2IG8A

Crystal structure of a protein of unknown function pa3499 from pseudomonas aeruginosa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
MTAVRRIRAAALPDLPDASWSNALLVGEELVMSGMTAHPATRQAAERGAALDAHAQALVVLGKVKALLEAAGGHVGNLYKLNVYVTRIADKDAIGRARQEFFAGQGTFPASTLVEVSGLVFPELLVEIDAWARLDIDLANCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a hypothetical protein PA3499 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PA3499
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2ig8A00
2OTMA 3LMEA 2UYNA 3GTZA 3ZP4A 1ONIA 4NWOB 2UYPA 3V4DA 3QUWA 3LYBA 1JD1A 2CWJA 1UFYA 2CHSA 1PF5A 1DBFA 3MQWA 5HP8A 1FNKA 2EWCA 3K0TA 3L7QA 3R0PA 3I7TA 1NQ3A 3VCZA 1UI9A 1QU9A 2UYKA 1X25A 3K12A 3M4SA 3D01A 1ODEA 1XHOA 1J7HA 2UYJA 2B33A 3M1XA 4ZK7A 3KJKA 3ZP7A 2CW4A 2UYNB 3KJJA 2DYYA 2IG8A 2CHTA 3I3FA 1XRGA 2CSLA 1COMA 1QAHA 2CVLA 3ZO8A 3ZOPA 5HP7A 1QD9A 1FNJA
chains in the Genus database with same CATH superfamily
4BVTA 4TV8A 3ON1A 4IIJA 3P0ZA 1XBIA 4I50A 1W59A 1Q86H 4X20A 5EIBC 5HY4A 4TZZA 1W40A 3CC7F 1FNKA 2KGWA 3ZO8A 2RHJA 2VAPA 3RYIA 3RYHB 3K2XA 4O2AB 4O4JA 3N2KA 3U0OA 3HKEB 1W5BA 5HXZA 3LWQC 4ZOLB 2CHTA 2RHOA 3WPWA 4HNAB 2CSLA 3WPXA 3CPWF 4BVRA 1FNJA 1H47A 5AVMA 4EI8A 5J2TA 1VQNF 3CXCF 3ZP4A 3ERNA 5GINC 3F0GA 1Z5VA 2HRUA 3S0WA 2AMTA 2HP3A 5J2TB 3F0EA 5G4VC 5LP6A 5FLXM 1NQ3A 2YXZA 2JNBA 5HY1A 3T80A 3K12A 5GONB 3Q8HA 3WJQA 3CCRF 2RHLA 2Z1FA 4I50B 1VQ4F 3CG6A 4WBNA 2F9ZC 1QVFF 2HS0A 2HX0A 5KX5A 4EI9A 3KHNA 4TV9A 4X3MA 1K8AH 4BT6A 3V3TA 2I6RA 5EZYB 3JAWA 4O4LB 3C9TA 1QVGF 3J80M 4TV8B 1VQKF 1YQNA 5IJ9A 4X1IB 3G71F 3JAWB 4O4LA 3EORA 3KE1A 4G4XA 5LYJB 1Q7YH 2ZF8A 5J2UA 1YI2F 3D54A 3WGMA 3WGJA 4BT4A 4E6EA 3ZOPA 2UYKA 3RA5A 2OTMA 2QA4F 4WBNB 2ZODA 2H8EA 2AIFA 1IV3A 3CCLF 1GO0A 5IT9M 3IR9A 2V9YA 3O85A 3CCEF 3MCAB 1DBFA 1TVKB 5CA0B 3JAMM 2KG4A 3NK7A 1VQVA 3L7QA 3S02A 3FBAA 5KMGA 1ODEA 4BVQA 1CK2A 5EB0A 4ZHYB 5CA1B 4O4IB 1XV2A 4O2AA 3JARB 3JATB 3N4YA 3TD4A 3CC2F 5LP6C 4G88A 5IYZB 5MN4A 3HKDA 4X3LA 1W55A 1W42A 1RA4A 2UYPA 3N2KB 3WJPA 4X1YB 4DRXA 3G4SF 5GONA 3SIVA 3P10A 4G4VA 3CPQA 5A2QM 3JALB 1J7HA 1OFUA 2HS4A 2RB9A 2Q1YA 4O2BA 3HTNA 3OBYA 2PMPA 1T0KB 3NMUC 