4ERHA

The crystal structure of ompa domain of ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Outer membrane protein A
publication title The crystal structure of OmpA domain of OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4erhA00
4G88A 4G4XA 3OONA 2ZOVA 4PWTA 4G4WA 4B5CA 5EAZA 4ERHA 4ZHWA 4ZHVA 2LCAA 4RHAA 2W8BC 2ZF8A 3TD4A 3S0HA 1OAPA 2K1SA 3IMPA 3TD5A 4ZHYB 1R1MA 3S03A 4B62A 2ZVZA 3WPWA 2N48A 2KGWA 4R40B 2MQEA 2L26A 4G4YA 3KHNA 3S02A 3TD3A 2ZVYA 2AIZP 2HQSC 2LBTA 3CYQA 3S0WA 3WPXA 3S06A 4G4VA 5EB1B 3S0YA 3LDTA 4G4ZA 5EB0A 3CYPB
chains in the Genus database with same CATH superfamily
3QHDA 1J7HA 2P6YA 1W40A 1VQOF 2R6R1 2HP0B 2AMTA 4DRXA 3KE1A 5IJ9B 5KX5A 3JATA 4WBNB 2UYNA 5GIOC 3JAKA 3VYTC 4DXDA 4ZHQB 2ALEA 3T80A 2R751 2H6LA 1VQPF 1VQ9F 4ZOLA 4E6EA 2BTOA 4I50B 4O4JB 1W42A 3IEQA 5JH7B 1TUBB 3K12A 2V9YA 4TV8A 3QTYA 1VK3A 3D54A 4TZZA 2CHSA 3HKDB 3MCQA 3CCUF 1Q7YH 3RYIA 3GHZA 5BMVA 2CSLA 3ERNA 3F0FA 2HRUA 4I4TB 4B5CA 2FC3A 5G4UC 3M84A 1FNJA 1FSZA 5FLXM 1YGYA 3JASA 3VO8A 1GO0A 3JARB 1FFXA 1R1MA 3RYFB 3HTNA 4HNAA 1VQKF 4M8IA 5CA1A 3S02A 3CCJF 1W3EX 5KMGA 3CMAF 1CK2A 4I55B 4O4HA 4G4VA 3CC4F 3PLAC 1RA4A 3LDTA 4O4LB 1S72F 2IAFA 4LCKA 1DBFA 3RYHB 3M1XA 1IV3A 3WGJA 3UT5A 4ERHA 3N2KA 1GX1A 2VGMA 3CG6A 3WGLA 1ODEA 4B46A 1IV1A 1Q86H 4O2BA 3AGKA 4C82A 5EIBD 3C9UA 3RA6A 2FGYA 3KHNA 5HP7A 1CLIA 3LWPC 1GO1A 2RHJA 5JQGB 1Z5WA 4X1KA 3F0GA 3HKBB 5J2UA 5FNVA 4EI7A 3S06A 5C8YB 3CPWF 3CYPB 3OBYA 4F6RA 5ITZA 1K73H 1N8RH 4NQ3A 4U39A 5IJ0B 1W55A 4BT6A 4C8EA 3JAWB 3R0PA 3I55F 5LP6C 3MBMA 3RYCA 3JAMM 1XRGA 1ZWZA 2ZVZA 5LYJB 1KC8H 5HXUA 5EYPB 4IIJB 3TD3A 2HQSC 4NWOB 3F6MA 2CHTA 4U3JB 4LNUB 3V4DA 2IQQA 4BVRA 2HP3A 3E22B 2LBWA 3DC2A 1IPAA 3ELCA 1VQMF 2GZLA 1XHOA 4NUTA 1K9MH 3K14A 4G4WA 2BTQB 5CB4B 1RLUA 1UI9A 1YQNA 4FFBA 3MQWA 4X1YA 5CA0A 5EZYB 3VOBA 1VQLF 3G4SF 1TVKB 3V3TA 4ZHYB 4ZI7B 2N48A 3F0DA 2Z01A 1W5AA 4ZK7A 3N4YA 4DRXB 1X25A 2I6RA 2OTJF 3G71F 3I7TA 5KX5B 3JATB 2GVIA 2UYNB 4G4ZA 5LA6A 1XV2A 3JAKB 3WXMB 1JJ2F 3IR9A 3N2GA 3RA5A 3MDOA 4TV9B 5EAZA 1YJWF 