3CCVF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccvF00
2OHWA 3CCQF 1Q82H 3CCLF 3G4SF 1CK2A 1VQOF 5FLXM 1VQ9F 2AIFA 4NUTA 1QVGF 3LWOC 5FJ4C 3AGKA 2LBWA 2LBXA 1YJWF 3I56F 1VQNF 3LFOA 1X7PA 1H7MA 5GIOC 4X3LA 3CCEF 3FFMA 3NVIB 3CCJF 3VMFB 1W3EX 3CCMF 3CC7F 5GIPC 1KC8H 1ZWZA 3N4ZA 1DT9A 3PAFA 5G4VC 2OTLF 3J80M 3CXCF 2KG4A 1Q81H 4LCKA 1PXWA 3CMEF 2OTJF 3CC2F 1X7OA 1M1KH 5EO3A 5GINC 5GAPK 2OZBA 1W41A 3CCVF 2VGNA 3N4YA 1S72F 3ON1A 2KTUA 1KD1H 4X3MA 2QA4F 1VQ6F 3LWVC 3V7EA 3NK7A 3CCUF 1K8AH 3RA6A 1YITF 1GZ0A 1SDSA 3OBYA 5DCVA 1IPAA 3CPQA 1YIJF 3NMUC 3O85A 1RLGA 2VGMA 1GO1A 2I6DA 1W40A 3LWRC 1E7KA 1W42A 1W2BF 2ALEA 3G6EF 3OW2F 1YI2F 3I55F 3SIVA 4TZZA 5G4UC 4BW0B 3CD6F 1T0KB 1XBIA 3CG6A 3E1YA 3WXMB 1YJNF 1CN7A 1VQ5F 3SIUA 2QI2A 5A2QM 1X52A 3J81M 1NJIH 5EWRA 3RA5A 2JNBA 3V7QA 1QVFF 5IT9M 1RA4A 3J7AR 2QEXF 2BO1A 3IR9A 3VI6A 1VQPF 1JJ2F 3CCRF 1VQ4F 4BY9D 2CZWA 1NMUB 3LWQC 1YHQF 2WALA 1VQ8F 2KTVA 3LWPC 1M90H 3GYQA 3CCSF 1N8RH 1GO0A 3G71F 2FC3A 1K9MH 1VQMF 3CMAF 1KQSF 1YJ9F 3PLAC 1Q7YH 3CC4F 1Q86H 3NK6A 3CPWF 3JAMM 3OBWA 3MCAB 4C4WC 3HAXD 3HJWC 5GANK 3E20B 1VQKF 1K73H 1VQLF 3NVKE 2HVYD 3JCMM 1VQ7F
chains in the Genus database with same CATH superfamily
1Q82H 3TD5A 5IJ9B 5MN4A 4C8EA 1JFFB 2AIFA 3JARA 3RYIA 1JY8A 3JVHA 5FJ4C 2W8BC 1RQ7A 2LBWA 1XHOA 1H48A 3C8LA 3Q8HA 4TV8A 1X7PA 1W5EA 1H7MA 1TVKA 2RHHA 3CCJF 3C9TA 3VMFB 5ITZB 1RQ2A 3JASA 4TV9B 2RHJA 1FNKA 4IHJB 3VYSC 2RB9A 2OTLF 3CXCF 2OTJF 1PXWA 3DDNA 1NQ3A 2Z1EA 2RHOA 1X7OA 1IV1A 5EO3A 3MCQA 4C82A 2VGNA 1QU9A 2UZHA 1S72F 3RYHB 3HKBA 4X3MA 2IAFA 3M84A 1CLIA 1UFYA 3DC2A 3CCUF 1K8AH 1YITF 3D54A 5DCVA 2ZVYA 1YIJF 3CB2A 3GHZA 5HY2A 5JVDA 2VGMA 3N2KA 2HP0B 2HS3A 5JQGA 1E7KA 2HRYA 1W2BF 3HWUA 5MN5A 4WBNB 3G6EF 1YI2F 4EB6A 4EI7A 4O4LA 3KHNA 4LNUB 5LOVB 3CD6F 1XBIA 1QAHA 3E1YA 2UYPA 4U3JB 2CW4A 2QI2A 5A2QM 1W59A 1NJIH 3RA5A 3R0PA 5FNVB 5EYPB 4HNAB 1YGYA 3J7AR 3UT5A 5JCOA 5J2TB 4BT4A 3IR9A 2PHNA 2MQEA 4BY9D 4X20B 2BTOA 3BYQA 2H8EA 2KTVA 5JH7B 3E22B 5CA0B 3F6MA 5C8YB 3G71F 2FGYA 2ZF8A 1IV3A 5HWEA 