2IG8A

Crystal structure of a protein of unknown function pa3499 from pseudomonas aeruginosa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
MTAVRRIRAAALPDLPDASWSNALLVGEELVMSGMTAHPATRQAAERGAALDAHAQALVVLGKVKALLEAAGGHVGNLYKLNVYVTRIADKDAIGRARQEFFAGQGTFPASTLVEVSGLVFPELLVEIDAWARLDIDLANCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PA3499
publication title The crystal structure of a hypothetical protein PA3499 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2ig8A00
1UFYA 2CHSA 3I7TA 1ONIA 1J7HA 2OTMA 1XRGA 3KJKA 1NQ3A 1QD9A 3LYBA 1ODEA 3ZP4A 3M1XA 3MQWA 1COMA 2UYPA 1UI9A 2CWJA 2EWCA 2IG8A 1FNKA 2CHTA 3QUWA 1QAHA 1JD1A 4NWOB 2UYNA 2CW4A 3I3FA 3ZO8A 1QU9A 2CSLA 3KJJA 2UYKA 3D01A 3L7QA 3LMEA 3K12A 3ZP7A 1X25A 3K0TA 3M4SA 3R0PA 3V4DA 3VCZA 1PF5A 3ZOPA 1DBFA 2UYNB 5HP8A 2DYYA 5HP7A 2CVLA 3GTZA 2B33A 2UYJA 4ZK7A 1XHOA 1FNJA
chains in the Genus database with same CATH superfamily
1W41A 2JNBA 2Z1TA 5MN6A 1Q8RA 1SA0B 3CCSF 3E22B 2BTQB 3C9TA 1T0KB 1VQ4F 4O4HB 3RYCA 1FNKA 2CHTA 5JVDA 4TUYB 3IMPA 1OFUA 3CC7F 3JAKA 3VYSC 1CLIA 2LBWA 5IJ9B 2YXZA 5CA0A 1SA0A 4TZZA 3PLAC 3E20B 1NJIH 2RHLA 3E22A 4O4HA 4I55A 4BT5A 3JATB 1E7KA 5GIOC 3G71F 2R751 5J2UB 3RYHB 1VQMF 4BT6A 4TUYA 2CWJA 1IV3A 2RB9A 4XCQA 5IJ9A 5MN4A 2BTOA 2HQSC 2OZBA 3CCQF 3CYQA 1YJ9F 1KC8H 5LP6A 3HTNA 2H8EA 3ZOPA 3RYFB 5JCOC 4G88A 2VGMA 3JATA 3LWRC 4I4TB 3RYHA 5J2UA 1QVGF 4DXDA 3ON1A 3ELCA 3JALB 2CHSA 3NK7A 1U43A 5HY2A 1NQ3A 2KTVA 3C9UA 4G4XA 1KQSF 1SZQA 1VQ9F 3CG6A 3C9RA 4B45A 3JAWA 2UZHA 1XBIA 3DDNA 3WGKA 3RYFA 2WALA 3CYPB 4I4TA 2Z01A 3TD4A 3LDTA 3LWOC 2CVLA 1GZ0A 4C8EA 3WJRA 4ZK7A 1H47A 5BMVB 1VQ7F 5KX5A 1ODEA 1VQNF 3CC2F 3FD5A 3N2KB 2P6YA 2EWCA 3IR9A 5IJ0B 3F0DA 2BO1A 2CW4A 3CCRF 4BT2A 5EZYB 3S0YA 5MN5A 5HP8A 1Q81H 4BY9D 3VO8A 5BMVA 2HRYA 2I6RA 4EI9A 2ZVYA 4O4LB 1YJNF 4B5CA 3N2KA 4DRXB 5IJ0A 3NVIB 1H48A 3KJKA 3Q8HA 3HJWC 1UI9A 4C8IA 3NVKE 4B46A 5EZYA 1GO1A 3CD6F 3KIZA 1VK3A 4EB6B 4M8IA 1VQ5F 3PAFA 3U0OA 4HNAB 1W57A 1FSZA 5GONB 4O4JA 2ALEA 4O4LA 3VYTC 2DT4A 4BVTA 3MBMA 3WPWA 4E6EA 4ZHYB 4ZI7B 4KWEA 1GX1A 3S0HA 4DRXA 1W3EX 1RQ2A 4ERHA 2PMPA 1M90H 5LXTB 1NMUB 5IT9M 2K1SA 