3CB2A 1R1MA 3GYQA 3M84A 1KNJA 5G4UC 5LYJA 5IJ0B 3HKBB 3MCQA 1SA0A 4XCQA 2LBXA 4ZOLA 1K73H 2QEXF 2DT4A 4B62A 1T0AA 3ESJA 2CWJA 4BT5A 3VMFB 4FFBA 5LOVA 1VHAA 4O4IA 4F6RB 3CCVF 5HP8A 2OZBA 4ZHVA 5EZYA 3I7TA 2HP0B 1U43A 1QU9A 2FC3A 4BT7A 1JJ2F 4ZI7A 1X52A 4ZHWA 5IJ9B 2CW4A 2Z01A 3MDOA 2R751 3S0YA 4BW0B 2BTQB 3N4ZA 5HXUA 1X7OA 1FFXB 5JQGB 3CCUF 3RYIB 5EYPB 3DC2A 3K14A 1W2BF 5LP6B 3JATA 3MBMA 3OBWA 5EAZA 4I4TB 1M1KH 5FJ4C 1IPAA 3R0PA 5IYZA 4PWTA 2KTUA 1H7MA 5MN6A 3I55F 1KQSF 1RLUA 2G9IA 1JFFA 3V7QA 4EB6B 3WXMB 5ITZB 2CVLA 3GHZA 1IV2A 3HKDB 5GIPC 3RA6A 3HWUA 3RE3A 4O2BB 5CA1A 2IQQA 2GZLA 4ERHA 1GZ0A 1YJWF 3E22A 3C9RA 3LWPC 2BTUA 2YYEA 3QUWA 1ZWZA 2OHWA 3C9UA 3LYBA 1JD1A 5LA6B 4IIJB 3VYUC 4DXDA 5MN5A 2K1SA 3S03A 1H48A 2LCAA 5HY2A 3UT5B 1XHOA 3CD6F 2HS3A 1VQ8F 2IG8A 4C4WC 1W5EA 2VGNA 3IMPA 3CC4F 1QD9A 4LCKA 4B46A 4O4HB 3JASA 2UYNA 1ONIA 3P4EA 1VQ9F 3B6NA 2KTVA 2BTOA 3E22B 3I56F 2FGYA 3F6MA 4O4HA 2CZWA 3LWOC 2EWCA 5EYPA 5HWEA 3JAKA 3JVHA 3VIUA 3M1XA 3E1YA 4ZK7A 1TVKA 4I55B 5CA0A 5JH7A 2HVYD 4TUYA 2L26A 3OONA 3VOBA 1X7PA 2Z1EA 1JY8A 2UZHA 3KJKA 3WGNA 3CCMF 3VO8A 4C8IA 1KD1H 5FNVB 4U3JA 5LXTA 3PAFA 1RLGA 2QTPA 3VTIC 2HP0A 3FD6A 4X1IA 4NQ3A 4EI7A 1Z5WA 2GVIA 3JCMM 2LBWA 3TD5A 4KWEA 5BMVA 1PF5A 5J2UB 3CCJF 5B8FA 1SDSA 3M4SA 2GLZA 1W5FA 3RYCA 2I6DA 3N2GA 3AGKA 4G4YA 2ZOVA 2UYNB 3ZP7A 4B5CA 4BT3A 5HY0A 3VI6A 3QHDA 3IEWA 3V4DA 1U3PA 2VGMA 5LOVB 4TUYB 3WGKA 4RQOA 1JFFB 3G6EF 4NUTA 1NJIH 1VH8A 2CHSA 3MQWA 1SZQA 3TD3A 5JVDB 3VCZA 3J81M 1KNKA 2Z1UA 1W3EX 3KIZA 5LA6A 5JCOA 4BVSA 1VK3A 5EWRA 3ELCA 1YJ9F 3KJJA 2DYYA 1YITF 3JASB 4BY9D 2OTLF 3C9SA 1QAHA 5CB4A 4B45A 4FFBB 2OTJF 1VQPF 5BMVB 2QI2A 3IEQA 4RHAA 4BT2A 2ALEA 3C8LA 2ZVYA 1Q81H 3VYSC 3CCSF 4TV9B 3DDNA 3LWRC 3LWVC 3RYCB 2VXYA 1YHQF 5FNVA 4YJ2B 3WJRA 1DT9A 2Z1TA 3K0TA 3HKEA 3JARA 1X25A 3NK6A 1FSZA 2B33A 2HQSC 1GX1A 4G4WA 4C8GA 2VAMA 3LDTA 1FFXA 2H6LA 4C82A 1VQOF 1XRGA 1Q8RA 1M90H 3VOAA 4X1KA 3CCQF 4I4TA 5ITZA 2Q1XA 4ZHQA 3RYFA 3PLAC 1IV4A 1YIJF 1VQLF 1Q82H 1E7KA 2MQEA 1TUBA 5CB4B 3D01A 3F0DA 4YJ3B 1IV1A 4M8IA 1N8RH 3HKCA 2R6R1 3UT5A 3IKEA 2PHNA 2IAFA 2BO1A 4X20B 2RHHA 3N2GB 3RYFB 3FPIA 2AIZP 