4ERHA

The crystal structure of ompa domain of ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
EVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of OmpA domain of OmpA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. 14028s
molecule tags Membrane protein
molecule keywords Outer membrane protein A
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4erhA00
2AIZP 4ZHYB 3TD3A 4G4WA 3S03A 4G88A 5EB0A 3S0WA 2ZVZA 3TD5A 4B62A 4ZHVA 3WPWA 3LDTA 4G4ZA 4ZHWA 4G4VA 2LBTA 2ZVYA 3WPXA 3S06A 4B5CA 3S0HA 4PWTA 2KGWA 4R40B 3S02A 4G4XA 3TD4A 4G4YA 2ZOVA 3S0YA 3CYQA 2HQSC 3KHNA 2MQEA 3CYPB 4ERHA 2W8BC 4RHAA 5EB1B 5EAZA 2LCAA 2N48A 2ZF8A 3IMPA 2L26A 3OONA 1R1MA 2K1SA 1OAPA
chains in the Genus database with same CATH superfamily
5G4VC 3LWVC 2OTLF 4BT2A 1FFXA 1JFFB 5J2TB 4FFBB 4HNAA 3DC2A 3M1XA 1XRGA 2UYNA 3LWOC 2R751 1VQ5F 5JH7A 2CZWA 3ESJA 5IYZB 2HQSC 5DCVA 1KNKA 5EYPA 1DT9A 3NMUC 4BT7A 2HRYA 5FNVA 4HNAB 3IKFA 5EZYA 1YQNA 5IT9M 4C82A 4DRXA 3R0PA 2HS4A 3MQWA 1NQ3A 4X1YA 3HKEB 2UYPA 4C81A 4BT4A 3F6MA 2LBTA 3F0FA 4BVRA 5JQGA 3S0HA 3OBYA 4O4IA 5KMGA 4TV9B 4G4XA 3F0DA 3K12A 3RYCB 3VIUA 3LWRC 3JCMM 3AGKA 3TD5A 1RQ7A 3VCZA 3VYTC 4ZI7B 1XBIA 2CVLA 1VQ7F 1W3EX 1VQMF 1W5FA 2IAFA 3N2GA 5CB4A 5LP6A 2Q1YA 3E22A 3CMEF 3FBAA 1U40A 4IIJB 3N4YA 4LNUB 3I3FA 2QEXF 3CD6F 1X52A 1YGYA 4BW0B 4B45A 3HWUA 1J7HA 2I6DA 5EB1B 1VK3A 5EZYB 3WGLA 3ZOPA 3NK7A 5CB4B 1VQ9F 3HKCA 4F6RB 4ZHYB 3ZO8A 2HX0A 4X1IA 5MN5A 4G4WA 2FGYA 4TV8A 5CA1B 2ZAUA 1M1KH 3JARA 3JATA 1YIJF 2H8EA 3J7AR 2CSLA 4BVQA 1S72F 5GANK 2HVYD 3F0GA 1U3LA 1GZ0A 2H8CA 4O4HB 4X20A 4ZHQB 2R6R1 4B46A 1IPAA 1XHOA 5BMVB 3UT5B 1SDSA 2VGMA 4X1KB 1CLIA 2BTUA 5HWEA 1X7PA 5ITZA 5EWRA 3EORA 3C9RA 4BVSA 1VQKF 3C9UA 1IV1A 4X3MA 2ZVZA 3N2GB 2LBWA 3WJRA 1YJWF 5GONA 5JCOA 3VTIC 5LYJB 3K0TA 3BYQA 5EO3A 3CCRF 3PLAC 3CCEF 4ZK7A 2UYJA 2FC3A 5IJ0B 3CCJF 1UI9A 2LCAA 3HKDA 3WGMA 1JN1A 2Z1UA 2OTMA 3RYIA 2RB9A 2YYEA 3HAXD 3NK6A 4M8IA 1TVKB 5C8YB 1TUBB 3ELCA 1VQNF 1RQ2A 2RHOA 2CHTA 3RE3A 3VYSC 3K14A 4O2BB 4ZHVA 3LDTA 1U3PA 3NVIB 3IKEA 1T0AA 2V9YA 2VXYA 4C8IA 