4ERHA

The crystal structure of ompa domain of ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein A
publication title The crystal structure of OmpA domain of OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Membrane protein
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4erhA00
4R40B 4G4WA 2LBTA 4B5CA 2ZVZA 4G88A 3TD5A 4ZHVA 3S02A 3S03A 5EAZA 1OAPA 2K1SA 2N48A 2LCAA 3CYQA 2AIZP 5EB1B 4ZHYB 4PWTA 2ZF8A 2HQSC 3TD4A 1R1MA 3IMPA 3OONA 4G4ZA 4B62A 2L26A 4G4XA 4G4VA 4RHAA 3CYPB 2ZOVA 3WPXA 3LDTA 4ZHWA 3S0YA 2ZVYA 4G4YA 3S0HA 3S06A 3S0WA 2KGWA 5EB0A 3WPWA 2MQEA 3TD3A 3KHNA 2W8BC 4ERHA
chains in the Genus database with same CATH superfamily
1M90H 3JARA 3GHZA 3RYHA 1E7KA 2Z1TA 1H47A 5GANK 1QD9A 5HY2A 2HVYD 1RQ2A 2G9IA 2OHWA 4O2BA 3RYFB 2UYJA 1PF5A 3HKCA 4G4XA 3N4ZA 4BVQA 4X1KB 4X20A 5CB4A 5GIOC 5A2QM 1X52A 3K14A 1QVGF 2W8BC 3RYCB 5EIBD 2P6YA 3VOAA 3SIUA 2DYYA 2I6DA 5HP8A 1KQSF 4X1IB 3KE1A 3CCEF 4WBNB 3TD5A 1CK2A 3JASB 2UYNA 4C81A 4IIJB 2UYKA 5BMVB 2QI2A 5EB1B 3E22A 4ZI7A 4C82A 2HS3A 5EO3A 4RQOA 1TVKB 5G4VC 3LWOC 5GONB 1SA0B 1VQNF 2HRYA 2AMTA 4O4JA 3S0WA 3CXCF 4YJ2B 1OFUA 4O4IB 5LYJB 3F0DA 2HX0A 3M4SA 5JVDB 5J2UA 2MQEA 3IEWA 3LYBA 2FC3A 2CSLA 3CCVF 1W5AA 4TV9A 4G4WA 3CCQF 1ODEA 4TV8B 4EB6B 4KWEA 3JAWA 2RHOA 3JATB 5KMGB 1H7MA 3NK7A 3RA6A 2YYEA 3V3TA 5IYZA 3KJKA 2B33A 3CD6F 1IV2A 1X7OA 1U40A 3CMEF 4O4HA 3VI6A 4BT4A 1Q8RA 2GVIA 2UYPA 1TUBB 3ZP4A 3TD3A 3N2GB 5LP6A 2VAMA 3HKDB 4O4LB 4R40B 2HP3A 3K2XA 3C9RA 3WJQA 4BVRA 3VTIC 3JARB 3RYHB 5ITZA 3HWUA 1XV2A 1GO1A 5G4UC 3VO8A 3VYUC 4ZK7A 1YITF 4O2BB 3B6NA 1Z5VA 3FFMA 2HS4A 3WJPA 3HKCB 1Q82H 3EORA 1FSZA 4X20B 5CB4B 3JAKA 1T0KB 5C8YA 3CYQA 2H8CA 2OTJF 2KTUA 2F9ZC 1KNKA 4F6RA 3C9UA 2LBTA 5JCOA 1YGYA 2BTOA 3LWQC 1Q81H 4HNAA 4X3MA 2UYNB 3MBMA 5B8FA 4C8IA 4BT5A 4ZI7B 3E22B 1K9MH 3VMFB 5J2TA 3UT5A 1GX1A 3S0YA 3S0HA 3VOBA 4O4JB 4I4TA 4E6EA 1W2BF 3C9TA 1XBIA 3KHNA 2HRUA 1RLGA 3LWVC 1RQ7A 5J2UB 2IQQA 4FFBA 2IG8A 3L7QA 5LP6C 5MN6A 4TV9B 5KX5A 3DDNA 3QTYA 3OW2F 3CC7F 1S72F 4I55A 3J80M 3JAWB 1FFXA 5LA6A 5HXUA 4TUYA 