4ERHA

The crystal structure of ompa domain of ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein A
molecule tags Membrane protein
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
publication title The crystal structure of OmpA domain of OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4erhA00
3S0YA 4R40B 1R1MA 3IMPA 3OONA 2AIZP 3S03A 4PWTA 4G4VA 4ZHWA 2KGWA 3CYQA 5EAZA 3WPWA 4RHAA 5EB1B 2MQEA 4ZHVA 5EB0A 3S02A 1OAPA 2ZVYA 3S0WA 2L26A 2W8BC 2ZVZA 2LBTA 4G4WA 3WPXA 3CYPB 2HQSC 3TD3A 4B62A 2K1SA 2N48A 3S0HA 3KHNA 2ZF8A 4G4XA 3TD5A 3S06A 4ERHA 4G4ZA 3TD4A 2ZOVA 3LDTA 4ZHYB 4G88A 4G4YA 2LCAA 4B5CA
chains in the Genus database with same CATH superfamily
3S0YA 2RB9A 1W41A 4C8IA 2VGMA 2YYEA 5LXTA 3HKDA 3JATB 2CWJA 1UI9A 2VAMA 2HS0A 1VQVA 1NMUB 3GYQA 3S02A 4TV9B 1M1KH 4YJ3A 2I6RA 2R751 1PF5A 3WJRA 4EB6A 3CCRF 1U3PA 2HRUA 4EI9A 3ERNA 3CXCF 2UZHA 2QA4F 3HKDB 3PLAC 2LCAA 4O2AA 1XRGA 3WGMA 3DDNA 4YJ3B 3ESJA 3JARA 4X1IA 4EI8A 4ZI7B 1VQKF 4DXDA 5EWRA 5KX5B 1CN7A 3LFOA 5JCOC 2CVLA 3MDOA 3JALB 4X1KA 3NMUC 4BT5A 3I56F 4TZZA 1QVFF 4B62A 1QU9A 3RYFB 5MN5A 1CK2A 4I50A 3CPWF 3KIZA 1Z5WA 5IJ9A 1W2BF 1YJWF 1IV4A 2UYNB 2BTQB 3VYTC 1SZQA 3MCQA 5EIBC 4O4HB 2OHWA 3N2KB 3SIVA 1H48A 1YIJF 2MQEA 2GVIA 5AVMA 3L7QA 3IEQA 1J7HA 2H6LA 1VQ9F 1QD9A 4C81A 3OBWA 1KD1H 3CYPB 3K14A 3J7AR 3T80A 4ERHA 5IJ9B 2FC3A 4I55B 2DYYA 3CCVF 3RA5A 4BW0B 1UFYA 5JQGA 4BY9D 4HNAB 3D01A 1VQ6F 1X25A 3IMPA 1X7OA 2GZLA 2DT4A 1S72F 3GTZA 1IPAA 4O4JA 4TV8B 5EAZA 3E22B 1QAHA 3JAKB 1ODEA 5LP6C 3JAKA 4B46A 1T0KB 3R0PA 3C9TA 3S0WA 3M4SA 2R6R1 2ZVZA 3FPIA 3VYUC 1Q7YH 2AIFA 2ZODA 3LWRC 1RLGA 3TD4A 1YQNA 2PMPA 4BT6A 3LWQC 2IQQA 2BTOA 2HP0B 3GHZA 4TUYB 1VQ8F 1XHOA 2AIZP 3B6NA 3VI6A 5CA0B 5IT9M 3JATA 3F6MA 3FBAA 4BT2A 3CC4F 5EYPB 3HKEA 3J81M 5IJ0A 1GX1A 5LP6A 4B45A 3HTNA 4WBNB 3N2GA 2ZVYA 1SA0A 3MQWA 5CA1A 1NQ3A 1U43A 4I4TA 2K1SA 5C8YA 3RYIA 3LWPC 1FNJA 4G4XA 5J2TA 3S06A 3E22A 1K73H 2V9YA 4TV8A 1JY8A 2RHLA 5HY0A 4G4YA 3CG6A 3VO8A 1W5EA 3KE1A 1W5FA 4G4VA 2Z1EA 3UT5A 3OBYA 5IYZA 5EB1B 5LP6B 1Q81H 3M84A 3RA6A 