4YJ3A 3V7EA 4F6RA 1K9MH 1VQ5F 3SIUA 3LMEA 3S06A 4LNUB 4NWOB 4IHJB 3QTYA 3CMEF 2VAWA 5GAPK 4O4JB 3JAKB 5GIOC 3WGLA 1UFYA 1U40A 2NMUA 5JCOC 4ZHQB 2UYJA 3S0HA 5JVDA 1TUBB 5EB1B 1W5AA 3CMAF 1W581 1SA0B 3HAXD 4C8EA 1RQ7A 3NVIB 1GO1A 5EO3A 4I55A 4EB6A 1CLIA 1KC8H 3GTZA 3E20B 5C8YA 1W41A 1U3LA 3LFOA 3IKFA 3CYPB 4R40B 5IJ0A 2H8CA 3HKCB 1PXWA 4C81A 1UI9A 3F0FA 5KX5B 3OW2F 4X1YA 4DRXB 5GANK 1VQ6F 4U3JB 5LXTB 1W57A 4X1KB 1CN7A 3D00A 2LBTA 3I3FA 5KMGB 3FFMA 5JQGA 4IHJA 1COMA 1NMUB 3JALA 2HRYA 1S72F 5JH7B 2P6YA 3NVKE 5DCVA 1RQ2A 2ZVZA 4ZI7B 1JN1A 1YGYA 3VYTC 1OAPA 2WALA 3J7AR 3FD5A 1VQ7F 2W8BC 4HNAA 3CYQA 4U39A 3HJWC 4YJ2A 5C8YB 1YJNF 3HKBA 3RYHA 1VQMF 3BYQA 2N48A 2ZAUA 5EIBD 4LNUA 5HP7A 4G4ZA
chains in the Genus database with same CATH topology
2OTMA 3LMEA 2UYNA 3GTZA 3ZP4A 1ONIA 4NWOB 2UYPA 3V4DA 3QUWA 3LYBA 1JD1A 2CWJA 1UFYA 2CHSA 1PF5A 1DBFA 3MQWA 5HP8A 1FNKA 2EWCA 3K0TA 3L7QA 3R0PA 3I7TA 1NQ3A 3VCZA 1UI9A 1QU9A 2UYKA 1X25A 3K12A 3M4SA 3D01A 1ODEA 1XHOA 1J7HA 2UYJA 2B33A 3M1XA 4ZK7A 3KJKA 3ZP7A 2CW4A 2UYNB 3KJJA 2DYYA 2IG8A 2CHTA 3I3FA 1XRGA 2CSLA 1COMA 1QAHA 2CVLA 3ZO8A 3ZOPA 5HP7A 1QD9A 1FNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTM A;  3LME A;  2UYN A;  3GTZ A;  3ZP4 A;  1ONI A;  4NWO B;  2UYP A;  3V4D A;  3QUW A;  3LYB A;  1JD1 A;  2CWJ A;  1UFY A;  2CHS A;  1PF5 A;  1DBF A;  3MQW A;  5HP8 A;  1FNK A;  2EWC A;  3K0T A;  3L7Q A;  3R0P A;  3I7T A;  1NQ3 A;  3VCZ A;  1UI9 A;  1QU9 A;  2UYK A;  1X25 A;  3K12 A;  3M4S A;  3D01 A;  1ODE A;  1XHO A;  1J7H A;  2UYJ A;  2B33 A;  3M1X A;  4ZK7 A;  3KJK A;  3ZP7 A;  2CW4 A;  2UYN B;  3KJJ A;  2DYY A;  2IG8 A;  2CHT A;  3I3F A;  1XRG A;  2CSL A;  1COM A;  1QAH A;  2CVL A;  3ZO8 A;  3ZOP A;  5HP7 A;  1QD9 A;  1FNJ A; 
#chains in the Genus database with same CATH topology
 4BVT A;  4TV8 A;  3ON1 A;  4IIJ A;  3P0Z A;  1XBI A;  4I50 A;  1W59 A;  1Q86 H;  4X20 A;  5EIB C;  5HY4 A;  4TZZ A;  1W40 A;  3CC7 F;  1FNK A;  2KGW A;  3ZO8 A;  2RHJ A;  2VAP A;  3RYI A;  3RYH B;  3K2X A;  4O2A B;  4O4J A;  3N2K A;  3U0O A;  3HKE B;  1W5B A;  5HXZ A;  3LWQ C;  4ZOL B;  2CHT A;  2RHO A;  3WPW A;  