3KIZA 3HKCA 2G9IA 2LCAA 5LOVA 4TV8B 2VGNA 3Q8HA 4BT5A 1OFUA 3CCVF 5IYZA 3RYIB 5GONA 1W59A 1JY8A 2H8CA 3RE3A 5BMVB 1COMA 1U3LA 3JCMM 1U43A 1FFXB 3M4SA 3ZOPA 3CCQF 4HNAB 4YJ3A 3WGNA 5CA1B 3CC2F 4XCQA 2ZAUA 5HXZA 5KMGB 3LWOC 2RHOA 2Z1TA 3OW2F 3S03A 2Q1YA 1T0AA 5LXTA 1H47A 1YIJF 1QU9A 1IV2A 2OZBA 3UT5B 2OTMA 3N2KB 5DCVA 3CCRF 3HWUA 3K2XA 2H8EA 5EB0A 2GLZA 5HY1A 4O2BB 3NK6A 4G4XA 1K8AH 1QVFF 1DT9A 4PWTA 4KWEA 2ZODA 4BT2A 4X1KB 2UYJA 5EWRA 2ZF8A 5J2UB 3TD4A 3WJQA 3IMPA 3OBWA 2EWCA 5FNVB 3VYSC 2HS4A 2KGWA 4F6RB 5ITZB 5JVDA 2AIZP 3O85A 2Z1EA 1YJNF 1QAHA 1X7PA 1YHQF 3RYCB 1CN7A 4C8GA 2VXYA 1Q82H 2WALA 1W41A 3NK7A 1VQNF 2OTLF 4ZHVA 1X7OA 3EORA 5HY2A 2Z1FA 2IG8A 4X20A 3HJWC 4C81A 5MN4A 4IHJA 4TUYA 4R40B 3NVIB 3HKEA 4BT7A 1VQVA 2ZVYA 1U3PA 3VYUC 3VMFB 3BYQA 4FFBB 2PMPA 3C8LA 3C9SA 4X1IB 4X1YB 5CA0B 1KNKA 3S0YA 3WGMA 4G88A 3ZP7A 3NVKE 3J80M 2YXZA 1RQ2A 1KD1H 3QUWA 5JCOC 1YJ9F 3OONA 3FBAA 3L7QA 2BO1A 4EB6A 1M90H 3CB2A 3SIVA 2K1SA 5EO3A 4BT4A 3JALA 3LWQC 5IJ0A 4BW0B 3N2GB 2RHLA 3HKCB 2KG4A 5LOVB 3KJKA 3G6EF 1VQ6F 2LBXA 5IYZB 1JFFA 4O2AA 3JVHA 5GONB 2ZOVA 4ZOLB 1Z5VA 3LWVC 4BY9D 2HS0A 2PHNA 1U40A 4RHAA 3CXCF 3TD5A 3J7AR 3CCEF 1QD9A 4X3MA 1VQ8F 1SZQA 4O4IA 5B8FA 4YJ3B 2LBTA 1Q8RA 1Q81H 3PAFA 4YJ2A 5EZYA 1XBIA 3ESJA 3CCSF 2BTUA 5HY0A 5EB1B 3FD5A 3JASB 3IEWA 2CVLA 2RB9A 3FD6A 1UFYA 5LXTB 5J2TA 1SDSA 4C8IA 3I56F 3CCMF 3KJJA 5LP6A 3HAXD 3ON1A 5MN5A 2CWJA 2W8BC 3SIUA 1RQ7A 1SA0A 4O4HB 1M1KH 2B33A 5EIBC 3F0EA 2HP0A 2OHWA 4TV9A 5IJ9A 3S0WA 3IKEA 1VQ5F 4WBNA 2HX0A 1H7MA 2HVYD 4ZHQA 3IKFA 1PF5A 5MN6A 2NMUA 5JCOA 2UYKA 4I50A 3U0OA 3D01A 4O4JA 3V7EA 3NMUC 5JVDB 2JNBA 5JH7A 2HRYA 1TUBA 1GZ0A 3WJPA 5IT9M 1W5FA 3HKDA 1NJIH 3CD6F 1VHAA 2CW4A 4B45A 4BVQA 4I4TA 2VAMA 4BVSA 2Q1XA 3GTZA 3JARA 3LFOA 4G4YA 4X20B 3RYFA 3WJRA 3CMEF 5AVMA 3V7QA 3ZO8A 4IHJB 3VIUA 4C4WC 4TUYB 3CPQA 3HKEB 3VI6A 1T0KB 2UYPA 2RHHA 3MCAB 4I55A 3E1YA 2QI2A 4O4LA 3S0HA 1OAPA 3ZP4A 1VQ7F 3N4ZA 3WGKA 4B62A 4RQOA 1YITF 2QEXF 2L26A 3RYHA 1FNKA 2Z1UA 1NMUB 3FPIA 2VAWA 4EB6B 3VOAA 5G4VC 1JN1A 3WPXA 5A2QM 5GAPK 1VH8A 