4ERHA

The crystal structure of ompa domain of ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of OmpA domain of OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Membrane protein
molecule keywords Outer membrane protein A
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4erhA00
3CYQA 2ZVZA 3KHNA 4R40B 3S0WA 4G4ZA 3S0YA 4ZHYB 4RHAA 1OAPA 2N48A 2KGWA 2W8BC 3TD5A 2ZOVA 2ZVYA 5EB0A 3WPWA 4ZHVA 2HQSC 2MQEA 3LDTA 1R1MA 4B5CA 3S06A 2ZF8A 3CYPB 5EAZA 2LBTA 2AIZP 3S02A 3TD3A 3IMPA 4G4XA 3S03A 3OONA 4G4VA 4G88A 4B62A 2LCAA 2K1SA 4G4YA 4ZHWA 3TD4A 4ERHA 5EB1B 4G4WA 4PWTA 3WPXA 2L26A 3S0HA
chains in the Genus database with same CATH superfamily
2DT4A 2Z1UA 3KJJA 4I4TA 5MN5A 2ALEA 2HS0A 1VQ6F 3K14A 2I6RA 1X7PA 2LBXA 5HY4A 3OBWA 3CMEF 3RA5A 3QHDA 3JAMM 4B46A 2BTUA 3HJWC 3CD6F 3VCZA 4G88A 2R6R1 2PHNA 3GYQA 4FFBB 5GANK 4XCQA 1QD9A 4NQ3A 4ERHA 2CSLA 4ZHQB 3MCQA 2PMPA 4NWOB 1PXWA 3IKEA 4LCKA 3S0HA 1K9MH 2RHJA 4TV9A 2Q1YA 5C8YB 3F6MA 4BY9D 4DRXA 3HWUA 3KIZA 5GAPK 2DYYA 3CB2A 3IR9A 4B5CA 2AIZP 2HP0B 5EYPA 3NMUC 1VQ4F 3M1XA 3MQWA 5HWEA 4B62A 4DXDA 4BT6A 4X1YA 5AVMA 5LOVA 1NQ3A 1W5BA 3K2XA 1FFXA 2KG4A 2QTPA 3I7TA 3GTZA 5JH7B 1RA4A 1W5FA 2QI2A 2HS4A 2OTLF 1TVKA 2AIFA 2V9YA 3KHNA 3KE1A 3N4YA 1K73H 3L7QA 5FJ4C 3G6EF 3K0TA 3VYTC 3SIVA 1TUBA 5EIBC 5LYJB 2BO1A 1W59A 1CN7A 4BT2A 4U3JB 3VTIC 4U39A 2GLZA 1R1MA 3JVHA 5HXZA 2EWCA 3C9SA 5EAZA 5C8YA 1W3EX 4E6EA 5CB4A 3FD6A 1W581 1W5AA 2GZLA 4G4YA 3RA6A 3JAKB 4ZHWA 4C8IA 2CHTA 4BVTA 3TD4A 5G4UC 1GX1A 2HS3A 5GONA 1FFXB 4O4IB 1W57A 3HKCA 3CPQA 3CPWF 1RLGA 2YYEA 2NMUA 5KMGB 2UYJA 3N4ZA 4G4XA 3LWQC 1DT9A 3F0GA 3VOBA 3RYIB 3WGNA 1CLIA 3JCMM 3CXCF 3G4SF 3NK6A 5IJ9A 1U40A 3CMAF 5LA6B 1KNJA 2Z1EA 3R0PA 3WPXA 1ZWZA 4BVRA 3ESJA 1YITF 2ZAUA 3FFMA 4I50B 3WPWA 4KWEA 2Q1XA 3E20B 1ONIA 1QAHA 3N2KA 1JFFA 2IAFA 3F0DA 2CWJA 2UYNB 3JATB 4O4JA 1FNKA 1JJ2F 1COMA 5EO3A 3LWVC 2UYKA 1M90H 3V7QA 5KMGA 1GO1A 4TUYB 2OTJF 5CA0B 3SIUA 5EB1B 4G4WA 1RQ7A 3I56F 4F6RA 3NK7A 3CYQA 4YJ2B 4C82A 5LP6B 1IV4A 1T0KB 4C4WC 4BT4A 5HP7A 4WBNA 1FNJA 5ITZA 1T0AA 4TV8B 