1W41A

T. celer l30e e90a variant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGASRILALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electrostatic Interactions Contribute to Reduced Heat Capacity Change of Unfolding in a Thermophilic Ribosomal Protein L30E
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w41A00
3OBWA 1Q81H 3CPWF 1W3EX 3JAMM 3CC7F 1CN7A 2QI2A 3O85A 3CCMF 3CCSF 3I55F 1CK2A 5DCVA 3CCVF 3CPQA 5GAPK 1JJ2F 2BO1A 1XBIA 1S72F 3CCRF 3CCEF 1W41A 3V7QA 2OTLF 4TZZA 1RLGA 1IPAA 3CCUF 1YJ9F 3SIUA 1YHQF 3CXCF 3J7AR 4X3LA 3AGKA 5EO3A 1M1KH 1Q82H 3CD6F 3RA6A 2WALA 1KQSF 3FFMA 4BY9D 1GZ0A 1VQMF 2KTVA 1W2BF 3CC4F 5GANK 1YI2F 1SDSA 3CMEF 1NMUB 1NJIH 3CMAF 3LWPC 1Q86H 5FJ4C 3E20B 1VQ7F 4X3MA 1K8AH 3HAXD 1RA4A 3J80M 3J81M 3CC2F 2OTJF 1K9MH 1VQOF 1DT9A 1X7PA 2CZWA 1YJWF 1QVGF 3LWOC 3G6EF 1YIJF 1M90H 1K73H 3N4YA 2KG4A 1E7KA 3SIVA 5G4UC 2VGMA 1YITF 1Q7YH 3JCMM 3LWVC 3G4SF 1VQPF 1KD1H 1VQNF 3CG6A 5EWRA 1ZWZA 5G4VC 2OHWA 3VI6A 1VQ5F 3LWQC 5A2QM 3LWRC 5IT9M 4BW0B 2LBWA 3MCAB 2QA4F 1H7MA 3WXMB 2KTUA 1KC8H 1X52A 3HJWC 3LFOA 5GIPC 3OW2F 3IR9A 3OBYA 4C4WC 1VQLF 2VGNA 1T0KB 3ON1A 5FLXM 3GYQA 1X7OA 1VQ4F 1GO1A 2LBXA 1VQ6F 3RA5A 3NMUC 3CCJF 2HVYD 2QEXF 3PLAC 3PAFA 1QVFF 1GO0A 2ALEA 1VQKF 2AIFA 3CCQF 1PXWA 3NVIB 3NVKE 3V7EA 3I56F 2I6DA 1N8RH 1YJNF 5GINC 2OZBA 2FC3A 1W40A 3NK6A 3N4ZA 1W42A 3VMFB 2JNBA 5GIOC 3E1YA 3CCLF 1VQ8F 4LCKA 4NUTA 3NK7A 1VQ9F 3G71F
chains in the Genus database with same CATH superfamily
3KJJA 5HY4A 3LYBA 1W3EX 2UYNB 3DC2A 3ZOPA 5KX5A 1VH8A 4HNAA 2B33A 3WGKA 3D54A 1Q8RA 4NQ3A 4WBNA 3JAWA 1JJ2F 2DT4A 3HWUA 1UI9A 1ONIA 4BT5A 4XCQA 3JAKB 1IPAA 3UT5A 3E22B 4O2BB 4TUYB 3CCUF 5LYJA 3U0OA 5HWEA 4I4TB 3RYFA 3RA6A 3TD4A 2UYKA 2ZOVA 3VYUC 3VCZA 5LXTB 2CVLA 5GANK 1YI2F 3CC4F 3CMEF 3JASB 3K2XA 1NJIH 3CMAF 5JH7B 3LWPC 3HKDA 1Z5VA 5FJ4C 5KMGB 2ZVYA 1K8AH 3JARB 1NQ3A 4R40B 2OTJF 1KNJA 3RYIA 4E6EA 1DT9A 4G4YA 2CZWA 1U43A 1JFFB 4IHJA 2VAWA 3D01A 1YIJF 3QTYA 3JVHA 3N4YA 4X1KB 1E7KA 5G4UC 5IJ9B 2Z1FA 5JQGB 1YITF 5EZYA 1Q7YH 3JCMM 3LWVC 2ZF8A 4ZHWA 1GX1A 3CG6A 5EWRA 4C8IA 4O4IB 3LWQC 