5GAPK 3ESJA 5IYZB 2BTQB 3JAMM 2RHHA 3NVKE 4U3JA 1JFFA 2QTPA 1YHQF 4G4YA 3Q8HA 2KTVA 4O4HB 3IKFA 1DT9A 1W55A 1YIJF 4X1YA 4BT6A 5HY1A 2GZLA 5LP6B 2YXZA 3J81M 1W42A 5JCOC 1UFYA 3IKEA 2KG4A 1GO0A 2AIZP 2HQSC 5JH7A 3P10A 1M1KH 3ZO8A 5ITZB 2QA4F 2JNBA 3N4YA 3R0PA 3LWRC 3ELCA 3CYPB 1VQKF 2CWJA 3GYQA 5JQGA 2EWCA 1SDSA 4ERHA 4U39A 3JAKB 5C8YB 1U3LA 3IR9A 1DBFA 2OTMA 4F6RB 1JY8A 4ZHVA 2FGYA 1YJ9F 3S03A 4ZOLA 4ZHQA 4PWTA 3HKEA 2R751 5LOVA 3LMEA 5FJ4C 4HNAB 3FD6A 3WGKA 3HAXD 5J2TB 3S06A 3UT5B 1IV3A 2ALEA 3FBAA 1U43A 4I4TB 2OZBA 3F0GA 4YJ3A 5GINC 1J7HA 1YJWF 3CPQA 1K8AH 4BVSA 1PXWA 3RYIA 4FFBB 4DRXA 4O2AA 2Z1EA 5EAZA 1COMA 1OAPA 3RYFA 4C8GA 1N8RH 1FNKA 1IV1A 2ZODA 5KX5B 1IV4A 3VYSC 5CA1A 1VQ4F 4B62A 1CN7A 3M1XA 2IAFA 4I55B 4LNUA 5DCVA 5EYPA 3WGNA 4RHAA 1FFXB 5LA6B 1VQ5F 4TUYB 2CHTA 2RHJA 1W581 2HP0A 5EZYA 4U3JB 3C8LA 1JFFB 2KGWA 3WXMB 1W5EA 3WPWA 3F0EA 2I6RA 1NMUB 3JALA 1Z5WA 4X1YB 2ZVZA 1IPAA 3CCMF 5LXTA 1W5FA 2N48A 2PHNA 3E20B 3CPWF 1GZ0A 2ZF8A 3N2KA 1Q7YH 1VQLF 3TD4A 1W40A 3HKBA 5MN5A 4LCKA 2Q1YA 5JH7B 3WGMA 1VQOF 4YJ2A 4M8IA 2H8EA 3C9SA 2AIFA 3BYQA 3LDTA 5HWEA 1VQPF 1UI9A 4ZHWA 2UZHA 4NUTA 5CA0A 4TZZA 5IJ0A 3WGLA 2CW4A 5JQGB 5MN4A 4B46A 2HS0A 1H48A 1X25A 1RA4A 4I50A 1CLIA 5EWRA 2VXYA 5GIPC 2OTLF 3MDOA 3CCUF 4BT2A 5IT9M 3D01A 2VAWA 4ZOLB 2PMPA 3LWPC 2BO1A 4ZHQB 3P0ZA 3HKEB 3M84A 5LOVB 3ERNA 3T80A 3G6EF 3CMAF 5FNVA 1YQNA 3DC2A 1KD1H 3FD5A 2Z1UA 3O85A 4C8EA 3QHDA 1YJNF 1NJIH 1JD1A 4BT7A 5HXZA 3LFOA 3ZP7A 3I7TA 4EI7A 4YJ3B 3JCMM 3G4SF 1K73H 2VGMA 2RB9A 4BT3A 3RYIB 3ZOPA 4O2AB 4DRXB 4BVTA 4EI9A 3CCJF 3U0OA 4EI8A 1W5BA 3RA5A 4G4VA 3WPXA 5CA1B 2ZOVA 3MQWA 1XRGA 4LNUB 3MCQA 5EYPB 3SIVA 3V7QA 3V7EA 5EB0A 2HP0B 5EZYB 2QEXF 4BW0B 5IJ9A 1T0AA 1QAHA 3CG6A 4G88A 3K12A 3HJWC 1X7PA 3JALB 2CHSA 1YI2F 2BTUA 2K1SA 5HY0A 3ON1A 3GTZA 4DXDA 2Q1XA 1R1MA 5LXTB 3F6MA 2VAPA 4G4ZA 3N2KB 3HTNA 3NK6A 3HKBB 3CC4F 3NMUC 4NQ3A 3QUWA 3D00A 4IHJA 3VYTC 2LBXA 1JJ2F 3CCRF 5FLXM 1W57A 3I55F 2CZWA 3RE3A 5CA0B 1FNJA 5IJ0B 3MCAB 3G71F 4B5CA 2Z1FA 1RLUA 1QVFF 3KIZA 1VHAA 2LCAA 3I56F 2Z01A 1VQ7F 3PAFA 