4HNA B;  2CSL A;  3WPX A;  3CPW F;  4BVR A;  1FNJ A;  1H47 A;  5AVM A;  4EI8 A;  5J2T A;  1VQN F;  3CXC F;  3ZP4 A;  3ERN A;  5GIN C;  3F0G A;  1Z5V A;  2HRU A;  3S0W A;  2AMT A;  2HP3 A;  5J2T B;  3F0E A;  5G4V C;  5LP6 A;  5FLX M;  1NQ3 A;  2YXZ A;  2JNB A;  5HY1 A;  3T80 A;  3K12 A;  5GON B;  3Q8H A;  3WJQ A;  3CCR F;  2RHL A;  2Z1F A;  4I50 B;  1VQ4 F;  3CG6 A;  4WBN A;  2F9Z C;  1QVF F;  2HS0 A;  2HX0 A;  5KX5 A;  4EI9 A;  3KHN A;  4TV9 A;  4X3M A;  1K8A H;  4BT6 A;  3V3T A;  2I6R A;  5EZY B;  3JAW A;  4O4L B;  3C9T A;  1QVG F;  3J80 M;  4TV8 B;  1VQK F;  1YQN A;  5IJ9 A;  4X1I B;  3G71 F;  3JAW B;  4O4L A;  3EOR A;  3KE1 A;  4G4X A;  5LYJ B;  1Q7Y H;  2ZF8 A;  5J2U A;  1YI2 F;  3D54 A;  3WGM A;  3WGJ A;  4BT4 A;  4E6E A;  3ZOP A;  2UYK A;  3RA5 A;  2OTM A;  2QA4 F;  4WBN B;  2ZOD A;  2H8E A;  2AIF A;  1IV3 A;  3CCL F;  1GO0 A;  5IT9 M;  3IR9 A;  2V9Y A;  3O85 A;  3CCE F;  3MCA B;  1DBF A;  1TVK B;  5CA0 B;  3JAM M;  2KG4 A;  3NK7 A;  1VQV A;  3L7Q A;  3S02 A;  3FBA A;  5KMG A;  1ODE A;  4BVQ A;  1CK2 A;  5EB0 A;  4ZHY B;  5CA1 B;  4O4I B;  1XV2 A;  4O2A A;  3JAR B;  3JAT B;  3N4Y A;  3TD4 A;  3CC2 F;  5LP6 C;  4G88 A;  5IYZ B;  5MN4 A;  3HKD A;  4X3L A;  1W55 A;  1W42 A;  1RA4 A;  2UYP A;  3N2K B;  3WJP A;  4X1Y B;  4DRX A;  3G4S F;  5GON A;  3SIV A;  3P10 A;  4G4V A;  3CPQ A;  5A2Q M;  3JAL B;  1J7H A;  1OFU A;  2HS4 A;  2RB9 A;  2Q1Y A;  4O2B A;  3HTN A;  3OBY A;  2PMP A;  1T0K B;  3NMU C;  3CB2 A;  1R1M A;  3GYQ A;  3M84 A;  1KNJ A;  5G4U C;  5LYJ A;  5IJ0 B;  3HKB B;  3MCQ A;  1SA0 A;  4XCQ A;  2LBX A;  4ZOL A;  1K73 H;  2QEX F;  2DT4 A;  4B62 A;  1T0A A;  3ESJ A;  2CWJ A;  4BT5 A;  3VMF B;  4FFB A;  5LOV A;  1VHA A;  4O4I A;  4F6R B;  3CCV F;  5HP8 A;  2OZB A;  4ZHV A;  5EZY A;  3I7T A;  2HP0 B;  1U43 A;  1QU9 A;  2FC3 A;  4BT7 A;  1JJ2 F;  4ZI7 A;  1X52 A;  4ZHW A;  5IJ9 B;  2CW4 A;  2Z01 A;  3MDO A;  2R75 1;  3S0Y A;  4BW0 B;  2BTQ B;  3N4Z A;  5HXU A;  1X7O A;  1FFX B;  5JQG B;  3CCU F;  3RYI B;  5EYP B;  3DC2 A;  3K14 A;  1W2B F;  5LP6 B;  3JAT A;  3MBM A;  3OBW A;  5EAZ A;  4I4T B;  1M1K H;  5FJ4 C;  1IPA A;  3R0P