2IG8A

Crystal structure of a protein of unknown function pa3499 from pseudomonas aeruginosa
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
MTAVRRIRAAALPDLPDASWSNALLVGEELVMSGMTAHPATRQAAERGAALDAHAQALVVLGKVKALLEAAGGHVGNLYKLNVYVTRIADKDAIGRARQEFFAGQGTFPASTLVEVSGLVFPELLVEIDAWARLDIDLANCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a hypothetical protein PA3499 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PA3499
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2ig8A00
1FNKA 1ODEA 3LYBA 2CVLA 3D01A 3R0PA 4ZK7A 2B33A 1UFYA 2CHSA 1COMA 1DBFA 1JD1A 3LMEA 1J7HA 1QD9A 1NQ3A 1QU9A 3I3FA 3I7TA 3M4SA 2DYYA 1X25A 2CW4A 2CWJA 3M1XA 3MQWA 1XHOA 2UYPA 2UYJA 3ZOPA 5HP7A 4NWOB 3K12A 2EWCA 5HP8A 3QUWA 1ONIA 1PF5A 2UYNB 1XRGA 3ZO8A 3GTZA 3ZP7A 3K0TA 1QAHA 2CHTA 2UYKA 3V4DA 2IG8A 2OTMA 3VCZA 3KJKA 3L7QA 3KJJA 3ZP4A 1UI9A 1FNJA 2CSLA 2UYNA
chains in the Genus database with same CATH superfamily
1H47A 4X3LA 3HKDB 4I50A 4LCKA 4G4XA 4BVRA 2HRUA 5AVMA 2YXZA 4TUYA 3NMUC 1COMA 3CCRF 3RYHA 5CA0B 1TUBA 1SA0B 3JAKA 3TD4A 3WGMA 5HXUA 5J2UB 5EYPB 3N2KB 4IIJB 4NWOB 4I55A 3S06A 5HP8A 2AIZP 5EAZA 1XV2A 1E7KA 1KNJA 2HP0A 5EZYB 4LNUB 1T0AA 3ZP4A 3WGNA 5IJ9B 5EB0A 3KJJA 3RYCB 5ITZB 2KG4A 3G71F 1UI9A 3E22B 5LXTA 3CCLF 5JH7B 1W42A 5G4UC 3ERNA 3CYPB 1Q81H 5HY2A 1ODEA 3VYUC 3S02A 1UFYA 3VMFB 1VQ6F 5DCVA 1DBFA 3TD5A 3HKBA 4ZOLB 1FSZA 1KQSF 5FJ4C 5CB4A 2CW4A 4X1YB 3WJRA 1Q8RA 2PHNA 3ZOPA 3VI6A 1W40A 4EI7A 4YJ3A 3C9UA 3JARA 1YHQF 4ZHWA 1Q7YH 4PWTA 5LP6A 1W5AA 2CZWA 2IAFA 3JATB 3KJKA 2LBTA 3N4YA 3WPWA 5GINC 4U39A 3E20B 5EIBC 3IMPA 4R40B 4X20B 3P4EA 2ZOVA 1KNKA 5GAPK 1NQ3A 3HKEB 3CCVF 1YQNA 2NMUA 3VO8A 2ZVZA 4X1KB 3IKEA 1K9MH 3CCUF 4EI8A 3CCEF 5GANK 3IEQA 3UT5B 4B45A 3K0TA 1GO0A 3OBYA 2H6LA 2CHTA 3RA6A 2HVYD 2VAMA 3JALA 3FD5A 1FNJA 1YITF 4BVQA 5IJ0B 3MBMA 1XBIA 4ZHQB 2B33A 4BT3A 2VGMA 1DT9A 1VK3A 4I4TA 1TUBB 1QU9A 1W41A 3JAKB 3FPIA 3VYSC 1VQ9F 3B6NA 2CWJA 5LYJA 3I55F 3SIVA 1W2BF 2RHHA 2Q1YA 3NK6A 2G9IA 2HS4A 1ONIA 5EIBD 1ZWZA 4U3JB 1Z5VA 1JN1A 1YJ9F 2YYEA 3LDTA 5EO3A 1IV3A 3RYCA 3WGJA 4BVTA 2HP3A 1W5EA 1U40A 5LYJB 1H7MA 1U43A 1VQ4F 5G4VC 3ON1A 3J80M 