1W41A

T. celer l30e e90a variant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGASRILALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Electrostatic Interactions Contribute to Reduced Heat Capacity Change of Unfolding in a Thermophilic Ribosomal Protein L30E
pubmed doi rcsb
source organism Thermococcus celer
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w41A00
1YITF 1X52A 3N4ZA 5IT9M 2VGNA 1CN7A 3LWRC 3CCRF 3CMEF 3J80M 1ZWZA 4NUTA 1RA4A 3NK7A 1W3EX 1KQSF 1GO1A 1K8AH 3RA6A 5EWRA 1M90H 1T0KB 2QI2A 1DT9A 3CCLF 2WALA 5GANK 3CPQA 2LBXA 3V7QA 2BO1A 5A2QM 3JAMM 3G71F 1NJIH 2HVYD 3SIVA 1KC8H 3NK6A 3OBWA 1VQ5F 3CC2F 1VQOF 1K9MH 1VQ7F 1X7PA 4X3LA 1KD1H 5DCVA 3J7AR 3NVKE 3ON1A 1VQ8F 3CC7F 3NMUC 3PLAC 3LWOC 2OZBA 3RA5A 1SDSA 2JNBA 1RLGA 3E20B 1XBIA 2FC3A 3J81M 4TZZA 1Q81H 4BW0B 3FFMA 1K73H 2OTLF 2KTUA 3HJWC 2KTVA 1YHQF 2OTJF 1W41A 3CCJF 3CG6A 2OHWA 3G6EF 3CCUF 2QA4F 2ALEA 1QVFF 3OBYA 4C4WC 3WXMB 3LWVC 2I6DA 1VQKF 1W2BF 3I56F 1VQ6F 3CCVF 3SIUA 3VI6A 1N8RH 1VQ9F 1IPAA 1YJNF 1W42A 5GAPK 5G4VC 1VQLF 2VGMA 5GINC 3IR9A 3OW2F 1YJ9F 1JJ2F 1W40A 1VQ4F 3GYQA 1YIJF 1X7OA 2AIFA 3LFOA 1GZ0A 2KG4A 1YJWF 1NMUB 3CPWF 1QVGF 1PXWA 2QEXF 1Q7YH 3CC4F 3PAFA 4X3MA 1VQNF 3N4YA 1VQMF 1E7KA 3I55F 3MCAB 3VMFB 3HAXD 1H7MA 3E1YA 3CXCF 3AGKA 3LWPC 3NVIB 3CCSF 3LWQC 4LCKA 1Q82H 2LBWA 3G4SF 3CMAF 5EO3A 3CCMF 4BY9D 5G4UC 1YI2F 1M1KH 2CZWA 3CD6F 3JCMM 1CK2A 3CCQF 1S72F 5FJ4C 1VQPF 3V7EA 1Q86H 3CCEF 5FLXM 3O85A 1GO0A 5GIPC 5GIOC
chains in the Genus database with same CATH superfamily
3I7TA 1X52A 3HKCA 1RLUA 3LMEA 1CN7A 3P0ZA 4G4WA 2DYYA 2Z1TA 5FNVB 3TD5A 4O4IB 4YJ2B 1W5BA 4E6EA 2ZAUA 3F0EA 4LNUA 1GO1A 5EWRA 2QI2A 4TV8B 2WALA 3FD5A 3WJPA 3CPQA 3ZOPA 5GANK 3IKEA 1W55A 5HXZA 5A2QM 2UYPA 3JAMM 3JAWA 1NJIH 3SIVA 3U0OA 5LOVA 3HKBA 3C8LA 3KIZA 3ZO8A 3OBWA 1KC8H 4X20A 1KD1H 1JFFA 2Z1EA 3J7AR 4I50B 3NVKE 4ZHVA 5AVMA 3IKFA 3QHDA 1T0AA 3RA5A 4ZK7A 5IJ9B 4G4YA 1SDSA 1YQNA 4ERHA 4BW0B 2RHOA 1K73H 5J2TB 5JCOC 2VAPA 1UFYA 3UT5A 3RE3A 4EI9A 4ZI7B 1W41A 5IYZA 4O4HA 3CYPB 2OHWA 2QA4F 1JD1A 3KE1A 3OBYA 2UYJA 