1VQ5F 2KGWA 4BW0B 2UZHA 5JVDA 3M4SA 4O4HA 1JD1A 3GHZA 4X1IB 2YXZA 3LFOA 3N2KB 3IKFA 4BT6A 1JY8A 3IKEA 3JASA 3FPIA 4BVTA 1VQ4F 1ODEA 1XV2A 1GO1A 1XRGA 4DRXA 3WGNA 2LBXA 4BVQA 3RYFB 2NMUA 1DBFA 3NMUC 3CCJF 5LOVB 4ERHA 2QEXF 3PAFA 1GO0A 5BMVB 5LP6A 2QTPA 2HS4A 3V7EA 4LNUB 3OONA 4B5CA 4WBNB 2Q1YA 3CYQA 3RE3A 3VMFB 2JNBA 5GIOC 3E1YA 5EIBD 5HXUA 1PF5A 5B8FA 5GONA 4NUTA 3VOAA 5CB4B 1OFUA 4X1YA 5HY2A 2OTMA 3OBWA 3CPWF 4O4HB 3JATB 3CC7F 4O4LA 5CA1A 2CSLA 3V3TA 5HY1A 3CCSF 3HKEA 2HRUA 2LBTA 3RYHB 2P6YA 1CK2A 5LA6B 3VTIC 3WPWA 4BT3A 5EZYB 4YJ2B 4EB6B 1W41A 1YGYA 1RQ2A 5HY0A 3V7QA 2OTLF 5IYZA 1RLGA 5HP8A 1YJ9F 4O4JB 4NWOB 2CHSA 5C8YA 5IJ0A 3CXCF 3J7AR 3N2GA 5EO3A 1Q82H 2IG8A 2WALA 3N2KA 1VQMF 3C8LA 3WPXA 3ERNA 1SDSA 1NMUB 2PMPA 1QU9A 1W5EA 4PWTA 2HP0B 1VQ7F 2R751 4X3MA 3WJRA 4BVSA 1COMA 3LMEA 2Z01A 3HAXD 3KE1A 2FGYA 2RHHA 3FBAA 4EB6A 1K9MH 4I4TA 1R1MA 4M8IA 1QVGF 1M90H 1K73H 3VO8A 2IQQA 2KG4A 3M84A 3SIVA 5JCOA 4C81A 4YJ3A 4ZHQA 2Z1UA 2HP0A 3C9SA 3P10A 1VQNF 2RB9A 5G4VC 2VAMA 3V4DA 5A2QM 3LWRC 3S0YA 5IT9M 4EI9A 1W55A 2LBWA 1U3PA 3C9RA 3MCAB 2QA4F 3WXMB 2VAPA 4TV9B 4BT2A 3F0GA 3MDOA 1Z5WA 3HJWC 1SA0A 5EB1B 3K0TA 3D00A 3OW2F 4TV8B 3IR9A 3OBYA 1VQLF 2VGNA 3IMPA 5J2UA 1YQNA 3ON1A 2HRYA 2AMTA 3E22A 3KHNA 5LP6B 5BMVA 5LOVA 4TV8A 3RA5A 1FFXB 2HVYD 3PLAC 3JAWB 4C8EA 1W59A 3GTZA 5MN5A 4BVRA 4ZI7B 2HX0A 4X1YB 4ZOLB 3HKCA 3EORA 1UFYA 2V9YA 2AIFA 1PXWA 3NVKE 3I56F 3KIZA 1H47A 1VHAA 1W40A 4X1IA 3N4ZA 1W57A 4C82A 3QHDA 3S06A 4ZHQB 3NK7A 1VQ9F 3MBMA 3WGMA 2W8BC 1W5BA 2UYJA 4G4XA 2RHOA 1RQ7A 3O85A 2PHNA 4X1KA 4BT4A 4ZHYB 5DCVA 5GAPK 3HKBA 2K1SA 2CWJA 1SZQA 1TVKA 1S72F 2F9ZC 2BTOA 3S0WA 2HS3A 1OAPA 3MCQA 1TVKB 3F0FA 1VK3A 3HKBB 5JCOC 2BTUA 3L7QA 3AGKA 2VXYA 1FNJA 5LXTA 5IYZB 1TUBA 4X20B 1KQSF 2AIZP 2KTVA 3DDNA 1W2BF 1KNKA 1IV4A 5ITZA 3E20B 5LA6A 2ZAUA 3IEQA 3MQWA 3JAKA 5HP7A 2ZODA 5EB0A 1RA4A 3J80M 4I50B 1X25A 1U3LA 1X7PA 3G6EF 3I3FA 2Z1TA 3T80A 1XHOA 5GONB 3ZP4A 5LP6C 5MN6A 5C8YB 5IJ0B 3HKCB 2HP3A 3WJQA 4ZI7A 5JH7A 2R6R1 4ZHVA 4RQOA 3M1XA 4U39A 2ZVZA 3R0PA 3QUWA 4I55A 2KTUA 3JALB 1X52A 1KC8H 3VIUA 2CW4A 3FD6A 1IV1A 