5LXTA 2F9ZC 4TUYA 1YJ9F 1U40A 1Q7YH 3CC4F 4O2AA 1Q86H 5IJ0B 3CPWF 1DBFA 3JAMM 1SA0B 3HAXD 5BMVB 5LP6C 5GANK 1W55A 3E20B 3HKDA 4I4TA 3NVKE 1VQLF 4G4XA 4EI9A 3WJRA 4ZHYB 5J2UB 3CCLF 3G4SF 1CK2A 4NUTA 4YJ3A 3VTIC 5CB4B 3AGKA 2Z01A 2LBXA 1YJWF 4BT5A 4BT6A 3I56F 3WGJA 1U3PA 2EWCA 5GIOC 5HP8A 3FFMA 3WGNA 5KX5A 4ZHWA 5GIPC 3VYTC 4BT3A 3N4ZA 5EZYB 5IJ9A 2KGWA 1W5AA 2DYYA 1JFFA 3HKCB 2N48A 3N2GA 3CC2F 5CA1B 1YQNA 2UYJA 3D00A 1W41A 3VOBA 4X1KB 4BT7A 4DRXB 1IV4A 3ON1A 4G4VA 5MN6A 3IKEA 2QA4F 1FSZA 5ITZA 3VOAA 3ZP7A 5HY0A 2BTUA 2Q1YA 2HS0A 1UI9A 4TV9A 3RA6A 3TD3A 1SDSA 3P10A 3F0GA 4IHJA 3JAKB 1FFXB 3O85A 1RLGA 4I55B 4B62A 1XV2A 1FNJA 1GO1A 4NWOB 3LWRC 1W42A 5LYJB 1RLUA 4BVSA 2ALEA 4B5CA 3OW2F 5JCOC 1X25A 2CVLA 4X1IB 3IEQA 2IQQA 5G4UC 4BW0B 3ZP4A 1YJNF 5KMGB 1VQ5F 2VAMA 1X52A 3C9SA 5LP6B 3V7QA 2AIZP 2GVIA 2HP0A 4ZHQB 5HXZA 3CYQA 1RA4A 4O4JA 4WBNA 3JAWB 1JJ2F 3CCRF 4LNUA 2ZODA 3F0DA 5LOVA 1GX1A 1M90H 4U3JA 1N8RH 4NQ3A 3KJKA 1TUBA 5EB1B 3VCZA 4IIJB 5FNVA 5EYPA 2UYNA 3CMAF 4G4ZA 4O2BB 4HNAA 3NK6A 4ZOLB 4ZI7B 3S03A 3OBWA 5J2TA 3MCAB 4C4WC 3I7TA 3RYFB 2UYKA 4X20A 5GONB 5HY1A 3GTZA 3M1XA 2OHWA 5JH7A 3FBAA 3V3TA 3E22A 2IG8A 5CA0A 3KIZA 1SZQA 2YYEA 5C8YA 1QD9A 3LWOC 3WGKA 2Z1TA 4O4HB 5B8FA 4O4LB 3VIUA 1VQNF 3CYPB 5IJ0A 4E6EA 1W5FA 1R1MA 2P6YA 1SA0A 4F6RB 5BMVA 5LA6A 3NVIB 3P4EA 4O4IB 3CCMF 1ONIA 2GZLA 3CC7F 5HY4A 5J2UA 1KC8H 1ZWZA 2H6LA 1COMA 1DT9A 3PAFA 5G4VC 3JALB 2CSLA 4G4WA 5CB4A 3IKFA 4ERHA 3CMEF 2CHSA 2ZAUA 1JN1A 1M1KH 5GAPK 4I50B 4ZHVA 2L26A 3LYBA 3CCVF 3ELCA 3N4YA 4M8IA 1KD1H 2QTPA 3QTYA 1Z5VA 3LWVC 3KJJA 5IYZB 1VHAA 3S06A 3NK7A 1U3LA 5LXTB 5EZYA 1GZ0A 4FFBA 3OBYA 2Z1UA 4BVRA 3HKCA 1J7HA 3M4SA 4RQOA 1IPAA 3K0TA 3MQWA 3NMUC 2CWJA 1OAPA 5CA1A 4KWEA 2R751 2I6DA 2R6R1 4X1KA 3HTNA 2Q1XA 3QHDA 2YXZA 3QUWA 1W5BA 4C81A 3OONA 3RYCB 4TZZA 3HKEB 5HP7A 3WXMB 3WPWA 2I6RA 3SIUA 2H8CA 3MBMA 3JAKA 1FFXA 5EWRA 4X1YB 3K14A 3EORA 4I55A 2ZOVA 1QVFF 4YJ2B 3JATB 2HRUA 3C9UA 5IT9M 5LYJA 4C8GA 3ERNA 3VO8A 1OFUA 4EI8A 2K1SA 1VQPF 1VQ4F 4X1IA 3F0EA 4ZK7A 1YHQF 