4I50B 3J7AR 1W59A 3IMPA 3KJJA 1VH8A 3OONA 4X1KA 1XHOA 3JVHA 2ZVYA 4NWOB 3WGJA 3RYCA 4XCQA 3PLAC 4B45A 5FNVB 1JN1A 1SZQA 4X1IA 1ONIA 4WBNA 1VQMF 3JASA 4IIJA 3CB2A 1Q86H 5BMVA 3NVIB 3F0FA 5HY4A 4ZHYB 1TVKA 1KC8H 5GONA 1SA0A 1QU9A 1ZWZA 3IEQA 3WJRA 1VQ6F 3OBWA 1VK3A 3K0TA 4O4IA 3AGKA 3E1YA 5LYJA 2DT4A 5JVDA 1VQ8F 4BY9D 3I3FA 3FPIA 3V4DA 2RHLA 3OBYA 1W3EX 3CCSF 4TV8A 1U3PA 2V9YA 4EB6A 2ZAUA 2GLZA 5IJ9B 4X3LA 3JATA 5KMGA 2H6LA 2VGNA 3S02A 5HP7A 1VQVA 3P4EA 2NMUA 2WALA 5AVMA 3CC2F 3VCZA 2L26A 2R6R1 3CCLF 1KNJA 1W41A 2CVLA 1TUBA 3D54A 3N2GA 4IHJB 5EIBC 4C4WC 3HKDA 4O4LA 3VIUA 1VQ9F 1NQ3A 2LBWA
chains in the Genus database with same CATH topology
4R40B 4G4WA 2LBTA 4B5CA 2ZVZA 4G88A 3TD5A 4ZHVA 3S02A 3S03A 5EAZA 1OAPA 2K1SA 2N48A 2LCAA 3CYQA 2AIZP 5EB1B 4ZHYB 4PWTA 2ZF8A 2HQSC 3TD4A 1R1MA 3IMPA 3OONA 4G4ZA 4B62A 2L26A 4G4XA 4G4VA 4RHAA 3CYPB 2ZOVA 3WPXA 3LDTA 4ZHWA 3S0YA 2ZVYA 4G4YA 3S0HA 3S06A 3S0WA 2KGWA 5EB0A 3WPWA 2MQEA 3TD3A 3KHNA 2W8BC 4ERHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R40 B;  4G4W A;  2LBT A;  4B5C A;  2ZVZ A;  4G88 A;  3TD5 A;  4ZHV A;  3S02 A;  3S03 A;  5EAZ A;  1OAP A;  2K1S A;  2N48 A;  2LCA A;  3CYQ A;  2AIZ P;  5EB1 B;  4ZHY B;  4PWT A;  2ZF8 A;  2HQS C;  3TD4 A;  1R1M A;  3IMP A;  3OON A;  4G4Z A;  4B62 A;  2L26 A;  4G4X A;  4G4V A;  4RHA A;  3CYP B;  2ZOV A;  3WPX A;  3LDT A;  4ZHW A;  3S0Y A;  2ZVY A;  4G4Y A;  3S0H A;  3S06 A;  3S0W A;  2KGW A;  5EB0 A;  3WPW A;  2MQE A;  3TD3 A;  3KHN A;  2W8B C;  4ERH A; 
#chains in the Genus database with same CATH topology
 1M90 H;  3JAR A;  3GHZ A;  3RYH A;  1E7K A;  2Z1T A;  1H47 A;  5GAN K;  1QD9 A;  5HY2 A;  2HVY D;  1RQ2 A;  2G9I A;  2OHW A;  4O2B A;  3RYF B;  2UYJ A;  1PF5 A;  3HKC A;  4G4X A;  3N4Z A;  4BVQ A;  4X1K B;  4X20 A;  5CB4 A;  5GIO C;  5A2Q M;  1X52 A;  3K14 A;  1QVG F;  2W8B C;  3RYC B;  5EIB D;  2P6Y A;  3VOA A;  3SIU A;  2DYY A;  2I6D A;  5HP8 A;  1KQS F;  4X1I B;  3KE1 A;  3CCE F;  4WBN B;  3TD5 A;  1CK2 A;  3JAS B;  2UYN A;  4C81 A;  4IIJ B;  2UYK A;  5BMV B;  