4C4WC 3WXMB 4G4XA 1VQKF 1VQ6F 3FBAA 1FFXA 5CA0B 5CA1B 4DRXB 4F6RB 1W42A 5GAPK 5GONB 3IR9A 5EIBC 3KHNA 5KMGA 1VQ4F 4IIJA 3GYQA 1YIJF 1X7OA 2AIFA 1KNKA 3ESJA 3L7QA 4LNUB 3S0HA 1PXWA 2HP0A 3C9UA 2DT4A 2VAWA 4BT4A 3VOBA 1Q7YH 3PAFA 3JASA 4EB6A 3I55F 3MCAB 5LOVB 1VH8A 5JCOA 3CXCF 3NVIB 2UYKA 5JH7A 4I4TA 3K0TA 1KNJA 5EO3A 4BY9D 1QD9A 3LYBA 1QU9A 1Q8RA 2LCAA 4O4IA 4U39A 3UT5B 4BVSA 3TD4A 4G4ZA 3CCQF 4O4HB 3VYTC 2UYNA 4TV8A 3K12A 1VQPF 2L26A 2ZVYA 4C8GA 5LP6C 3WGNA 1FFXB 4EI7A 2HX0A 3OONA 2HS4A 3GHZA 3N4ZA 4YJ3A 1VHAA 4I50A 5KMGB 2CWJA 3WGLA 1W581 3IEQA 2VAMA 2Z1UA 1M90H 4B46A 3CCLF 3JASB 3K14A 3N2GA 2VXYA 2BO1A 4G4VA 3S03A 4O2AA 3G71F 3C9RA 1Z5VA 4BT3A 3NK6A 5HY2A 5JH7B 3CYQA 3S0WA 1JN1A 5CA0A 5CA1A 3PLAC 2RB9A 2YYEA 4DRXA 4F6RA 5LA6A 5LP6A 2JNBA 4M8IA 3KJKA 4NQ3A 1X25A 1XBIA 5GONA 1FNJA 2EWCA 5IJ0A 4U3JA 2PHNA 4BT6A 3FFMA 4O4LA 4TV9B 2GLZA 2HQSC 4I55A 4O4JB 2UYNB 3CCJF 3CG6A 2IG8A 3CCUF 3ZP4A 3RYIB 3DC2A 1QVFF 3JARA 3N2KB 3WJQA 1RQ2A 3VI6A 3P4EA 1OAPA 4YJ3B 3VCZA 2B33A 5ITZA 3WJRA 5GINC 4RQOA 2GVIA 5LXTB 1W59A 1TUBB 2KG4A 3JAKA 1NMUB 3WPXA 3CPWF 2QEXF 1W5FA 4IHJA 3N2GB 3WPWA 3CC4F 4B5CA 3S02A 3D01A 4C81A 1VQNF 5EZYB 2BTQB 1JY8A 2F9ZC 2H8EA 4C82A 4O2AB 3QTYA 2YXZA 3VIUA 4TUYB 4C8IA 2RHJA 4FFBA 3CCSF 2CW4A 1W57A 2GZLA 4BVQA 4LCKA 4NWOB 2AMTA 5B8FA 5LA6B 5LP6B 2HS0A 3G4SF 3D54A 5IJ0B 3RYHB 4U3JB 5G4UC 4X1KB 1M1KH 4O4LB 2CZWA 3F0FA 4I55B 3K2XA 1CLIA 1IV1A 4DXDA 5FJ4C 1RQ7A 3S0YA 3HWUA 3JARB 3P10A 4X1IB 2N48A 1GO0A 5GIPC 3HTNA 5EIBD 3EORA 4G88A 3WGJA 2HRYA 5ITZB 2OTMA 5IT9M 1H47A 3IMPA 5J2UA 3E22B 3LWRC 3CMEF 3CCRF 3JALB 3J80M 2ZF8A 1ZWZA 3JAKB 1IV2A 3I3FA 3NK7A 4B62A 4IHJB 5JVDA 5HP8A 2H6LA 1W5EA 4TV9A 2LBXA 4O4JA 4O2BB 5EAZA 2PMPA 1FNKA 1DBFA 3RYCB 1YGYA 2IQQA 3RYIA 1NQ3A 4FFBB 2KGWA 2BTUA 3FD6A 3LDTA 4ZOLA 3N2KA 1K9MH 1XHOA 5JQGA 1VQ7F 3ON1A 1VQ8F 3CC7F 3NMUC 3LWOC 3JVHA 2P6YA 2CHTA 4BVRA 3J81M 3KJJA 1Q81H 5LXTA 1TUBA 2KTUA 3WGMA 2G9IA 3HKEB 4HNAA 5HY0A 1XV2A 1YHQF 2FGYA 5HY1A 5EZYA 2MQEA 4X1YB 2ALEA 3ELCA 3S06A 3LWVC 5HP7A 2I6DA 3I56F 3CCVF 1N8RH 4TUYA 1U3LA 1YJNF 2BTOA 5J2UB 