4BT7A 3FBAA 4TZZA 2HVYD 3DC2A 3Q8HA 1YQNA 3CC4F 3JALB 3IMPA 3DDNA 4I50A 3RYFB 2RB9A 2CZWA 2LCAA 3JASA 4O4LA 4EI8A 2K1SA 3T80A 1VHAA 1VQOF 2UZHA 2H6LA 4YJ3B 1XHOA 3U0OA 3WJRA 1YIJF 1VK3A 3M84A 2B33A 3WJPA 3CC2F 3HTNA 5EZYB 5IT9M 3WGMA 3ZOPA 3I55F 3VMFB 3UT5A 4X1KB 5JVDA 4EB6A 3S0YA 3V3TA 3LYBA 1OFUA 3HAXD 2H8EA 1KNKA 5FNVA 4ZHVA 3JARB 2HQSC 2H8CA 3LDTA 1Q86H 3CYPB 3LWOC 4O2BA 3WGKA 3C9UA 1JFFB 2WALA 5GONB 1NJIH 4HNAA 5KX5A 1JD1A 5HP8A 3RYCA 5GINC 3D01A 3WGLA 2HRUA 5IJ0B 3P0ZA 4EI7A 1VQ7F 3RYIA 3HKDB 3CCSF 1IV3A 5J2TB 5HY0A 3J80M 3CG6A 3CCEF 4FFBA 4X20B 4G4VA 5LXTB 2JNBA 1RLUA 3N2GB 1Q82H 3CCRF 2UYPA 1E7KA 1VQMF 1VQ9F 3ON1A 3CCUF 1FSZA 3JAKA 3F0FA 5EWRA 3RYHB 3HKEA 4PWTA 3S02A 1N8RH 1KQSF 2ZVZA 4R40B 3WGJA 3CCJF 3E1YA 4ZHYB 5LYJA 1IV2A 2N48A 4EB6B 3CC7F 2ZVYA 2HX0A 3JALA 3ERNA 5JQGB 3RYFA 5HXUA 2ZF8A 2LBTA 5CA0A 1X52A 3VIUA 3S03A 1M1KH 5BMVA 3B6NA 5JH7A 1VQKF 1JN1A 4BT3A 1TVKB 5GIPC 3J81M 3N2KB 1Q81H 2KTVA 4X20A 3MCAB 4O4JB 3F0EA 4O2AB 2VAWA 4U3JA 4B45A 1SA0B 4M8IA 3OBYA 4O4HB 3HKBA 1K8AH 3TD5A 1Q7YH 3RYHA 4O2BB 4ZOLB 4ZI7B 1QU9A 1YI2F 1VH8A 2OTMA 2VGNA 2I6DA 3RYCB 5IJ9B 2UYNA 3JATA 3UT5B 1QVGF 5LA6A 3P4EA 1QVFF 2IQQA 3D00A 2AMTA 3CCQF 3VOAA 3S0WA 1XBIA 5J2TA 1SDSA 2HRYA 5HY2A 1VQ8F 1VQVA 4ZHQA 3E22B 4LNUB 5JCOA 5KX5B 2MQEA 2QEXF 3FPIA 1YGYA 3M4SA 1J7HA 5FNVB 2LBWA 1W42A 4ZI7A 3I3FA 3QTYA 3J7AR 5EIBD 2FGYA 4IHJA 2GVIA 3WJQA 5EZYA 4C8GA 3RE3A 1OAPA 2KGWA 4X3MA 1UFYA 1U3PA 2VGMA 3JARA 3LWPC 3BYQA 1H7MA 5DCVA 1TUBB 1YHQF 1SZQA 2RHHA 1W2BF 1YJWF 4YJ3A 4BT5A 4BW0B 2HP3A 2R751 4X1YB 3K12A 4O2AA 4IIJB 4EI9A 5ITZB 3HKBB 3GHZA 1YJNF 4DRXB 4X1KA 5JVDB 5MN6A 2QA4F 5J2UA 3N2GA 4G4ZA 4RHAA 1W41A 5CA1A 2ZODA 4ZK7A 5HY1A 4IHJB 2ZOVA 5EB0A 5IJ0A 2HP0A 5EYPB 1IPAA 3IEWA 3HKEB 1JY8A 5LP6C 1KC8H 4X1IA 3NVIB 1XV2A 2OZBA 1Z5WA 3PAFA 1RQ2A 3D54A 5LXTA 1U43A 3KJKA 3C9RA 3ZP7A 3VYUC 3O85A 2IG8A 3JAWB 1W55A 2L26A 3MDOA 2VAMA 1VQPF 3E22A 1S72F 3HKDA 4C8EA 2YXZA 3IEQA 3V7EA 1YJ9F 4O4IA 3FD5A 2KTUA 2BTOA 4HNAB 3S06A 3TD3A 3G71F 3OONA 5FLXM 5IYZB 3CCMF 4I55A 3LFOA 3V4DA 3CCVF 