1W41A

T. celer l30e e90a variant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGASRILALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Electrostatic Interactions Contribute to Reduced Heat Capacity Change of Unfolding in a Thermophilic Ribosomal Protein L30E
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w41A00
5IT9M 2VGMA 5EWRA 1GO1A 2BO1A 5A2QM 3CCVF 1VQ5F 3LWQC 5GIPC 5FJ4C 3N4YA 2VGNA 1X7OA 3ON1A 1VQ7F 1X7PA 1YITF 4C4WC 2FC3A 1ZWZA 2OTJF 3N4ZA 3RA6A 3CC7F 1QVFF 4NUTA 1Q7YH 1YI2F 1W41A 2KG4A 3E1YA 1PXWA 1M1KH 2AIFA 2I6DA 1NJIH 1QVGF 3IR9A 1E7KA 1Q81H 1K9MH 2JNBA 1W42A 3OBWA 2QI2A 1DT9A 2OZBA 3V7EA 4X3LA 3CC4F 1YJ9F 1KQSF 2HVYD 3RA5A 1Q82H 2OHWA 3NMUC 2CZWA 4TZZA 3FFMA 4BW0B 1XBIA 3CMAF 1CN7A 1VQ8F 1VQ4F 3SIVA 3CCQF 1VQ6F 4BY9D 1VQLF 3CCJF 5DCVA 5GAPK 3NK6A 3J7AR 3PLAC 5G4VC 1VQOF 5GIOC 3CG6A 1NMUB 1VQNF 3JCMM 2ALEA 3AGKA 2LBXA 1N8RH 3NVKE 3LWVC 3GYQA 1S72F 3NVIB 3I55F 3WXMB 3V7QA 3E20B 1YJWF 1VQMF 1KC8H 2KTUA 3CC2F 3CMEF 4X3MA 3CPQA 3HJWC 1T0KB 3G71F 3G6EF 1H7MA 2KTVA 3MCAB 3OBYA 2QA4F 3LFOA 3SIUA 3J81M 1RLGA 1GO0A 3CCUF 1YJNF 1K73H 2OTLF 1X52A 2QEXF 1SDSA 3CXCF 3VMFB 3VI6A 3CCEF 1W3EX 3O85A 5EO3A 3LWOC 2WALA 1VQ9F 1W2BF 1CK2A 3LWPC 3LWRC 1KD1H 3OW2F 1VQPF 1W40A 3PAFA 1YHQF 5FLXM 3NK7A 1Q86H 1RA4A 1VQKF 2LBWA 3HAXD 1JJ2F 5GANK 3CCLF 3CCMF 3CPWF 1YIJF 3CCSF 5G4UC 1IPAA 5GINC 3JAMM 4LCKA 1K8AH 3I56F 3G4SF 3J80M 1M90H 3CCRF 3CD6F 1GZ0A
chains in the Genus database with same CATH superfamily
3S03A 5EWRA 3S0YA 3VOBA 1VQ5F 3LWQC 5FJ4C 3N4YA 4X1IA 2VGNA 2DYYA 3RYIA 5JCOA 4C4WC 1FNJA 2OTJF 1RQ2A 5HP8A 2HRUA 4NUTA 1Q7YH 1VQVA 2VXYA 1KNJA 4FFBB 3FBAA 3HTNA 2EWCA 4EI7A 3IR9A 2UYJA 5EIBC 4BVQA 1K9MH 3E22B 4I55A 3V7EA 4X3LA 3CC4F 4TUYB 3TD4A 1KQSF 3RYHA 4C8EA 4G88A 3F0EA 1FFXA 2CZWA 3FFMA 3JATA 3K2XA 3FPIA 3CMAF 5FNVB 3CYPB 5BMVA 3CCQF 1VQ6F 4E6EA 4DRXA 3CYQA 2W8BC 5JQGB 3NK6A 5G4VC 2GVIA 5LP6C 3CG6A 3DC2A 3AGKA 3S02A 5HY2A 1N8RH 1TUBA 3LWVC 3QHDA 3I55F 3HKBA 3T80A 3IMPA 2HQSC 3VTIC 3TD3A 3WGKA 2BTQB 2AIZP 2RHHA 3MCQA 3F6MA 5JCOC 3UT5B 3HJWC 1T0AA 4G4ZA 