4B45A 2WALA 3N2GB 3RYHA 2VAPA 5KMGA 3ZO8A 3LWPC 3IEWA 3JARB 3RYIB 3WGLA 3S0WA 5LP6A 1VQMF 2BTQB 4BT2A 3FPIA 3P0ZA 4ZHQA 2OTMA 4TV8B 5EB0A 1TVKB 3JAWA 3LDTA 3HJWC 2LBTA 3V4DA 3T80A 1VQKF 1K73H 2ZVZA 3JCMM 5HXUA 1VQ8F 3CCQF 3S02A 3JASB 3WPXA 1VQOF 5FLXM 1PF5A 1VQ9F 4C8IA 1QVGF 4IIJA 2HX0A 4O2BA 3LFOA 4ZOLA 4ZI7A 1JD1A 4X3LA 4R40B 4DXDA 3CCEF 3HKBB 3RYFA 2PMPA 5GONA 1U43A 4G4YA 1W3EX 4PWTA 2HQSC 2GLZA 5EIBD 3I3FA 2DT4A 3VYUC 3J80M 2KG4A 3S0YA 1Q81H 4LCKA 4O4JB 5JVDB 1ODEA 4O4HA 3N2KB 5GINC 3D01A 2OZBA 5JQGB 2CHTA 2KTUA 1W581 4EB6B 4F6RA 3IMPA 1VQ6F 4O4IA 1TUBB 3V7EA 1IV2A 2UYNB 1VQVA 2B33A 3JALA 4B46A 5EAZA 3CPQA 1W57A 4I50A 1W40A 3WGMA 4RHAA 1KNKA 3UT5B 2RHLA 2VAWA 1T0AA 3I55F 3SIVA 3RE3A 5IYZA 3ESJA 4XCQA 1T0KB 3CG6A 1CN7A 3LMEA 5EIBC 1Z5WA 5AVMA 2Z1FA 3J81M 3K12A 3WJPA 2LCAA 3L7QA 1XRGA 2JNBA 4TUYB 5LA6B 4O2AB 4G88A 2QEXF 2BO1A 3B6NA 3VI6A 2G9IA 3MDOA 3RYCA 3HKDB 1H47A 2CZWA 1NMUB 1Q8RA 3HKEA 4I4TB 4U39A 3S0HA 3TD4A 4DRXA 3LWQC 2NMUA 3KE1A 3GYQA 3CCSF 3FD6A 2V9YA 2AMTA 1GO0A 3F0FA 4YJ3B 2FC3A 3ZOPA 4X1YA 1K9MH 2VXYA 1KQSF 1VK3A 3PLAC 4YJ2A 3JATA 1KNJA 1VH8A 3FD5A 3U0OA 4BVQA 2HP3A 4BVTA 4FFBB 3C9RA 2HS4A 5KX5B 3WJQA 2HVYD 1VQ7F 3K2XA
chains in the Genus database with same CATH topology
2OHWA 3CCQF 1Q82H 3CCLF 3G4SF 3V3TA 1CK2A 1VQOF 5FLXM 1VQ9F 2AIFA 4NUTA 1QVGF 3LWOC 5FJ4C 3AGKA 2LBWA 2LBXA 1YJWF 3I56F 1VQNF 3LFOA 1X7PA 1H7MA 5GIOC 4X3LA 3CCEF 3FFMA 3NVIB 3CCJF 3VMFB 1W3EX 2GLZA 3CCMF 3CC7F 5GIPC 5HY4A 1KC8H 1ZWZA 3N4ZA 1DT9A 3PAFA 5G4VC 2OTLF 3J80M 3CXCF 2KG4A 1Q81H 4LCKA 1PXWA 3CMEF 2OTJF 3CC2F 1X7OA 1M1KH 5EO3A 5GINC 5GAPK 2OZBA 3D00A 1W41A 3CCVF 2VGNA 3N4YA 1S72F 3ON1A 2KTUA 1KD1H 4X3MA 2QA4F 1VQ6F 3LWVC 3V7EA 3NK7A 5HY0A 3CCUF 1K8AH 3RA6A 1YITF 1GZ0A 1SDSA 3OBYA 4BVRA 5DCVA 1IPAA 3CPQA 1YIJF 3NMUC 3O85A 1RLGA 5HY2A 2VGMA 1GO1A 2I6DA 1W40A 3LWRC 1E7KA 1W42A 1W2BF 4BVSA 2ALEA 3G6EF 3OW2F 4EI7A 1YI2F 3I55F 3SIVA 4TZZA 5G4UC 4BW0B 3CD6F 4XCQA 1T0KB 1XBIA 3CG6A 3E1YA 3WXMB 1YJNF 1CN7A 1VQ5F 3SIUA 2QI2A 5A2QM 1X52A 3J81M 1NJIH 