3ELCA 3ZO8A 1GO0A 2OHWA 1GZ0A 1CK2A 4LNUA 3C9TA 1VQ5F 5B8FA 2RHOA 5GIOC 1Z5VA 4NUTA 5CB4B 2CHSA 2F9ZC 5A2QM 2BTQB 4O4HA 4RQOA 1X7OA 3LWRC 2Z01A 3MBMA 4F6RB 3AGKA 1U3LA 1ODEA 5JCOC 4ZOLA 2CVLA 4X3LA 2Z1FA 3VI6A 3EORA 1PF5A 1UI9A 3HKCB 2P6YA 1VQLF 2VAPA 2Z1TA 4I4TB 4TUYA 1X25A 3QUWA 1H47A 3ZP4A 3JASB 4O4LB 5G4VC 1Q8RA 5CA1B 2CW4A 5JQGA 4C81A 1KD1H 5LP6A 4YJ2A 5BMVB 1XRGA 2W8BC 1W5EA 4WBNB 3C8LA 3PLAC 3CCLF 4X1IB 2G9IA 1NMUB 4BVSA 3IKFA 2RHLA 4TV8A 4IIJA 2VXYA 1VQNF 3NVKE 5LOVB 5IYZA 5MN4A 5J2UB 4I55B 3VO8A 1SA0A 3LMEA 4TV9B 3WXMB 1W40A 1H48A 1DBFA 3JAWA 3P10A 2FC3A 3VYSC 1IV1A 3OW2F 4BVQA
chains in the Genus database with same CATH topology
3CYQA 2ZVZA 3KHNA 4R40B 3S0WA 4G4ZA 3S0YA 4ZHYB 4RHAA 1OAPA 2N48A 2KGWA 2W8BC 3TD5A 2ZOVA 2ZVYA 5EB0A 3WPWA 4ZHVA 2HQSC 2MQEA 3LDTA 1R1MA 4B5CA 3S06A 2ZF8A 3CYPB 5EAZA 2LBTA 2AIZP 3S02A 3TD3A 3IMPA 4G4XA 3S03A 3OONA 4G4VA 4G88A 4B62A 2LCAA 2K1SA 4G4YA 4ZHWA 3TD4A 4ERHA 5EB1B 4G4WA 4PWTA 3WPXA 2L26A 3S0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYQ A;  2ZVZ A;  3KHN A;  4R40 B;  3S0W A;  4G4Z A;  3S0Y A;  4ZHY B;  4RHA A;  1OAP A;  2N48 A;  2KGW A;  2W8B C;  3TD5 A;  2ZOV A;  2ZVY A;  5EB0 A;  3WPW A;  4ZHV A;  2HQS C;  2MQE A;  3LDT A;  1R1M A;  4B5C A;  3S06 A;  2ZF8 A;  3CYP B;  5EAZ A;  2LBT A;  2AIZ P;  3S02 A;  3TD3 A;  3IMP A;  4G4X A;  3S03 A;  3OON A;  4G4V A;  4G88 A;  4B62 A;  2LCA A;  2K1S A;  4G4Y A;  4ZHW A;  3TD4 A;  4ERH A;  5EB1 B;  4G4W A;  4PWT A;  3WPX A;  2L26 A;  3S0H A; 
#chains in the Genus database with same CATH topology
 2DT4 A;  2Z1U A;  3KJJ A;  4I4T A;  5MN5 A;  2ALE A;  2HS0 A;  1VQ6 F;  3K14 A;  2I6R A;  1X7P A;  2LBX A;  5HY4 A;  3OBW A;  3CME F;  3RA5 A;  3QHD A;  3JAM M;  4B46 A;  2BTU A;  3HJW C;  3CD6 F;  3VCZ A;  4G88 A;  2R6R 1;  2PHN A;  3GYQ A;  4FFB B;  5GAN K;  4XCQ A;  1QD9 A;  4NQ3 A;  4ERH A;  2CSL A;  4ZHQ B;  3MCQ A;  2PMP A;  4NWO B;  1PXW A;  3IKE A;  4LCK A;  3S0H A;  1K9M H;  2RHJ A;  4TV9 A;  2Q1Y A;  5C8Y B;  3F6M A;  4BY9 D;  4DRX A;  3HWU A;  3KIZ A;  