3HKCA 1VQ4F 4O4IB 4RQOA 4G4WA 2G9IA 3JAWA 3VOBA 5FLXM 3TD5A 3S0HA 2Q1YA 1VQPF 2Z1FA 2RHHA 4ZHYB 1JFFA 3HKBB 5LOVB 4E6EA 5IJ0B 2IAFA 2ZAUA 1DBFA 3K2XA 1R1MA 4EB6B 4ZHWA 3CCEF 4ZHQA 3NK7A 5J2TB 3IKFA 1VK3A 1W59A 5LYJA 5ITZB 5HY4A 1KQSF 3I7TA 4F6RA 4LCKA 4O4JB 1NJIH 2BTUA 2KTUA 3F0GA 5LXTB 2HQSC 5EZYA 2CHSA 4ZI7A 4X1IB 1DT9A 1YJ9F 4G88A 2HS3A 4YJ2A 2VAPA 4B5CA 5HY2A 3OW2F 4C4WC 3CC7F 3NVKE 2HRYA 3VCZA 3FD5A 3IR9A 4BVSA 1XV2A 5GANK 3JVHA 5J2UA 3FFMA 3C9UA 3CCJF 4NUTA 4EI7A 4TV9A 3CCLF 3TD3A 4ZOLB 1TUBA 1Q82H 5GIPC 3JAWB 3ZOPA 2VGNA 1U3LA 2IG8A 2YXZA 1FFXB 3JASA 3F0EA 1YI2F 1RQ7A 3RE3A 1N8RH 3NVIB 3LYBA 4O4IA 3P0ZA 3NK6A 1QVGF 4HNAA 3V7EA 3V3TA 2Z1UA 3HJWC 1H47A 3VMFB 4KWEA 1W5AA 4ZHVA 5FNVA 3QUWA 5FNVB 4ZHQB 3E20B 4X3LA 2UYKA 4BT7A 3E1YA 2VXYA 5G4VC 3WGNA 4BT4A 3RYIB 2Z01A 2OZBA 4I4TB 2JNBA 3I3FA 3WGKA 1JJ2F 1VHAA 4C8EA 1VQ7F 3ON1A 5HP8A 4C82A 3HKEB 3F0DA 1CLIA 3RYCA 1YJNF 4DRXB 3HAXD 5EO3A 4BT3A 4PWTA 2FGYA 5HY1A 4I50B 2NMUA 2B33A 2CHTA 3C8LA 5IYZB 4FFBA 3LMEA 1Q86H 2HVYD 3CCMF 1IV2A 5CA1B 3Q8HA 1YHQF 1X7PA 1KC8H 3HWUA 5KMGB 4X1YB 1VQNF 2WALA 3G71F 1X52A 3JARB 2QTPA 2Q1XA 1TUBB 1YGYA 2UYPA 5GINC 1KNKA 3LWOC 3LWVC 1K8AH 3FD6A 1IV1A 1VQMF 4BVTA 4M8IA 1M90H 1YITF 5GONB 4X20B 1U40A 2L26A 4U39A 5G4UC 3WXMB 1E7KA 5JH7B 3G4SF 4X1YA 4DRXA 2ZF8A 5HXZA 1W5BA 1Q8RA 4IIJB 5JVDB 1TVKA 3K0TA 3D54A 3V7QA 2QEXF 2CW4A 5LA6B 4R40B 5HP7A 3ELCA 4F6RB 3O85A 2PHNA 1VH8A 3WPWA 4RHAA 3P4EA 3PAFA 3M1XA 1IV3A 5MN4A 1W57A 1W581 2W8BC 5CB4B 3VTIC 1W55A 2QI2A 3JAMM 1Z5VA 5JQGB 5A2QM 1FSZA 5EIBD 3P10A 2H8EA 3KHNA 5LA6A 3D00A 5LOVA 3V4DA 3AGKA 3N2KA 3C9SA 4O2BA 2LBWA 1ZWZA 3C9RA 5C8YB 2P6YA 4O4LA 1RLUA 2Z1TA 5JH7A 1VQOF 3CB2A 2GLZA 3CCUF 1VQLF 1JN1A 3RYHA 3K12A 2KTVA 3N4YA 5EB0A 1TVKB 3N2GB 3JASB 3JALA 1GZ0A 4X1KB 4LNUB 2LBXA 2AMTA 2OTMA 3DC2A 1PXWA 1FFXA 2ZOVA 3CMAF 3ZP7A 3VIUA 5GONA 3JCMM 2HP0A 4TUYA 3VYSC 4O2AB 1W42A 4NQ3A 5JVDA 3CD6F 5EZYB 1SA0B 1COMA 4WBNA 3MCAB 4XCQA 3SIUA 2KGWA 5J2UB 2BO1A 5EYPA 3U0OA 5MN6A 5FJ4C 2HS4A 5KX5A 1VQ5F 3IKEA 5GIOC 2RHOA 4FFBB 3QTYA 1W40A 2OTLF 4YJ2B 