2G9IA 5J2UB 3S02A 3WGJA 4B46A 4EI7A 4RHAA 2H8EA 5GIPC 5CA1B 4C4WC 2H6LA 1H48A 3VYTC 1SA0B 5EYPA 2GZLA 3K14A 4FFBA 5J2TA 5KX5B 1VQ6F 1J7HA 1W5AA 4G88A 3C9UA 2UYPA 2H8CA 2HS0A 2UYNA 1QVFF 1T0AA 2Z1EA 3F0DA 2YYEA 4LNUA 4B45A 3NVIB 4IIJA 3Q8HA 2Q1XA 5GINC 2FC3A 1W42A 4O2AA 3CCLF 3I7TA 1VQ8F 5AVMA 4LCKA 4DRXB 4F6RA 4O2AB 2CHTA 3G71F 3FD5A 2RHLA 3ZO8A 1Q81H 5HXZA 4I55B 3P4EA 3WGLA 3JAMM 1CN7A 4G4WA 4C8GA 2QI2A 3CCMF 3RYCA 3I55F 3CCVF 3HKDB 3CPQA 1FSZA 4U3JB 2BO1A 1XBIA 3TD5A 3ZP7A 2MQEA 5JVDB 3CCRF 3CCEF 3VOBA 4FFBB 5J2TB 3WJPA 4TZZA 5FNVB 3TD3A 3F0EA 3SIUA 1YHQF 1U40A 3BYQA 4X3LA 1M1KH 3CD6F 3RYHA 1CLIA 4KWEA 3HKEB 1VQVA 3FFMA 4I50A 4BY9D 1GZ0A 3ELCA 4O4LB 2LCAA 1Q86H 2N48A 2EWCA 2GVIA 1IV3A 1JFFA 1W5FA 3J81M 3CC2F 3LDTA 3IEWA 5CB4A 3P0ZA 3JARA 1VQOF 1YJWF 5KMGA 3LWOC 4TV9A 1W581 1QD9A 3ESJA 2VGMA 4ZK7A 3S03A 3HTNA 5LYJB 3G4SF 1VQPF 1KD1H 1FNKA 2BTQB 1IV2A 1ZWZA 2I6RA 2OHWA 3B6NA 4O2BA 4TUYA 3UT5B 3VI6A 4YJ3B 5MN4A 4F6RB 1JN1A 2DYYA 5EIBC 5EAZA 5CA0B 1H7MA 5ITZB 3CB2A 5FNVA 2RHJA 4G4VA 1TUBB 4X20A 4HNAB 4U3JA 1T0KB 2HQSC 2L26A 1QAHA 3KJKA 5FLXM 4BT7A 3GYQA 1X7OA 3RYCB 2IAFA 3VYSC 1RLUA 3N2GB 3S0HA 4G4ZA 4O4JA 4EI8A 4ZOLA 4O4IA 5EYPB 2ALEA 1VQKF 1FFXA 3F6MA 3CCQF 4YJ2A 5CA0A 5JQGA 5IJ9A 2I6DA 1N8RH 1YJNF 2OZBA 3NK6A 4B62A 3CYPB 2GLZA 3K12A 4IHJB 3JALA 4IIJB 3JATA 4DXDA 3RYIB 3C9TA
chains in the Genus database with same CATH topology
5HY2A 5HY4A 3OBWA 1Q81H 3CPWF 1W3EX 5HXZA 3JAMM 3CC7F 1CN7A 2QI2A 3O85A 3V3TA 5HY1A 3CCMF 3CCSF 3I55F 4NQ3A 1CK2A 5DCVA 3CCVF 3CPQA 5GAPK 1JJ2F 2BO1A 1XBIA 1S72F 2F9ZC 3CCRF 3CCEF 1W41A 5HY0A 3V7QA 2OTLF 4TZZA 4XCQA 1RLGA 1IPAA 3CCUF 1YJ9F 3SIUA 1YHQF 3CXCF 5HWEA 3J7AR 4X3LA 3AGKA 5EO3A 1M1KH 1Q82H 3CD6F 3RA6A 2WALA 1KQSF 3FFMA 4BY9D 1GZ0A 1VQMF 2KTVA 1W2BF 3CC4F 5GANK 1YI2F 1SDSA 3CMEF 1NMUB 1NJIH 3CMAF 3LWPC 1Q86H 5FJ4C 3E20B 1VQ7F 4X3MA 1K8AH 4BVSA 3HAXD 1RA4A 3J80M 2FGYA 3J81M 3CC2F 1K9MH 2OTJF 1VQOF 1DT9A 1X7PA 2CZWA 1YJWF 1QVGF 3LWOC 3G6EF 1YIJF 1M90H 1K73H 3N4YA 2KG4A 1E7KA 3SIVA 5G4UC 2VGMA 1YITF 1Q7YH 3JCMM 3LWVC 3G4SF 1VQPF 1KD1H 1VQNF 3CG6A 5EWRA 1ZWZA 