5HP8A 1H48A 3DDNA 3J81M 3JALB 2QTPA 3E20B 2DYYA 5JQGA 1KNJA 1W2BF 1PXWA 1X52A 3HKBA 3LMEA 3B6NA 5C8YA 5LA6B 3WPWA 4X3LA 1JFFB 1QVGF 4O2AB 2DT4A 3JAWA 1W5BA 3CC7F 3LYBA 1ONIA 5HY4A 2I6DA 1RLGA 5FJ4C 3C9TA 3P4EA 2F9ZC 1JD1A 3FFMA 5LYJA 3GYQA 5GANK 2HS3A 3K0TA 3D00A 5EYPA 4IIJA 5GINC 4O4IB 3LWRC 4U3JA 3C9RA 4X1IA 1VQ4F 4ZHWA 4YJ2B 4LNUA 2KTUA 2CZWA 1W57A 1W581 1KQSF 3E22A 3P0ZA 3I3FA 5HWEA 3VTIC 4BT3A 3VCZA 1E7KA 2MQEA 2KTVA 2VAPA 1YI2F 4BVTA 3P10A 4EI9A 5J2TB 2QA4F 2YYEA 3CCLF 4EI8A 5CB4A 3CYQA 1NQ3A 1W5EA 5GIPC 5LP6B 2UZHA 1TVKA 2AIFA 1IV4A 4ZI7A 1SA0B
chains in the Genus database with same CATH topology
4G88A 4G4XA 3OONA 2ZOVA 4PWTA 4G4WA 4B5CA 5EAZA 4ERHA 4ZHWA 4ZHVA 2LCAA 4RHAA 2W8BC 2ZF8A 3TD4A 3S0HA 1OAPA 2K1SA 3IMPA 3TD5A 4ZHYB 1R1MA 3S03A 4B62A 2ZVZA 3WPWA 2N48A 2KGWA 4R40B 2MQEA 2L26A 4G4YA 3KHNA 3S02A 3TD3A 2ZVYA 2AIZP 2HQSC 2LBTA 3CYQA 3S0WA 3WPXA 3S06A 4G4VA 5EB1B 3S0YA 3LDTA 4G4ZA 5EB0A 3CYPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G88 A;  4G4X A;  3OON A;  2ZOV A;  4PWT A;  4G4W A;  4B5C A;  5EAZ A;  4ERH A;  4ZHW A;  4ZHV A;  2LCA A;  4RHA A;  2W8B C;  2ZF8 A;  3TD4 A;  3S0H A;  1OAP A;  2K1S A;  3IMP A;  3TD5 A;  4ZHY B;  1R1M A;  3S03 A;  4B62 A;  2ZVZ A;  3WPW A;  2N48 A;  2KGW A;  4R40 B;  2MQE A;  2L26 A;  4G4Y A;  3KHN A;  3S02 A;  3TD3 A;  2ZVY A;  2AIZ P;  2HQS C;  2LBT A;  3CYQ A;  3S0W A;  3WPX A;  3S06 A;  4G4V A;  5EB1 B;  3S0Y A;  3LDT A;  4G4Z A;  5EB0 A;  3CYP B; 
#chains in the Genus database with same CATH topology
 3QHD A;  1J7H A;  2P6Y A;  1W40 A;  1VQO F;  2R6R 1;  2HP0 B;  2AMT A;  4DRX A;  3KE1 A;  5IJ9 B;  5KX5 A;  3JAT A;  4WBN B;  2UYN A;  5GIO C;  3JAK A;  3VYT C;  4DXD A;  4ZHQ B;  2ALE A;  3T80 A;  2R75 1;  2H6L A;  1VQP F;  1VQ9 F;  4ZOL A;  4E6E A;  2BTO A;  4I50 B;  4O4J B;  1W42 A;  3IEQ A;  5JH7 B;  1TUB B;  3K12 A;  2V9Y A;  4TV8 A;  3QTY A;  1VK3 A;  3D54 A;  4TZZ A;  2CHS A;  3HKD B;  3MCQ A;  3CCU F;  1Q7Y H;  3RYI A;  3GHZ A;  5BMV A;  2CSL A;  3ERN A;  3F0F A;  2HRU A;  4I4T B;  