4IHJB 3J80M 2RHJA 4X20A 5DCVA 4O4LB 5KMGA 3RYCB 2N48A 5BMVB 3KJJA 3QHDA 4ZK7A 3LDTA 2H8CA 1K9MH 2HX0A 2CZWA 2HP3A 2I6DA 2VAWA 1JD1A 1KNJA 3OONA 3S03A 3G6EF 3WJQA 2ALEA 3CYQA 3IEWA 3ZP4A 2EWCA 5ITZA 5LYJB 3HKCB 2CSLA 4NWOB 3N4ZA 4LNUA 2F9ZC 5JCOA 1RA4A 4BVRA 1JFFB 3WGLA 2LBTA 2OTJF 1T0AA 3EORA 1W3EX 3KJKA 4X3MA 3HKBA 3F0FA 4I55A 2UYNA 5CB4A 4IIJA 4C8GA 5B8FA 3MBMA 1SDSA 4O4HA 1XBIA 4O2BB 3CCQF 1FNKA 1OFUA 3BYQA 3RYFA 3WJPA 4U3JB 4U3JA 3RYHB 2KG4A 3ZO8A 3UT5B 1RQ2A 1OAPA 5CA0A 5HXUA 3WGJA 1H7MA 3WPXA 4BVQA 5BMVA 4ZOLA 3CMEF 5HWEA 3I55F 3CPQA 4G4ZA 3CCSF 1GO0A 2UYJA 4IHJA 3VOAA 5GAPK 1GO1A 3CC2F 1ONIA
chains in the Genus database with same CATH topology
3S0YA 4R40B 1R1MA 3IMPA 3OONA 2AIZP 3S03A 4PWTA 4G4VA 4ZHWA 2KGWA 3CYQA 5EAZA 3WPWA 4RHAA 5EB1B 2MQEA 4ZHVA 5EB0A 3S02A 1OAPA 2ZVYA 3S0WA 2L26A 2W8BC 2ZVZA 2LBTA 4G4WA 3WPXA 3CYPB 2HQSC 3TD3A 4B62A 2K1SA 2N48A 3S0HA 3KHNA 2ZF8A 4G4XA 3TD5A 3S06A 4ERHA 4G4ZA 3TD4A 2ZOVA 3LDTA 4ZHYB 4G88A 4G4YA 2LCAA 4B5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0Y A;  4R40 B;  1R1M A;  3IMP A;  3OON A;  2AIZ P;  3S03 A;  4PWT A;  4G4V A;  4ZHW A;  2KGW A;  3CYQ A;  5EAZ A;  3WPW A;  4RHA A;  5EB1 B;  2MQE A;  4ZHV A;  5EB0 A;  3S02 A;  1OAP A;  2ZVY A;  3S0W A;  2L26 A;  2W8B C;  2ZVZ A;  2LBT A;  4G4W A;  3WPX A;  3CYP B;  2HQS C;  3TD3 A;  4B62 A;  2K1S A;  2N48 A;  3S0H A;  3KHN A;  2ZF8 A;  4G4X A;  3TD5 A;  3S06 A;  4ERH A;  4G4Z A;  3TD4 A;  2ZOV A;  3LDT A;  4ZHY B;  4G88 A;  4G4Y A;  2LCA A;  4B5C A; 
#chains in the Genus database with same CATH topology
 3S0Y A;  2RB9 A;  1W41 A;  4C8I A;  2VGM A;  2YYE A;  5LXT A;  3HKD A;  3JAT B;  2CWJ A;  1UI9 A;  2VAM A;  2HS0 A;  1VQV A;  1NMU B;  3GYQ A;  3S02 A;  4TV9 B;  1M1K H;  4YJ3 A;  2I6R A;  2R75 1;  1PF5 A;  3WJR A;  4EB6 A;  3CCR F;  1U3P A;  2HRU A;  4EI9 A;  3ERN A;  3CXC F;  2UZH A;  2QA4 F;  3HKD B;  3PLA C;  2LCA A;  4O2A A;  1XRG A;  3WGM A;  3DDN A;  4YJ3 B;  3ESJ A;  3JAR A;  4X1I A;  4EI8 A;  4ZI7 B;  1VQK F;  4DXD A;  5EWR A;  5KX5 B;  1CN7 A;  