1KD1H 2QI2A 1W41A 3JALB 3RYFA 1FFXB 5IJ9A 1VQ8F 4X1KA 3FFMA 3E1YA 4U3JA 5GAPK 3OW2F 5EIBD 1Z5WA 1M90H 3ERNA 1OAPA 3JAWA 4BT6A 3KE1A 4BVTA 3FD6A 3VYUC 5EB0A 1YHQF 5G4UC 3KJKA 4O4LB 3ZP4A 3P0ZA 1Q81H 3CCMF 3J80M 1K8AH 3S02A 3WJQA 3I7TA 3CC4F 2AIFA 5J2UA 4KWEA 5LP6B 3DDNA 5JCOC 2W8BC 4RHAA 2HP3A 4WBNA 3CXCF 1W2BF 5AVMA 2UYKA 3CG6A 3PAFA 3J81M 3QTYA 2K1SA 1VH8A 1ZWZA 5HY4A 4TV9A 1VQ6F 1X25A 3JAKB 4YJ2A 2HRUA 3D54A 4G88A 3QHDA 5JVDB 3QUWA 3G6EF 4ZHWA 2BTQB 4RQOA 3LWPC 4PWTA 3GYQA 1VQLF 3I55F 2CHSA 4BT5A 3CCUF 3RA6A 4IHJA 3LMEA 2HS0A 5FNVB 3KHNA 3M84A 5KX5A 2B33A 1Z5VA 2Z1FA 3LWQC 3P10A 4O4JA 1YJNF 4ZOLB 1KQSF 3L7QA 1W42A 3NVKE 3P4EA 4O4LA 4DXDA 4EB6A 1YITF 1Q7YH 4TUYA 5C8YA 2KTUA 4EI8A 5LOVA 4O2BA 1SA0B 1RA4A 3WGJA 4R40B 2DT4A 3I56F 3MBMA 1W55A 2ZOVA 3JVHA 3HKCB 4F6RA 5MN4A 1T0KB 5IYZA 4TV8B 5LP6C 5CA0B 2WALA 1VQ4F 3FPIA 3HKBB 5HY1A 3LFOA 3VOBA 4I55A 3M4SA 1FNJA 3CMAF 1JD1A 3S03A 1FNKA 2BO1A 3CPWF 4C8EA 4I4TB 3IEWA 4I50B 1W5EA 5B8FA 3OBWA 4BY9D 2VAPA 3HKEA 3RYIB 3CCLF 2I6RA 3S06A 3VOAA 4B5CA 4IHJB 5LA6B 1VQVA 3O85A 3WGKA 1QD9A 3JASB 1E7KA 4O2AA 2EWCA 2P6YA 3K2XA 2Z1EA 1PF5A 3RYCA 5GIPC 5HY0A 3N2KA 2N48A 3C8LA 2VGNA 3IMPA 3WXMB 2GLZA 1XV2A 3JALA 3RYFB 2H6LA 2HP0A 3MCAB 3JATB 1K73H 4ZI7A 4U3JB 3VI6A 2NMUA 2RHLA 3HJWC 3JASA 3CCVF 2G9IA 3GTZA 5IJ0A 1Q8RA 1ODEA 1IV2A 3N2KB 1CK2A 4LNUA 4G4YA 3KIZA 1FSZA 1JFFA 1TVKA 2KG4A 2Z01A 5FLXM 2KTVA 3B6NA 1QVFF 1Q82H 1W5AA 3OONA 3T80A 4X1IB 5LYJA 1JJ2F 3D01A 3C9TA 3C9SA 1VHAA 1H7MA 1GO0A 4B62A 4EI9A 3JARB 3WPXA 2PHNA 2DYYA 3LYBA 3IEQA 2UZHA 1VQPF 1SA0A 1NJIH 4X20B 4NWOB 4ZHQA 5A2QM 3CB2A 4DRXB 2AMTA 4O4HA 2CWJA 2LBXA 3HTNA 2BTOA 3E22B 1COMA 1ONIA 1GX1A 4YJ3A 2JNBA 4IIJA 1K9MH 4C4WC 3HKBA 5JQGB 2PMPA 2L26A 3D00A 2AIZP 4FFBA 3V3TA 4C8GA 5GIOC 2F9ZC 1UFYA 1CN7A 3KJJA 1W57A 2ZODA 3SIVA 2GVIA 4I50A 3VMFB 2VAMA 4WBNB 4G4ZA 5GONB 4E6EA 2Q1XA 2HS3A 5LXTA 3VO8A 3MDOA 5LOVB 1Q86H 3SIUA 1W5BA 2RHJA 1SZQA 3S0YA 4O2AB 3CCSF 4NQ3A 3CC7F 2OHWA 1U43A 5EAZA 5JVDA 1IV4A 4X1YB 1H47A 3F0EA 3HKDB 3E20B 1DBFA 2YXZA 2HP0B 3TD3A 2QA4F 5FJ4C 4O4IB 4LCKA 5EIBC 