5G4VC 2OHWA 3VI6A 1VQ5F 3LWQC 5A2QM 3LWRC 5IT9M 4EI9A 4BW0B 2LBWA 3MCAB 2QA4F 1H7MA 3WXMB 2KTUA 1KC8H 1X52A 3HJWC 4EI7A 3LFOA 5GIPC 3D00A 3OW2F 3IR9A 3OBYA 4C4WC 1VQLF 2VGNA 1T0KB 3ON1A 5FLXM 4BVTA 3GYQA 1X7OA 1VQ4F 1GO1A 2LBXA 4BVQA 1VQ6F 3RA5A 3NMUC 3CCJF 2HVYD 4EI8A 2QEXF 3PAFA 1QVFF 3PLAC 1GO0A 4BVRA 2ALEA 1VQKF 2AIFA 3CCQF 1PXWA 3NVIB 3NVKE 3V7EA 3I56F 2I6DA 1N8RH 1YJNF 5GINC 2OZBA 2FC3A 1W40A 3NK6A 3N4ZA 2GLZA 1W42A 3VMFB 2JNBA 5GIOC 3E1YA 3CCLF 1VQ8F 5HXUA 4LCKA 4NUTA 3NK7A 1VQ9F 3G71F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBW A;  1Q81 H;  3CPW F;  1W3E X;  3JAM M;  3CC7 F;  1CN7 A;  2QI2 A;  3O85 A;  3CCM F;  3CCS F;  3I55 F;  1CK2 A;  5DCV A;  3CCV F;  3CPQ A;  5GAP K;  1JJ2 F;  2BO1 A;  1XBI A;  1S72 F;  3CCR F;  3CCE F;  1W41 A;  3V7Q A;  2OTL F;  4TZZ A;  1RLG A;  1IPA A;  3CCU F;  1YJ9 F;  3SIU A;  1YHQ F;  3CXC F;  3J7A R;  4X3L A;  3AGK A;  5EO3 A;  1M1K H;  1Q82 H;  3CD6 F;  3RA6 A;  2WAL A;  1KQS F;  3FFM A;  4BY9 D;  1GZ0 A;  1VQM F;  2KTV A;  1W2B F;  3CC4 F;  5GAN K;  1YI2 F;  1SDS A;  3CME F;  1NMU B;  1NJI H;  3CMA F;  3LWP C;  1Q86 H;  5FJ4 C;  3E20 B;  1VQ7 F;  4X3M A;  1K8A H;  3HAX D;  1RA4 A;  3J80 M;  3J81 M;  3CC2 F;  2OTJ F;  1K9M H;  1VQO F;  1DT9 A;  1X7P A;  2CZW A;  1YJW F;  1QVG F;  3LWO C;  3G6E F;  1YIJ F;  1M90 H;  1K73 H;  3N4Y A;  2KG4 A;  1E7K A;  3SIV A;  5G4U C;  2VGM A;  1YIT F;  1Q7Y H;  3JCM M;  3LWV C;  3G4S F;  1VQP F;  1KD1 H;  1VQN F;  3CG6 A;  5EWR A;  1ZWZ A;  5G4V C;  2OHW A;  3VI6 A;  1VQ5 F;  3LWQ C;  5A2Q M;  3LWR C;  5IT9 M;  4BW0 B;  2LBW A;  3MCA B;  2QA4 F;  1H7M A;  3WXM B;  2KTU A;  1KC8 H;  1X52 A;  3HJW C;  3LFO A;  5GIP C;  3OW2 F;  3IR9 A;  3OBY A;  4C4W C;  1VQL F;  2VGN A;  1T0K B;  3ON1 A;  5FLX M;  3GYQ A;  1X7O A;  1VQ4 F;  1GO1 A;  2LBX A;  1VQ6 F;  3RA5 A;  3NMU C;  3CCJ F;  2HVY D;  2QEX F;  3PLA C;  3PAF A;  1QVF F;  1GO0 A;  2ALE A;  1VQK F;  2AIF A;  3CCQ F;  1PXW A;  3NVI B;  3NVK E;  3V7E A;  3I56 F;  2I6D A;  1N8R H;  1YJN F;  5GIN C;  2OZB A;  2FC3 A;  1W40 A;  3NK6 A;  3N4Z A;  1W42 A;  3VMF B;  2JNB A;  5GIO C;  3E1Y A;  3CCL F;  1VQ8 F;  4LCK A;  4NUT A;  3NK7 A;  1VQ9 F;  3G71 F; 