2F9ZC 1XHOA 3F0EA 3S0WA 3F6MA 2GVIA 1U40A 3CMEF 4C4WC 3F0GA 3HKEB 4EB6A 1N8RH 5HXZA 3MCQA 2IAFA 5J2TB 3BYQA 4HNAA 4WBNB 4I55B 5GONA 4PWTA 4TV8B 4NWOB 2KG4A 4ZI7A 1YIJF 2NMUA 3K12A 1Z5WA 2ZOVA 4C82A 5LXTA 3V7QA 4X1KA 3R0PA 3VIUA 1W581 3WJPA 2HRUA 3HKEA 5LP6B 5J2TA 1W40A 4YJ3B 2LBXA 3D54A 1ONIA 4WBNA 1OAPA 1VH8A 4U3JA 4TV8A 1YJWF 3FD6A 3MQWA 3P4EA 4LCKA 3D00A 4X1IB 1SDSA 3V7EA 3S02A 4G4VA 3IKFA 3D01A 2HS3A 4BVSA 3JASB 1S72F 3JAWB 3RA5A 5LP6C 3M84A 4TV9B 4IIJB 4C8GA 5LYJB 3VOBA 3CCVF 4YJ3A 1RA4A 3TD3A 1PXWA 2FC3A 5B8FA 4ZHVA 4X3MA 3N2GA 1VQ6F 4X1IA 1K8AH 3WGNA 3LWQC 3S03A 3M1XA 3UT5B 1W5AA 2L26A 2HP3A 3GHZA 4O2AA 2GLZA 3JASA 1M1KH 3QUWA 4TV9A 5LYJA 4IIJA 5HXUA 5KX5B 1KD1H 1W59A 3I3FA 1QU9A 3KJJA 1IV4A 1K9MH 3WGJA 5GAPK 5CA1B 5IYZA 4C81A 3V3TA 5FJ4C 1YGYA 2UYNB 2DYYA 3HWUA 4RHAA 3ESJA 2H6LA 1VQKF 3I55F 3OBYA 3UT5A 4EI8A 1FNJA 3JAMM 3VYUC 3VOAA 3WPXA 3QHDA 3FBAA 5HY1A 2BTUA 4BT3A 5GINC 1Z5VA 3F0FA 2IG8A 5EIBC 5EIBD 1JN1A 4BW0B 5CA1A 1W55A 2UYNA 1GO0A 3ZO8A 2HP0B 3IKEA 4U39A 2AIFA 3LMEA 3VMFB 3HKDB 4F6RA 1W42A 3N4YA 3V4DA 5EYPB 4X1YB 2HS0A 3NK6A 5LA6B 3CCJF 2Z1EA 3FFMA 2QA4F 1RLUA 1X7OA 4O2BB 4BVQA 3E1YA 4O4JB 1W5BA 1YQNA 3CXCF 5AVMA 3P10A 2GZLA 1IPAA 3LYBA 4G4YA 3ZP4A 3RE3A 2RHHA 2OTLF 5EB1B 5DCVA 1KNKA 4R40B 2HP0A 3GYQA 3HKDA 3OBWA 5EYPA 2VAMA 4X1YA 5LA6A 2VGNA 2LBTA 2UYKA 2FGYA 2H8CA 3FPIA 4LNUB 3MCAB 1XV2A 4O2BA 1KNJA 5GANK 1PF5A 1DBFA 1W5EA 2YYEA 3CB2A 4NQ3A 5FLXM 3OONA 4X1KB 1VQPF 3CCMF 2OTJF 2N48A 3HAXD 4ZHWA 4LNUA 1QVFF 2HS4A 5EO3A 4U3JB 4YJ2B 4EI7A 4X3LA 3I56F 4BT7A 3K14A 3TD5A 5HP7A 3CCUF 3HKCB 3VTIC 1TUBB 2AMTA 3GTZA 1VQOF 1RLGA 3CCEF 3T80A 3K2XA 2RHOA 3HKBB 4YJ2A 1COMA 3N2GB 2RHJA 2ZVZA 5HY0A 1Q7YH 3HKCA 1TVKA 2AIZP 5C8YB 1TUBA 4O2AB 3MDOA 3VCZA 1T0AA 1W2BF 2OHWA 1U3PA 4G4ZA 5FNVB 3LWPC 4ZHQB 2HX0A 3HKBA 5KMGB 2UYJA 2ZODA 5JH7B 3IEWA 5IYZB 5HY4A 3CC4F 2R6R1 4O4IB 1R1MA 2QTPA 1XRGA 2IQQA 1YITF 1K73H 3QTYA 2HVYD 5C8YA 1VQ8F 3C9SA 1JD1A 4G4WA 4BT4A 5FNVA 2Q1XA 3CPQA 4ZHQA 5KMGA 1X25A 5CB4B 2QEXF 3OW2F 1X7PA 2VAWA 5JH7A 2Z1FA 3AGKA 5JCOA 1VQVA 2ZAUA 1CK2A 3CPWF 4I50B 4O4IA 3RA6A 3EORA 4F6RB 1RQ7A 5EB0A 1UFYA 2I6DA 4FFBB 