3M4SA 3CMEF 5HY0A 1SA0A 3RYIB 2FGYA 1JJ2F 3JVHA 2BTUA 5LA6A 5CA1B 4YJ2B 2I6DA 1RQ2A 2QA4F 5MN4A 2IG8A 2Z01A 5J2TA 1QVGF 1IPAA 3V3TA 5JQGB 2HP0B 5EZYA 4C82A 4O4JB 2H8EA 1TVKB 3IR9A 5KX5B 2AIFA 2Z1UA 3N2GA 5HXZA 2CHSA 4DRXB 4BT7A 4G4WA 1VQMF 2L26A 1U3LA 3MCQA 1YGYA 3I3FA 2AMTA 3QTYA 3RYFA 1X25A 2HX0A 4BVSA 4ZHYB 5GIPC 1GZ0A 4C8GA 2VAPA 3Q8HA 3JCMM 5KX5A 3ZO8A 3M84A 1U3PA 3F0DA 3GTZA 3IEWA 4TV9A 3NVKE 2HQSC 1QAHA 4O4LB 4BY9D 2MQEA 3ELCA 2UYNA 4BW0B 2JNBA 3WJPA 3HWUA 5EYPA 3LWOC 3FBAA 3HKCA 3N2KA 4G88A 1OFUA 4IIJA 1H48A 3F0FA 1RQ7A 3TD3A 3CXCF 2Z1EA 1VQNF 4TV8B 4EB6B 4HNAA 3I56F 1IV2A 5ITZA 2ZAUA 5BMVB 3KIZA 3S0YA 4WBNA 1VQLF 5C8YB 3F0GA 3F0EA 3CPQA 3RA5A 5HWEA 4HNAB 3F6MA 3J7AR 4ZK7A 3VOBA 2V9YA 2RHLA 3T80A 4FFBB 1QD9A 3IKFA 4DRXA 1OAPA 1X7OA 2DYYA 4I4TB 5IYZA 3EORA 3QHDA 1XRGA 4ZHQA 1RLGA 5FLXM 2Q1XA 1YIJF 1X7PA 1VQ8F 5MN6A 4BT6A 5GONA 5MN5A 3JAWA 1IV1A 5EB1B 1W5BA 3PAFA 2CVLA 2WALA 1GO1A 3D01A 4BT4A 5EWRA 1SDSA 1PXWA 2ALEA 1VQ5F 2HS0A 3CCJF 5A2QM 4O4IB 2BO1A 4RQOA 1YI2F 3CCMF 3I7TA 3V7EA 5CA0A 3RYHB 2VXYA 4O2BB 2UYJA 3K12A 2EWCA 3QUWA 4X20A 3E22A 5LXTB 2RHOA 4WBNB 1KC8H 3HJWC 3L7QA 4YJ2A 5C8YA 3P10A 4LNUA 4BT5A 4G4VA 3GHZA 4EI9A 2BTOA 2QI2A 2PMPA 4ZOLA 1Z5WA 5JVDB 2Z1FA 4ZI7B 3NK7A 1RA4A 2UYPA 2GZLA 1YJNF 4O2AB 1W581 3O85A 3VOAA 1VQOF 3ESJA 1VQKF 4NUTA 1K8AH 3CCSF 1W3EX 3JAMM 3CC4F 3S03A 3JARB 4C8EA 3S0WA 5LP6B 3JATA 2LBXA 1JFFA 1FFXA 2I6RA 4KWEA 5HY1A 3LWQC 3CCQF 3CG6A 4XCQA 3HKEA 5GIOC 3N4ZA 2QEXF 4FFBA 4O4HA 2VAWA 4X1KA 4O4IA 5KMGB 5JCOC 3CC2F 1T0KB 3MQWA 3OW2F 1PF5A 2P6YA 2BTQB 4X3MA 4IHJB 2H8CA 4O4JA 2OTLF 3CB2A 3LWRC 5IT9M 3P0ZA 2K1SA 3VCZA 3BYQA 3C9TA 4M8IA 5GONB 4C8IA 2ZVYA 5LP6C 1Q86H 2W8BC 4E6EA 5BMVA 3RYIA 4G4ZA 2N48A 3FFMA 4B46A 2OTJF 2IQQA 1NMUB 1KD1H 2UZHA 2ZODA 4ZI7A 3HKDA 4I50B 3VIUA 1W5FA 3WGKA 2LBWA 1TVKA 4C81A 5B8FA 3CMAF 1VQPF 1W57A 4X1IA 5LOVB 4F6RB 2OZBA 1VQVA 2R6R1 3UT5A 1CK2A 1IV4A 3JASA 3CYQA 3LFOA 1W59A 4BT2A 5J2UA 1M1KH 3LMEA 1J7HA 5JVDA 4TZZA 1VH8A 5JCOA 1GX1A 1VQ7F 4B62A 2RB9A 5HY4A 2QTPA 2UYNB 1SZQA 1CLIA 5J2TB 3JASB 2HS3A 3FD6A 1S72F 5JH7A 5JQGA 2OTMA 2LCAA 3DDNA 5FNVA 4RHAA 4O2BA 4NQ3A 3MCAB 3CD6F 