2IG8A

Crystal structure of a protein of unknown function pa3499 from pseudomonas aeruginosa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
MTAVRRIRAAALPDLPDASWSNALLVGEELVMSGMTAHPATRQAAERGAALDAHAQALVVLGKVKALLEAAGGHVGNLYKLNVYVTRIADKDAIGRARQEFFAGQGTFPASTLVEVSGLVFPELLVEIDAWARLDIDLANCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PA3499
publication title The crystal structure of a hypothetical protein PA3499 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2ig8A00
3I3FA 3V4DA 2UYNA 3VCZA 2CW4A 3QUWA 1DBFA 2CSLA 3K0TA 2EWCA 1QU9A 1J7HA 2UYPA 2UYJA 3M4SA 1XRGA 4ZK7A 3LYBA 1PF5A 3R0PA 3KJJA 2IG8A 3D01A 2CWJA 2CVLA 1ODEA 2CHSA 3LMEA 1QAHA 5HP8A 3L7QA 2OTMA 3ZP7A 3GTZA 2B33A 1UI9A 1X25A 1QD9A 1FNJA 3K12A 1COMA 1ONIA 2DYYA 3ZP4A 3I7TA 2CHTA 3ZOPA 3ZO8A 1UFYA 2UYNB 5HP7A 3M1XA 1JD1A 4NWOB 3MQWA 2UYKA 3KJKA 1NQ3A 1XHOA 1FNKA
chains in the Genus database with same CATH superfamily
5JCOA 1YIJF 4DXDA 1QU9A 5J2UA 1W5AA 3CXCF 4WBNB 3WGLA 4X1YA 1YGYA 5EWRA 2B33A 3C9UA 5FLXM 4IIJA 5EO3A 3B6NA 3FD5A 3NK7A 3CC4F 2VAPA 1VK3A 3E20B 4ZOLA 1OFUA 2HP0B 3F6MA 4F6RB 4O2BA 2DT4A 1NQ3A 2I6RA 5CA0A 2HS4A 2PHNA 2I6DA 3HKCA 3T80A 5G4VC 3WPWA 4O4JA 4X20B 3JVHA 3WJRA 2Z1UA 3S06A 3WJQA 5KX5A 1T0KB 4ZHYB 1ONIA 3CCSF 3HKBB 4FFBA 1GO0A 4EI7A 2QI2A 4NUTA 4TV8B 3DDNA 4I4TA 1Q7YH 2UYKA 2AIFA 4NQ3A 3J81M 3ELCA 4ZHQA 5HXZA 5KMGA 1XV2A 2CW4A 5C8YA 3CCMF 5EIBC 4ZHWA 1KQSF 1J7HA 5ITZB 4ZK7A 2G9IA 1FFXB 1W42A 5JQGA 4IHJB 3D01A 4EI9A 3JCMM 3L7QA 3KE1A 5LYJB 5GIOC 1W59A 3E22B 5GONA 2YXZA 2PMPA 4YJ3A 1X7OA 2NMUA 3IKFA 2F9ZC 4C82A 2KTUA 2HQSC 1JFFA 3JAKA 5IYZA 2ALEA 5LA6A 2ZVYA 3JARA 4C8EA 1YJ9F 4G4VA 2FGYA 1TUBA 1U40A 3K14A 4EI8A 5J2UB 1OAPA 5J2TA 1NJIH 3S0WA 3CCEF 5JH7A 1S72F 5LP6A 1SDSA 4X1YB 3IEWA 2H8CA 2VXYA 1Z5WA 4IIJB 5EAZA 3M84A 4ZI7B 1ODEA 5HP8A 3JATA 3O85A 5EB0A 4O2AA 3S02A 3JALA 3N2GA 4ZOLB 5HY0A 5CB4A 1YQNA 3I7TA 2CHTA 5EYPA 1VQ4F 1YHQF 5HWEA 1RLGA 4C4WC 3EORA 5CA0B 3CMAF 3KHNA 1IPAA 3I3FA 2ZF8A 4O4JB 5JCOC 4ZHVA 5EZYA 3HKEB 2HS0A 5LXTA 3RYIA 4B62A 1M90H 3V3TA 1KD1H 3FPIA 3ERNA 1X52A 4BT5A 5BMVA 1YJNF 5KX5B 2CWJA 4HNAA 5MN4A 2OTMA 5HXUA 3OW2F 3RA6A 