5GAP K;  2DYY A;  3CB2 A;  3IR9 A;  4B5C A;  2AIZ P;  2HP0 B;  5EYP A;  3NMU C;  1VQ4 F;  3M1X A;  3MQW A;  5HWE A;  4B62 A;  4DXD A;  4BT6 A;  4X1Y A;  5AVM A;  5LOV A;  1NQ3 A;  1W5B A;  3K2X A;  1FFX A;  2KG4 A;  2QTP A;  3I7T A;  3GTZ A;  5JH7 B;  1RA4 A;  1W5F A;  2QI2 A;  2HS4 A;  2OTL F;  1TVK A;  2AIF A;  2V9Y A;  3KHN A;  3KE1 A;  3N4Y A;  1K73 H;  3L7Q A;  5FJ4 C;  3G6E F;  3K0T A;  3VYT C;  3SIV A;  1TUB A;  5EIB C;  5LYJ B;  2BO1 A;  1W59 A;  1CN7 A;  4BT2 A;  4U3J B;  3VTI C;  4U39 A;  2GLZ A;  1R1M A;  3JVH A;  5HXZ A;  2EWC A;  3C9S A;  5EAZ A;  5C8Y A;  1W3E X;  4E6E A;  5CB4 A;  3FD6 A;  1W58 1;  1W5A A;  2GZL A;  4G4Y A;  3RA6 A;  3JAK B;  4ZHW A;  4C8I A;  2CHT A;  4BVT A;  3TD4 A;  5G4U C;  1GX1 A;  2HS3 A;  5GON A;  1FFX B;  4O4I B;  1W57 A;  3HKC A;  3CPQ A;  3CPW F;  1RLG A;  2YYE A;  2NMU A;  5KMG B;  2UYJ A;  3N4Z A;  4G4X A;  3LWQ C;  1DT9 A;  3F0G A;  3VOB A;  3RYI B;  3WGN A;  1CLI A;  3JCM M;  3CXC F;  3G4S F;  3NK6 A;  5IJ9 A;  1U40 A;  3CMA F;  5LA6 B;  1KNJ A;  2Z1E A;  3R0P A;  3WPX A;  1ZWZ A;  4BVR A;  3ESJ A;  1YIT F;  2ZAU A;  3FFM A;  4I50 B;  3WPW A;  4KWE A;  2Q1X A;  3E20 B;  1ONI A;  1QAH A;  3N2K A;  1JFF A;  2IAF A;  3F0D A;  2CWJ A;  2UYN B;  3JAT B;  4O4J A;  1FNK A;  1JJ2 F;  1COM A;  5EO3 A;  3LWV C;  2UYK A;  1M90 H;  3V7Q A;  5KMG A;  1GO1 A;  4TUY B;  2OTJ F;  5CA0 B;  3SIU A;  5EB1 B;  4G4W A;  1RQ7 A;  3I56 F;  4F6R A;  3NK7 A;  3CYQ A;  4YJ2 B;  4C82 A;  5LP6 B;  1IV4 A;  1T0K B;  4C4W C;  4BT4 A;  5HP7 A;  4WBN A;  1FNJ A;  5ITZ A;  1T0A A;  4TV8 B;  4BT7 A;  3FBA A;  4TZZ A;  2HVY D;  3DC2 A;  3Q8H A;  1YQN A;  3CC4 F;  3JAL B;  3IMP A;  3DDN A;  4I50 A;  3RYF B;  2RB9 A;  2CZW A;  2LCA A;  3JAS A;  4O4L A;  4EI8 A;  2K1S A;  3T80 A;  1VHA A;  1VQO F;  2UZH A;  2H6L A;  4YJ3 B;  1XHO A;  3U0O A;  3WJR A;  1YIJ F;  1VK3 A;  3M84 A;  2B33 A;  3WJP A;  3CC2 F;  3HTN A;  5EZY B;  5IT9 M;  3WGM A;  3ZOP A;  3I55 F;  3VMF B;  3UT5 A;  4X1K B;  5JVD A;  4EB6 A;  3S0Y A;  3V3T A;  3LYB A;  1OFU A;  3HAX