3D00A 4YJ3B 3SIUA 3R0PA 1X52A 5CB4B 3LWVC 3RYFB 2KGWA 3OBWA 4O4HB 3WGLA 2ZF8A 3WJQA 5KMGA 3M1XA 4B5CA 5HP7A 3S0HA 3E1YA 5FNVB 1JY8A 2KTUA 3GYQA 3JAWB 4O4LA 1Q82H 3WXMB 2DT4A 3VTIC 2UYKA 5IJ9A 2GVIA 3G4SF 3G6EF 4F6RA 2VGNA 3K2XA 4U3JA 3WPXA 4O2AA 3LYBA 1K73H 3KE1A 5IYZB 3LWPC 3HKBB 4TV8A 3C9RA 4EB6A 2HRYA 3N2GB 3KHNA 5IJ0A 3C8LA 1JFFB 1RLUA 3JALB 3ZP7A 3V7QA 3HTNA 2Z1TA 3J81M 4X1IB 5LOVA 3VYTC 4IHJA 3U0OA 3CPWF 5LA6B 5CA1A 4G4YA 1M90H 4TV9B 3MDOA 1FNKA 2RHJA 3C9SA 4ZHVA 4ERHA 2R751 3AGKA 2KTVA 3PLAC 4X1YA 1CN7A 3CC7F 3HAXD 3RE3A 3OONA 1NJIH 1VHAA 2OHWA 1XHOA 1W55A 4DXDA 1R1MA 3HKCB 2GLZA 4TUYB 2FC3A 1N8RH 1YJWF 4C4WC 1QVFF 1FFXB 3DC2A 3D54A 3V4DA 2F9ZC 3NVIB 1JD1A 2CSLA 4I55B 3K14A
chains in the Genus database with same CATH topology
1FNKA 1ODEA 3LYBA 2CVLA 3D01A 3R0PA 4ZK7A 2B33A 1UFYA 2CHSA 1COMA 1DBFA 1JD1A 3LMEA 1J7HA 1QD9A 1NQ3A 1QU9A 3I3FA 3I7TA 3M4SA 2DYYA 1X25A 2CW4A 2CWJA 3M1XA 3MQWA 1XHOA 2UYPA 2UYJA 3ZOPA 5HP7A 4NWOB 3K12A 2EWCA 5HP8A 3QUWA 1ONIA 1PF5A 2UYNB 1XRGA 3ZO8A 3GTZA 3ZP7A 3K0TA 1QAHA 2CHTA 2UYKA 3V4DA 2IG8A 2OTMA 3VCZA 3KJKA 3L7QA 3KJJA 3ZP4A 1UI9A 1FNJA 2CSLA 2UYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNK A;  1ODE A;  3LYB A;  2CVL A;  3D01 A;  3R0P A;  4ZK7 A;  2B33 A;  1UFY A;  2CHS A;  1COM A;  1DBF A;  1JD1 A;  3LME A;  1J7H A;  1QD9 A;  1NQ3 A;  1QU9 A;  3I3F A;  3I7T A;  3M4S A;  2DYY A;  1X25 A;  2CW4 A;  2CWJ A;  3M1X A;  3MQW A;  1XHO A;  2UYP A;  2UYJ A;  3ZOP A;  5HP7 A;  4NWO B;  3K12 A;  2EWC A;  5HP8 A;  3QUW A;  1ONI A;  1PF5 A;  2UYN B;  1XRG A;  3ZO8 A;  3GTZ A;  3ZP7 A;  3K0T A;  1QAH A;  2CHT A;  2UYK A;  3V4D A;  2IG8 A;  2OTM A;  3VCZ A;  3KJK A;  3L7Q A;  3KJJ A;  3ZP4 A;  1UI9 A;  1FNJ A;  2CSL A;  2UYN A; 
#chains in the Genus database with same CATH topology
 1H47 A;  4X3L A;  3HKD B;  4I50 A;  4LCK A;  4G4X A;  4BVR A;  2HRU A;  5AVM A;  2YXZ A;  4TUY A;  3NMU C;  1COM A;  3CCR F;  3RYH A;  5CA0 B;  1TUB A;  1SA0 B;  3JAK A;  3TD4 A;  3WGM A;  5HXU A;  5J2U B;  5EYP B;  3N2K B;  4IIJ B;  4NWO B;  4I55 A;  3S06 A;  5HP8 A;  2AIZ P;  5EAZ A;  1XV2 A;  1E7K A;  1KNJ A;  