4FFBB 1QD9A 3WJPA 3K12A 4TZZA 4I4TB 4ZHQB 5GAPK 3HJWC 1DT9A 1RA4A 2Z1FA 5KMGB 1VQMF 3CYQA 1VQOF 5C8YB 3VYSC 4BT6A 4BVQA 5IJ0B 1SA0B 5A2QM 3S03A 3GYQA 5JQGB 1JY8A 3QUWA 1VQNF 1VQVA 2KTVA 2ZAUA 5GIPC 3C9TA 2UYPA 5GONB 1IV4A 2IAFA 1CN7A 3R0PA 3LWQC 3J7AR 2VGNA 3N4ZA 4YJ3B 2IG8A 3IR9A 1QVGF 3IMPA 1FNJA 3JAKB 1JFFB 3LWRC 5LA6B 1RLUA 4EB6A 3JARB 2HRYA 4G4WA 1TUBB 3LWVC 4TUYA 5EB1B 5J2TB 3CCQF 3OBYA 3RYFB 4TV9A 3KJKA 5LP6B 3S0YA 3K2XA 1IV2A 3VOAA 3VYUC 3JATB 3JAMM 3I55F 4O2AB 3JALB 3N2GB 3VI6A 4BT2A 4O4HA 3Q8HA 3NMUC 1X7PA 5CB4B 3N2KA 4X1KB 5EYPB 2L26A 4BT4A 1PXWA 3CCJF 3MCAB 4X1IA 1VQ9F 1GZ0A 1W3EX 3JASB 3JAWB 3ZOPA 5EZYB 1JD1A 5LOVA 1GX1A 5LXTB 3RYIB 5HY1A 2R751 3CCRF 1K8AH 2VAMA 3UT5A 2H8EA 3WXMB 5BMVB 1VQ7F 3LFOA 4G4ZA 4HNAB 5LP6C 1KNKA 5JVDA 4BY9D 4I55A 1QVFF 1RQ7A 2R6R1 5IJ9A 1VQKF 4B45A 1W5EA 2ZOVA 3VTIC 3DC2A 4G4YA 4DRXA 4KWEA 1UFYA 2CZWA 3BYQA 2W8BC 2KGWA 1FSZA 3VOBA 4X3LA 1FNKA 1RQ2A 2WALA 2CSLA 1U3LA 2LCAA 2OTLF 2RHHA 3LYBA 3HKDA 2HRUA 4G4XA 1K9MH 4BT3A 4I50A 3VYTC 3WGKA 4EB6B 4C81A 4B46A 1UI9A 1VH8A 4C8GA 4TUYB 2QEXF 1VQ5F 4U39A 3D00A 2ZVZA 2HX0A 4TV9B 1N8RH 2QTPA 4O2BB 2LBWA 5FNVA 2BTUA 3GHZA 5G4UC 3HKCB 1Z5VA 3RE3A 3WGJA 3WGMA 1DBFA 3CCUF 4O4HB 3C9RA 3E1YA 1YITF 2FC3A 3P0ZA 1PF5A 2CHSA 3NK6A 3NVKE 4LNUA 3V7QA 1X25A 2HP3A 1M1KH 2YYEA 5LOVB 2MQEA 3CPWF 1CLIA 3UT5B 3IEQA 1YJWF 3MCQA 2GZLA 3F0EA 3CCLF 2Z1EA 1VHAA 5MN5A 5JVDB 2BO1A 1Q8RA 4I55B 4BW0B 4R40B 4O4LA 5IJ9B 1Q82H 5GINC 1YI2F 2HVYD 2Z01A 3MDOA 4E6EA 2K1SA 3CCVF 2IQQA 3QTYA 4BT7A 4DRXB 4ERHA 3CMEF 2N48A 3CG6A 3FBAA 2Z1TA 3LWPC 5IYZB 3FFMA 3CC7F 1H7MA 5HY2A 5JH7B 2LBXA 3V4DA 2QA4F 2UYNA 3HKDB 3N4YA 1W40A 3CD6F 4I50B 3OONA 1JJ2F 4O4IA 3F0DA 5IT9M 1VQPF 2JNBA 2OZBA 1W5FA 4U3JA 4YJ2A 3CPQA 5AVMA 2GVIA 4B5CA 1JN1A 1Q86H 4ZI7A 3C9SA 5FNVB 4G88A 2AIZP 3ZP4A 3D54A 3RYHA 3P4EA 3U0OA 3G71F 3MQWA 1W55A 3RYCA 3SIUA 3AGKA 4BVSA 4C8IA 1CK2A 1VQ8F 5CA1A 3P10A 1U3PA 3K0TA 3IKEA 3S0HA 3M4SA 1XRGA 3HKEA 4LNUB 2RHLA 3VO8A 3FD6A 2RHOA 1K73H 2OTJF 3LMEA 3KIZA 1TVKA 2AMTA 2KG4A 2BTQB 5HP7A 3M1XA 3LDTA 4O4LB 3F0GA 5HY4A 3LWOC 3CB2A 2Q1YA 1W41A 2DYYA 1XHOA 3HAXD 3OBWA 3VCZA 2V9YA 4RHAA 