A;  5IYZ A;  4PWT A;  2KTU A;  1H7M A;  5MN6 A;  3I55 F;  1KQS F;  1RLU A;  2G9I A;  1JFF A;  3V7Q A;  4EB6 B;  3WXM B;  5ITZ B;  2CVL A;  3GHZ A;  1IV2 A;  3HKD B;  5GIP C;  3RA6 A;  3HWU A;  3RE3 A;  4O2B B;  5CA1 A;  2IQQ A;  2GZL A;  4ERH A;  1GZ0 A;  1YJW F;  3E22 A;  3C9R A;  3LWP C;  2BTU A;  2YYE A;  3QUW A;  1ZWZ A;  2OHW A;  3C9U A;  3LYB A;  1JD1 A;  5LA6 B;  4IIJ B;  3VYU C;  4DXD A;  5MN5 A;  2K1S A;  3S03 A;  1H48 A;  2LCA A;  5HY2 A;  3UT5 B;  1XHO A;  3CD6 F;  2HS3 A;  1VQ8 F;  2IG8 A;  4C4W C;  1W5E A;  2VGN A;  3IMP A;  3CC4 F;  1QD9 A;  4LCK A;  4B46 A;  4O4H B;  3JAS A;  2UYN A;  1ONI A;  3P4E A;  1VQ9 F;  3B6N A;  2KTV A;  2BTO A;  3E22 B;  3I56 F;  2FGY A;  3F6M A;  4O4H A;  2CZW A;  3LWO C;  2EWC A;  5EYP A;  5HWE A;  3JAK A;  3JVH A;  3VIU A;  3M1X A;  3E1Y A;  4ZK7 A;  1TVK A;  4I55 B;  5CA0 A;  5JH7 A;  2HVY D;  4TUY A;  2L26 A;  3OON A;  3VOB A;  1X7P A;  2Z1E A;  1JY8 A;  2UZH A;  3KJK A;  3WGN A;  3CCM F;  3VO8 A;  4C8I A;  1KD1 H;  5FNV B;  4U3J A;  5LXT A;  3PAF A;  1RLG A;  2QTP A;  3VTI C;  2HP0 A;  3FD6 A;  4X1I A;  4NQ3 A;  4EI7 A;  1Z5W A;  2GVI A;  3JCM M;  2LBW A;  3TD5 A;  4KWE A;  5BMV A;  1PF5 A;  5J2U B;  3CCJ F;  5B8F A;  1SDS A;  3M4S A;  2GLZ A;  1W5F A;  3RYC A;  2I6D A;  3N2G A;  3AGK A;  4G4Y A;  2ZOV A;  2UYN B;  3ZP7 A;  4B5C A;  4BT3 A;  5HY0 A;  3VI6 A;  3QHD A;  3IEW A;  3V4D A;  1U3P A;  2VGM A;  5LOV B;  4TUY B;  3WGK A;  4RQO A;  1JFF B;  3G6E F;  4NUT A;  1NJI H;  1VH8 A;  2CHS A;  3MQW A;  1SZQ A;  3TD3 A;  5JVD B;  3VCZ A;  3J81 M;  1KNK A;  2Z1U A;  1W3E X;  3KIZ A;  5LA6 A;  5JCO A;  4BVS A;  1VK3 A;  5EWR A;  3ELC A;  1YJ9 F;  3KJJ A;  2DYY A;  1YIT F;  3JAS B;  4BY9 D;  2OTL F;  3C9S A;  1QAH A;  5CB4 A;  4B45 A;  4FFB B;  2OTJ F;  1VQP F;  5BMV B;  2QI2 A;  3IEQ A;  4RHA A;  4BT2 A;  2ALE A;  3C8L A;  2ZVY A;  1Q81 H;  3VYS C;  3CCS F;  4TV9 B;  3DDN A;  3LWR C;  3LWV C;  3RYC B;  2VXY A;  1YHQ F;  5FNV A;  4YJ2 B;  3WJR A;  1DT9 A;  2Z1T A;  3K0T A;  3HKE A;  3JAR A;  1X25 A;  3NK6 A;  1FSZ A;  2B33 A;  2HQS C;  1GX1 A;  4G4W A;  4C8G A;  2VAM A;  3LDT A;  1FFX