3G71F 2CHSA 1QAHA 4F6RB 3J81M 3RYFB 2K1SA 3JAWA 4O4HA 2HP3A 1W3EX 4BVSA 3O85A 2WALA 5IJ0A 3IKFA 4I50B 3LWPC 4KWEA 5JH7A 1X25A 3LWRC 3OW2F 3K14A 1QD9A 5HXUA 1U40A 2LBWA 3HAXD 3F0DA 3C9RA 1JJ2F 2Q1YA 3CCMF 2RHLA 3CCSF 4ZK7A 4ERHA 4YJ2A 1K8AH 3S06A 5KMGA 2AMTA 3MDOA 1H47A 1GZ0A 4O2AB 2UYNB 3KHNA 2HS3A 3C8LA 4ZHYB 3JARA 5LXTA 2ZAUA 5CA1A 1TVKB 5A2QM 3LMEA 5JVDA 1Q8RA 5LA6A 1FNKA 1VQ7F 1X7PA 2MQEA 3RYCB 3OONA 3M84A 3N4ZA 4I4TB 1YI2F 1W41A 2KG4A 2I6DA 4O4LA 1QVGF 1YQNA 1H48A 3VYTC 4X1YA 4ZHQB 3RE3A 3LDTA 5CB4B 1NQ3A 5IJ9B 5EIBD 2YXZA 3N2GB 4B62A 4B46A 3WPXA 1IV2A 2PHNA 4BW0B 3D00A 1CN7A 4ZHWA 4X1KA 1OAPA 2ZVZA 1VQ4F 3ESJA 2R751 3R0PA 3CCJF 3C9TA 5DCVA 3M4SA 4TV8A 3JASA 1VQOF 4EI9A 4NQ3A 1VQNF 3D01A 5EYPA 1RLUA 3HKDB 2IG8A 5IYZB 3C9UA 1JN1A 3I7TA 2DT4A 3WJQA 4F6RA 1S72F 3NVIB 3V7QA 1W5EA 1YJWF 2N48A 2ZF8A 3MBMA 4EB6B 4HNAB 4BT6A 3F0FA 4TV9A 4ZI7B 1IV3A 3WPWA 2UYPA 3GTZA 4IIJB 2KTVA 3OBYA 4I50A 2VAMA 1Z5WA 4IHJB 1RLGA 3F0GA 1K73H 4U3JB 1X52A 4BVRA 2QEXF 1SDSA 3JALA 2V9YA 4O4JB 5J2TB 3ZO8A 5EO3A 4B45A 3ZOPA 2HP0B 5HP7A 1KD1H 3KJJA 1Q82H 5FLXM 1GX1A 5GONB 3NK7A 1Q86H 5LP6B 1JFFB 3KE1A 5ITZA 3JVHA 4O4IB 4O2AA 2UYNA 4YJ3B 5GANK 1W5AA 3CCLF 1TVKA 5J2UA 3CPWF 5G4UC 1IPAA 1U43A 4LCKA 4WBNB 4X1IB 3WGJA 2R6R1 5LYJB 4ZOLB 3J80M 3I56F 2OTMA 4C8GA 3P10A 1UI9A 1ONIA 3DDNA 2ZOVA 1JD1A 1GO1A 2GZLA 3LYBA 2HS0A 3HKEB 3CCVF 3VOAA 5EZYB 3ON1A 4ZHQA 2I6RA 1YITF 2Z1EA 4I55B 2FC3A 3EORA 5IJ9A 1W5FA 1CLIA 3ZP4A 5HY0A 3IEQA 3E1YA 1PXWA 4BVTA 3WJPA 1NJIH 4G4XA 2RB9A 1E7KA 3ZP7A 2JNBA 3OBWA 2QTPA 4C8IA 5BMVB 1QU9A 1SA0B 1DT9A 4B5CA 2OZBA 1YGYA 4FFBA 2CW4A 3RA5A 3TD5A 2H8CA 3QUWA 3HKCB 1U3LA 1VQ8F 3L7QA 3WGLA 3SIVA 3E22A 4X20B 2IQQA 4TUYA 5GAPK 3JAKB 5CA0B 3WGNA 5EB0A 3HWUA 5FNVA 2F9ZC 3Q8HA 2LBXA 4DXDA 3GYQA 1ODEA 3WXMB 1VQMF 2IAFA 5JQGA 1KC8H 4U3JA 5LOVB 4RHAA 2YYEA 3CC2F 3JAWB 2Z1FA 1XHOA 2ZODA 3WJRA 3CPQA 2CSLA 1T0KB 3G6EF 3MQWA 1H7MA 2PMPA 1IV1A 2KGWA 3SIUA 5JH7B 5C8YB 2OTLF 5GONA 1JFFA 4PWTA 1W55A 1OFUA 3CXCF 1FSZA 3UT5A 3VI6A 4YJ3A 3CCEF 2VAPA 3LWOC 3V3TA 1VQ9F 1W2BF 3U0OA 5KX5B 4WBNA 