4B5C A;  2FC3 A;  5G4U C;  3M84 A;  1FNJ A;  1FSZ A;  5FLX M;  1YGY A;  3JAS A;  3VO8 A;  1GO0 A;  3JAR B;  1FFX A;  1R1M A;  3RYF B;  3HTN A;  4HNA A;  1VQK F;  4M8I A;  5CA1 A;  3S02 A;  3CCJ F;  1W3E X;  5KMG A;  3CMA F;  1CK2 A;  4I55 B;  4O4H A;  4G4V A;  3CC4 F;  3PLA C;  1RA4 A;  3LDT A;  4O4L B;  1S72 F;  2IAF A;  4LCK A;  1DBF A;  3RYH B;  3M1X A;  1IV3 A;  3WGJ A;  3UT5 A;  4ERH A;  3N2K A;  1GX1 A;  2VGM A;  3CG6 A;  3WGL A;  1ODE A;  4B46 A;  1IV1 A;  1Q86 H;  4O2B A;  3AGK A;  4C82 A;  5EIB D;  3C9U A;  3RA6 A;  2FGY A;  3KHN A;  5HP7 A;  1CLI A;  3LWP C;  1GO1 A;  2RHJ A;  5JQG B;  1Z5W A;  4X1K A;  3F0G A;  3HKB B;  5J2U A;  5FNV A;  4EI7 A;  3S06 A;  5C8Y B;  3CPW F;  3CYP B;  3OBY A;  4F6R A;  5ITZ A;  1K73 H;  1N8R H;  4NQ3 A;  4U39 A;  5IJ0 B;  1W55 A;  4BT6 A;  4C8E A;  3JAW B;  3R0P A;  3I55 F;  5LP6 C;  3MBM A;  3RYC A;  3JAM M;  1XRG A;  1ZWZ A;  2ZVZ A;  5LYJ B;  1KC8 H;  5HXU A;  5EYP B;  4IIJ B;  3TD3 A;  2HQS C;  4NWO B;  3F6M A;  2CHT A;  4U3J B;  4LNU B;  3V4D A;  2IQQ A;  4BVR A;  2HP3 A;  3E22 B;  2LBW A;  3DC2 A;  1IPA A;  3ELC A;  1VQM F;  2GZL A;  1XHO A;  4NUT A;  1K9M H;  3K14 A;  4G4W A;  2BTQ B;  5CB4 B;  1RLU A;  1UI9 A;  1YQN A;  4FFB A;  3MQW A;  4X1Y A;  5CA0 A;  5EZY B;  3VOB A;  1VQL F;  3G4S F;  1TVK B;  3V3T A;  4ZHY B;  4ZI7 B;  2N48 A;  3F0D A;  2Z01 A;  1W5A A;  4ZK7 A;  3N4Y A;  4DRX B;  1X25 A;  2I6R A;  2OTJ F;  3G71 F;  3I7T A;  5KX5 B;  3JAT B;  2GVI A;  2UYN B;  4G4Z A;  5LA6 A;  1XV2 A;  3JAK B;  3WXM B;  1JJ2 F;  3IR9 A;  3N2G A;  3RA5 A;  3MDO A;  4TV9 B;  5EAZ A;  1YJW F;  3KIZ A;  3HKC A;  2G9I A;  2LCA A;  5LOV A;  4TV8 B;  2VGN A;  3Q8H A;  4BT5 A;  1OFU A;  3CCV F;  5IYZ A;  3RYI B;  5GON A;  1W59 A;  1JY8 A;  2H8C A;  3RE3 A;  5BMV B;  1COM A;  1U3L A;  3JCM M;  1U43 A;  1FFX B;  3M4S A;  3ZOP A;  3CCQ F;  4HNA B;  4YJ3 A;  3WGN A;  5CA1 B;  3CC2 F;  4XCQ A;  2ZAU A;  5HXZ A;  5KMG B;  3LWO C;  2RHO A;  2Z1T A;  3OW2 F;  3S03 A;  2Q1Y A;  1T0A A;  5LXT A;  1H47 A;  1YIJ F;  1QU9 