5EWRA 3RA5A 5HXUA 2JNBA 3V7QA 1QVFF 5HXZA 5IT9M 1RA4A 3J7AR 2QEXF 2BO1A 3IR9A 3VI6A 4EI8A 1VQPF 1JJ2F 3CCRF 1VQ4F 4BY9D 2CZWA 1NMUB 3LWQC 1YHQF 2WALA 1VQ8F 2KTVA 3LWPC 1M90H 3GYQA 3CCSF 1N8RH 4NQ3A 1GO0A 3G71F 2FC3A 2FGYA 1K9MH 5HWEA 1VQMF 2F9ZC 3CMAF 1KQSF 1YJ9F 3PLAC 1Q7YH 3CC4F 1Q86H 3NK6A 3CPWF 4BVQA 3JAMM 3OBWA 3MCAB 4C4WC 4BVTA 3HAXD 3HJWC 5GANK 3E20B 1VQKF 1K73H 1VQLF 3NVKE 5HY1A 2HVYD 3JCMM 1VQ7F 4EI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHW A;  3CCQ F;  1Q82 H;  3CCL F;  3G4S F;  1CK2 A;  1VQO F;  5FLX M;  1VQ9 F;  2AIF A;  4NUT A;  1QVG F;  3LWO C;  5FJ4 C;  3AGK A;  2LBW A;  2LBX A;  1YJW F;  3I56 F;  1VQN F;  3LFO A;  1X7P A;  1H7M A;  5GIO C;  4X3L A;  3CCE F;  3FFM A;  3NVI B;  3CCJ F;  3VMF B;  1W3E X;  3CCM F;  3CC7 F;  5GIP C;  1KC8 H;  1ZWZ A;  3N4Z A;  1DT9 A;  3PAF A;  5G4V C;  2OTL F;  3J80 M;  3CXC F;  2KG4 A;  1Q81 H;  4LCK A;  1PXW A;  3CME F;  2OTJ F;  3CC2 F;  1X7O A;  1M1K H;  5EO3 A;  5GIN C;  5GAP K;  2OZB A;  1W41 A;  3CCV F;  2VGN A;  3N4Y A;  1S72 F;  3ON1 A;  2KTU A;  1KD1 H;  4X3M A;  2QA4 F;  1VQ6 F;  3LWV C;  3V7E A;  3NK7 A;  3CCU F;  1K8A H;  3RA6 A;  1YIT F;  1GZ0 A;  1SDS A;  3OBY A;  5DCV A;  1IPA A;  3CPQ A;  1YIJ F;  3NMU C;  3O85 A;  1RLG A;  2VGM A;  1GO1 A;  2I6D A;  1W40 A;  3LWR C;  1E7K A;  1W42 A;  1W2B F;  2ALE A;  3G6E F;  3OW2 F;  1YI2 F;  3I55 F;  3SIV A;  4TZZ A;  5G4U C;  4BW0 B;  3CD6 F;  1T0K B;  1XBI A;  3CG6 A;  3E1Y A;  3WXM B;  1YJN F;  1CN7 A;  1VQ5 F;  3SIU A;  2QI2 A;  5A2Q M;  1X52 A;  3J81 M;  1NJI H;  5EWR A;  3RA5 A;  2JNB A;  3V7Q A;  1QVF F;  5IT9 M;  1RA4 A;  3J7A R;  2QEX F;  2BO1 A;  3IR9 A;  3VI6 A;  1VQP F;  1JJ2 F;  3CCR F;  1VQ4 F;  4BY9 D;  2CZW A;  1NMU B;  3LWQ C;  1YHQ F;  2WAL A;  1VQ8 F;  2KTV A;  3LWP C;  1M90 H;  3GYQ A;  3CCS F;  1N8R H;  1GO0 A;  3G71 F;  2FC3 A;  1K9M H;  1VQM F;  3CMA F;  1KQS F;  1YJ9 F;  3PLA C;  1Q7Y H;  3CC4 F;  1Q86 H;  3NK6 A;  3CPW F;  3JAM M;  3OBW A;  3MCA B;  4C4W C;  3HAX D;  3HJW C;  5GAN K;  3E20 B;  1VQK F;  1K73 H;  1VQL F;  3NVK E;  2HVY D;  3JCM M;  1VQ7 F; 