5ITZB 1PXWA 5HXZA 1YJ9F 4ZOLA 3CC2F 1VQOF 4XCQA 1W59A 1X7OA 1JY8A 3GHZA 4EI7A 5HP8A 4EB6B 2IQQA 3ON1A 5MN6A 3U0OA 2ZF8A 5HXUA 5HP7A 3Q8HA 3V7QA 1RLGA 3CCQF 3JAWB 2ALEA 1RLUA 1KNJA 4U39A 3IR9A 3UT5A 2OTJF 5CA0A 5BMVA 1OFUA 1W581 3MCQA 5LXTB 5J2TA 3V7EA 3RA5A 2Z1TA 4I55B 2KGWA 1W40A 3G71F 1KC8H 2OZBA 4O4JB 3CYQA 3CYPB 2MQEA 4I4TA 5JH7B 1QAHA 1IV3A 4YJ3B 5EYPB 5CA1A 1NMUB 5IJ9B 1N8RH 4TUYB 1R1MA 2VAWA 3N4ZA 5LA6A 2QTPA 2CW4A 3JAKA 4YJ2B 3S0WA 2IG8A 4X3LA 3WPWA 1YI2F 4G4VA 2ZVYA 3RYHB 3FD5A 3V4DA 3WJPA 4BT3A 2RHHA 2GZLA 3JAMM 3TD4A 1H48A 3CPQA 5KMGB 5GINC 3WGNA 1TUBA 4NUTA 4ERHA 1GO1A 4TZZA 5KX5B 1QVGF 2UYNB 3ZP7A 5J2UB 3G4SF 1QU9A 5HY2A 3RYHA
chains in the Genus database with same CATH topology
2AIZP 4ZHYB 3TD3A 4G4WA 3S03A 4G88A 5EB0A 3S0WA 2ZVZA 3TD5A 4B62A 4ZHVA 3WPWA 3LDTA 4G4ZA 4ZHWA 4G4VA 2LBTA 2ZVYA 3WPXA 3S06A 4B5CA 3S0HA 4PWTA 2KGWA 4R40B 3S02A 4G4XA 3TD4A 4G4YA 2ZOVA 3S0YA 3CYQA 2HQSC 3KHNA 2MQEA 3CYPB 4ERHA 2W8BC 4RHAA 5EB1B 5EAZA 2LCAA 2N48A 2ZF8A 3IMPA 2L26A 3OONA 1R1MA 2K1SA 1OAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIZ P;  4ZHY B;  3TD3 A;  4G4W A;  3S03 A;  4G88 A;  5EB0 A;  3S0W A;  2ZVZ A;  3TD5 A;  4B62 A;  4ZHV A;  3WPW A;  3LDT A;  4G4Z A;  4ZHW A;  4G4V A;  2LBT A;  2ZVY A;  3WPX A;  3S06 A;  4B5C A;  3S0H A;  4PWT A;  2KGW A;  4R40 B;  3S02 A;  4G4X A;  3TD4 A;  4G4Y A;  2ZOV A;  3S0Y A;  3CYQ A;  2HQS C;  3KHN A;  2MQE A;  3CYP B;  4ERH A;  2W8B C;  4RHA A;  5EB1 B;  5EAZ A;  2LCA A;  2N48 A;  2ZF8 A;  3IMP A;  2L26 A;  3OON A;  1R1M A;  2K1S A;  1OAP A; 
#chains in the Genus database with same CATH topology
 5G4V C;  3LWV C;  2OTL F;  4BT2 A;  1FFX A;  1JFF B;  5J2T B;  4FFB B;  4HNA A;  3DC2 A;  3M1X A;  1XRG A;  2UYN A;  3LWO C;  2R75 1;  1VQ5 F;  5JH7 A;  2CZW A;  3ESJ A;  5IYZ B;  2HQS C;  5DCV A;  1KNK A;  5EYP A;  1DT9 A;  3NMU C;  4BT7 A;  2HRY A;  5FNV A;  4HNA B;  3IKF A;  5EZY A;  1YQN A;  5IT9 M;  4C82 A;  4DRX A;  3R0P A;  2HS4 A;  3MQW A;  1NQ3 A;  4X1Y A;  3HKE B;  2UYP A;  4C81 A;  4BT4 A;  3F6M A;  2LBT A;  3F0F