1Q81H 3G6EF 4XCQA 5IJ0A 1SA0A 2P6YA 3PLAC 3TD3A 3KJJA 3QHDA 5GANK 1VQLF 2RB9A 3HTNA 2GLZA 3ESJA 4WBNA 3F0FA 5EIBD 4LCKA 2UYNB 1VQ6F 2BTOA 1NMUB 3TD5A 5B8FA 4PWTA 3V7EA 3VIUA 3HWUA 4BVTA 3MBMA 4O4IB 3CC2F 1IV3A 2HP0A 1R1MA 2OHWA 4U3JB 4YJ2B 3RYFA 1GO1A 4F6RA 1U43A 2HS3A 4X3MA 2ZODA 3N2KB 3ON1A 3WPXA 3ZP7A 4X1IB 3TD4A 4M8IA 4X20A 4BVRA 3J80M 1W57A 3SIVA 1E7KA 2RHJA 3RYHB 3RYCB 1COMA 4X1KA 3PAFA 1KNJA 5CA1B 1XBIA 3VMFB 3C8LA 3G4SF 3RA5A 3JASA 3JAWA 3HKBA 2Q1XA 1SZQA 5DCVA 4TV8A 1W581 4RQOA 3CYPB 2EWCA 1T0AA 1IV1A 5FJ4C 2UYJA 1H48A 2UZHA 2VGMA 1TVKB 2H6LA 2CVLA 3WGNA 1QAHA 5ITZA 3GTZA 5MN6A 1FFXA 4IHJA 3I56F 2LBTA 5LYJA 1W2BF 3NVIB 3E22A 1H47A 3ZO8A 1KC8H 1W5BA 1ZWZA 4NWOB 2VAWA
chains in the Genus database with same CATH topology
3I3FA 3V4DA 2UYNA 3VCZA 2CW4A 3QUWA 1DBFA 2CSLA 3K0TA 2EWCA 1QU9A 1J7HA 2UYPA 2UYJA 3M4SA 1XRGA 4ZK7A 3LYBA 1PF5A 3R0PA 3KJJA 2IG8A 3D01A 2CWJA 2CVLA 1ODEA 2CHSA 3LMEA 1QAHA 5HP8A 3L7QA 2OTMA 3ZP7A 3GTZA 2B33A 1UI9A 1X25A 1QD9A 1FNJA 3K12A 1COMA 1ONIA 2DYYA 3ZP4A 3I7TA 2CHTA 3ZOPA 3ZO8A 1UFYA 2UYNB 5HP7A 3M1XA 1JD1A 4NWOB 3MQWA 2UYKA 3KJKA 1NQ3A 1XHOA 1FNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3F A;  3V4D A;  2UYN A;  3VCZ A;  2CW4 A;  3QUW A;  1DBF A;  2CSL A;  3K0T A;  2EWC A;  1QU9 A;  1J7H A;  2UYP A;  2UYJ A;  3M4S A;  1XRG A;  4ZK7 A;  3LYB A;  1PF5 A;  3R0P A;  3KJJ A;  2IG8 A;  3D01 A;  2CWJ A;  2CVL A;  1ODE A;  2CHS A;  3LME A;  1QAH A;  5HP8 A;  3L7Q A;  2OTM A;  3ZP7 A;  3GTZ A;  2B33 A;  1UI9 A;  1X25 A;  1QD9 A;  1FNJ A;  3K12 A;  1COM A;  1ONI A;  2DYY A;  3ZP4 A;  3I7T A;  2CHT A;  3ZOP A;  3ZO8 A;  1UFY A;  2UYN B;  5HP7 A;  3M1X A;  1JD1 A;  4NWO B;  3MQW A;  2UYK A;  3KJK A;  1NQ3 A;  1XHO A;  1FNK A; 
#chains in the Genus database with same CATH topology
 5JCO A;  1YIJ F;  4DXD A;  1QU9 A;  5J2U A;  1W5A A;  3CXC F;  4WBN B;  3WGL A;  4X1Y A;  1YGY A;  5EWR A;  2B33 A;  3C9U A;  5FLX M;  4IIJ A;  5EO3 A;  3B6N A;  3FD5 A;  3NK7 A;  3CC4 F;  2VAP A;  1VK3 A;  3E20 B;  4ZOL A;  1OFU A;  2HP0 B;  3F6M A;  4F6R B;  4O2B A;  2DT4 A;  1NQ3 A;  2I6R A;  5CA0 A;  2HS4 A;  2PHN A;  