3RYFA 1W40A 3PAFA 4G4WA 3IEWA 4YJ2B 1YHQF 5LYJA 4ZOLA 2CVLA 5KMGB 1RA4A 4O2BB 2H6LA 2BTUA 3WGMA 3JARB 2FGYA 1KNKA 5CA1B 5LXTB 1YIJF 3FD6A 2CWJA 5GINC 3HKEA 3IKEA 5JVDB 5LA6B 2CHTA 5EZYA 4U39A 3P0ZA 3QTYA 3C9SA 2Z01A 3CCRF 5IT9M 2VGMA 4LNUB 1VK3A 2UZHA 5EAZA 2BO1A 2Q1XA 3VYUC 4O4LB 4C81A 4BT5A 5GIPC 1DBFA 1X7OA 2RHOA 4X1YB 2ZVYA 3N2KB 1SA0A 1ZWZA 2L26A 5AVMA 3BYQA 3RA6A 5MN5A 3CC7F 1QVFF 2H8EA 3K12A 1M1KH 2AIFA 2HS4A 3HKCA 1PF5A 4X1KB 1Q81H 1W42A 4R40B 1UFYA 3RYCA 2QI2A 4X20A 3RYIB 3FD5A 4I4TA 3M1XA 3VYSC 1VH8A 2B33A 1YJ9F 2HVYD 5B8FA 3JAKA 2LCAA 2OHWA 3GHZA 3JASB 1RQ7A 1XRGA 4TV8B 5CA0A 3S0WA 4TZZA 3NMUC 1XBIA 2VAWA 4RQOA 3VIUA 5EYPB 2LBTA 2RHJA 1Z5VA 5CB4A 3CB2A 4BY9D 4BT2A 1VQLF 4EI8A 3N2GA 5HY4A 1R1MA 5LOVA 3P4EA 3RYHB 3J7AR 3PLAC 4TV9B 5GIOC 1FFXB 3JATB 1NMUB 5EB1B 2G9IA 3JCMM 2ALEA 1W57A 3NVKE 3ELCA 4DRXB 4ZHVA 3E20B 4NWOB 2Z1UA 5C8YA 2KTUA 1J7HA 5HXZA 3KJKA 3CMEF 5MN6A 2Z1TA 2GLZA 3KIZA 3K0TA 3JALB 4X3MA 5HWEA 4G4YA 4BT3A 1W5BA 3HKDA 5IYZA 1W59A 1TUBB 3MCAB 3I3FA 3VO8A 2HX0A 2QA4F 5KX5A 3LFOA 3VCZA 1GO0A 3HKBB 1SZQA 1XV2A 3CCUF 4EB6A 1YJNF 4HNAA 5HY1A 4O2BA 3VMFB 4ZI7A 5ITZB 1COMA 4G4VA 4IIJA 2BTOA 4XCQA 5J2UB 1CK2A 3D54A 3ERNA 2P6YA 4IHJA 3S0HA 2UYKA 4BT4A 2NMUA 1VQPF 1VHAA 4C82A 1JY8A 4M8IA 4BT7A 1VQKF 2HRYA 1W581 4O4JA 4O4HB 5MN4A 1U3PA 5J2TA 4LNUA 5IJ0B 2HP0A 3JAMM 3G4SF 1IV4A 5LP6A 3N2KA 1M90H 3V4DA 3CD6F 4O4IA 3B6NA
chains in the Genus database with same CATH topology
5IT9M 2VGMA 5EWRA 1GO1A 2BO1A 5A2QM 3CCVF 1VQ5F 3LWQC 5GIPC 5FJ4C 3N4YA 2VGNA 1X7OA 3ON1A 1VQ7F 1X7PA 1YITF 4C4WC 2FC3A 1ZWZA 2OTJF 3N4ZA 3RA6A 3CC7F 5HY0A 1QVFF 4NUTA 1Q7YH 1YI2F 1W41A 2KG4A 3E1YA 1PXWA 1M1KH 2AIFA 4BVTA 2I6DA 1NJIH 1QVGF 4EI7A 3IR9A 4BVQA 1E7KA 1Q81H 1K9MH 2JNBA 1W42A 3OBWA 2QI2A 1DT9A 2OZBA 3V7EA 4X3LA 3CC4F 1YJ9F 1KQSF 2HVYD 3RA5A 1Q82H 2OHWA 3NMUC 2CZWA 4TZZA 3FFMA 4BW0B 3D00A 1XBIA 3CMAF 1CN7A 1VQ8F 1VQ4F 3SIVA 3CCQF 1VQ6F 4BY9D 1VQLF 4EI8A 3CCJF 5HY4A 5DCVA 5GAPK 3NK6A 3J7AR 3PLAC 5G4VC 1VQOF 5GIOC 4EI9A 4NQ3A 3CG6A 1NMUB 1VQNF 2F9ZC 3JCMM 2ALEA 3AGKA 2LBXA 