3 A;  2Z1F A;  4G4Y A;  3KIZ A;  4ZHQ A;  5ITZ A;  4G4X A;  3HKC B;  5IJ0 A;  4ZHV A;  5LYJ A;  1KNK A;  3HKC A;  1U3P A;  3K14 A;  5LOV B;  2AIZ P;  5LOV A;  4ZOL A;  1K9M H;  3VO8 A;  4ZI7 A;  3DC2 A;  3WGJ A;  4ZHY B;  4X3L A;  1PXW A;  1VH8 A;  1R1M A;  1TVK B;  3F0G A;  4I55 B;  1N8R H;  2DT4 A;  4BT7 A;  1IV2 A;  5GIP C;  1VQ6 F;  2KTU A;  3JAK A;  1VQN F;  1GX1 A;  4WBN A;  5HY1 A;  5G4U C;  1KQS F;  2QTP A;  2RHH A;  2R6R 1;  4I50 B;  4NUT A;  4BT5 A;  3MBM A;  4ZHW A;  3F6M A;  1SDS A;  5C8Y B;  1JY8 A;  3D01 A;  1U43 A;  3E20 B;  1QVF F;  5JH7 B;  1W42 A;  3IEW A;  4O4H B;  3JAL A;  3L7Q A;  3RA6 A;  2OTM A;  4C81 A;  3ZO8 A;  1VQP F;  1YI2 F;  1K8A H;  2HRU A;  3SIU A;  5HY0 A;  3RYF A;  2UYN B;  3VTI C;  1DT9 A;  2VGM A;  3C8L A;  3RE3 A;  1W55 A;  1H47 A;  4FFB A;  3AGK A;  4LNU A;  4TV8 A;  2CWJ A;  1Q7Y H;  1J7H A;  2P6Y A;  3OBY A;  1GO0 A;  2CSL A;  3N2K B;  4B46 A;  1W2B F;  3CCL F;  3IEQ A;  3GHZ A;  3N2K A;  4RQO A;  3CCE F;  1FNK A;  1DBF A;  1W40 A;  3CB2 A;  2OHW A;  2BTO A;  2UZH A;  3GTZ A;  3HAX D;  3CYQ A;  4O2B B;  5LA6 B;  3UT5 A;  3CG6 A;  3K12 A;  4O2B A;  4BY9 D;  1FFX B;  5HXZ A;  5JCO A;  1TUB B;  5DCV A;  1QVG F;  1RQ7 A;  1TUB A;  2B33 A;  2HS3 A;  3I3F A;  4TV9 B;  3LDT A;  1GO1 A;  4O4J A;  3IMP A;  2GVI A;  5LP6 A;  2IG8 A;  1IV1 A;  3HKE A;  5IJ9 A;  2RHJ A;  2K1S A;  1VQ7 F;  5EWR A;  2OTL F;  3I55 F;  3WJQ A;  3N4Y A;  1VQ4 F;  3ESJ A;  4KWE A;  2Z1U A;  4IHJ A;  4ZK7 A;  2BO1 A;  2G9I A;  3HKD A;  5KMG B;  3KHN A;  3FD5 A;  1CLI A;  2BTQ B;  5HXU A;  3D00 A;  2QEX F;  1S72 F;  1IV3 A;  3CD6 F;  2PMP A;  1T0K B;  4C82 A;  4X1I B;  4LCK A;  3BYQ A;  3MQW A;  4BT3 A;  4DXD A;  1NJI H; 
#chains in the Genus database with same CATH homology
 5G4V C;  3G4S F;  2WAL A;  3JCM M;  2VGN A;  3LWV C;  1K9M H;  3CME F;  3CC7 F;  5IT9 M;  2KG4 A;  4X3L A;  2F9Z C;  1PXW A;  4C4W C;  1N8R H;  3LFO A;  3NMU C;  1CK2 A;  3ON1 A;  5GIP C;  1VQ6 F;  2KTU A;  4EI8 A;  3CCS F;  1VQN F;  5HY1 A;  1KC8 H;  5G4U C;  1KQS F;  1RA4 A;  2GLZ A;  4NUT A;  3CPQ A;  5HY4 A;  5HY2 A;  3J80 M;  4XCQ A;  5GIN C;  3CXC F;  1SDS A;  1YJN F;  4BVR A;  1YJW F;  3J7A R;  3CC2 F;  3E20 B;  3WXM B;  1QVF F;  1W42 A;  1JJ2 F;  4BW0 B;  5GAN K;  1YIJ F;  3G71 F;  1YI2 F;  3RA6 A;  1VQP F;  3SIU A;  1K8A H;  5HY0 A;  1M90 H;  2LBW A;  3NVI B;  2I6D A;  1X52 A;  1DT9 A;  3PAF A;  2VGM A;  2KTV A;  3LWR C;  1H7M A;  3O85 A;  3JAM M;  3AGK A;  3N4Z A;  5EO3 A;  3LWQ C;  1Q7Y H;  3V7Q A;  3CPW F;  3IR9 A;  2JNB A;  3OBY A;  3CCJ F;  1GO0 A;  4BVQ A;  5FLX M;  4EI7 A;  1W3E X;  1VQO F;  1W2B F;  3CCL F;  3NK7 A;  1YJ9 F;  1VQM F;  1Q81 H;  3CCU F;  3CCE F;  1YHQ F;  1VQL F;  3CMA F;  1Q86 H;  3I56 F;  4NQ3 A;  1GZ0 A;  1W40 A;  1X7P A;  2OHW A;  1M1K H;  3V7E A;  3HAX D;  3NK6 A;  4TZZ A;  2QA4 F;  2QI2 A;  1W41 A;  3CG6 A;  3CCM F;  1K73 H;  1IPA A;  4EI9 A;  1RLG A;  3J81 M;  4BY9 D;  3CCR F;  5HXZ A;  2AIF A;  1VQ8 F;  3CCQ F;  5DCV A;  3OW2 F;  1QVG F;  1VQ5 F;  2LBX A;  3LWP C;  2OZB A;  4BVS A;  1GO1 A;  3CCV F;  3SIV A;  5FJ4 C;  1VQ9 F;  3HJW C;  3E1Y A;  3FFM A;  1ZWZ A;  1Q82 H;  1VQ7 F;  5EWR A;  3G6E F;  2OTL F;  3I55 F;  5GAP K;  2FGY A;  3CC4 F;  3N4Y A;  3OBW A;  1VQ4 F;  3PLA C;  1KD1 H;  5GIO C;  1VQK F;  1NMU B;  3VMF B;  4BVT A;  3RA5 A;  1XBI A;  5A2Q M;  1X7O A;  2BO1 A;  2ALE A;  3MCA B;  5HWE A;  3GYQ A;  1E7K A;  3NVK E;  1YIT F;  5HXU A;  2HVY D;  3V3T A;  3D00 A;  2QEX F;  4X3M A;  3VI6 A;  2FC3 A;  1S72 F;  3CD6 F;  1CN7 A;  2OTJ F;  1T0K B;  4LCK A;  3LWO C;  2CZW A;  1NJI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...