D;  2H8E A;  1KNK A;  5FNV A;  4ZHV A;  3JAR B;  2HQS C;  2H8C A;  3LDT A;  1Q86 H;  3CYP B;  3LWO C;  4O2B A;  3WGK A;  3C9U A;  1JFF B;  2WAL A;  5GON B;  1NJI H;  4HNA A;  5KX5 A;  1JD1 A;  5HP8 A;  3RYC A;  5GIN C;  3D01 A;  3WGL A;  2HRU A;  5IJ0 B;  3P0Z A;  4EI7 A;  1VQ7 F;  3RYI A;  3HKD B;  3CCS F;  1IV3 A;  5J2T B;  5HY0 A;  3J80 M;  3CG6 A;  3CCE F;  4FFB A;  4X20 B;  4G4V A;  5LXT B;  2JNB A;  1RLU A;  3N2G B;  1Q82 H;  3CCR F;  2UYP A;  1E7K A;  1VQM F;  1VQ9 F;  3ON1 A;  3CCU F;  1FSZ A;  3JAK A;  3F0F A;  5EWR A;  3RYH B;  3HKE A;  4PWT A;  3S02 A;  1N8R H;  1KQS F;  2ZVZ A;  4R40 B;  3WGJ A;  3CCJ F;  3E1Y A;  4ZHY B;  5LYJ A;  1IV2 A;  2N48 A;  4EB6 B;  3CC7 F;  2ZVY A;  2HX0 A;  3JAL A;  3ERN A;  5JQG B;  3RYF A;  5HXU A;  2ZF8 A;  2LBT A;  5CA0 A;  1X52 A;  3VIU A;  3S03 A;  1M1K H;  5BMV A;  3B6N A;  5JH7 A;  1VQK F;  1JN1 A;  4BT3 A;  1TVK B;  5GIP C;  3J81 M;  3N2K B;  1Q81 H;  2KTV A;  4X20 A;  3MCA B;  4O4J B;  3F0E A;  4O2A B;  2VAW A;  4U3J A;  4B45 A;  1SA0 B;  4M8I A;  3OBY A;  4O4H B;  3HKB A;  1K8A H;  3TD5 A;  1Q7Y H;  3RYH A;  4O2B B;  4ZOL B;  4ZI7 B;  1QU9 A;  1YI2 F;  1VH8 A;  2OTM A;  2VGN A;  2I6D A;  3RYC B;  5IJ9 B;  2UYN A;  3JAT A;  3UT5 B;  1QVG F;  5LA6 A;  3P4E A;  1QVF F;  2IQQ A;  3D00 A;  2AMT A;  3CCQ F;  3VOA A;  3S0W A;  1XBI A;  5J2T A;  1SDS A;  2HRY A;  5HY2 A;  1VQ8 F;  1VQV A;  4ZHQ A;  3E22 B;  4LNU B;  5JCO A;  5KX5 B;  2MQE A;  2QEX F;  3FPI A;  1YGY A;  3M4S A;  1J7H A;  5FNV B;  2LBW A;  1W42 A;  4ZI7 A;  3I3F A;  3QTY A;  3J7A R;  5EIB D;  2FGY A;  4IHJ A;  2GVI A;  3WJQ A;  5EZY A;  4C8G A;  3RE3 A;  1OAP A;  2KGW A;  4X3M A;  1UFY A;  1U3P A;  2VGM A;  3JAR A;  3LWP C;  3BYQ A;  1H7M A;  5DCV A;  1TUB B;  1YHQ F;  1SZQ A;  2RHH A;  1W2B F;  1YJW F;  4YJ3 A;  4BT5 A;  4BW0 B;  2HP3 A;  2R75 1;  4X1Y B;  3K12 A;  4O2A A;  4IIJ B;  4EI9 A;  5ITZ B;  3HKB B;  3GHZ A;  1YJN F;  4DRX B;  4X1K A;  5JVD B;  5MN6 A;  2QA4 F;  5J2U A;  3N2G A;  4G4Z A;  4RHA A;  1W41 A;  5CA1 A;  2ZOD A;  4ZK7 A;  