5MN4A 3VYSC 1YJ9F 3LFOA 1GZ0A 5LYJA 1YJWF 1QVGF 5JVDB 3RYHA 4X1KA 1U43A 4X3MA 3N4YA 2W8BC 5EYPB 3VTIC 1E7KA 2ZODA 2RHLA 1H7MA 4ZHWA 3HAXD 5EB0A 3E1YA 4ZOLB 4X1IA 4EI8A 5JQGB 3FPIA 3LWQC 1IV4A 2Z01A 1Q82H 3M4SA 1W5AA 3CCMF 3JATB 5C8YB 5HWEA 3E22A 3JALA 5CB4A 4HNAB 3CD6F 4R40B 1CK2A 3GTZA 1XRGA 3VOAA 5MN5A 2RHHA 3V7EA 1Q86H 4O2BA 3O85A 2I6RA 3RYCA 3VO8A 4XCQA 5BMVA 5GIOC 3DDNA 1YITF 1UI9A 3B6NA 4BT2A 4ZHYB 4ZHQA 2VGNA 1IV3A 3F6MA 3MBMA 5LYJB 4NUTA 1RA4A 3RYFA 1W3EX 1KQSF 5HY4A 1ODEA 3IEWA 1K8AH 1T0KB 3RA6A 3T80A 4C8EA 1DT9A 1FSZA 3BYQA 3HKEA 3V7QA 3D00A 2QTPA 1VQVA 2LBTA 2HVYD 4X1YA 5HXUA 5KX5A 1VQ5F 3CC2F 1SA0A 3HKCB 1VQOF 1X7PA 4X3LA 5DCVA 3MQWA 3V3TA 3C9TA 2CSLA 2ZOVA 2OZBA 1H48A 3MCQA 4KWEA 1TVKA 3R0PA 1RLGA 3E20B 3ZP7A 1U3PA 2FC3A 4TZZA 5CB4B 3QUWA 3V4DA 1SZQA 2OTLF 3HJWC 2KTVA 2Q1YA 4WBNA 4RHAA 2CHSA 2Z1FA 3M1XA 1Z5WA 2OTJF 3JAWB 1U40A 3C9SA 2HS3A 2UZHA 2HRUA 3G6EF 3HKBB 4PWTA 5EYPA 3F0GA 1ONIA 4X20B 1OFUA 3TD3A 5BMVB 1W2BF 1JFFB 2IAFA 3CB2A 3SIUA 3HKDA 1VQ9F 4BT5A 1IPAA 1QAHA 2R751 4ZHQB 5G4VC 1VQLF 2VGMA 2K1SA 2AIZP 5EB1B 3OW2F 1JJ2F 1W40A 3RYFB 5FNVA 3JATA 5C8YA 4YJ2A 5IYZB 3ERNA 3Q8HA 3VYUC 2HP3A 1J7HA 5MN6A 1VQMF 3VMFB 2R6R1 1R1MA 1PF5A 3AGKA 5KX5B 3LWPC 1SA0B 4BVTA 2LBWA 1TVKB 2V9YA 1COMA 4IIJB 3CMAF 2H8CA 3F0DA 5IJ9A 3WGKA 2HP0B 4BT7A 1YI2F 3MDOA 2Q1XA 4WBNB 5J2TA 3JCMM 4EB6B 1VK3A 1S72F 4ZI7A 2NMUA 2ZVZA 3M84A 3CCEF 5FLXM 2CVLA 1GX1A 4B45A 3HKDB 4I4TB
chains in the Genus database with same CATH topology
5GIOC 1YITF 1X52A 3N4ZA 5IT9M 2VGNA 1CN7A 3LWRC 3CCRF 3CMEF 3J80M 1ZWZA 4NUTA 1RA4A 3NK7A 1W3EX 1KQSF 5HY4A 1GO1A 1K8AH 3RA6A 5EWRA 1M90H 1T0KB 2QI2A 1DT9A 3CCLF 2WALA 5GANK 3CPQA 2LBXA 3V7QA 3D00A 2BO1A 5HXZA 5A2QM 3JAMM 3G71F 1NJIH 2HVYD 3SIVA 1KC8H 5HXUA 3NK6A 3OBWA 5HY2A 1VQ5F 3CC2F 1VQOF 1K9MH 1VQ7F 1X7PA 4X3LA 1KD1H 5DCVA 3J7AR 3NVKE 3ON1A 1VQ8F 3CC7F 3V3TA 3NMUC 3PLAC 3LWOC 2OZBA 3RA5A 1SDSA 2JNBA 1RLGA 4BVRA 4NQ3A 3E20B 1XBIA 2FC3A 3J81M 4TZZA 1Q81H 4BW0B 3FFMA 1K73H 2OTLF 2KTUA 3HJWC 2KTVA 2GLZA 5HY0A 1YHQF 4EI9A 2OTJF 1W41A 3CCJF 2FGYA 3CG6A 