A;  1IV2 A;  2OZB A;  3UT5 B;  2OTM A;  3N2K B;  5DCV A;  3CCR F;  3HWU A;  3K2X A;  2H8E A;  5EB0 A;  2GLZ A;  5HY1 A;  4O2B B;  3NK6 A;  4G4X A;  1K8A H;  1QVF F;  1DT9 A;  4PWT A;  4KWE A;  2ZOD A;  4BT2 A;  4X1K B;  2UYJ A;  5EWR A;  2ZF8 A;  5J2U B;  3TD4 A;  3WJQ A;  3IMP A;  3OBW A;  2EWC A;  5FNV B;  3VYS C;  2HS4 A;  2KGW A;  4F6R B;  5ITZ B;  5JVD A;  2AIZ P;  3O85 A;  2Z1E A;  1YJN F;  1QAH A;  1X7P A;  1YHQ F;  3RYC B;  1CN7 A;  4C8G A;  2VXY A;  1Q82 H;  2WAL A;  1W41 A;  3NK7 A;  1VQN F;  2OTL F;  4ZHV A;  1X7O A;  3EOR A;  5HY2 A;  2Z1F A;  2IG8 A;  4X20 A;  3HJW C;  4C81 A;  5MN4 A;  4IHJ A;  4TUY A;  4R40 B;  3NVI B;  3HKE A;  4BT7 A;  1VQV A;  2ZVY A;  1U3P A;  3VYU C;  3VMF B;  3BYQ A;  4FFB B;  2PMP A;  3C8L A;  3C9S A;  4X1I B;  4X1Y B;  5CA0 B;  1KNK A;  3S0Y A;  3WGM A;  4G88 A;  3ZP7 A;  3NVK E;  3J80 M;  2YXZ A;  1RQ2 A;  1KD1 H;  3QUW A;  5JCO C;  1YJ9 F;  3OON A;  3FBA A;  3L7Q A;  2BO1 A;  4EB6 A;  1M90 H;  3CB2 A;  3SIV A;  2K1S A;  5EO3 A;  4BT4 A;  3JAL A;  3LWQ C;  5IJ0 A;  4BW0 B;  3N2G B;  2RHL A;  3HKC B;  2KG4 A;  5LOV B;  3KJK A;  3G6E F;  1VQ6 F;  2LBX A;  5IYZ B;  1JFF A;  4O2A A;  3JVH A;  5GON B;  2ZOV A;  4ZOL B;  1Z5V A;  3LWV C;  4BY9 D;  2HS0 A;  2PHN A;  1U40 A;  4RHA A;  3CXC F;  3TD5 A;  3J7A R;  3CCE F;  1QD9 A;  4X3M A;  1VQ8 F;  1SZQ A;  4O4I A;  5B8F A;  4YJ3 B;  2LBT A;  1Q8R A;  1Q81 H;  3PAF A;  4YJ2 A;  5EZY A;  1XBI A;  3ESJ A;  3CCS F;  2BTU A;  5HY0 A;  5EB1 B;  3FD5 A;  3JAS B;  3IEW A;  2CVL A;  2RB9 A;  3FD6 A;  1UFY A;  5LXT B;  5J2T A;  1SDS A;  4C8I A;  3I56 F;  3CCM F;  3KJJ A;  5LP6 A;  3HAX D;  3ON1 A;  5MN5 A;  2CWJ A;  2W8B C;  3SIU A;  1RQ7 A;  1SA0 A;  4O4H B;  1M1K H;  2B33 A;  5EIB C;  3F0E A;  2HP0 A;  2OHW A;  4TV9 A;  5IJ9 A;  3S0W A;  3IKE A;  1VQ5 F;  4WBN A;  2HX0 A;  1H7M A;  2HVY D;  4ZHQ A;  3IKF A;  1PF5 A;  5MN6 A;  2NMU A;  5JCO A;  2UYK A;  4I50 A;  3U0O A;  3D01 A;  4O4J A;  3V7E A;  3NMU C;  5JVD B;  2JNB A;  5JH7 A;  2HRY A;  1TUB A;  1GZ0 A;  3WJP A;  