2KTUA 3WGMA 5A2QM 5EWRA 2UYPA 3WXMB 3SIVA 3KHNA 2V9YA 5GIPC 1YHQF 3WJQA 5CB4A 1QAHA 3B6NA 3LFOA 1FFXB 1VHAA 4NUTA 3RYIB 2CSLA 4I50A 3DC2A 1JFFB 3JCMM 3JALA 3N4ZA 4IHJB 1IV2A 5EAZA 1JY8A 2G9IA 4FFBA 2B33A 5JQGB 2LCAA 1IV1A 2W8BC 3JARB 5G4UC 3I7TA 2MQEA 2OTMA 5LOVB 2ZF8A 2Q1YA 5G4VC 1JJ2F 1FFXA 3RYIA 3J7AR 5ITZB 1JFFA 4IHJA 3P0ZA 1VQLF 1ZWZA 4X20B 3ZP7A 2Z1UA 4B62A 1YI2F 3G4SF 5JQGA 4ZOLB 3S06A 3KE1A 3ERNA 3JARA 2KGWA 1Q86H 2QI2A 5LOVA 2VXYA 3CCLF 1U3LA 3NMUC 2VAPA 2CZWA 1Q82H 1J7HA 5ITZA 1QD9A 3O85A 4X20A 1CN7A 3JVHA 5HWEA 3J80M 4ZOLA 3J81M 3VI6A 3SIUA 2PHNA 1H7MA 3C8LA 4RQOA 3L7QA 3RYCB 3IEQA 3K0TA 3M4SA 3G6EF 5JVDB 1W5FA 3WGLA 1TVKB 1DT9A 3JAKB 1X52A 3LWVC 4BVRA 3CMAF 5CA0B
chains in the Genus database with same CATH topology
1UFYA 2CHSA 3I7TA 1ONIA 1J7HA 2OTMA 1XRGA 3KJKA 1NQ3A 1QD9A 3LYBA 1ODEA 3ZP4A 3M1XA 3MQWA 1COMA 2UYPA 1UI9A 2CWJA 2EWCA 2IG8A 1FNKA 2CHTA 3QUWA 1QAHA 1JD1A 4NWOB 2UYNA 2CW4A 3I3FA 3ZO8A 1QU9A 2CSLA 3KJJA 2UYKA 3D01A 3L7QA 3LMEA 3K12A 3ZP7A 1X25A 3K0TA 3M4SA 3R0PA 3V4DA 3VCZA 1PF5A 3ZOPA 1DBFA 2UYNB 5HP8A 2DYYA 5HP7A 2CVLA 3GTZA 2B33A 2UYJA 4ZK7A 1XHOA 1FNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFY A;  2CHS A;  3I7T A;  1ONI A;  1J7H A;  2OTM A;  1XRG A;  3KJK A;  1NQ3 A;  1QD9 A;  3LYB A;  1ODE A;  3ZP4 A;  3M1X A;  3MQW A;  1COM A;  2UYP A;  1UI9 A;  2CWJ A;  2EWC A;  2IG8 A;  1FNK A;  2CHT A;  3QUW A;  1QAH A;  1JD1 A;  4NWO B;  2UYN A;  2CW4 A;  3I3F A;  3ZO8 A;  1QU9 A;  2CSL A;  3KJJ A;  2UYK A;  3D01 A;  3L7Q A;  3LME A;  3K12 A;  3ZP7 A;  1X25 A;  3K0T A;  3M4S A;  3R0P A;  3V4D A;  3VCZ A;  1PF5 A;  3ZOP A;  1DBF A;  2UYN B;  5HP8 A;  2DYY A;  5HP7 A;  2CVL A;  3GTZ A;  2B33 A;  2UYJ A;  4ZK7 A;  1XHO A;  1FNJ A; 
#chains in the Genus database with same CATH topology
 1W41 A;  2JNB A;  2Z1T A;  5MN6 A;  1Q8R A;  1SA0 B;  3CCS F;  3E22 B;  2BTQ B;  3C9T A;  1T0K B;  1VQ4 F;  4O4H B;  3RYC A;  1FNK A;  2CHT A;  5JVD A;  4TUY B;  3IMP A;  1OFU A;  3CC7 F;  3JAK A;  3VYS C;  1CLI A;  2LBW A;  5IJ9 B;  2YXZ A;  5CA0 A;  1SA0 A;  4TZZ A;  3PLA C;  3E20 B;  1NJI H;  2RHL A;  3E22 A;  4O4H A;  