5HY2A 1N8RH 3NVKE 3LWVC 3GYQA 1S72F 3NVIB 3I55F 3WXMB 3V7QA 3E20B 1YJWF 1VQMF 1KC8H 2KTUA 5HXZA 3CC2F 3CMEF 2GLZA 4X3MA 5HWEA 3CPQA 3HJWC 1T0KB 3G71F 3G6EF 1H7MA 2KTVA 3MCAB 3OBYA 2QA4F 3LFOA 3SIUA 3J81M 1RLGA 1GO0A 3CCUF 1YJNF 1K73H 2OTLF 1X52A 4BVRA 2QEXF 5HY1A 1SDSA 3CXCF 3VMFB 3VI6A 3CCEF 1W3EX 4BVSA 3O85A 5EO3A 3V3TA 2WALA 3LWOC 1VQ9F 4XCQA 1W2BF 1CK2A 3LWPC 3LWRC 1KD1H 3OW2F 1VQPF 1W40A 3PAFA 1YHQF 5HXUA 5FLXM 3NK7A 1Q86H 1RA4A 1VQKF 2LBWA 3HAXD 1JJ2F 5GANK 3CCLF 3CCMF 2FGYA 3CPWF 1YIJF 3CCSF 5G4UC 1IPAA 5GINC 3JAMM 4LCKA 1K8AH 3I56F 3G4SF 3J80M 1M90H 3CCRF 3CD6F 1GZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 M;  2VGM A;  5EWR A;  1GO1 A;  2BO1 A;  5A2Q M;  3CCV F;  1VQ5 F;  3LWQ C;  5GIP C;  5FJ4 C;  3N4Y A;  2VGN A;  1X7O A;  3ON1 A;  1VQ7 F;  1X7P A;  1YIT F;  4C4W C;  2FC3 A;  1ZWZ A;  2OTJ F;  3N4Z A;  3RA6 A;  3CC7 F;  1QVF F;  4NUT A;  1Q7Y H;  1YI2 F;  1W41 A;  2KG4 A;  3E1Y A;  1PXW A;  1M1K H;  2AIF A;  2I6D A;  1NJI H;  1QVG F;  3IR9 A;  1E7K A;  1Q81 H;  1K9M H;  2JNB A;  1W42 A;  3OBW A;  2QI2 A;  1DT9 A;  2OZB A;  3V7E A;  4X3L A;  3CC4 F;  1YJ9 F;  1KQS F;  2HVY D;  3RA5 A;  1Q82 H;  2OHW A;  3NMU C;  2CZW A;  4TZZ A;  3FFM A;  4BW0 B;  1XBI A;  3CMA F;  1CN7 A;  1VQ8 F;  1VQ4 F;  3SIV A;  3CCQ F;  1VQ6 F;  4BY9 D;  1VQL F;  3CCJ F;  5DCV A;  5GAP K;  3NK6 A;  3J7A R;  3PLA C;  5G4V C;  1VQO F;  5GIO C;  3CG6 A;  1NMU B;  1VQN F;  3JCM M;  2ALE A;  3AGK A;  2LBX A;  1N8R H;  3NVK E;  3LWV C;  3GYQ A;  1S72 F;  3NVI B;  3I55 F;  3WXM B;  3V7Q A;  3E20 B;  1YJW F;  1VQM F;  1KC8 H;  2KTU A;  3CC2 F;  3CME F;  4X3M A;  3CPQ A;  3HJW C;  1T0K B;  3G71 F;  3G6E F;  1H7M A;  2KTV A;  3MCA B;  3OBY A;  2QA4 F;  3LFO A;  3SIU A;  3J81 M;  1RLG A;  1GO0 A;  3CCU F;  1YJN F;  1K73 H;  2OTL F;  1X52 A;  2QEX F;  1SDS A;  3CXC F;  3VMF B;  3VI6 A;  3CCE F;  1W3E X;  3O85 A;  5EO3 A;  3LWO C;  2WAL A;  1VQ9 F;  1W2B F;  1CK2 A;  3LWP C;  3LWR C;  1KD1 H;  3OW2 F;  1VQP F;  1W40 A;  3PAF A;  1YHQ F;  5FLX M;  3NK7 A;  1Q86 H;  1RA4 A;  1VQK F;  2LBW A;  3HAX D;  1JJ2 F;  5GAN K;  3CCL F;  3CCM F;  3CPW F;  1YIJ F;  3CCS F;  5G4U C;  1IPA A;  5GIN C;  3JAM M;  4LCK A;  1K8A H;  3I56 F;  3G4S F;  3J80 M;  1M90 H;  3CCR F;  3CD6 F;  1GZ0 A; 