2QI2 A;  5EB1 B;  3E22 A;  4ZI7 A;  4C82 A;  2HS3 A;  5EO3 A;  4RQO A;  1TVK B;  5G4V C;  3LWO C;  5GON B;  1SA0 B;  1VQN F;  2HRY A;  2AMT A;  4O4J A;  3S0W A;  3CXC F;  4YJ2 B;  1OFU A;  4O4I B;  5LYJ B;  3F0D A;  2HX0 A;  3M4S A;  5JVD B;  5J2U A;  2MQE A;  3IEW A;  3LYB A;  2FC3 A;  2CSL A;  3CCV F;  1W5A A;  4TV9 A;  4G4W A;  3CCQ F;  1ODE A;  4TV8 B;  4EB6 B;  4KWE A;  3JAW A;  2RHO A;  3JAT B;  5KMG B;  1H7M A;  3NK7 A;  3RA6 A;  2YYE A;  3V3T A;  5IYZ A;  3KJK A;  2B33 A;  3CD6 F;  1IV2 A;  1X7O A;  1U40 A;  3CME F;  4O4H A;  3VI6 A;  4BT4 A;  1Q8R A;  2GVI A;  2UYP A;  1TUB B;  3ZP4 A;  3TD3 A;  3N2G B;  5LP6 A;  2VAM A;  3HKD B;  4O4L B;  4R40 B;  2HP3 A;  3K2X A;  3C9R A;  3WJQ A;  4BVR A;  3VTI C;  3JAR B;  3RYH B;  5ITZ A;  3HWU A;  1XV2 A;  1GO1 A;  5G4U C;  3VO8 A;  3VYU C;  4ZK7 A;  1YIT F;  4O2B B;  3B6N A;  1Z5V A;  3FFM A;  2HS4 A;  3WJP A;  3HKC B;  1Q82 H;  3EOR A;  1FSZ A;  4X20 B;  5CB4 B;  3JAK A;  1T0K B;  5C8Y A;  3CYQ A;  2H8C A;  2OTJ F;  2KTU A;  2F9Z C;  1KNK A;  4F6R A;  3C9U A;  2LBT A;  5JCO A;  1YGY A;  2BTO A;  3LWQ C;  1Q81 H;  4HNA A;  4X3M A;  2UYN B;  3MBM A;  5B8F A;  4C8I A;  4BT5 A;  4ZI7 B;  3E22 B;  1K9M H;  3VMF B;  5J2T A;  3UT5 A;  1GX1 A;  3S0Y A;  3S0H A;  3VOB A;  4O4J B;  4I4T A;  4E6E A;  1W2B F;  3C9T A;  1XBI A;  3KHN A;  2HRU A;  1RLG A;  3LWV C;  1RQ7 A;  5J2U B;  2IQQ A;  4FFB A;  2IG8 A;  3L7Q A;  5LP6 C;  5MN6 A;  4TV9 B;  5KX5 A;  3DDN A;  3QTY A;  3OW2 F;  3CC7 F;  1S72 F;  4I55 A;  3J80 M;  3JAW B;  1FFX A;  5LA6 A;  5HXU A;  4TUY A;  5GAP K;  3ESJ A;  5IYZ B;  2BTQ B;  3JAM M;  2RHH A;  3NVK E;  4U3J A;  1JFF A;  2QTP A;  1YHQ F;  4G4Y A;  3Q8H A;  2KTV A;  4O4H B;  3IKF A;  1DT9 A;  1W55 A;  1YIJ F;  4X1Y A;  4BT6 A;  5HY1 A;  2GZL A;  5LP6 B;  2YXZ A;  3J81 M;  1W42 A;  5JCO C;  1UFY A;  3IKE A;  2KG4 A;  1GO0 A;  2AIZ P;  2HQS C;  5JH7 A;  3P10 A;  1M1K H;  3ZO8 A;  5ITZ B;  2QA4 F;  2JNB A;  3N4Y A;  3R0P A;  3LWR C;  3ELC A;  3CYP B;  1VQK F;  2CWJ A;  3GYQ A;  5JQG A;  2EWC A;  1SDS