4I55 A;  4BT5 A;  3JAT B;  1E7K A;  5GIO C;  3G71 F;  2R75 1;  5J2U B;  3RYH B;  1VQM F;  4BT6 A;  4TUY A;  2CWJ A;  1IV3 A;  2RB9 A;  4XCQ A;  5IJ9 A;  5MN4 A;  2BTO A;  2HQS C;  2OZB A;  3CCQ F;  3CYQ A;  1YJ9 F;  1KC8 H;  5LP6 A;  3HTN A;  2H8E A;  3ZOP A;  3RYF B;  5JCO C;  4G88 A;  2VGM A;  3JAT A;  3LWR C;  4I4T B;  3RYH A;  5J2U A;  1QVG F;  4DXD A;  3ON1 A;  3ELC A;  3JAL B;  2CHS A;  3NK7 A;  1U43 A;  5HY2 A;  1NQ3 A;  2KTV A;  3C9U A;  4G4X A;  1KQS F;  1SZQ A;  1VQ9 F;  3CG6 A;  3C9R A;  4B45 A;  3JAW A;  2UZH A;  1XBI A;  3DDN A;  3WGK A;  3RYF A;  2WAL A;  3CYP B;  4I4T A;  2Z01 A;  3TD4 A;  3LDT A;  3LWO C;  2CVL A;  1GZ0 A;  4C8E A;  3WJR A;  4ZK7 A;  1H47 A;  5BMV B;  1VQ7 F;  5KX5 A;  1ODE A;  1VQN F;  3CC2 F;  3FD5 A;  3N2K B;  2P6Y A;  2EWC A;  3IR9 A;  5IJ0 B;  3F0D A;  2BO1 A;  2CW4 A;  3CCR F;  4BT2 A;  5EZY B;  3S0Y A;  5MN5 A;  5HP8 A;  1Q81 H;  4BY9 D;  3VO8 A;  5BMV A;  2HRY A;  2I6R A;  4EI9 A;  2ZVY A;  4O4L B;  1YJN F;  4B5C A;  3N2K A;  4DRX B;  5IJ0 A;  3NVI B;  1H48 A;  3KJK A;  3Q8H A;  3HJW C;  1UI9 A;  4C8I A;  3NVK E;  4B46 A;  5EZY A;  1GO1 A;  3CD6 F;  3KIZ A;  1VK3 A;  4EB6 B;  4M8I A;  1VQ5 F;  3PAF A;  3U0O A;  4HNA B;  1W57 A;  1FSZ A;  5GON B;  4O4J A;  2ALE A;  4O4L A;  3VYT C;  2DT4 A;  4BVT A;  3MBM A;  3WPW A;  4E6E A;  4ZHY B;  4ZI7 B;  4KWE A;  1GX1 A;  3S0H A;  4DRX A;  1W3E X;  1RQ2 A;  4ERH A;  2PMP A;  1M90 H;  5LXT B;  1NMU B;  5IT9 M;  2K1S A;  2F9Z C;  1XHO A;  3F0E A;  3S0W A;  3F6M A;  2GVI A;  1U40 A;  3CME F;  4C4W C;  3F0G A;  3HKE B;  4EB6 A;  1N8R H;  5HXZ A;  3MCQ A;  2IAF A;  5J2T B;  3BYQ A;  4HNA A;  4WBN B;  4I55 B;  5GON A;  4PWT A;  4TV8 B;  4NWO B;  2KG4 A;  4ZI7 A;  1YIJ F;  2NMU A;  3K12 A;  1Z5W A;  2ZOV A;  4C82 A;  5LXT A;  3V7Q A;  4X1K A;  3R0P A;  3VIU A;  1W58 1;  3WJP A;  2HRU A;  3HKE A;  5LP6 B;  5J2T A;  1W40 A;  4YJ3 B;  2LBX A;  3D54 A;  1ONI A;  4WBN A;  1OAP A;  1VH8 A;  4U3J A;  4TV8 A;  1YJW F;  3FD6 A;  3MQW A;  3P4E A;  4LCK A;  3D00 A;  4X1I B;  1SDS A;  3V7E A;  3S02 A;  4G4V A;  3IKF A;  3D01 A;  2HS3 A;  4BVS A;  3JAS B;  1S72 