5HY1 A;  4IHJ B;  2ZOV A;  5EB0 A;  5IJ0 A;  2HP0 A;  5EYP B;  1IPA A;  3IEW A;  3HKE B;  1JY8 A;  5LP6 C;  1KC8 H;  4X1I A;  3NVI B;  1XV2 A;  2OZB A;  1Z5W A;  3PAF A;  1RQ2 A;  3D54 A;  5LXT A;  1U43 A;  3KJK A;  3C9R A;  3ZP7 A;  3VYU C;  3O85 A;  2IG8 A;  3JAW B;  1W55 A;  2L26 A;  3MDO A;  2VAM A;  1VQP F;  3E22 A;  1S72 F;  3HKD A;  4C8E A;  2YXZ A;  3IEQ A;  3V7E A;  1YJ9 F;  4O4I A;  3FD5 A;  2KTU A;  2BTO A;  4HNA B;  3S06 A;  3TD3 A;  3G71 F;  3OON A;  5FLX M;  5IYZ B;  3CCM F;  4I55 A;  3LFO A;  3V4D A;  3CCV F;  3ELC A;  3ZO8 A;  1GO0 A;  2OHW A;  1GZ0 A;  1CK2 A;  4LNU A;  3C9T A;  1VQ5 F;  5B8F A;  2RHO A;  5GIO C;  1Z5V A;  4NUT A;  5CB4 B;  2CHS A;  2F9Z C;  5A2Q M;  2BTQ B;  4O4H A;  4RQO A;  1X7O A;  3LWR C;  2Z01 A;  3MBM A;  4F6R B;  3AGK A;  1U3L A;  1ODE A;  5JCO C;  4ZOL A;  2CVL A;  4X3L A;  2Z1F A;  3VI6 A;  3EOR A;  1PF5 A;  1UI9 A;  3HKC B;  2P6Y A;  1VQL F;  2VAP A;  2Z1T A;  4I4T B;  4TUY A;  1X25 A;  3QUW A;  1H47 A;  3ZP4 A;  3JAS B;  4O4L B;  5G4V C;  1Q8R A;  5CA1 B;  2CW4 A;  5JQG A;  4C81 A;  1KD1 H;  5LP6 A;  4YJ2 A;  5BMV B;  1XRG A;  2W8B C;  1W5E A;  4WBN B;  3C8L A;  3PLA C;  3CCL F;  4X1I B;  2G9I A;  1NMU B;  4BVS A;  3IKF A;  2RHL A;  4TV8 A;  4IIJ A;  2VXY A;  1VQN F;  3NVK E;  5LOV B;  5IYZ A;  5MN4 A;  5J2U B;  4I55 B;  3VO8 A;  1SA0 A;  3LME A;  4TV9 B;  3WXM B;  1W40 A;  1H48 A;  1DBF A;  3JAW A;  3P10 A;  2FC3 A;  3VYS C;  1IV1 A;  3OW2 F;  4BVQ A; 
#chains in the Genus database with same CATH homology
 3CYQ A;  2ZVZ A;  3KHN A;  4R40 B;  3S0W A;  4G4Z A;  3S0Y A;  4ZHY B;  4RHA A;  1OAP A;  2N48 A;  2KGW A;  2W8B C;  3TD5 A;  2ZOV A;  2ZVY A;  5EB0 A;  3WPW A;  4ZHV A;  2HQS C;  2MQE A;  3LDT A;  1R1M A;  4B5C A;  3S06 A;  2ZF8 A;  3CYP B;  5EAZ A;  2LBT A;  2AIZ P;  3S02 A;  3TD3 A;  3IMP A;  4G4X A;  3S03 A;  3OON A;  4G4V A;  4G88 A;  4B62 A;  2LCA A;  2K1S A;  4G4Y A;  4ZHW A;  3TD4 A;  4ERH A;  5EB1 B;  4G4W A;  4PWT A;  3WPX A;  2L26 A;  3S0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...