A;  2H6L A;  4C82 A;  1VQO F;  1XRG A;  1Q8R A;  1M90 H;  3VOA A;  4X1K A;  3CCQ F;  4I4T A;  5ITZ A;  2Q1X A;  4ZHQ A;  3RYF A;  3PLA C;  1IV4 A;  1YIJ F;  1VQL F;  1Q82 H;  1E7K A;  2MQE A;  1TUB A;  5CB4 B;  3D01 A;  3F0D A;  4YJ3 B;  1IV1 A;  4M8I A;  1N8R H;  3HKC A;  2R6R 1;  3UT5 A;  3IKE A;  2PHN A;  2IAF A;  2BO1 A;  4X20 B;  2RHH A;  3N2G B;  3RYF B;  3FPI A;  2AIZ P;  4YJ3 A;  3V7E A;  4F6R A;  1K9M H;  1VQ5 F;  3SIU A;  3LME A;  3S06 A;  4LNU B;  4NWO B;  4IHJ B;  3QTY A;  3CME F;  2VAW A;  5GAP K;  4O4J B;  3JAK B;  5GIO C;  3WGL A;  1UFY A;  1U40 A;  2NMU A;  5JCO C;  4ZHQ B;  2UYJ A;  3S0H A;  5JVD A;  1TUB B;  5EB1 B;  1W5A A;  3CMA F;  1W58 1;  1SA0 B;  3HAX D;  4C8E A;  1RQ7 A;  3NVI B;  1GO1 A;  5EO3 A;  4I55 A;  4EB6 A;  1CLI A;  1KC8 H;  3GTZ A;  3E20 B;  5C8Y A;  1W41 A;  1U3L A;  3LFO A;  3IKF A;  3CYP B;  4R40 B;  5IJ0 A;  2H8C A;  3HKC B;  1PXW A;  4C81 A;  1UI9 A;  3F0F A;  5KX5 B;  3OW2 F;  4X1Y A;  4DRX B;  5GAN K;  1VQ6 F;  4U3J B;  5LXT B;  1W57 A;  4X1K B;  1CN7 A;  3D00 A;  2LBT A;  3I3F A;  5KMG B;  3FFM A;  5JQG A;  4IHJ A;  1COM A;  1NMU B;  3JAL A;  2HRY A;  1S72 F;  5JH7 B;  2P6Y A;  3NVK E;  5DCV A;  1RQ2 A;  2ZVZ A;  4ZI7 B;  1JN1 A;  1YGY A;  3VYT C;  1OAP A;  2WAL A;  3J7A R;  3FD5 A;  1VQ7 F;  2W8B C;  4HNA A;  3CYQ A;  4U39 A;  3HJW C;  4YJ2 A;  5C8Y B;  1YJN F;  3HKB A;  3RYH A;  1VQM F;  3BYQ A;  2N48 A;  2ZAU A;  5EIB D;  4LNU A;  5HP7 A;  4G4Z A; 
#chains in the Genus database with same CATH homology
 2OTM A;  3LME A;  2UYN A;  3GTZ A;  3ZP4 A;  1ONI A;  4NWO B;  2UYP A;  3V4D A;  3QUW A;  3LYB A;  1JD1 A;  2CWJ A;  1UFY A;  2CHS A;  1PF5 A;  1DBF A;  3MQW A;  5HP8 A;  1FNK A;  2EWC A;  3K0T A;  3L7Q A;  3R0P A;  3I7T A;  1NQ3 A;  3VCZ A;  1UI9 A;  1QU9 A;  2UYK A;  1X25 A;  3K12 A;  3M4S A;  3D01 A;  1ODE A;  1XHO A;  1J7H A;  2UYJ A;  2B33 A;  3M1X A;  4ZK7 A;  3KJK A;  3ZP7 A;  2CW4 A;  2UYN B;  3KJJ A;  2DYY A;  2IG8 A;  2CHT A;  3I3F A;  1XRG A;  2CSL A;  1COM A;  1QAH A;  2CVL A;  3ZO8 A;  3ZOP A;  5HP7 A;  1QD9 A;  1FNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...