F;  3JAW B;  3RA5 A;  5LP6 C;  3M84 A;  4TV9 B;  4IIJ B;  4C8G A;  5LYJ B;  3VOB A;  3CCV F;  4YJ3 A;  1RA4 A;  3TD3 A;  1PXW A;  2FC3 A;  5B8F A;  4ZHV A;  4X3M A;  3N2G A;  1VQ6 F;  4X1I A;  1K8A H;  3WGN A;  3LWQ C;  3S03 A;  3M1X A;  3UT5 B;  1W5A A;  2L26 A;  2HP3 A;  3GHZ A;  4O2A A;  2GLZ A;  3JAS A;  1M1K H;  3QUW A;  4TV9 A;  5LYJ A;  4IIJ A;  5HXU A;  5KX5 B;  1KD1 H;  1W59 A;  3I3F A;  1QU9 A;  3KJJ A;  1IV4 A;  1K9M H;  3WGJ A;  5GAP K;  5CA1 B;  5IYZ A;  4C81 A;  3V3T A;  5FJ4 C;  1YGY A;  2UYN B;  2DYY A;  3HWU A;  4RHA A;  3ESJ A;  2H6L A;  1VQK F;  3I55 F;  3OBY A;  3UT5 A;  4EI8 A;  1FNJ A;  3JAM M;  3VYU C;  3VOA A;  3WPX A;  3QHD A;  3FBA A;  5HY1 A;  2BTU A;  4BT3 A;  5GIN C;  1Z5V A;  3F0F A;  2IG8 A;  5EIB C;  5EIB D;  1JN1 A;  4BW0 B;  5CA1 A;  1W55 A;  2UYN A;  1GO0 A;  3ZO8 A;  2HP0 B;  3IKE A;  4U39 A;  2AIF A;  3LME A;  3VMF B;  3HKD B;  4F6R A;  1W42 A;  3N4Y A;  3V4D A;  5EYP B;  4X1Y B;  2HS0 A;  3NK6 A;  5LA6 B;  3CCJ F;  2Z1E A;  3FFM A;  2QA4 F;  1RLU A;  1X7O A;  4O2B B;  4BVQ A;  3E1Y A;  4O4J B;  1W5B A;  1YQN A;  3CXC F;  5AVM A;  3P10 A;  2GZL A;  1IPA A;  3LYB A;  4G4Y A;  3ZP4 A;  3RE3 A;  2RHH A;  2OTL F;  5EB1 B;  5DCV A;  1KNK A;  4R40 B;  2HP0 A;  3GYQ A;  3HKD A;  3OBW A;  5EYP A;  2VAM A;  4X1Y A;  5LA6 A;  2VGN A;  2LBT A;  2UYK A;  2FGY A;  2H8C A;  3FPI A;  4LNU B;  3MCA B;  1XV2 A;  4O2B A;  1KNJ A;  5GAN K;  1PF5 A;  1DBF A;  1W5E A;  2YYE A;  3CB2 A;  4NQ3 A;  5FLX M;  3OON A;  4X1K B;  1VQP F;  3CCM F;  2OTJ F;  2N48 A;  3HAX D;  4ZHW A;  4LNU A;  1QVF F;  2HS4 A;  5EO3 A;  4U3J B;  4YJ2 B;  4EI7 A;  4X3L A;  3I56 F;  4BT7 A;  3K14 A;  3TD5 A;  5HP7 A;  3CCU F;  3HKC B;  3VTI C;  1TUB B;  2AMT A;  3GTZ A;  1VQO F;  1RLG A;  3CCE F;  3T80 A;  3K2X A;  2RHO A;  3HKB B;  4YJ2 A;  1COM A;  3N2G B;  2RHJ A;  2ZVZ A;  5HY0 A;  1Q7Y H;  3HKC A;  1TVK A;  2AIZ P;  5C8Y B;  1TUB A;  4O2A B;  3MDO A;  3VCZ A;  1T0A A;  1W2B F;  2OHW A;  1U3P A;  4G4Z A;  5FNV B;  3LWP C;  4ZHQ B;  2HX0 A;  3HKB A;  5KMG B;  2UYJ A;  2ZOD A;  5JH7 B;  3IEW A;  5IYZ B;  5HY4 A;  3CC4 F;  2R6R 1;  4O4I