#chains in the Genus database with same CATH topology
 1Q82 H;  3TD5 A;  5IJ9 B;  5MN4 A;  4C8E A;  1JFF B;  2AIF A;  3JAR A;  3RYI A;  1JY8 A;  3JVH A;  5FJ4 C;  2W8B C;  1RQ7 A;  2LBW A;  1XHO A;  1H48 A;  3C8L A;  3Q8H A;  4TV8 A;  1X7P A;  1W5E A;  1H7M A;  1TVK A;  2RHH A;  3CCJ F;  3C9T A;  3VMF B;  5ITZ B;  1RQ2 A;  3JAS A;  4TV9 B;  2RHJ A;  1FNK A;  4IHJ B;  3VYS C;  2RB9 A;  2OTL F;  3CXC F;  2OTJ F;  1PXW A;  3DDN A;  1NQ3 A;  2Z1E A;  2RHO A;  1X7O A;  1IV1 A;  5EO3 A;  3MCQ A;  4C82 A;  2VGN A;  1QU9 A;  2UZH A;  1S72 F;  3RYH B;  3HKB A;  4X3M A;  2IAF A;  3M84 A;  1CLI A;  1UFY A;  3DC2 A;  3CCU F;  1K8A H;  1YIT F;  3D54 A;  5DCV A;  2ZVY A;  1YIJ F;  3CB2 A;  3GHZ A;  5HY2 A;  5JVD A;  2VGM A;  3N2K A;  2HP0 B;  2HS3 A;  5JQG A;  1E7K A;  2HRY A;  1W2B F;  3HWU A;  5MN5 A;  4WBN B;  3G6E F;  1YI2 F;  4EB6 A;  4EI7 A;  4O4L A;  3KHN A;  4LNU B;  5LOV B;  3CD6 F;  1XBI A;  1QAH A;  3E1Y A;  2UYP A;  4U3J B;  2CW4 A;  2QI2 A;  5A2Q M;  1W59 A;  1NJI H;  3RA5 A;  3R0P A;  5FNV B;  5EYP B;  4HNA B;  1YGY A;  3J7A R;  3UT5 A;  5JCO A;  5J2T B;  4BT4 A;  3IR9 A;  2PHN A;  2MQE A;  4BY9 D;  4X20 B;  2BTO A;  3BYQ A;  2H8E A;  2KTV A;  5JH7 B;  3E22 B;  5CA0 B;  3F6M A;  5C8Y B;  3G71 F;  2FGY A;  2ZF8 A;  1IV3 A;  5HWE A;  5LXT A;  2F9Z C;  4TUY A;  1YJ9 F;  1U40 A;  1Q7Y H;  3CC4 F;  4O2A A;  1Q86 H;  5IJ0 B;  3CPW F;  1DBF A;  3JAM M;  1SA0 B;  3HAX D;  5BMV B;  5LP6 C;  5GAN K;  1W55 A;  3E20 B;  3HKD A;  4I4T A;  3NVK E;  1VQL F;  4G4X A;  4EI9 A;  3WJR A;  4ZHY B;  5J2U B;  3CCL F;  3G4S F;  1CK2 A;  4NUT A;  4YJ3 A;  3VTI C;  5CB4 B;  3AGK A;  2Z01 A;  2LBX A;  1YJW F;  4BT5 A;  4BT6 A;  3I56 F;  3WGJ A;  1U3P A;  2EWC A;  5GIO C;  5HP8 A;  3FFM A;  3WGN A;  5KX5 A;  4ZHW A;  5GIP C;  3VYT C;  4BT3 A;  3N4Z A;  5EZY B;  5IJ9 A;  2KGW A;  1W5A A;  2DYY A;  1JFF A;  3HKC B;  2N48 A;  3N2G A;  3CC2 F;  5CA1 B;  1YQN A;  2UYJ A;  3D00 A;  1W41 A;  