2HP0 A;  5EZY B;  4LNU B;  1T0A A;  3ZP4 A;  3WGN A;  5IJ9 B;  5EB0 A;  3KJJ A;  3RYC B;  5ITZ B;  2KG4 A;  3G71 F;  1UI9 A;  3E22 B;  5LXT A;  3CCL F;  5JH7 B;  1W42 A;  5G4U C;  3ERN A;  3CYP B;  1Q81 H;  5HY2 A;  1ODE A;  3VYU C;  3S02 A;  1UFY A;  3VMF B;  1VQ6 F;  5DCV A;  1DBF A;  3TD5 A;  3HKB A;  4ZOL B;  1FSZ A;  1KQS F;  5FJ4 C;  5CB4 A;  2CW4 A;  4X1Y B;  3WJR A;  1Q8R A;  2PHN A;  3ZOP A;  3VI6 A;  1W40 A;  4EI7 A;  4YJ3 A;  3C9U A;  3JAR A;  1YHQ F;  4ZHW A;  1Q7Y H;  4PWT A;  5LP6 A;  1W5A A;  2CZW A;  2IAF A;  3JAT B;  3KJK A;  2LBT A;  3N4Y A;  3WPW A;  5GIN C;  4U39 A;  3E20 B;  5EIB C;  3IMP A;  4R40 B;  4X20 B;  3P4E A;  2ZOV A;  1KNK A;  5GAP K;  1NQ3 A;  3HKE B;  3CCV F;  1YQN A;  2NMU A;  3VO8 A;  2ZVZ A;  4X1K B;  3IKE A;  1K9M H;  3CCU F;  4EI8 A;  3CCE F;  5GAN K;  3IEQ A;  3UT5 B;  4B45 A;  3K0T A;  1GO0 A;  3OBY A;  2H6L A;  2CHT A;  3RA6 A;  2HVY D;  2VAM A;  3JAL A;  3FD5 A;  1FNJ A;  1YIT F;  4BVQ A;  5IJ0 B;  3MBM A;  1XBI A;  4ZHQ B;  2B33 A;  4BT3 A;  2VGM A;  1DT9 A;  1VK3 A;  4I4T A;  1TUB B;  1QU9 A;  1W41 A;  3JAK B;  3FPI A;  3VYS C;  1VQ9 F;  3B6N A;  2CWJ A;  5LYJ A;  3I55 F;  3SIV A;  1W2B F;  2RHH A;  2Q1Y A;  3NK6 A;  2G9I A;  2HS4 A;  1ONI A;  5EIB D;  1ZWZ A;  4U3J B;  1Z5V A;  1JN1 A;  1YJ9 F;  2YYE A;  3LDT A;  5EO3 A;  1IV3 A;  3RYC A;  3WGJ A;  4BVT A;  2HP3 A;  1W5E A;  1U40 A;  5LYJ B;  1H7M A;  1U43 A;  1VQ4 F;  5G4V C;  3ON1 A;  3J80 M;  3M4S A;  3CME F;  5HY0 A;  1SA0 A;  3RYI B;  2FGY A;  1JJ2 F;  3JVH A;  2BTU A;  5LA6 A;  5CA1 B;  4YJ2 B;  2I6D A;  1RQ2 A;  2QA4 F;  5MN4 A;  2IG8 A;  2Z01 A;  5J2T A;  1QVG F;  1IPA A;  3V3T A;  5JQG B;  2HP0 B;  5EZY A;  4C82 A;  4O4J B;  2H8E A;  1TVK B;  3IR9 A;  5KX5 B;  2AIF A;  2Z1U A;  3N2G A;  5HXZ A;  2CHS A;  4DRX B;  4BT7 A;  4G4W A;  1VQM F;  2L26 A;  1U3L A;  3MCQ A;  1YGY A;  3I3F A;  2AMT A;  3QTY A;  3RYF A;  1X25 A;  2HX0 A;  4BVS A;  4ZHY B;  5GIP C;  1GZ0 A;  4C8G A;  2VAP A;  3Q8H A;  3JCM M;  5KX5 A;  3ZO8 A;  3M84 A;  1U3P A;  3F0D A;  3GTZ A;  3IEW A;  4TV9 A;  3NVK E;  2HQS C;  1QAH A;  4O4L B;  4BY9 D;  2MQE A;  3ELC