3LFO A;  5JCO C;  2CVL A;  3MDO A;  3JAL B;  4X1K A;  3NMU C;  4BT5 A;  3I56 F;  4TZZ A;  1QVF F;  4B62 A;  1QU9 A;  3RYF B;  5MN5 A;  1CK2 A;  4I50 A;  3CPW F;  3KIZ A;  1Z5W A;  5IJ9 A;  1W2B F;  1YJW F;  1IV4 A;  2UYN B;  2BTQ B;  3VYT C;  1SZQ A;  3MCQ A;  5EIB C;  4O4H B;  2OHW A;  3N2K B;  3SIV A;  1H48 A;  1YIJ F;  2MQE A;  2GVI A;  5AVM A;  3L7Q A;  3IEQ A;  1J7H A;  2H6L A;  1VQ9 F;  1QD9 A;  4C81 A;  3OBW A;  1KD1 H;  3CYP B;  3K14 A;  3J7A R;  3T80 A;  4ERH A;  5IJ9 B;  2FC3 A;  4I55 B;  2DYY A;  3CCV F;  3RA5 A;  4BW0 B;  1UFY A;  5JQG A;  4BY9 D;  4HNA B;  3D01 A;  1VQ6 F;  1X25 A;  3IMP A;  1X7O A;  2GZL A;  2DT4 A;  1S72 F;  3GTZ A;  1IPA A;  4O4J A;  4TV8 B;  5EAZ A;  3E22 B;  1QAH A;  3JAK B;  1ODE A;  5LP6 C;  3JAK A;  4B46 A;  1T0K B;  3R0P A;  3C9T A;  3S0W A;  3M4S A;  2R6R 1;  2ZVZ A;  3FPI A;  3VYU C;  1Q7Y H;  2AIF A;  2ZOD A;  3LWR C;  1RLG A;  3TD4 A;  1YQN A;  2PMP A;  4BT6 A;  3LWQ C;  2IQQ A;  2BTO A;  2HP0 B;  3GHZ A;  4TUY B;  1VQ8 F;  1XHO A;  2AIZ P;  3B6N A;  3VI6 A;  5CA0 B;  5IT9 M;  3JAT A;  3F6M A;  3FBA A;  4BT2 A;  3CC4 F;  5EYP B;  3HKE A;  3J81 M;  5IJ0 A;  1GX1 A;  5LP6 A;  4B45 A;  3HTN A;  4WBN B;  3N2G A;  2ZVY A;  1SA0 A;  3MQW A;  5CA1 A;  1NQ3 A;  1U43 A;  4I4T A;  2K1S A;  5C8Y A;  3RYI A;  3LWP C;  1FNJ A;  4G4X A;  5J2T A;  3S06 A;  3E22 A;  1K73 H;  2V9Y A;  4TV8 A;  1JY8 A;  2RHL A;  5HY0 A;  4G4Y A;  3CG6 A;  3VO8 A;  1W5E A;  3KE1 A;  1W5F A;  4G4V A;  2Z1E A;  3UT5 A;  3OBY A;  5IYZ A;  5EB1 B;  5LP6 B;  1Q81 H;  3M84 A;  3RA6 A;  3HKC A;  1VQ4 F;  4O4I B;  4RQO A;  4G4W A;  2G9I A;  3JAW A;  3VOB A;  5FLX M;  3TD5 A;  3S0H A;  2Q1Y A;  1VQP F;  2Z1F A;  2RHH A;  4ZHY B;  1JFF A;  3HKB B;  5LOV B;  4E6E A;  5IJ0 B;  2IAF A;  2ZAU A;  1DBF A;  3K2X A;  1R1M A;  4EB6 B;  4ZHW A;  3CCE F;  4ZHQ A;  3NK7 A;  5J2T B;  3IKF A;  1VK3 A;  1W59 A;  5LYJ A;  5ITZ B;  5HY4 A;  1KQS F;  3I7T A;  4F6R A;  4LCK A;  4O4J B;  1NJI H;  2BTU A;  2KTU A;  3F0G A;  5LXT B;  2HQS C;  5EZY A;  2CHS A;  4ZI7 A;  4X1I B;  