#chains in the Genus database with same CATH topology
 3KJJ A;  5HY4 A;  3LYB A;  1W3E X;  2UYN B;  3DC2 A;  3ZOP A;  5KX5 A;  1VH8 A;  4HNA A;  2B33 A;  3WGK A;  3D54 A;  1Q8R A;  4NQ3 A;  4WBN A;  3JAW A;  1JJ2 F;  2DT4 A;  3HWU A;  1UI9 A;  1ONI A;  4BT5 A;  4XCQ A;  3JAK B;  1IPA A;  3UT5 A;  3E22 B;  4O2B B;  4TUY B;  3CCU F;  5LYJ A;  3U0O A;  5HWE A;  4I4T B;  3RYF A;  3RA6 A;  3TD4 A;  2UYK A;  2ZOV A;  3VYU C;  3VCZ A;  5LXT B;  2CVL A;  5GAN K;  1YI2 F;  3CC4 F;  3CME F;  3JAS B;  3K2X A;  1NJI H;  3CMA F;  5JH7 B;  3LWP C;  3HKD A;  1Z5V A;  5FJ4 C;  5KMG B;  2ZVY A;  1K8A H;  3JAR B;  1NQ3 A;  4R40 B;  2OTJ F;  1KNJ A;  3RYI A;  4E6E A;  1DT9 A;  4G4Y A;  2CZW A;  1U43 A;  1JFF B;  4IHJ A;  2VAW A;  3D01 A;  1YIJ F;  3QTY A;  3JVH A;  3N4Y A;  4X1K B;  1E7K A;  5G4U C;  5IJ9 B;  2Z1F A;  5JQG B;  1YIT F;  5EZY A;  1Q7Y H;  3JCM M;  3LWV C;  2ZF8 A;  4ZHW A;  1GX1 A;  3CG6 A;  5EWR A;  4C8I A;  4O4I B;  3LWQ C;  1VQ5 F;  2KGW A;  4BW0 B;  2UZH A;  5JVD A;  3M4S A;  4O4H A;  1JD1 A;  3GHZ A;  4X1I B;  2YXZ A;  3LFO A;  3N2K B;  3IKF A;  4BT6 A;  1JY8 A;  3IKE A;  3JAS A;  3FPI A;  4BVT A;  1VQ4 F;  1ODE A;  1XV2 A;  1GO1 A;  1XRG A;  4DRX A;  3WGN A;  2LBX A;  4BVQ A;  3RYF B;  2NMU A;  1DBF A;  3NMU C;  3CCJ F;  5LOV B;  4ERH A;  2QEX F;  3PAF A;  1GO0 A;  5BMV B;  5LP6 A;  2QTP A;  2HS4 A;  3V7E A;  4LNU B;  3OON A;  4B5C A;  4WBN B;  2Q1Y A;  3CYQ A;  3RE3 A;  3VMF B;  2JNB A;  5GIO C;  3E1Y A;  5EIB D;  5HXU A;  1PF5 A;  5B8F A;  5GON A;  4NUT A;  3VOA A;  5CB4 B;  1OFU A;  4X1Y A;  5HY2 A;  2OTM A;  3OBW A;  3CPW F;  4O4H B;  3JAT B;  3CC7 F;  4O4L A;  5CA1 A;  2CSL A;  3V3T A;  5HY1 A;  3CCS F;  3HKE A;  2HRU A;  2LBT A;  3RYH B;  2P6Y A;  1CK2 A;  5LA6 B;  3VTI C;  3WPW A;  4BT3 A;  5EZY B;  4YJ2 B;  4EB6 B;  1W41 A;  1YGY A;  1RQ2 A;  5HY0 A;  3V7Q A;  2OTL F;  5IYZ A;  1RLG A;  5HP8 A;  1YJ9 F;  4O4J B;  4NWO B;  2CHS A;  5C8Y A;  5IJ0 A;  3CXC F;  3J7A R;  3N2G A;  5EO3 A;  