3VOB A;  4X1K B;  4BT7 A;  4DRX B;  1IV4 A;  3ON1 A;  4G4V A;  5MN6 A;  3IKE A;  2QA4 F;  1FSZ A;  5ITZ A;  3VOA A;  3ZP7 A;  5HY0 A;  2BTU A;  2Q1Y A;  2HS0 A;  1UI9 A;  4TV9 A;  3RA6 A;  3TD3 A;  1SDS A;  3P10 A;  3F0G A;  4IHJ A;  3JAK B;  1FFX B;  3O85 A;  1RLG A;  4I55 B;  4B62 A;  1XV2 A;  1FNJ A;  1GO1 A;  4NWO B;  3LWR C;  1W42 A;  5LYJ B;  1RLU A;  4BVS A;  2ALE A;  4B5C A;  3OW2 F;  5JCO C;  1X25 A;  2CVL A;  4X1I B;  3IEQ A;  2IQQ A;  5G4U C;  4BW0 B;  3ZP4 A;  1YJN F;  5KMG B;  1VQ5 F;  2VAM A;  1X52 A;  3C9S A;  5LP6 B;  3V7Q A;  2AIZ P;  2GVI A;  2HP0 A;  4ZHQ B;  5HXZ A;  3CYQ A;  1RA4 A;  4O4J A;  4WBN A;  3JAW B;  1JJ2 F;  3CCR F;  4LNU A;  2ZOD A;  3F0D A;  5LOV A;  1GX1 A;  1M90 H;  4U3J A;  1N8R H;  4NQ3 A;  3KJK A;  1TUB A;  5EB1 B;  3VCZ A;  4IIJ B;  5FNV A;  5EYP A;  2UYN A;  3CMA F;  4G4Z A;  4O2B B;  4HNA A;  3NK6 A;  4ZOL B;  4ZI7 B;  3S03 A;  3OBW A;  5J2T A;  3MCA B;  4C4W C;  3I7T A;  3RYF B;  2UYK A;  4X20 A;  5GON B;  5HY1 A;  3GTZ A;  3M1X A;  2OHW A;  5JH7 A;  3FBA A;  3V3T A;  3E22 A;  2IG8 A;  5CA0 A;  3KIZ A;  1SZQ A;  2YYE A;  5C8Y A;  1QD9 A;  3LWO C;  3WGK A;  2Z1T A;  4O4H B;  5B8F A;  4O4L B;  3VIU A;  1VQN F;  3CYP B;  5IJ0 A;  4E6E A;  1W5F A;  1R1M A;  2P6Y A;  1SA0 A;  4F6R B;  5BMV A;  5LA6 A;  3NVI B;  3P4E A;  4O4I B;  3CCM F;  1ONI A;  2GZL A;  3CC7 F;  5HY4 A;  5J2U A;  1KC8 H;  1ZWZ A;  2H6L A;  1COM A;  1DT9 A;  3PAF A;  5G4V C;  3JAL B;  2CSL A;  4G4W A;  5CB4 A;  3IKF A;  4ERH A;  3CME F;  2CHS A;  2ZAU A;  1JN1 A;  1M1K H;  5GAP K;  4I50 B;  4ZHV A;  2L26 A;  3LYB A;  3CCV F;  3ELC A;  3N4Y A;  4M8I A;  1KD1 H;  2QTP A;  3QTY A;  1Z5V A;  3LWV C;  3KJJ A;  5IYZ B;  1VHA A;  3S06 A;  3NK7 A;  1U3L A;  5LXT B;  5EZY A;  1GZ0 A;  4FFB A;  3OBY A;  2Z1U A;  4BVR A;  3HKC A;  1J7H A;  3M4S A;  4RQO A;  1IPA A;  3K0T A;  3MQW A;  3NMU C;  2CWJ A;  1OAP A;  5CA1 A;  4KWE A;  2R75 1;  2I6D A;  2R6R 1;  4X1K A;  3HTN A;  2Q1X A;  3QHD A;  2YXZ A;  3QUW A;  1W5B A;  4C81 A;  3OON A;  