A;  4BVR A;  5JQG A;  3S0H A;  3OBY A;  4O4I A;  5KMG A;  4TV9 B;  4G4X A;  3F0D A;  3K12 A;  3RYC B;  3VIU A;  3LWR C;  3JCM M;  3AGK A;  3TD5 A;  1RQ7 A;  3VCZ A;  3VYT C;  4ZI7 B;  1XBI A;  2CVL A;  1VQ7 F;  1W3E X;  1VQM F;  1W5F A;  2IAF A;  3N2G A;  5CB4 A;  5LP6 A;  2Q1Y A;  3E22 A;  3CME F;  3FBA A;  1U40 A;  4IIJ B;  3N4Y A;  4LNU B;  3I3F A;  2QEX F;  3CD6 F;  1X52 A;  1YGY A;  4BW0 B;  4B45 A;  3HWU A;  1J7H A;  2I6D A;  5EB1 B;  1VK3 A;  5EZY B;  3WGL A;  3ZOP A;  3NK7 A;  5CB4 B;  1VQ9 F;  3HKC A;  4F6R B;  4ZHY B;  3ZO8 A;  2HX0 A;  4X1I A;  5MN5 A;  4G4W A;  2FGY A;  4TV8 A;  5CA1 B;  2ZAU A;  1M1K H;  3JAR A;  3JAT A;  1YIJ F;  2H8E A;  3J7A R;  2CSL A;  4BVQ A;  1S72 F;  5GAN K;  2HVY D;  3F0G A;  1U3L A;  1GZ0 A;  2H8C A;  4O4H B;  4X20 A;  4ZHQ B;  2R6R 1;  4B46 A;  1IPA A;  1XHO A;  5BMV B;  3UT5 B;  1SDS A;  2VGM A;  4X1K B;  1CLI A;  2BTU A;  5HWE A;  1X7P A;  5ITZ A;  5EWR A;  3EOR A;  3C9R A;  4BVS A;  1VQK F;  3C9U A;  1IV1 A;  4X3M A;  2ZVZ A;  3N2G B;  2LBW A;  3WJR A;  1YJW F;  5GON A;  5JCO A;  3VTI C;  5LYJ B;  3K0T A;  3BYQ A;  5EO3 A;  3CCR F;  3PLA C;  3CCE F;  4ZK7 A;  2UYJ A;  2FC3 A;  5IJ0 B;  3CCJ F;  1UI9 A;  2LCA A;  3HKD A;  3WGM A;  1JN1 A;  2Z1U A;  2OTM A;  3RYI A;  2RB9 A;  2YYE A;  3HAX D;  3NK6 A;  4M8I A;  1TVK B;  5C8Y B;  1TUB B;  3ELC A;  1VQN F;  1RQ2 A;  2RHO A;  2CHT A;  3RE3 A;  3VYS C;  3K14 A;  4O2B B;  4ZHV A;  3LDT A;  1U3P A;  3NVI B;  3IKE A;  1T0A A;  2V9Y A;  2VXY A;  4C8I A;  1KD1 H;  2QI2 A;  1W41 A;  3JAL B;  3RYF A;  1FFX B;  5IJ9 A;  1VQ8 F;  4X1K A;  3FFM A;  3E1Y A;  4U3J A;  5GAP K;  3OW2 F;  5EIB D;  1Z5W A;  1M90 H;  3ERN A;  1OAP A;  3JAW A;  4BT6 A;  3KE1 A;  4BVT A;  3FD6 A;  3VYU C;  5EB0 A;  1YHQ F;  5G4U C;  3KJK A;  4O4L B;  3ZP4 A;  3P0Z A;  1Q81 H;  3CCM F;  3J80 M;  1K8A H;  3S02 A;  3WJQ A;  3I7T A;  3CC4 F;  2AIF A;  5J2U A;  4KWE A;  5LP6 B;  3DDN A;  5JCO C;  2W8B C;  4RHA A;  2HP3 A;  4WBN A;  3CXC F;  1W2B F;  5AVM A;  2UYK A;  3CG6 A;  3PAF A;  3J81 M;  3QTY A;  2K1S A;  1VH8 