A;  2UYN A;  4BW0 B;  2JNB A;  3WJP A;  3HWU A;  5EYP A;  3LWO C;  3FBA A;  3HKC A;  3N2K A;  4G88 A;  1OFU A;  4IIJ A;  1H48 A;  3F0F A;  1RQ7 A;  3TD3 A;  3CXC F;  2Z1E A;  1VQN F;  4TV8 B;  4EB6 B;  4HNA A;  3I56 F;  1IV2 A;  5ITZ A;  2ZAU A;  5BMV B;  3KIZ A;  3S0Y A;  4WBN A;  1VQL F;  5C8Y B;  3F0G A;  3F0E A;  3CPQ A;  3RA5 A;  5HWE A;  4HNA B;  3F6M A;  3J7A R;  4ZK7 A;  3VOB A;  2V9Y A;  2RHL A;  3T80 A;  4FFB B;  1QD9 A;  3IKF A;  4DRX A;  1OAP A;  1X7O A;  2DYY A;  4I4T B;  5IYZ A;  3EOR A;  3QHD A;  1XRG A;  4ZHQ A;  1RLG A;  5FLX M;  2Q1X A;  1YIJ F;  1X7P A;  1VQ8 F;  5MN6 A;  4BT6 A;  5GON A;  5MN5 A;  3JAW A;  1IV1 A;  5EB1 B;  1W5B A;  3PAF A;  2CVL A;  2WAL A;  1GO1 A;  3D01 A;  4BT4 A;  5EWR A;  1SDS A;  1PXW A;  2ALE A;  1VQ5 F;  2HS0 A;  3CCJ F;  5A2Q M;  4O4I B;  2BO1 A;  4RQO A;  1YI2 F;  3CCM F;  3I7T A;  3V7E A;  5CA0 A;  3RYH B;  2VXY A;  4O2B B;  2UYJ A;  3K12 A;  2EWC A;  3QUW A;  4X20 A;  3E22 A;  5LXT B;  2RHO A;  4WBN B;  1KC8 H;  3HJW C;  3L7Q A;  4YJ2 A;  5C8Y A;  3P10 A;  4LNU A;  4BT5 A;  4G4V A;  3GHZ A;  4EI9 A;  2BTO A;  2QI2 A;  2PMP A;  4ZOL A;  1Z5W A;  5JVD B;  2Z1F A;  4ZI7 B;  3NK7 A;  1RA4 A;  2UYP A;  2GZL A;  1YJN F;  4O2A B;  1W58 1;  3O85 A;  3VOA A;  1VQO F;  3ESJ A;  1VQK F;  4NUT A;  1K8A H;  3CCS F;  1W3E X;  3JAM M;  3CC4 F;  3S03 A;  3JAR B;  4C8E A;  3S0W A;  5LP6 B;  3JAT A;  2LBX A;  1JFF A;  1FFX A;  2I6R A;  4KWE A;  5HY1 A;  3LWQ C;  3CCQ F;  3CG6 A;  4XCQ A;  3HKE A;  5GIO C;  3N4Z A;  2QEX F;  4FFB A;  4O4H A;  2VAW A;  4X1K A;  4O4I A;  5KMG B;  5JCO C;  3CC2 F;  1T0K B;  3MQW A;  3OW2 F;  1PF5 A;  2P6Y A;  2BTQ B;  4X3M A;  4IHJ B;  2H8C A;  4O4J A;  2OTL F;  3CB2 A;  3LWR C;  5IT9 M;  3P0Z A;  2K1S A;  3VCZ A;  3BYQ A;  3C9T A;  4M8I A;  5GON B;  4C8I A;  2ZVY A;  5LP6 C;  1Q86 H;  2W8B C;  4E6E A;  5BMV A;  3RYI A;  4G4Z A;  2N48 A;  3FFM A;  4B46 A;  2OTJ F;  2IQQ A;  1NMU B;  1KD1 H;  2UZH A;  2ZOD A;  4ZI7 A;  3HKD A;  4I50 B;  3VIU A;  1W5F A;  3WGK A;  2LBW A;  1TVK A;  4C81 A;  5B8F A;  3CMA F;  1VQP F;  1W57 A;  4X1I A;  5LOV B;  4F6R B;  2OZB A;  1VQV