3RYC B;  4TZZ A;  3HKE B;  5HP7 A;  3WXM B;  3WPW A;  2I6R A;  3SIU A;  2H8C A;  3MBM A;  3JAK A;  1FFX A;  5EWR A;  4X1Y B;  3K14 A;  3EOR A;  4I55 A;  2ZOV A;  1QVF F;  4YJ2 B;  3JAT B;  2HRU A;  3C9U A;  5IT9 M;  5LYJ A;  4C8G A;  3ERN A;  3VO8 A;  1OFU A;  4EI8 A;  2K1S A;  1VQP F;  1VQ4 F;  4X1I A;  3F0E A;  4ZK7 A;  1YHQ F;  4B45 A;  2WAL A;  3N2G B;  3RYH A;  2VAP A;  5KMG A;  3ZO8 A;  3LWP C;  3IEW A;  3JAR B;  3RYI B;  3WGL A;  3S0W A;  5LP6 A;  1VQM F;  2BTQ B;  4BT2 A;  3FPI A;  3P0Z A;  4ZHQ A;  2OTM A;  4TV8 B;  5EB0 A;  1TVK B;  3JAW A;  3LDT A;  3HJW C;  2LBT A;  3V4D A;  3T80 A;  1VQK F;  1K73 H;  2ZVZ A;  3JCM M;  5HXU A;  1VQ8 F;  3CCQ F;  3S02 A;  3JAS B;  3WPX A;  1VQO F;  5FLX M;  1PF5 A;  1VQ9 F;  4C8I A;  1QVG F;  4IIJ A;  2HX0 A;  4O2B A;  3LFO A;  4ZOL A;  4ZI7 A;  1JD1 A;  4X3L A;  4R40 B;  4DXD A;  3CCE F;  3HKB B;  3RYF A;  2PMP A;  5GON A;  1U43 A;  4G4Y A;  1W3E X;  4PWT A;  2HQS C;  2GLZ A;  5EIB D;  3I3F A;  2DT4 A;  3VYU C;  3J80 M;  2KG4 A;  3S0Y A;  1Q81 H;  4LCK A;  4O4J B;  5JVD B;  1ODE A;  4O4H A;  3N2K B;  5GIN C;  3D01 A;  2OZB A;  5JQG B;  2CHT A;  2KTU A;  1W58 1;  4EB6 B;  4F6R A;  3IMP A;  1VQ6 F;  4O4I A;  1TUB B;  3V7E A;  1IV2 A;  2UYN B;  1VQV A;  2B33 A;  3JAL A;  4B46 A;  5EAZ A;  3CPQ A;  1W57 A;  4I50 A;  1W40 A;  3WGM A;  4RHA A;  1KNK A;  3UT5 B;  2RHL A;  2VAW A;  1T0A A;  3I55 F;  3SIV A;  3RE3 A;  5IYZ A;  3ESJ A;  4XCQ A;  1T0K B;  3CG6 A;  1CN7 A;  3LME A;  5EIB C;  1Z5W A;  5AVM A;  2Z1F A;  3J81 M;  3K12 A;  3WJP A;  2LCA A;  3L7Q A;  1XRG A;  2JNB A;  4TUY B;  5LA6 B;  4O2A B;  4G88 A;  2QEX F;  2BO1 A;  3B6N A;  3VI6 A;  2G9I A;  3MDO A;  3RYC A;  3HKD B;  1H47 A;  2CZW A;  1NMU B;  1Q8R A;  3HKE A;  4I4T B;  4U39 A;  3S0H A;  3TD4 A;  4DRX A;  3LWQ C;  2NMU A;  3KE1 A;  3GYQ A;  3CCS F;  3FD6 A;  2V9Y A;  2AMT A;  1GO0 A;  3F0F A;  4YJ3 B;  2FC3 A;  3ZOP A;  4X1Y A;  1K9M H;  2VXY A;  1KQS F;  1VK3 A;  3PLA C;  4YJ2 A;  3JAT A;  1KNJ A;  1VH8 A;  3FD5 A;  3U0O A;  4BVQ A;  2HP3 A;  4BVT A;  4FFB B;  3C9R A;  2HS4 A;  5KX5 B;  3WJQ A;  2HVY D;  1VQ7 F;  3K2X A; 