2OHWA 5HY1A 3G6EF 3CCUF 2QA4F 2ALEA 1QVFF 3OBYA 4C4WC 3WXMB 3LWVC 2I6DA 1VQKF 1W2BF 3I56F 1VQ6F 3CCVF 3SIUA 3VI6A 1N8RH 1VQ9F 1IPAA 1YJNF 1W42A 5GAPK 5G4VC 1VQLF 2VGMA 5GINC 3IR9A 3OW2F 1YJ9F 1JJ2F 1W40A 1VQ4F 3GYQA 1YIJF 1X7OA 2AIFA 3LFOA 1GZ0A 2KG4A 1YJWF 1NMUB 3CPWF 1QVGF 1PXWA 2QEXF 1Q7YH 3CC4F 3PAFA 4X3MA 1VQNF 3N4YA 2F9ZC 1VQMF 1E7KA 3I55F 3MCAB 3VMFB 3HAXD 1H7MA 3E1YA 3CXCF 3AGKA 3LWPC 4EI8A 4BVTA 3NVIB 3CCSF 4BVQA 3LWQC 4LCKA 1Q82H 2LBWA 3G4SF 3CMAF 5EO3A 3CCMF 4BY9D 5HWEA 5G4UC 1YI2F 1M1KH 4BVSA 2CZWA 3CD6F 3JCMM 1CK2A 3CCQF 1S72F 5FJ4C 1VQPF 3V7EA 1Q86H 3CCEF 5FLXM 3O85A 1GO0A 5GIPC 4XCQA 4EI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT F;  1X52 A;  3N4Z A;  5IT9 M;  2VGN A;  1CN7 A;  3LWR C;  3CCR F;  3CME F;  3J80 M;  1ZWZ A;  4NUT A;  1RA4 A;  3NK7 A;  1W3E X;  1KQS F;  1GO1 A;  1K8A H;  3RA6 A;  5EWR A;  1M90 H;  1T0K B;  2QI2 A;  1DT9 A;  3CCL F;  2WAL A;  5GAN K;  3CPQ A;  2LBX A;  3V7Q A;  2BO1 A;  5A2Q M;  3JAM M;  3G71 F;  1NJI H;  2HVY D;  3SIV A;  1KC8 H;  3NK6 A;  3OBW A;  1VQ5 F;  3CC2 F;  1VQO F;  1K9M H;  1VQ7 F;  1X7P A;  4X3L A;  1KD1 H;  5DCV A;  3J7A R;  3NVK E;  3ON1 A;  1VQ8 F;  3CC7 F;  3NMU C;  3PLA C;  3LWO C;  2OZB A;  3RA5 A;  1SDS A;  2JNB A;  1RLG A;  3E20 B;  1XBI A;  2FC3 A;  3J81 M;  4TZZ A;  1Q81 H;  4BW0 B;  3FFM A;  1K73 H;  2OTL F;  2KTU A;  3HJW C;  2KTV A;  1YHQ F;  2OTJ F;  1W41 A;  3CCJ F;  3CG6 A;  2OHW A;  3G6E F;  3CCU F;  2QA4 F;  2ALE A;  1QVF F;  3OBY A;  4C4W C;  3WXM B;  3LWV C;  2I6D A;  1VQK F;  1W2B F;  3I56 F;  1VQ6 F;  3CCV F;  3SIU A;  3VI6 A;  1N8R H;  1VQ9 F;  1IPA A;  1YJN F;  1W42 A;  5GAP K;  5G4V C;  1VQL F;  2VGM A;  5GIN C;  3IR9 A;  3OW2 F;  1YJ9 F;  1JJ2 F;  1W40 A;  1VQ4 F;  3GYQ A;  1YIJ F;  1X7O A;  2AIF A;  3LFO A;  1GZ0 A;  2KG4 A;  1YJW F;  1NMU B;  3CPW F;  1QVG F;  1PXW A;  2QEX F;  1Q7Y H;  3CC4 F;  3PAF A;  4X3M A;  1VQN F;  3N4Y A;  1VQM F;  1E7K A;  3I55 F;  3MCA B;  3VMF B;  3HAX D;  1H7M A;  3E1Y A;  3CXC F;  3AGK A;  3LWP C;  3NVI B;  3CCS F;  3LWQ C;  4LCK A;  1Q82 H;  2LBW A;  3G4S F;  3CMA F;  5EO3 A;  3CCM F;  4BY9 D;  5G4U C;  1YI2 F;  1M1K H;  2CZW A;  3CD6 F;  3JCM M;  1CK2 A;  3CCQ F;  1S72 F;  5FJ4 C;  1VQP F;  3V7E A;  1Q86 H;  3CCE F;  5FLX M;  3O85 A;  1GO0 A;  5GIP C;  5GIO C; 