2I6D A;  3HKC A;  3T80 A;  5G4V C;  3WPW A;  4O4J A;  4X20 B;  3JVH A;  3WJR A;  2Z1U A;  3S06 A;  3WJQ A;  5KX5 A;  1T0K B;  4ZHY B;  1ONI A;  3CCS F;  3HKB B;  4FFB A;  1GO0 A;  4EI7 A;  2QI2 A;  4NUT A;  4TV8 B;  3DDN A;  4I4T A;  1Q7Y H;  2UYK A;  2AIF A;  4NQ3 A;  3J81 M;  3ELC A;  4ZHQ A;  5HXZ A;  5KMG A;  1XV2 A;  2CW4 A;  5C8Y A;  3CCM F;  5EIB C;  4ZHW A;  1KQS F;  1J7H A;  5ITZ B;  4ZK7 A;  2G9I A;  1FFX B;  1W42 A;  5JQG A;  4IHJ B;  3D01 A;  4EI9 A;  3JCM M;  3L7Q A;  3KE1 A;  5LYJ B;  5GIO C;  1W59 A;  3E22 B;  5GON A;  2YXZ A;  2PMP A;  4YJ3 A;  1X7O A;  2NMU A;  3IKF A;  2F9Z C;  4C82 A;  2KTU A;  2HQS C;  1JFF A;  3JAK A;  5IYZ A;  2ALE A;  5LA6 A;  2ZVY A;  3JAR A;  4C8E A;  1YJ9 F;  4G4V A;  2FGY A;  1TUB A;  1U40 A;  3K14 A;  4EI8 A;  5J2U B;  1OAP A;  5J2T A;  1NJI H;  3S0W A;  3CCE F;  5JH7 A;  1S72 F;  5LP6 A;  1SDS A;  4X1Y B;  3IEW A;  2H8C A;  2VXY A;  1Z5W A;  4IIJ B;  5EAZ A;  3M84 A;  4ZI7 B;  1ODE A;  5HP8 A;  3JAT A;  3O85 A;  5EB0 A;  4O2A A;  3S02 A;  3JAL A;  3N2G A;  4ZOL B;  5HY0 A;  5CB4 A;  1YQN A;  3I7T A;  2CHT A;  5EYP A;  1VQ4 F;  1YHQ F;  5HWE A;  1RLG A;  4C4W C;  3EOR A;  5CA0 B;  3CMA F;  3KHN A;  1IPA A;  3I3F A;  2ZF8 A;  4O4J B;  5JCO C;  4ZHV A;  5EZY A;  3HKE B;  2HS0 A;  5LXT A;  3RYI A;  4B62 A;  1M90 H;  3V3T A;  1KD1 H;  3FPI A;  3ERN A;  1X52 A;  4BT5 A;  5BMV A;  1YJN F;  5KX5 B;  2CWJ A;  4HNA A;  5MN4 A;  2OTM A;  5HXU A;  3OW2 F;  3RA6 A;  4FFB B;  1QD9 A;  3WJP A;  3K12 A;  4TZZ A;  4I4T B;  4ZHQ B;  5GAP K;  3HJW C;  1DT9 A;  1RA4 A;  2Z1F A;  5KMG B;  1VQM F;  3CYQ A;  1VQO F;  5C8Y B;  3VYS C;  4BT6 A;  4BVQ A;  5IJ0 B;  1SA0 B;  5A2Q M;  3S03 A;  3GYQ A;  5JQG B;  1JY8 A;  3QUW A;  1VQN F;  1VQV A;  2KTV A;  2ZAU A;  5GIP C;  3C9T A;  2UYP A;  5GON B;  1IV4 A;  2IAF A;  1CN7 A;  3R0P A;  3LWQ C;  3J7A R;  2VGN A;  3N4Z A;  4YJ3 B;  2IG8 A;  3IR9 A;  1QVG F;  3IMP A;  1FNJ A;  3JAK B;  1JFF B;  3LWR C;  5LA6 B;  1RLU A;  4EB6 A;  3JAR B;  2HRY A;  4G4W A;  1TUB B;  3LWV C;  4TUY A;  5EB1 B;  5J2T B;  3CCQ F;  3OBY A;  3RYF B;  4TV9 A;  3KJK A;  5LP6 B;  3S0Y