1DT9 A;  1YJ9 F;  4G88 A;  2HS3 A;  4YJ2 A;  2VAP A;  4B5C A;  5HY2 A;  3OW2 F;  4C4W C;  3CC7 F;  3NVK E;  2HRY A;  3VCZ A;  3FD5 A;  3IR9 A;  4BVS A;  1XV2 A;  5GAN K;  3JVH A;  5J2U A;  3FFM A;  3C9U A;  3CCJ F;  4NUT A;  4EI7 A;  4TV9 A;  3CCL F;  3TD3 A;  4ZOL B;  1TUB A;  1Q82 H;  5GIP C;  3JAW B;  3ZOP A;  2VGN A;  1U3L A;  2IG8 A;  2YXZ A;  1FFX B;  3JAS A;  3F0E A;  1YI2 F;  1RQ7 A;  3RE3 A;  1N8R H;  3NVI B;  3LYB A;  4O4I A;  3P0Z A;  3NK6 A;  1QVG F;  4HNA A;  3V7E A;  3V3T A;  2Z1U A;  3HJW C;  1H47 A;  3VMF B;  4KWE A;  1W5A A;  4ZHV A;  5FNV A;  3QUW A;  5FNV B;  4ZHQ B;  3E20 B;  4X3L A;  2UYK A;  4BT7 A;  3E1Y A;  2VXY A;  5G4V C;  3WGN A;  4BT4 A;  3RYI B;  2Z01 A;  2OZB A;  4I4T B;  2JNB A;  3I3F A;  3WGK A;  1JJ2 F;  1VHA A;  4C8E A;  1VQ7 F;  3ON1 A;  5HP8 A;  4C82 A;  3HKE B;  3F0D A;  1CLI A;  3RYC A;  1YJN F;  4DRX B;  3HAX D;  5EO3 A;  4BT3 A;  4PWT A;  2FGY A;  5HY1 A;  4I50 B;  2NMU A;  2B33 A;  2CHT A;  3C8L A;  5IYZ B;  4FFB A;  3LME A;  1Q86 H;  2HVY D;  3CCM F;  1IV2 A;  5CA1 B;  3Q8H A;  1YHQ F;  1X7P A;  1KC8 H;  3HWU A;  5KMG B;  4X1Y B;  1VQN F;  2WAL A;  3G71 F;  1X52 A;  3JAR B;  2QTP A;  2Q1X A;  1TUB B;  1YGY A;  2UYP A;  5GIN C;  1KNK A;  3LWO C;  3LWV C;  1K8A H;  3FD6 A;  1IV1 A;  1VQM F;  4BVT A;  4M8I A;  1M90 H;  1YIT F;  5GON B;  4X20 B;  1U40 A;  2L26 A;  4U39 A;  5G4U C;  3WXM B;  1E7K A;  5JH7 B;  3G4S F;  4X1Y A;  4DRX A;  2ZF8 A;  5HXZ A;  1W5B A;  1Q8R A;  4IIJ B;  5JVD B;  1TVK A;  3K0T A;  3D54 A;  3V7Q A;  2QEX F;  2CW4 A;  5LA6 B;  4R40 B;  5HP7 A;  3ELC A;  4F6R B;  3O85 A;  2PHN A;  1VH8 A;  3WPW A;  4RHA A;  3P4E A;  3PAF A;  3M1X A;  1IV3 A;  5MN4 A;  1W57 A;  1W58 1;  2W8B C;  5CB4 B;  3VTI C;  1W55 A;  2QI2 A;  3JAM M;  1Z5V A;  5JQG B;  5A2Q M;  1FSZ A;  5EIB D;  3P10 A;  2H8E A;  3KHN A;  5LA6 A;  3D00 A;  5LOV A;  3V4D A;  3AGK A;  3N2K A;  3C9S A;  4O2B A;  2LBW A;  1ZWZ A;  3C9R A;  5C8Y B;  2P6Y A;  4O4L A;  1RLU A;  2Z1T A;  5JH7 A;  1VQO F;  3CB2 A;  2GLZ A;  3CCU F;  1VQL F;  1JN1 A;  