B;  1R1M A;  2QTP A;  1XRG A;  2IQQ A;  1YIT F;  1K73 H;  3QTY A;  2HVY D;  5C8Y A;  1VQ8 F;  3C9S A;  1JD1 A;  4G4W A;  4BT4 A;  5FNV A;  2Q1X A;  3CPQ A;  4ZHQ A;  5KMG A;  1X25 A;  5CB4 B;  2QEX F;  3OW2 F;  1X7P A;  2VAW A;  5JH7 A;  2Z1F A;  3AGK A;  5JCO A;  1VQV A;  2ZAU A;  1CK2 A;  3CPW F;  4I50 B;  4O4I A;  3RA6 A;  3EOR A;  4F6R B;  1RQ7 A;  5EB0 A;  1UFY A;  2I6D A;  4FFB B;  2KTU A;  3WGM A;  5A2Q M;  5EWR A;  2UYP A;  3WXM B;  3SIV A;  3KHN A;  2V9Y A;  5GIP C;  1YHQ F;  3WJQ A;  5CB4 A;  1QAH A;  3B6N A;  3LFO A;  1FFX B;  1VHA A;  4NUT A;  3RYI B;  2CSL A;  4I50 A;  3DC2 A;  1JFF B;  3JCM M;  3JAL A;  3N4Z A;  4IHJ B;  1IV2 A;  5EAZ A;  1JY8 A;  2G9I A;  4FFB A;  2B33 A;  5JQG B;  2LCA A;  1IV1 A;  2W8B C;  3JAR B;  5G4U C;  3I7T A;  2MQE A;  2OTM A;  5LOV B;  2ZF8 A;  2Q1Y A;  5G4V C;  1JJ2 F;  1FFX A;  3RYI A;  3J7A R;  5ITZ B;  1JFF A;  4IHJ A;  3P0Z A;  1VQL F;  1ZWZ A;  4X20 B;  3ZP7 A;  2Z1U A;  4B62 A;  1YI2 F;  3G4S F;  5JQG A;  4ZOL B;  3S06 A;  3KE1 A;  3ERN A;  3JAR A;  2KGW A;  1Q86 H;  2QI2 A;  5LOV A;  2VXY A;  3CCL F;  1U3L A;  3NMU C;  2VAP A;  2CZW A;  1Q82 H;  1J7H A;  5ITZ A;  1QD9 A;  3O85 A;  4X20 A;  1CN7 A;  3JVH A;  5HWE A;  3J80 M;  4ZOL A;  3J81 M;  3VI6 A;  3SIU A;  2PHN A;  1H7M A;  3C8L A;  4RQO A;  3L7Q A;  3RYC B;  3IEQ A;  3K0T A;  3M4S A;  3G6E F;  5JVD B;  1W5F A;  3WGL A;  1TVK B;  1DT9 A;  3JAK B;  1X52 A;  3LWV C;  4BVR A;  3CMA F;  5CA0 B; 
#chains in the Genus database with same CATH homology
 1UFY A;  2CHS A;  3I7T A;  1ONI A;  1J7H A;  2OTM A;  1XRG A;  3KJK A;  1NQ3 A;  1QD9 A;  3LYB A;  1ODE A;  3ZP4 A;  3M1X A;  3MQW A;  1COM A;  2UYP A;  1UI9 A;  2CWJ A;  2EWC A;  2IG8 A;  1FNK A;  2CHT A;  3QUW A;  1QAH A;  1JD1 A;  4NWO B;  2UYN A;  2CW4 A;  3I3F A;  3ZO8 A;  1QU9 A;  2CSL A;  3KJJ A;  2UYK A;  3D01 A;  3L7Q A;  3LME A;  3K12 A;  3ZP7 A;  1X25 A;  3K0T A;  3M4S A;  3R0P A;  3V4D A;  3VCZ A;  1PF5 A;  3ZOP A;  1DBF A;  2UYN B;  5HP8 A;  2DYY A;  5HP7 A;  2CVL A;  3GTZ A;  2B33 A;  2UYJ A;  4ZK7 A;  1XHO A;  1FNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...