#chains in the Genus database with same CATH topology
 3S03 A;  5EWR A;  3S0Y A;  3VOB A;  1VQ5 F;  3LWQ C;  5FJ4 C;  3N4Y A;  4X1I A;  2VGN A;  2DYY A;  3RYI A;  5JCO A;  4C4W C;  1FNJ A;  2OTJ F;  1RQ2 A;  5HP8 A;  2HRU A;  4NUT A;  1Q7Y H;  1VQV A;  2VXY A;  1KNJ A;  4FFB B;  3FBA A;  3HTN A;  2EWC A;  4EI7 A;  3IR9 A;  2UYJ A;  5EIB C;  4BVQ A;  1K9M H;  3E22 B;  4I55 A;  3V7E A;  4X3L A;  3CC4 F;  4TUY B;  3TD4 A;  1KQS F;  3RYH A;  4C8E A;  4G88 A;  3F0E A;  1FFX A;  2CZW A;  3FFM A;  3JAT A;  3K2X A;  3FPI A;  3CMA F;  5FNV B;  3CYP B;  5BMV A;  3CCQ F;  1VQ6 F;  4E6E A;  4DRX A;  3CYQ A;  2W8B C;  5JQG B;  3NK6 A;  5G4V C;  2GVI A;  5LP6 C;  3CG6 A;  3DC2 A;  3AGK A;  3S02 A;  5HY2 A;  1N8R H;  1TUB A;  3LWV C;  3QHD A;  3I55 F;  3HKB A;  3T80 A;  3IMP A;  2HQS C;  3VTI C;  3TD3 A;  3WGK A;  2BTQ B;  2AIZ P;  2RHH A;  3MCQ A;  3F6M A;  5JCO C;  3UT5 B;  3HJW C;  1T0A A;  4G4Z A;  3G71 F;  2CHS A;  1QAH A;  4F6R B;  3J81 M;  3RYF B;  2K1S A;  3JAW A;  4O4H A;  2HP3 A;  1W3E X;  4BVS A;  3O85 A;  2WAL A;  5IJ0 A;  3IKF A;  4I50 B;  3LWP C;  4KWE A;  5JH7 A;  1X25 A;  3LWR C;  3OW2 F;  3K14 A;  1QD9 A;  5HXU A;  1U40 A;  2LBW A;  3HAX D;  3F0D A;  3C9R A;  1JJ2 F;  2Q1Y A;  3CCM F;  2RHL A;  3CCS F;  4ZK7 A;  4ERH A;  4YJ2 A;  1K8A H;  3S06 A;  5KMG A;  2AMT A;  3MDO A;  1H47 A;  1GZ0 A;  4O2A B;  2UYN B;  3KHN A;  2HS3 A;  3C8L A;  4ZHY B;  3JAR A;  5LXT A;  2ZAU A;  5CA1 A;  1TVK B;  5A2Q M;  3LME A;  5JVD A;  1Q8R A;  5LA6 A;  1FNK A;  1VQ7 F;  1X7P A;  2MQE A;  3RYC B;  3OON A;  3M84 A;  3N4Z A;  4I4T B;  1YI2 F;  1W41 A;  2KG4 A;  2I6D A;  4O4L A;  1QVG F;  1YQN A;  1H48 A;  3VYT C;  4X1Y A;  4ZHQ B;  3RE3 A;  3LDT A;  5CB4 B;  1NQ3 A;  5IJ9 B;  5EIB D;  2YXZ A;  3N2G B;  4B62 A;  4B46 A;  3WPX A;  1IV2 A;  2PHN A;  4BW0 B;  3D00 A;  1CN7 A;  4ZHW A;  