#chains in the Genus database with same CATH topology
 3I7T A;  1X52 A;  3HKC A;  1RLU A;  3LME A;  1CN7 A;  3P0Z A;  4G4W A;  2DYY A;  2Z1T A;  5FNV B;  3TD5 A;  4O4I B;  4YJ2 B;  1W5B A;  4E6E A;  2ZAU A;  3F0E A;  4LNU A;  1GO1 A;  5EWR A;  2QI2 A;  4TV8 B;  2WAL A;  3FD5 A;  3WJP A;  3CPQ A;  3ZOP A;  5GAN K;  3IKE A;  1W55 A;  5HXZ A;  5A2Q M;  2UYP A;  3JAM M;  3JAW A;  1NJI H;  3SIV A;  3U0O A;  5LOV A;  3HKB A;  3C8L A;  3KIZ A;  3ZO8 A;  3OBW A;  1KC8 H;  4X20 A;  1KD1 H;  1JFF A;  2Z1E A;  3J7A R;  4I50 B;  3NVK E;  4ZHV A;  5AVM A;  3IKF A;  3QHD A;  1T0A A;  3RA5 A;  4ZK7 A;  5IJ9 B;  4G4Y A;  1SDS A;  1YQN A;  4ERH A;  4BW0 B;  2RHO A;  1K73 H;  5J2T B;  5JCO C;  2VAP A;  1UFY A;  3UT5 A;  3RE3 A;  4EI9 A;  4ZI7 B;  1W41 A;  5IYZ A;  4O4H A;  3CYP B;  2OHW A;  2QA4 F;  1JD1 A;  3KE1 A;  3OBY A;  2UYJ A;  4C4W C;  3WXM B;  4G4X A;  1VQK F;  1VQ6 F;  3FBA A;  1FFX A;  5CA0 B;  5CA1 B;  4DRX B;  4F6R B;  1W42 A;  5GAP K;  5GON B;  3IR9 A;  5EIB C;  3KHN A;  5KMG A;  1VQ4 F;  4IIJ A;  3GYQ A;  1YIJ F;  1X7O A;  2AIF A;  1KNK A;  3ESJ A;  3L7Q A;  4LNU B;  3S0H A;  1PXW A;  2HP0 A;  3C9U A;  2DT4 A;  2VAW A;  4BT4 A;  3VOB A;  1Q7Y H;  3PAF A;  3JAS A;  4EB6 A;  3I55 F;  3MCA B;  5LOV B;  1VH8 A;  5JCO A;  3CXC F;  3NVI B;  2UYK A;  5JH7 A;  4I4T A;  3K0T A;  1KNJ A;  5EO3 A;  4BY9 D;  1QD9 A;  3LYB A;  1QU9 A;  1Q8R A;  2LCA A;  4O4I A;  4U39 A;  3UT5 B;  4BVS A;  3TD4 A;  4G4Z A;  3CCQ F;  4O4H B;  3VYT C;  2UYN A;  4TV8 A;  3K12 A;  1VQP F;  2L26 A;  2ZVY A;  4C8G A;  5LP6 C;  3WGN A;  1FFX B;  4EI7 A;  2HX0 A;  3OON A;  2HS4 A;  3GHZ A;  3N4Z A;  4YJ3 A;  1VHA A;  4I50 A;  5KMG B;  2CWJ A;  3WGL A;  1W58 1;  3IEQ A;  2VAM A;  2Z1U A;  1M90 H;  4B46 A;  3CCL F;  3JAS B;  3K14 A;  3N2G A;  2VXY A;  2BO1 A;  4G4V A;  3S03 A;  4O2A A;  