A;  4ERH A;  4U39 A;  3JAK B;  5C8Y B;  1U3L A;  3IR9 A;  1DBF A;  2OTM A;  4F6R B;  1JY8 A;  4ZHV A;  2FGY A;  1YJ9 F;  3S03 A;  4ZOL A;  4ZHQ A;  4PWT A;  3HKE A;  2R75 1;  5LOV A;  3LME A;  5FJ4 C;  4HNA B;  3FD6 A;  3WGK A;  3HAX D;  5J2T B;  3S06 A;  3UT5 B;  1IV3 A;  2ALE A;  3FBA A;  1U43 A;  4I4T B;  2OZB A;  3F0G A;  4YJ3 A;  5GIN C;  1J7H A;  1YJW F;  3CPQ A;  1K8A H;  4BVS A;  1PXW A;  3RYI A;  4FFB B;  4DRX A;  4O2A A;  2Z1E A;  5EAZ A;  1COM A;  1OAP A;  3RYF A;  4C8G A;  1N8R H;  1FNK A;  1IV1 A;  2ZOD A;  5KX5 B;  1IV4 A;  3VYS C;  5CA1 A;  1VQ4 F;  4B62 A;  1CN7 A;  3M1X A;  2IAF A;  4I55 B;  4LNU A;  5DCV A;  5EYP A;  3WGN A;  4RHA A;  1FFX B;  5LA6 B;  1VQ5 F;  4TUY B;  2CHT A;  2RHJ A;  1W58 1;  2HP0 A;  5EZY A;  4U3J B;  3C8L A;  1JFF B;  2KGW A;  3WXM B;  1W5E A;  3WPW A;  3F0E A;  2I6R A;  1NMU B;  3JAL A;  1Z5W A;  4X1Y B;  2ZVZ A;  1IPA A;  3CCM F;  5LXT A;  1W5F A;  2N48 A;  2PHN A;  3E20 B;  3CPW F;  1GZ0 A;  2ZF8 A;  3N2K A;  1Q7Y H;  1VQL F;  3TD4 A;  1W40 A;  3HKB A;  5MN5 A;  4LCK A;  2Q1Y A;  5JH7 B;  3WGM A;  1VQO F;  4YJ2 A;  4M8I A;  2H8E A;  3C9S A;  2AIF A;  3BYQ A;  3LDT A;  5HWE A;  1VQP F;  1UI9 A;  4ZHW A;  2UZH A;  4NUT A;  5CA0 A;  4TZZ A;  5IJ0 A;  3WGL A;  2CW4 A;  5JQG B;  5MN4 A;  4B46 A;  2HS0 A;  1H48 A;  1X25 A;  1RA4 A;  4I50 A;  1CLI A;  5EWR A;  2VXY A;  5GIP C;  2OTL F;  3MDO A;  3CCU F;  4BT2 A;  5IT9 M;  3D01 A;  2VAW A;  4ZOL B;  2PMP A;  3LWP C;  2BO1 A;  4ZHQ B;  3P0Z A;  3HKE B;  3M84 A;  5LOV B;  3ERN A;  3T80 A;  3G6E F;  3CMA F;  5FNV A;  1YQN A;  3DC2 A;  1KD1 H;  3FD5 A;  2Z1U A;  3O85 A;  4C8E A;  3QHD A;  1YJN F;  1NJI H;  1JD1 A;  4BT7 A;  5HXZ A;  3LFO A;  3ZP7 A;  3I7T A;  4EI7 A;  4YJ3 B;  3JCM M;  3G4S F;  1K73 H;  2VGM A;  2RB9 A;  4BT3 A;  3RYI B;  3ZOP A;  4O2A B;  4DRX B;  4BVT A;  4EI9 A;  3CCJ F;  3U0O A;  4EI8 A;  1W5B A;  3RA5 A;  4G4V A;  3WPX A;  5CA1 B;  2ZOV A;  3MQW A;  1XRG A;  4LNU B;  3MCQ A;  5EYP B;  3SIV A;  3V7Q A;  3V7E A;  5EB0 A;  2HP0 B;  5EZY B;  2QEX F;  