4X1K A;  1OAP A;  2ZVZ A;  1VQ4 F;  3ESJ A;  2R75 1;  3R0P A;  3CCJ F;  3C9T A;  5DCV A;  3M4S A;  4TV8 A;  3JAS A;  1VQO F;  4EI9 A;  4NQ3 A;  1VQN F;  3D01 A;  5EYP A;  1RLU A;  3HKD B;  2IG8 A;  5IYZ B;  3C9U A;  1JN1 A;  3I7T A;  2DT4 A;  3WJQ A;  4F6R A;  1S72 F;  3NVI B;  3V7Q A;  1W5E A;  1YJW F;  2N48 A;  2ZF8 A;  3MBM A;  4EB6 B;  4HNA B;  4BT6 A;  3F0F A;  4TV9 A;  4ZI7 B;  1IV3 A;  3WPW A;  2UYP A;  3GTZ A;  4IIJ B;  2KTV A;  3OBY A;  4I50 A;  2VAM A;  1Z5W A;  4IHJ B;  1RLG A;  3F0G A;  1K73 H;  4U3J B;  1X52 A;  4BVR A;  2QEX F;  1SDS A;  3JAL A;  2V9Y A;  4O4J B;  5J2T B;  3ZO8 A;  5EO3 A;  4B45 A;  3ZOP A;  2HP0 B;  5HP7 A;  1KD1 H;  3KJJ A;  1Q82 H;  5FLX M;  1GX1 A;  5GON B;  3NK7 A;  1Q86 H;  5LP6 B;  1JFF B;  3KE1 A;  5ITZ A;  3JVH A;  4O4I B;  4O2A A;  2UYN A;  4YJ3 B;  5GAN K;  1W5A A;  3CCL F;  1TVK A;  5J2U A;  3CPW F;  5G4U C;  1IPA A;  1U43 A;  4LCK A;  4WBN B;  4X1I B;  3WGJ A;  2R6R 1;  5LYJ B;  4ZOL B;  3J80 M;  3I56 F;  2OTM A;  4C8G A;  3P10 A;  1UI9 A;  1ONI A;  3DDN A;  2ZOV A;  1JD1 A;  1GO1 A;  2GZL A;  3LYB A;  2HS0 A;  3HKE B;  3CCV F;  3VOA A;  5EZY B;  3ON1 A;  4ZHQ A;  2I6R A;  1YIT F;  2Z1E A;  4I55 B;  2FC3 A;  3EOR A;  5IJ9 A;  1W5F A;  1CLI A;  3ZP4 A;  5HY0 A;  3IEQ A;  3E1Y A;  1PXW A;  4BVT A;  3WJP A;  1NJI H;  4G4X A;  2RB9 A;  1E7K A;  3ZP7 A;  2JNB A;  3OBW A;  2QTP A;  4C8I A;  5BMV B;  1QU9 A;  1SA0 B;  1DT9 A;  4B5C A;  2OZB A;  1YGY A;  4FFB A;  2CW4 A;  3RA5 A;  3TD5 A;  2H8C A;  3QUW A;  3HKC B;  1U3L A;  1VQ8 F;  3L7Q A;  3WGL A;  3SIV A;  3E22 A;  4X20 B;  2IQQ A;  4TUY A;  5GAP K;  3JAK B;  5CA0 B;  3WGN A;  5EB0 A;  3HWU A;  5FNV A;  2F9Z C;  3Q8H A;  2LBX A;  4DXD A;  3GYQ A;  1ODE A;  3WXM B;  1VQM F;  2IAF A;  5JQG A;  1KC8 H;  4U3J A;  5LOV B;  4RHA A;  2YYE A;  3CC2 F;  3JAW B;  2Z1F A;  1XHO A;  2ZOD A;  3WJR A;  3CPQ A;  2CSL A;  1T0K B;  3G6E F;  3MQW A;  1H7M A;  2PMP A;  1IV1 A;  2KGW A;  3SIU A;  5JH7 B;  5C8Y B;  2OTL F;  5GON A;  1JFF A;  4PWT A;  1W55 A;  1OFU A;  3CXC F;  1FSZ A;  3UT5 