3G71 F;  3C9R A;  1Z5V A;  4BT3 A;  3NK6 A;  5HY2 A;  5JH7 B;  3CYQ A;  3S0W A;  1JN1 A;  5CA0 A;  5CA1 A;  3PLA C;  2RB9 A;  2YYE A;  4DRX A;  4F6R A;  5LA6 A;  5LP6 A;  2JNB A;  4M8I A;  3KJK A;  4NQ3 A;  1X25 A;  1XBI A;  5GON A;  1FNJ A;  2EWC A;  5IJ0 A;  4U3J A;  2PHN A;  4BT6 A;  3FFM A;  4O4L A;  4TV9 B;  2GLZ A;  2HQS C;  4I55 A;  4O4J B;  2UYN B;  3CCJ F;  3CG6 A;  2IG8 A;  3CCU F;  3ZP4 A;  3RYI B;  3DC2 A;  1QVF F;  3JAR A;  3N2K B;  3WJQ A;  1RQ2 A;  3VI6 A;  3P4E A;  1OAP A;  4YJ3 B;  3VCZ A;  2B33 A;  5ITZ A;  3WJR A;  5GIN C;  4RQO A;  2GVI A;  5LXT B;  1W59 A;  1TUB B;  2KG4 A;  3JAK A;  1NMU B;  3WPX A;  3CPW F;  2QEX F;  1W5F A;  4IHJ A;  3N2G B;  3WPW A;  3CC4 F;  4B5C A;  3S02 A;  3D01 A;  4C81 A;  1VQN F;  5EZY B;  2BTQ B;  1JY8 A;  2F9Z C;  2H8E A;  4C82 A;  4O2A B;  3QTY A;  2YXZ A;  3VIU A;  4TUY B;  4C8I A;  2RHJ A;  4FFB A;  3CCS F;  2CW4 A;  1W57 A;  2GZL A;  4BVQ A;  4LCK A;  4NWO B;  2AMT A;  5B8F A;  5LA6 B;  5LP6 B;  2HS0 A;  3G4S F;  3D54 A;  5IJ0 B;  3RYH B;  4U3J B;  5G4U C;  4X1K B;  1M1K H;  4O4L B;  2CZW A;  3F0F A;  4I55 B;  3K2X A;  1CLI A;  1IV1 A;  4DXD A;  5FJ4 C;  1RQ7 A;  3S0Y A;  3HWU A;  3JAR B;  3P10 A;  4X1I B;  2N48 A;  1GO0 A;  5GIP C;  3HTN A;  5EIB D;  3EOR A;  4G88 A;  3WGJ A;  2HRY A;  5ITZ B;  2OTM A;  5IT9 M;  1H47 A;  3IMP A;  5J2U A;  3E22 B;  3LWR C;  3CME F;  3CCR F;  3JAL B;  3J80 M;  2ZF8 A;  1ZWZ A;  3JAK B;  1IV2 A;  3I3F A;  3NK7 A;  4B62 A;  4IHJ B;  5JVD A;  5HP8 A;  2H6L A;  1W5E A;  4TV9 A;  2LBX A;  4O4J A;  4O2B B;  5EAZ A;  2PMP A;  1FNK A;  1DBF A;  3RYC B;  1YGY A;  2IQQ A;  3RYI A;  1NQ3 A;  4FFB B;  2KGW A;  2BTU A;  3FD6 A;  3LDT A;  4ZOL A;  3N2K A;  1K9M H;  1XHO A;  5JQG A;  1VQ7 F;  3ON1 A;  1VQ8 F;  3CC7 F;  3NMU C;  3LWO C;  3JVH A;  2P6Y A;  2CHT A;  4BVR A;  3J81 M;  3KJJ A;  1Q81 H;  5LXT A;  1TUB A;  2KTU A;  3WGM A;  2G9I A;  3HKE B;  4HNA A;  5HY0 A;  1XV2 A;  1YHQ F;  2FGY A;  5HY1 A;  5EZY A;  2MQE A;  4X1Y B;  2ALE A;  3ELC A;  3S06 A;  3LWV C;  5HP7 A;  2I6D A;  3I56 F;  