A;  3K2X A;  1IV2 A;  3VOA A;  3VYU C;  3JAT B;  3JAM M;  3I55 F;  4O2A B;  3JAL B;  3N2G B;  3VI6 A;  4BT2 A;  4O4H A;  3Q8H A;  3NMU C;  1X7P A;  5CB4 B;  3N2K A;  4X1K B;  5EYP B;  2L26 A;  4BT4 A;  1PXW A;  3CCJ F;  3MCA B;  4X1I A;  1VQ9 F;  1GZ0 A;  1W3E X;  3JAS B;  3JAW B;  3ZOP A;  5EZY B;  1JD1 A;  5LOV A;  1GX1 A;  5LXT B;  3RYI B;  5HY1 A;  2R75 1;  3CCR F;  1K8A H;  2VAM A;  3UT5 A;  2H8E A;  3WXM B;  5BMV B;  1VQ7 F;  3LFO A;  4G4Z A;  4HNA B;  5LP6 C;  1KNK A;  5JVD A;  4BY9 D;  4I55 A;  1QVF F;  1RQ7 A;  2R6R 1;  5IJ9 A;  1VQK F;  4B45 A;  1W5E A;  2ZOV A;  3VTI C;  3DC2 A;  4G4Y A;  4DRX A;  4KWE A;  1UFY A;  2CZW A;  3BYQ A;  2W8B C;  2KGW A;  1FSZ A;  3VOB A;  4X3L A;  1FNK A;  1RQ2 A;  2WAL A;  2CSL A;  1U3L A;  2LCA A;  2OTL F;  2RHH A;  3LYB A;  3HKD A;  2HRU A;  4G4X A;  1K9M H;  4BT3 A;  4I50 A;  3VYT C;  3WGK A;  4EB6 B;  4C81 A;  4B46 A;  1UI9 A;  1VH8 A;  4C8G A;  4TUY B;  2QEX F;  1VQ5 F;  4U39 A;  3D00 A;  2ZVZ A;  2HX0 A;  4TV9 B;  1N8R H;  2QTP A;  4O2B B;  2LBW A;  5FNV A;  2BTU A;  3GHZ A;  5G4U C;  3HKC B;  1Z5V A;  3RE3 A;  3WGJ A;  3WGM A;  1DBF A;  3CCU F;  4O4H B;  3C9R A;  3E1Y A;  1YIT F;  2FC3 A;  3P0Z A;  1PF5 A;  2CHS A;  3NK6 A;  3NVK E;  4LNU A;  3V7Q A;  1X25 A;  2HP3 A;  1M1K H;  2YYE A;  5LOV B;  2MQE A;  3CPW F;  1CLI A;  3UT5 B;  3IEQ A;  1YJW F;  3MCQ A;  2GZL A;  3F0E A;  3CCL F;  2Z1E A;  1VHA A;  5MN5 A;  5JVD B;  2BO1 A;  1Q8R A;  4I55 B;  4BW0 B;  4R40 B;  4O4L A;  5IJ9 B;  1Q82 H;  5GIN C;  1YI2 F;  2HVY D;  2Z01 A;  3MDO A;  4E6E A;  2K1S A;  3CCV F;  2IQQ A;  3QTY A;  4BT7 A;  4DRX B;  4ERH A;  3CME F;  2N48 A;  3CG6 A;  3FBA A;  2Z1T A;  3LWP C;  5IYZ B;  3FFM A;  3CC7 F;  1H7M A;  5HY2 A;  5JH7 B;  2LBX A;  3V4D A;  2QA4 F;  2UYN A;  3HKD B;  3N4Y A;  1W40 A;  3CD6 F;  4I50 B;  3OON A;  1JJ2 F;  4O4I A;  3F0D A;  5IT9 M;  1VQP F;  2JNB A;  2OZB A;  1W5F A;  4U3J A;  4YJ2 A;  3CPQ A;  5AVM A;  2GVI A;  4B5C A;  1JN1 A;  1Q86 H;  4ZI7 A;  3C9S A;  5FNV B;  4G88 A;  2AIZ P;  3ZP4 A;  3D54 A;  3RYH A;  3P4E A;  3U0O A;  3G71 F;  3MQW A;  1W55 A;  3RYC A;  3SIU A;  3AGK