A;  2R6R 1;  3UT5 A;  1CK2 A;  1IV4 A;  3JAS A;  3CYQ A;  3LFO A;  1W59 A;  4BT2 A;  5J2U A;  1M1K H;  3LME A;  1J7H A;  5JVD A;  4TZZ A;  1VH8 A;  5JCO A;  1GX1 A;  1VQ7 F;  4B62 A;  2RB9 A;  5HY4 A;  2QTP A;  2UYN B;  1SZQ A;  1CLI A;  5J2T B;  3JAS B;  2HS3 A;  3FD6 A;  1S72 F;  5JH7 A;  5JQG A;  2OTM A;  2LCA A;  3DDN A;  5FNV A;  4RHA A;  4O2B A;  4NQ3 A;  3MCA B;  3CD6 F;  3D00 A;  4YJ3 B;  3SIU A;  3R0P A;  1X52 A;  5CB4 B;  3LWV C;  3RYF B;  2KGW A;  3OBW A;  4O4H B;  3WGL A;  2ZF8 A;  3WJQ A;  5KMG A;  3M1X A;  4B5C A;  5HP7 A;  3S0H A;  3E1Y A;  5FNV B;  1JY8 A;  2KTU A;  3GYQ A;  3JAW B;  4O4L A;  1Q82 H;  3WXM B;  2DT4 A;  3VTI C;  2UYK A;  5IJ9 A;  2GVI A;  3G4S F;  3G6E F;  4F6R A;  2VGN A;  3K2X A;  4U3J A;  3WPX A;  4O2A A;  3LYB A;  1K73 H;  3KE1 A;  5IYZ B;  3LWP C;  3HKB B;  4TV8 A;  3C9R A;  4EB6 A;  2HRY A;  3N2G B;  3KHN A;  5IJ0 A;  3C8L A;  1JFF B;  1RLU A;  3JAL B;  3ZP7 A;  3V7Q A;  3HTN A;  2Z1T A;  3J81 M;  4X1I B;  5LOV A;  3VYT C;  4IHJ A;  3U0O A;  3CPW F;  5LA6 B;  5CA1 A;  4G4Y A;  1M90 H;  4TV9 B;  3MDO A;  1FNK A;  2RHJ A;  3C9S A;  4ZHV A;  4ERH A;  2R75 1;  3AGK A;  2KTV A;  3PLA C;  4X1Y A;  1CN7 A;  3CC7 F;  3HAX D;  3RE3 A;  3OON A;  1NJI H;  1VHA A;  2OHW A;  1XHO A;  1W55 A;  4DXD A;  1R1M A;  3HKC B;  2GLZ A;  4TUY B;  2FC3 A;  1N8R H;  1YJW F;  4C4W C;  1QVF F;  1FFX B;  3DC2 A;  3D54 A;  3V4D A;  2F9Z C;  3NVI B;  1JD1 A;  2CSL A;  4I55 B;  3K14 A; 
#chains in the Genus database with same CATH homology
 1FNK A;  1ODE A;  3LYB A;  2CVL A;  3D01 A;  3R0P A;  4ZK7 A;  2B33 A;  1UFY A;  2CHS A;  1COM A;  1DBF A;  1JD1 A;  3LME A;  1J7H A;  1QD9 A;  1NQ3 A;  1QU9 A;  3I3F A;  3I7T A;  3M4S A;  2DYY A;  1X25 A;  2CW4 A;  2CWJ A;  3M1X A;  3MQW A;  1XHO A;  2UYP A;  2UYJ A;  3ZOP A;  5HP7 A;  4NWO B;  3K12 A;  2EWC A;  5HP8 A;  3QUW A;  1ONI A;  1PF5 A;  2UYN B;  1XRG A;  3ZO8 A;  3GTZ A;  3ZP7 A;  3K0T A;  1QAH A;  2CHT A;  2UYK A;  3V4D A;  2IG8 A;  2OTM A;  3VCZ A;  3KJK A;  3L7Q A;  3KJJ A;  3ZP4 A;  1UI9 A;  1FNJ A;  2CSL A;  2UYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...