A;  1ZWZ A;  5HY4 A;  4TV9 A;  1VQ6 F;  1X25 A;  3JAK B;  4YJ2 A;  2HRU A;  3D54 A;  4G88 A;  3QHD A;  5JVD B;  3QUW A;  3G6E F;  4ZHW A;  2BTQ B;  4RQO A;  3LWP C;  4PWT A;  3GYQ A;  1VQL F;  3I55 F;  2CHS A;  4BT5 A;  3CCU F;  3RA6 A;  4IHJ A;  3LME A;  2HS0 A;  5FNV B;  3KHN A;  3M84 A;  5KX5 A;  2B33 A;  1Z5V A;  2Z1F A;  3LWQ C;  3P10 A;  4O4J A;  1YJN F;  4ZOL B;  1KQS F;  3L7Q A;  1W42 A;  3NVK E;  3P4E A;  4O4L A;  4DXD A;  4EB6 A;  1YIT F;  1Q7Y H;  4TUY A;  5C8Y A;  2KTU A;  4EI8 A;  5LOV A;  4O2B A;  1SA0 B;  1RA4 A;  3WGJ A;  4R40 B;  2DT4 A;  3I56 F;  3MBM A;  1W55 A;  2ZOV A;  3JVH A;  3HKC B;  4F6R A;  5MN4 A;  1T0K B;  5IYZ A;  4TV8 B;  5LP6 C;  5CA0 B;  2WAL A;  1VQ4 F;  3FPI A;  3HKB B;  5HY1 A;  3LFO A;  3VOB A;  4I55 A;  3M4S A;  1FNJ A;  3CMA F;  1JD1 A;  3S03 A;  1FNK A;  2BO1 A;  3CPW F;  4C8E A;  4I4T B;  3IEW A;  4I50 B;  1W5E A;  5B8F A;  3OBW A;  4BY9 D;  2VAP A;  3HKE A;  3RYI B;  3CCL F;  2I6R A;  3S06 A;  3VOA A;  4B5C A;  4IHJ B;  5LA6 B;  1VQV A;  3O85 A;  3WGK A;  1QD9 A;  3JAS B;  1E7K A;  4O2A A;  2EWC A;  2P6Y A;  3K2X A;  2Z1E A;  1PF5 A;  3RYC A;  5GIP C;  5HY0 A;  3N2K A;  2N48 A;  3C8L A;  2VGN A;  3IMP A;  3WXM B;  2GLZ A;  1XV2 A;  3JAL A;  3RYF B;  2H6L A;  2HP0 A;  3MCA B;  3JAT B;  1K73 H;  4ZI7 A;  4U3J B;  3VI6 A;  2NMU A;  2RHL A;  3HJW C;  3JAS A;  3CCV F;  2G9I A;  3GTZ A;  5IJ0 A;  1Q8R A;  1ODE A;  1IV2 A;  3N2K B;  1CK2 A;  4LNU A;  4G4Y A;  3KIZ A;  1FSZ A;  1JFF A;  1TVK A;  2KG4 A;  2Z01 A;  5FLX M;  2KTV A;  3B6N A;  1QVF F;  1Q82 H;  1W5A A;  3OON A;  3T80 A;  4X1I B;  5LYJ A;  1JJ2 F;  3D01 A;  3C9T A;  3C9S A;  1VHA A;  1H7M A;  1GO0 A;  4B62 A;  4EI9 A;  3JAR B;  3WPX A;  2PHN A;  2DYY A;  3LYB A;  3IEQ A;  2UZH A;  1VQP F;  1SA0 A;  1NJI H;  4X20 B;  4NWO B;  4ZHQ A;  5A2Q M;  3CB2 A;  4DRX B;  2AMT A;  4O4H A;  2CWJ A;  2LBX A;  3HTN A;  2BTO A;  3E22 B;  1COM A;  1ONI A;  1GX1 A;  4YJ3 A;  2JNB A;  4IIJ A;  1K9M H;  4C4W C;  3HKB A;  5JQG B;  2PMP A;  2L26 A;  3D00 A;  2AIZ P;  4FFB A;  3V3T A;  4C8G