5IT9 M;  1W5F A;  3HKD A;  1NJI H;  3CD6 F;  1VHA A;  2CW4 A;  4B45 A;  4BVQ A;  4I4T A;  2VAM A;  4BVS A;  2Q1X A;  3GTZ A;  3JAR A;  3LFO A;  4G4Y A;  4X20 B;  3RYF A;  3WJR A;  3CME F;  5AVM A;  3V7Q A;  3ZO8 A;  4IHJ B;  3VIU A;  4C4W C;  4TUY B;  3CPQ A;  3HKE B;  3VI6 A;  1T0K B;  2UYP A;  2RHH A;  3MCA B;  4I55 A;  3E1Y A;  2QI2 A;  4O4L A;  3S0H A;  1OAP A;  3ZP4 A;  1VQ7 F;  3N4Z A;  3WGK A;  4B62 A;  4RQO A;  1YIT F;  2QEX F;  2L26 A;  3RYH A;  1FNK A;  2Z1U A;  1NMU B;  3FPI A;  2VAW A;  4EB6 B;  3VOA A;  5G4V C;  1JN1 A;  3WPX A;  5A2Q M;  5GAP K;  1VH8 A;  5HP8 A;  1H48 A;  3DDN A;  3J81 M;  3JAL B;  2QTP A;  3E20 B;  2DYY A;  5JQG A;  1KNJ A;  1W2B F;  1PXW A;  1X52 A;  3HKB A;  3LME A;  3B6N A;  5C8Y A;  5LA6 B;  3WPW A;  4X3L A;  1JFF B;  1QVG F;  4O2A B;  2DT4 A;  3JAW A;  1W5B A;  3CC7 F;  3LYB A;  1ONI A;  5HY4 A;  2I6D A;  1RLG A;  5FJ4 C;  3C9T A;  3P4E A;  2F9Z C;  1JD1 A;  3FFM A;  5LYJ A;  3GYQ A;  5GAN K;  2HS3 A;  3K0T A;  3D00 A;  5EYP A;  4IIJ A;  5GIN C;  4O4I B;  3LWR C;  4U3J A;  3C9R A;  4X1I A;  1VQ4 F;  4ZHW A;  4YJ2 B;  4LNU A;  2KTU A;  2CZW A;  1W57 A;  1W58 1;  1KQS F;  3E22 A;  3P0Z A;  3I3F A;  5HWE A;  3VTI C;  4BT3 A;  3VCZ A;  1E7K A;  2MQE A;  2KTV A;  2VAP A;  1YI2 F;  4BVT A;  3P10 A;  4EI9 A;  5J2T B;  2QA4 F;  2YYE A;  3CCL F;  4EI8 A;  5CB4 A;  3CYQ A;  1NQ3 A;  1W5E A;  5GIP C;  5LP6 B;  2UZH A;  1TVK A;  2AIF A;  1IV4 A;  4ZI7 A;  1SA0 B; 
#chains in the Genus database with same CATH homology
 4G88 A;  4G4X A;  3OON A;  2ZOV A;  4PWT A;  4G4W A;  4B5C A;  5EAZ A;  4ERH A;  4ZHW A;  4ZHV A;  2LCA A;  4RHA A;  2W8B C;  2ZF8 A;  3TD4 A;  3S0H A;  1OAP A;  2K1S A;  3IMP A;  3TD5 A;  4ZHY B;  1R1M A;  3S03 A;  4B62 A;  2ZVZ A;  3WPW A;  2N48 A;  2KGW A;  4R40 B;  2MQE A;  2L26 A;  4G4Y A;  3KHN A;  3S02 A;  3TD3 A;  2ZVY A;  2AIZ P;  2HQS C;  2LBT A;  3CYQ A;  3S0W A;  3WPX A;  3S06 A;  4G4V A;  5EB1 B;  3S0Y A;  3LDT A;  4G4Z A;  5EB0 A;  3CYP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...