A;  3VI6 A;  4YJ3 A;  3CCE F;  2VAP A;  3LWO C;  3V3T A;  1VQ9 F;  1W2B F;  3U0O A;  5KX5 B;  4WBN A;  3RYF A;  1W40 A;  3PAF A;  4G4W A;  3IEW A;  4YJ2 B;  1YHQ F;  5LYJ A;  4ZOL A;  2CVL A;  5KMG B;  1RA4 A;  4O2B B;  2H6L A;  2BTU A;  3WGM A;  3JAR B;  2FGY A;  1KNK A;  5CA1 B;  5LXT B;  1YIJ F;  3FD6 A;  2CWJ A;  5GIN C;  3HKE A;  3IKE A;  5JVD B;  5LA6 B;  2CHT A;  5EZY A;  4U39 A;  3P0Z A;  3QTY A;  3C9S A;  2Z01 A;  3CCR F;  5IT9 M;  2VGM A;  4LNU B;  1VK3 A;  2UZH A;  5EAZ A;  2BO1 A;  2Q1X A;  3VYU C;  4O4L B;  4C81 A;  4BT5 A;  5GIP C;  1DBF A;  1X7O A;  2RHO A;  4X1Y B;  2ZVY A;  3N2K B;  1SA0 A;  1ZWZ A;  2L26 A;  5AVM A;  3BYQ A;  3RA6 A;  5MN5 A;  3CC7 F;  1QVF F;  2H8E A;  3K12 A;  1M1K H;  2AIF A;  2HS4 A;  3HKC A;  1PF5 A;  4X1K B;  1Q81 H;  1W42 A;  4R40 B;  1UFY A;  3RYC A;  2QI2 A;  4X20 A;  3RYI B;  3FD5 A;  4I4T A;  3M1X A;  3VYS C;  1VH8 A;  2B33 A;  1YJ9 F;  2HVY D;  5B8F A;  3JAK A;  2LCA A;  2OHW A;  3GHZ A;  3JAS B;  1RQ7 A;  1XRG A;  4TV8 B;  5CA0 A;  3S0W A;  4TZZ A;  3NMU C;  1XBI A;  2VAW A;  4RQO A;  3VIU A;  5EYP B;  2LBT A;  2RHJ A;  1Z5V A;  5CB4 A;  3CB2 A;  4BY9 D;  4BT2 A;  1VQL F;  4EI8 A;  3N2G A;  5HY4 A;  1R1M A;  5LOV A;  3P4E A;  3RYH B;  3J7A R;  3PLA C;  4TV9 B;  5GIO C;  1FFX B;  3JAT B;  1NMU B;  5EB1 B;  2G9I A;  3JCM M;  2ALE A;  1W57 A;  3NVK E;  3ELC A;  4DRX B;  4ZHV A;  3E20 B;  4NWO B;  2Z1U A;  5C8Y A;  2KTU A;  1J7H A;  5HXZ A;  3KJK A;  3CME F;  5MN6 A;  2Z1T A;  2GLZ A;  3KIZ A;  3K0T A;  3JAL B;  4X3M A;  5HWE A;  4G4Y A;  4BT3 A;  1W5B A;  3HKD A;  5IYZ A;  1W59 A;  1TUB B;  3MCA B;  3I3F A;  3VO8 A;  2HX0 A;  2QA4 F;  5KX5 A;  3LFO A;  3VCZ A;  1GO0 A;  3HKB B;  1SZQ A;  1XV2 A;  3CCU F;  4EB6 A;  1YJN F;  4HNA A;  5HY1 A;  4O2B A;  3VMF B;  4ZI7 A;  5ITZ B;  1COM A;  4G4V A;  4IIJ A;  2BTO A;  4XCQ A;  5J2U B;  1CK2 A;  3D54 A;  3ERN A;  2P6Y A;  4IHJ A;  3S0H A;  2UYK A;  4BT4 A;  2NMU A;  1VQP F;  1VHA A;  4C82 A;  1JY8 A;  4M8I A;  4BT7 A;  1VQK F;  2HRY A;  1W58 1;  4O4J A;  4O4H B;  5MN4 A;  1U3P A;  5J2T A;  4LNU A;  5IJ0 B;  2HP0 A;  3JAM M;  3G4S F;  1IV4 A;  5LP6 A;  3N2K A;  1M90 H;  3V4D A;  3CD6 F;  4O4I A;  3B6N A; 