A;  5GIO C;  2F9Z C;  1UFY A;  1CN7 A;  3KJJ A;  1W57 A;  2ZOD A;  3SIV A;  2GVI A;  4I50 A;  3VMF B;  2VAM A;  4WBN B;  4G4Z A;  5GON B;  4E6E A;  2Q1X A;  2HS3 A;  5LXT A;  3VO8 A;  3MDO A;  5LOV B;  1Q86 H;  3SIU A;  1W5B A;  2RHJ A;  1SZQ A;  3S0Y A;  4O2A B;  3CCS F;  4NQ3 A;  3CC7 F;  2OHW A;  1U43 A;  5EAZ A;  5JVD A;  1IV4 A;  4X1Y B;  1H47 A;  3F0E A;  3HKD B;  3E20 B;  1DBF A;  2YXZ A;  2HP0 B;  3TD3 A;  2QA4 F;  5FJ4 C;  4O4I B;  4LCK A;  5EIB C;  5ITZ B;  1PXW A;  5HXZ A;  1YJ9 F;  4ZOL A;  3CC2 F;  1VQO F;  4XCQ A;  1W59 A;  1X7O A;  1JY8 A;  3GHZ A;  4EI7 A;  5HP8 A;  4EB6 B;  2IQQ A;  3ON1 A;  5MN6 A;  3U0O A;  2ZF8 A;  5HXU A;  5HP7 A;  3Q8H A;  3V7Q A;  1RLG A;  3CCQ F;  3JAW B;  2ALE A;  1RLU A;  1KNJ A;  4U39 A;  3IR9 A;  3UT5 A;  2OTJ F;  5CA0 A;  5BMV A;  1OFU A;  1W58 1;  3MCQ A;  5LXT B;  5J2T A;  3V7E A;  3RA5 A;  2Z1T A;  4I55 B;  2KGW A;  1W40 A;  3G71 F;  1KC8 H;  2OZB A;  4O4J B;  3CYQ A;  3CYP B;  2MQE A;  4I4T A;  5JH7 B;  1QAH A;  1IV3 A;  4YJ3 B;  5EYP B;  5CA1 A;  1NMU B;  5IJ9 B;  1N8R H;  4TUY B;  1R1M A;  2VAW A;  3N4Z A;  5LA6 A;  2QTP A;  2CW4 A;  3JAK A;  4YJ2 B;  3S0W A;  2IG8 A;  4X3L A;  3WPW A;  1YI2 F;  4G4V A;  2ZVY A;  3RYH B;  3FD5 A;  3V4D A;  3WJP A;  4BT3 A;  2RHH A;  2GZL A;  3JAM M;  3TD4 A;  1H48 A;  3CPQ A;  5KMG B;  5GIN C;  3WGN A;  1TUB A;  4NUT A;  4ERH A;  1GO1 A;  4TZZ A;  5KX5 B;  1QVG F;  2UYN B;  3ZP7 A;  5J2U B;  3G4S F;  1QU9 A;  5HY2 A;  3RYH A; 
#chains in the Genus database with same CATH homology
 2AIZ P;  4ZHY B;  3TD3 A;  4G4W A;  3S03 A;  4G88 A;  5EB0 A;  3S0W A;  2ZVZ A;  3TD5 A;  4B62 A;  4ZHV A;  3WPW A;  3LDT A;  4G4Z A;  4ZHW A;  4G4V A;  2LBT A;  2ZVY A;  3WPX A;  3S06 A;  4B5C A;  3S0H A;  4PWT A;  2KGW A;  4R40 B;  3S02 A;  4G4X A;  3TD4 A;  4G4Y A;  2ZOV A;  3S0Y A;  3CYQ A;  2HQS C;  3KHN A;  2MQE A;  3CYP B;  4ERH A;  2W8B C;  4RHA A;  5EB1 B;  5EAZ A;  2LCA A;  2N48 A;  2ZF8 A;  3IMP A;  2L26 A;  3OON A;  1R1M A;  2K1S A;  1OAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...