3RYH A;  3K12 A;  2KTV A;  3N4Y A;  5EB0 A;  1TVK B;  3N2G B;  3JAS B;  3JAL A;  1GZ0 A;  4X1K B;  4LNU B;  2LBX A;  2AMT A;  2OTM A;  3DC2 A;  1PXW A;  1FFX A;  2ZOV A;  3CMA F;  3ZP7 A;  3VIU A;  5GON A;  3JCM M;  2HP0 A;  4TUY A;  3VYS C;  4O2A B;  1W42 A;  4NQ3 A;  5JVD A;  3CD6 F;  5EZY B;  1SA0 B;  1COM A;  4WBN A;  3MCA B;  4XCQ A;  3SIU A;  2KGW A;  5J2U B;  2BO1 A;  5EYP A;  3U0O A;  5MN6 A;  5FJ4 C;  2HS4 A;  5KX5 A;  1VQ5 F;  3IKE A;  5GIO C;  2RHO A;  4FFB B;  3QTY A;  1W40 A;  2OTL F;  4YJ2 B;  4IHJ B;  3J80 M;  2RHJ A;  4X20 A;  5DCV A;  4O4L B;  5KMG A;  3RYC B;  2N48 A;  5BMV B;  3KJJ A;  3QHD A;  4ZK7 A;  3LDT A;  2H8C A;  1K9M H;  2HX0 A;  2CZW A;  2HP3 A;  2I6D A;  2VAW A;  1JD1 A;  1KNJ A;  3OON A;  3S03 A;  3G6E F;  3WJQ A;  2ALE A;  3CYQ A;  3IEW A;  3ZP4 A;  2EWC A;  5ITZ A;  5LYJ B;  3HKC B;  2CSL A;  4NWO B;  3N4Z A;  4LNU A;  2F9Z C;  5JCO A;  1RA4 A;  4BVR A;  1JFF B;  3WGL A;  2LBT A;  2OTJ F;  1T0A A;  3EOR A;  1W3E X;  3KJK A;  4X3M A;  3HKB A;  3F0F A;  4I55 A;  2UYN A;  5CB4 A;  4IIJ A;  4C8G A;  5B8F A;  3MBM A;  1SDS A;  4O4H A;  1XBI A;  4O2B B;  3CCQ F;  1FNK A;  1OFU A;  3BYQ A;  3RYF A;  3WJP A;  4U3J B;  4U3J A;  3RYH B;  2KG4 A;  3ZO8 A;  3UT5 B;  1RQ2 A;  1OAP A;  5CA0 A;  5HXU A;  3WGJ A;  1H7M A;  3WPX A;  4BVQ A;  5BMV A;  4ZOL A;  3CME F;  5HWE A;  3I55 F;  3CPQ A;  4G4Z A;  3CCS F;  1GO0 A;  2UYJ A;  4IHJ A;  3VOA A;  5GAP K;  1GO1 A;  3CC2 F;  1ONI A; 
#chains in the Genus database with same CATH homology
 3S0Y A;  4R40 B;  1R1M A;  3IMP A;  3OON A;  2AIZ P;  3S03 A;  4PWT A;  4G4V A;  4ZHW A;  2KGW A;  3CYQ A;  5EAZ A;  3WPW A;  4RHA A;  5EB1 B;  2MQE A;  4ZHV A;  5EB0 A;  3S02 A;  1OAP A;  2ZVY A;  3S0W A;  2L26 A;  2W8B C;  2ZVZ A;  2LBT A;  4G4W A;  3WPX A;  3CYP B;  2HQS C;  3TD3 A;  4B62 A;  2K1S A;  2N48 A;  3S0H A;  3KHN A;  2ZF8 A;  4G4X A;  3TD5 A;  3S06 A;  4ERH A;  4G4Z A;  3TD4 A;  2ZOV A;  3LDT A;  4ZHY B;  4G88 A;  4G4Y A;  2LCA A;  4B5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...