A;  4BVS A;  4C8I A;  1CK2 A;  1VQ8 F;  5CA1 A;  3P10 A;  1U3P A;  3K0T A;  3IKE A;  3S0H A;  3M4S A;  1XRG A;  3HKE A;  4LNU B;  2RHL A;  3VO8 A;  3FD6 A;  2RHO A;  1K73 H;  2OTJ F;  3LME A;  3KIZ A;  1TVK A;  2AMT A;  2KG4 A;  2BTQ B;  5HP7 A;  3M1X A;  3LDT A;  4O4L B;  3F0G A;  5HY4 A;  3LWO C;  3CB2 A;  2Q1Y A;  1W41 A;  2DYY A;  1XHO A;  3HAX D;  3OBW A;  3VCZ A;  2V9Y A;  4RHA A;  1Q81 H;  3G6E F;  4XCQ A;  5IJ0 A;  1SA0 A;  2P6Y A;  3PLA C;  3TD3 A;  3KJJ A;  3QHD A;  5GAN K;  1VQL F;  2RB9 A;  3HTN A;  2GLZ A;  3ESJ A;  4WBN A;  3F0F A;  5EIB D;  4LCK A;  2UYN B;  1VQ6 F;  2BTO A;  1NMU B;  3TD5 A;  5B8F A;  4PWT A;  3V7E A;  3VIU A;  3HWU A;  4BVT A;  3MBM A;  4O4I B;  3CC2 F;  1IV3 A;  2HP0 A;  1R1M A;  2OHW A;  4U3J B;  4YJ2 B;  3RYF A;  1GO1 A;  4F6R A;  1U43 A;  2HS3 A;  4X3M A;  2ZOD A;  3N2K B;  3ON1 A;  3WPX A;  3ZP7 A;  4X1I B;  3TD4 A;  4M8I A;  4X20 A;  4BVR A;  3J80 M;  1W57 A;  3SIV A;  1E7K A;  2RHJ A;  3RYH B;  3RYC B;  1COM A;  4X1K A;  3PAF A;  1KNJ A;  5CA1 B;  1XBI A;  3VMF B;  3C8L A;  3G4S F;  3RA5 A;  3JAS A;  3JAW A;  3HKB A;  2Q1X A;  1SZQ A;  5DCV A;  4TV8 A;  1W58 1;  4RQO A;  3CYP B;  2EWC A;  1T0A A;  1IV1 A;  5FJ4 C;  2UYJ A;  1H48 A;  2UZH A;  2VGM A;  1TVK B;  2H6L A;  2CVL A;  3WGN A;  1QAH A;  5ITZ A;  3GTZ A;  5MN6 A;  1FFX A;  4IHJ A;  3I56 F;  2LBT A;  5LYJ A;  1W2B F;  3NVI B;  3E22 A;  1H47 A;  3ZO8 A;  1KC8 H;  1W5B A;  1ZWZ A;  4NWO B;  2VAW A; 
#chains in the Genus database with same CATH homology
 3I3F A;  3V4D A;  2UYN A;  3VCZ A;  2CW4 A;  3QUW A;  1DBF A;  2CSL A;  3K0T A;  2EWC A;  1QU9 A;  1J7H A;  2UYP A;  2UYJ A;  3M4S A;  1XRG A;  4ZK7 A;  3LYB A;  1PF5 A;  3R0P A;  3KJJ A;  2IG8 A;  3D01 A;  2CWJ A;  2CVL A;  1ODE A;  2CHS A;  3LME A;  1QAH A;  5HP8 A;  3L7Q A;  2OTM A;  3ZP7 A;  3GTZ A;  2B33 A;  1UI9 A;  1X25 A;  1QD9 A;  1FNJ A;  3K12 A;  1COM A;  1ONI A;  2DYY A;  3ZP4 A;  3I7T A;  2CHT A;  3ZOP A;  3ZO8 A;  1UFY A;  2UYN B;  5HP7 A;  3M1X A;  1JD1 A;  4NWO B;  3MQW A;  2UYK A;  3KJK A;  1NQ3 A;  1XHO A;  1FNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...