3CCV F;  1N8R H;  4TUY A;  1U3L A;  1YJN F;  2BTO A;  5J2U B;  5MN4 A;  3VYS C;  1YJ9 F;  3LFO A;  1GZ0 A;  5LYJ A;  1YJW F;  1QVG F;  5JVD B;  3RYH A;  4X1K A;  1U43 A;  4X3M A;  3N4Y A;  2W8B C;  5EYP B;  3VTI C;  1E7K A;  2ZOD A;  2RHL A;  1H7M A;  4ZHW A;  3HAX D;  5EB0 A;  3E1Y A;  4ZOL B;  4X1I A;  4EI8 A;  5JQG B;  3FPI A;  3LWQ C;  1IV4 A;  2Z01 A;  1Q82 H;  3M4S A;  1W5A A;  3CCM F;  3JAT B;  5C8Y B;  5HWE A;  3E22 A;  3JAL A;  5CB4 A;  4HNA B;  3CD6 F;  4R40 B;  1CK2 A;  3GTZ A;  1XRG A;  3VOA A;  5MN5 A;  2RHH A;  3V7E A;  1Q86 H;  4O2B A;  3O85 A;  2I6R A;  3RYC A;  3VO8 A;  4XCQ A;  5BMV A;  5GIO C;  3DDN A;  1YIT F;  1UI9 A;  3B6N A;  4BT2 A;  4ZHY B;  4ZHQ A;  2VGN A;  1IV3 A;  3F6M A;  3MBM A;  5LYJ B;  4NUT A;  1RA4 A;  3RYF A;  1W3E X;  1KQS F;  5HY4 A;  1ODE A;  3IEW A;  1K8A H;  1T0K B;  3RA6 A;  3T80 A;  4C8E A;  1DT9 A;  1FSZ A;  3BYQ A;  3HKE A;  3V7Q A;  3D00 A;  2QTP A;  1VQV A;  2LBT A;  2HVY D;  4X1Y A;  5HXU A;  5KX5 A;  1VQ5 F;  3CC2 F;  1SA0 A;  3HKC B;  1VQO F;  1X7P A;  4X3L A;  5DCV A;  3MQW A;  3V3T A;  3C9T A;  2CSL A;  2ZOV A;  2OZB A;  1H48 A;  3MCQ A;  4KWE A;  1TVK A;  3R0P A;  1RLG A;  3E20 B;  3ZP7 A;  1U3P A;  2FC3 A;  4TZZ A;  5CB4 B;  3QUW A;  3V4D A;  1SZQ A;  2OTL F;  3HJW C;  2KTV A;  2Q1Y A;  4WBN A;  4RHA A;  2CHS A;  2Z1F A;  3M1X A;  1Z5W A;  2OTJ F;  3JAW B;  1U40 A;  3C9S A;  2HS3 A;  2UZH A;  2HRU A;  3G6E F;  3HKB B;  4PWT A;  5EYP A;  3F0G A;  1ONI A;  4X20 B;  1OFU A;  3TD3 A;  5BMV B;  1W2B F;  1JFF B;  2IAF A;  3CB2 A;  3SIU A;  3HKD A;  1VQ9 F;  4BT5 A;  1IPA A;  1QAH A;  2R75 1;  4ZHQ B;  5G4V C;  1VQL F;  2VGM A;  2K1S A;  2AIZ P;  5EB1 B;  3OW2 F;  1JJ2 F;  1W40 A;  3RYF B;  5FNV A;  3JAT A;  5C8Y A;  4YJ2 A;  5IYZ B;  3ERN A;  3Q8H A;  3VYU C;  2HP3 A;  1J7H A;  5MN6 A;  1VQM F;  3VMF B;  2R6R 1;  1R1M A;  1PF5 A;  3AGK A;  5KX5 B;  3LWP C;  1SA0 B;  4BVT A;  2LBW A;  1TVK B;  2V9Y A;  1COM A;  4IIJ B;  3CMA F;  2H8C A;  3F0D A;  5IJ9 A;  3WGK A;  2HP0 B;  4BT7 A;  1YI2 F;  3MDO A;  2Q1X A;  4WBN B;  5J2T A;  3JCM M;  4EB6 B;  1VK3 A;  1S72 F;  4ZI7 A;  2NMU A;  2ZVZ A;  3M84 A;  3CCE F;  5FLX M;  2CVL A;  1GX1 A;  4B45 A;  3HKD B;  4I4T B; 