#chains in the Genus database with same CATH homology
 2OHW A;  3CCQ F;  1Q82 H;  3CCL F;  3G4S F;  3V3T A;  1CK2 A;  1VQO F;  5FLX M;  1VQ9 F;  2AIF A;  4NUT A;  1QVG F;  3LWO C;  5FJ4 C;  3AGK A;  2LBW A;  2LBX A;  1YJW F;  3I56 F;  1VQN F;  3LFO A;  1X7P A;  1H7M A;  5GIO C;  4X3L A;  3CCE F;  3FFM A;  3NVI B;  3CCJ F;  3VMF B;  1W3E X;  2GLZ A;  3CCM F;  3CC7 F;  5GIP C;  5HY4 A;  1KC8 H;  1ZWZ A;  3N4Z A;  1DT9 A;  3PAF A;  5G4V C;  2OTL F;  3J80 M;  3CXC F;  2KG4 A;  1Q81 H;  4LCK A;  1PXW A;  3CME F;  2OTJ F;  3CC2 F;  1X7O A;  1M1K H;  5EO3 A;  5GIN C;  5GAP K;  2OZB A;  3D00 A;  1W41 A;  3CCV F;  2VGN A;  3N4Y A;  1S72 F;  3ON1 A;  2KTU A;  1KD1 H;  4X3M A;  2QA4 F;  1VQ6 F;  3LWV C;  3V7E A;  3NK7 A;  5HY0 A;  3CCU F;  1K8A H;  3RA6 A;  1YIT F;  1GZ0 A;  1SDS A;  3OBY A;  4BVR A;  5DCV A;  1IPA A;  3CPQ A;  1YIJ F;  3NMU C;  3O85 A;  1RLG A;  5HY2 A;  2VGM A;  1GO1 A;  2I6D A;  1W40 A;  3LWR C;  1E7K A;  1W42 A;  1W2B F;  4BVS A;  2ALE A;  3G6E F;  3OW2 F;  4EI7 A;  1YI2 F;  3I55 F;  3SIV A;  4TZZ A;  5G4U C;  4BW0 B;  3CD6 F;  4XCQ A;  1T0K B;  1XBI A;  3CG6 A;  3E1Y A;  3WXM B;  1YJN F;  1CN7 A;  1VQ5 F;  3SIU A;  2QI2 A;  5A2Q M;  1X52 A;  3J81 M;  1NJI H;  5EWR A;  3RA5 A;  5HXU A;  2JNB A;  3V7Q A;  1QVF F;  5HXZ A;  5IT9 M;  1RA4 A;  3J7A R;  2QEX F;  2BO1 A;  3IR9 A;  3VI6 A;  4EI8 A;  1VQP F;  1JJ2 F;  3CCR F;  1VQ4 F;  4BY9 D;  2CZW A;  1NMU B;  3LWQ C;  1YHQ F;  2WAL A;  1VQ8 F;  2KTV A;  3LWP C;  1M90 H;  3GYQ A;  3CCS F;  1N8R H;  4NQ3 A;  1GO0 A;  3G71 F;  2FC3 A;  2FGY A;  1K9M H;  5HWE A;  1VQM F;  2F9Z C;  3CMA F;  1KQS F;  1YJ9 F;  3PLA C;  1Q7Y H;  3CC4 F;  1Q86 H;  3NK6 A;  3CPW F;  4BVQ A;  3JAM M;  3OBW A;  3MCA B;  4C4W C;  4BVT A;  3HAX D;  3HJW C;  5GAN K;  3E20 B;  1VQK F;  1K73 H;  1VQL F;  3NVK E;  5HY1 A;  2HVY D;  3JCM M;  1VQ7 F;  4EI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...