#chains in the Genus database with same CATH homology
 5IT9 M;  2VGM A;  5EWR A;  1GO1 A;  2BO1 A;  5A2Q M;  3CCV F;  1VQ5 F;  3LWQ C;  5GIP C;  5FJ4 C;  3N4Y A;  2VGN A;  1X7O A;  3ON1 A;  1VQ7 F;  1X7P A;  1YIT F;  4C4W C;  2FC3 A;  1ZWZ A;  2OTJ F;  3N4Z A;  3RA6 A;  3CC7 F;  5HY0 A;  1QVF F;  4NUT A;  1Q7Y H;  1YI2 F;  1W41 A;  2KG4 A;  3E1Y A;  1PXW A;  1M1K H;  2AIF A;  4BVT A;  2I6D A;  1NJI H;  1QVG F;  4EI7 A;  3IR9 A;  4BVQ A;  1E7K A;  1Q81 H;  1K9M H;  2JNB A;  1W42 A;  3OBW A;  2QI2 A;  1DT9 A;  2OZB A;  3V7E A;  4X3L A;  3CC4 F;  1YJ9 F;  1KQS F;  2HVY D;  3RA5 A;  1Q82 H;  2OHW A;  3NMU C;  2CZW A;  4TZZ A;  3FFM A;  4BW0 B;  3D00 A;  1XBI A;  3CMA F;  1CN7 A;  1VQ8 F;  1VQ4 F;  3SIV A;  3CCQ F;  1VQ6 F;  4BY9 D;  1VQL F;  4EI8 A;  3CCJ F;  5HY4 A;  5DCV A;  5GAP K;  3NK6 A;  3J7A R;  3PLA C;  5G4V C;  1VQO F;  5GIO C;  4EI9 A;  4NQ3 A;  3CG6 A;  1NMU B;  1VQN F;  2F9Z C;  3JCM M;  2ALE A;  3AGK A;  2LBX A;  5HY2 A;  1N8R H;  3NVK E;  3LWV C;  3GYQ A;  1S72 F;  3NVI B;  3I55 F;  3WXM B;  3V7Q A;  3E20 B;  1YJW F;  1VQM F;  1KC8 H;  2KTU A;  5HXZ A;  3CC2 F;  3CME F;  2GLZ A;  4X3M A;  5HWE A;  3CPQ A;  3HJW C;  1T0K B;  3G71 F;  3G6E F;  1H7M A;  2KTV A;  3MCA B;  3OBY A;  2QA4 F;  3LFO A;  3SIU A;  3J81 M;  1RLG A;  1GO0 A;  3CCU F;  1YJN F;  1K73 H;  2OTL F;  1X52 A;  4BVR A;  2QEX F;  5HY1 A;  1SDS A;  3CXC F;  3VMF B;  3VI6 A;  3CCE F;  1W3E X;  4BVS A;  3O85 A;  5EO3 A;  3V3T A;  2WAL A;  3LWO C;  1VQ9 F;  4XCQ A;  1W2B F;  1CK2 A;  3LWP C;  3LWR C;  1KD1 H;  3OW2 F;  1VQP F;  1W40 A;  3PAF A;  1YHQ F;  5HXU A;  5FLX M;  3NK7 A;  1Q86 H;  1RA4 A;  1VQK F;  2LBW A;  3HAX D;  1JJ2 F;  5GAN K;  3CCL F;  3CCM F;  2FGY A;  3CPW F;  1YIJ F;  3CCS F;  5G4U C;  1IPA A;  5GIN C;  3JAM M;  4LCK A;  1K8A H;  3I56 F;  3G4S F;  3J80 M;  1M90 H;  3CCR F;  3CD6 F;  1GZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...