4BW0 B;  5IJ9 A;  1T0A A;  1QAH A;  3CG6 A;  4G88 A;  3K12 A;  3HJW C;  1X7P A;  3JAL B;  2CHS A;  1YI2 F;  2BTU A;  2K1S A;  5HY0 A;  3ON1 A;  3GTZ A;  4DXD A;  2Q1X A;  1R1M A;  5LXT B;  3F6M A;  2VAP A;  4G4Z A;  3N2K B;  3HTN A;  3NK6 A;  3HKB B;  3CC4 F;  3NMU C;  4NQ3 A;  3QUW A;  3D00 A;  4IHJ A;  3VYT C;  2LBX A;  1JJ2 F;  3CCR F;  5FLX M;  1W57 A;  3I55 F;  2CZW A;  3RE3 A;  5CA0 B;  1FNJ A;  5IJ0 B;  3MCA B;  3G71 F;  4B5C A;  2Z1F A;  1RLU A;  1QVF F;  3KIZ A;  1VHA A;  2LCA A;  3I56 F;  2Z01 A;  1VQ7 F;  3PAF A;  4I50 B;  3J7A R;  1W59 A;  3IMP A;  3KJJ A;  1VH8 A;  3OON A;  4X1K A;  1XHO A;  3JVH A;  2ZVY A;  4NWO B;  3WGJ A;  3RYC A;  4XCQ A;  3PLA C;  4B45 A;  5FNV B;  1JN1 A;  1SZQ A;  4X1I A;  1ONI A;  4WBN A;  1VQM F;  3JAS A;  4IIJ A;  3CB2 A;  1Q86 H;  5BMV A;  3NVI B;  3F0F A;  5HY4 A;  4ZHY B;  1TVK A;  1KC8 H;  5GON A;  1SA0 A;  1QU9 A;  1ZWZ A;  3IEQ A;  3WJR A;  1VQ6 F;  3OBW A;  1VK3 A;  3K0T A;  4O4I A;  3AGK A;  3E1Y A;  5LYJ A;  2DT4 A;  5JVD A;  1VQ8 F;  4BY9 D;  3I3F A;  3FPI A;  3V4D A;  2RHL A;  3OBY A;  1W3E X;  3CCS F;  4TV8 A;  1U3P A;  2V9Y A;  4EB6 A;  2ZAU A;  2GLZ A;  5IJ9 B;  4X3L A;  3JAT A;  5KMG A;  2H6L A;  2VGN A;  3S02 A;  5HP7 A;  1VQV A;  3P4E A;  2NMU A;  2WAL A;  5AVM A;  3CC2 F;  3VCZ A;  2L26 A;  2R6R 1;  3CCL F;  1KNJ A;  1W41 A;  2CVL A;  1TUB A;  3D54 A;  3N2G A;  4IHJ B;  5EIB C;  4C4W C;  3HKD A;  4O4L A;  3VIU A;  1VQ9 F;  1NQ3 A;  2LBW A; 
#chains in the Genus database with same CATH homology
 4R40 B;  4G4W A;  2LBT A;  4B5C A;  2ZVZ A;  4G88 A;  3TD5 A;  4ZHV A;  3S02 A;  3S03 A;  5EAZ A;  1OAP A;  2K1S A;  2N48 A;  2LCA A;  3CYQ A;  2AIZ P;  5EB1 B;  4ZHY B;  4PWT A;  2ZF8 A;  2HQS C;  3TD4 A;  1R1M A;  3IMP A;  3OON A;  4G4Z A;  4B62 A;  2L26 A;  4G4X A;  4G4V A;  4RHA A;  3CYP B;  2ZOV A;  3WPX A;  3LDT A;  4ZHW A;  3S0Y A;  2ZVY A;  4G4Y A;  3S0H A;  3S06 A;  3S0W A;  2KGW A;  5EB0 A;  3WPW A;  2MQE A;  3TD3 A;  3KHN A;  2W8B C;  4ERH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...