#chains in the Genus database with same CATH homology
 5GIO C;  1YIT F;  1X52 A;  3N4Z A;  5IT9 M;  2VGN A;  1CN7 A;  3LWR C;  3CCR F;  3CME F;  3J80 M;  1ZWZ A;  4NUT A;  1RA4 A;  3NK7 A;  1W3E X;  1KQS F;  5HY4 A;  1GO1 A;  1K8A H;  3RA6 A;  5EWR A;  1M90 H;  1T0K B;  2QI2 A;  1DT9 A;  3CCL F;  2WAL A;  5GAN K;  3CPQ A;  2LBX A;  3V7Q A;  3D00 A;  2BO1 A;  5HXZ A;  5A2Q M;  3JAM M;  3G71 F;  1NJI H;  2HVY D;  3SIV A;  1KC8 H;  5HXU A;  3NK6 A;  3OBW A;  5HY2 A;  1VQ5 F;  3CC2 F;  1VQO F;  1K9M H;  1VQ7 F;  1X7P A;  4X3L A;  1KD1 H;  5DCV A;  3J7A R;  3NVK E;  3ON1 A;  1VQ8 F;  3CC7 F;  3V3T A;  3NMU C;  3PLA C;  3LWO C;  2OZB A;  3RA5 A;  1SDS A;  2JNB A;  1RLG A;  4BVR A;  4NQ3 A;  3E20 B;  1XBI A;  2FC3 A;  3J81 M;  4TZZ A;  1Q81 H;  4BW0 B;  3FFM A;  1K73 H;  2OTL F;  2KTU A;  3HJW C;  2KTV A;  2GLZ A;  5HY0 A;  1YHQ F;  4EI9 A;  2OTJ F;  1W41 A;  3CCJ F;  2FGY A;  3CG6 A;  2OHW A;  5HY1 A;  3G6E F;  3CCU F;  2QA4 F;  2ALE A;  1QVF F;  3OBY A;  4C4W C;  3WXM B;  3LWV C;  2I6D A;  1VQK F;  1W2B F;  3I56 F;  1VQ6 F;  3CCV F;  3SIU A;  3VI6 A;  1N8R H;  1VQ9 F;  1IPA A;  1YJN F;  1W42 A;  5GAP K;  5G4V C;  1VQL F;  2VGM A;  5GIN C;  3IR9 A;  3OW2 F;  1YJ9 F;  1JJ2 F;  1W40 A;  1VQ4 F;  3GYQ A;  1YIJ F;  1X7O A;  2AIF A;  3LFO A;  1GZ0 A;  2KG4 A;  1YJW F;  1NMU B;  3CPW F;  1QVG F;  1PXW A;  2QEX F;  1Q7Y H;  3CC4 F;  3PAF A;  4X3M A;  1VQN F;  3N4Y A;  2F9Z C;  1VQM F;  1E7K A;  3I55 F;  3MCA B;  3VMF B;  3HAX D;  1H7M A;  3E1Y A;  3CXC F;  3AGK A;  3LWP C;  4EI8 A;  4BVT A;  3NVI B;  3CCS F;  4BVQ A;  3LWQ C;  4LCK A;  1Q82 H;  2LBW A;  3G4S F;  3CMA F;  5EO3 A;  3CCM F;  4BY9 D;  5HWE A;  5G4U C;  1YI2 F;  1M1K H;  4BVS A;  2CZW A;  3CD6 F;  3JCM M;  1CK2 A;  3CCQ F;  1S72 F;  5FJ4 C;  1VQP F;  3V7E A;  1Q86 H;  3CCE F;  5FLX M;  3O85 A;  1GO0 A;  5GIP C;  4XCQ A;  4EI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...