1Q82 H;  2IG8 A;  2WAL A;  3N2K A;  1VQM F;  3C8L A;  3WPX A;  3ERN A;  1SDS A;  1NMU B;  2PMP A;  1QU9 A;  1W5E A;  4PWT A;  2HP0 B;  1VQ7 F;  2R75 1;  4X3M A;  3WJR A;  4BVS A;  1COM A;  3LME A;  2Z01 A;  3HAX D;  3KE1 A;  2FGY A;  2RHH A;  3FBA A;  4EB6 A;  1K9M H;  4I4T A;  1R1M A;  4M8I A;  1QVG F;  1M90 H;  1K73 H;  3VO8 A;  2IQQ A;  2KG4 A;  3M84 A;  3SIV A;  5JCO A;  4C81 A;  4YJ3 A;  4ZHQ A;  2Z1U A;  2HP0 A;  3C9S A;  3P10 A;  1VQN F;  2RB9 A;  5G4V C;  2VAM A;  3V4D A;  5A2Q M;  3LWR C;  3S0Y A;  5IT9 M;  4EI9 A;  1W55 A;  2LBW A;  1U3P A;  3C9R A;  3MCA B;  2QA4 F;  3WXM B;  2VAP A;  4TV9 B;  4BT2 A;  3F0G A;  3MDO A;  1Z5W A;  3HJW C;  1SA0 A;  5EB1 B;  3K0T A;  3D00 A;  3OW2 F;  4TV8 B;  3IR9 A;  3OBY A;  1VQL F;  2VGN A;  3IMP A;  5J2U A;  1YQN A;  3ON1 A;  2HRY A;  2AMT A;  3E22 A;  3KHN A;  5LP6 B;  5BMV A;  5LOV A;  4TV8 A;  3RA5 A;  1FFX B;  2HVY D;  3PLA C;  3JAW B;  4C8E A;  1W59 A;  3GTZ A;  5MN5 A;  4BVR A;  4ZI7 B;  2HX0 A;  4X1Y B;  4ZOL B;  3HKC A;  3EOR A;  1UFY A;  2V9Y A;  2AIF A;  1PXW A;  3NVK E;  3I56 F;  3KIZ A;  1H47 A;  1VHA A;  1W40 A;  4X1I A;  3N4Z A;  1W57 A;  4C82 A;  3QHD A;  3S06 A;  4ZHQ B;  3NK7 A;  1VQ9 F;  3MBM A;  3WGM A;  2W8B C;  1W5B A;  2UYJ A;  4G4X A;  2RHO A;  1RQ7 A;  3O85 A;  2PHN A;  4X1K A;  4BT4 A;  4ZHY B;  5DCV A;  5GAP K;  3HKB A;  2K1S A;  2CWJ A;  1SZQ A;  1TVK A;  1S72 F;  2F9Z C;  2BTO A;  3S0W A;  2HS3 A;  1OAP A;  3MCQ A;  1TVK B;  3F0F A;  1VK3 A;  3HKB B;  5JCO C;  2BTU A;  3L7Q A;  3AGK A;  2VXY A;  1FNJ A;  5LXT A;  5IYZ B;  1TUB A;  4X20 B;  1KQS F;  2AIZ P;  2KTV A;  3DDN A;  1W2B F;  1KNK A;  1IV4 A;  5ITZ A;  3E20 B;  5LA6 A;  2ZAU A;  3IEQ A;  3MQW A;  3JAK A;  5HP7 A;  2ZOD A;  5EB0 A;  1RA4 A;  3J80 M;  4I50 B;  1X25 A;  1U3L A;  1X7P A;  3G6E F;  3I3F A;  2Z1T A;  3T80 A;  1XHO A;  5GON B;  3ZP4 A;  5LP6 C;  5MN6 A;  5C8Y B;  5IJ0 B;  3HKC B;  2HP3 A;  3WJQ A;  4ZI7 A;  5JH7 A;  2R6R 1;  4ZHV A;  4RQO A;  3M1X A;  4U39 A;  2ZVZ A;  3R0P A;  3QUW A;  4I55 A;  2KTU A;  3JAL B;  1X52 A;  1KC8 H;  3VIU A;  2CW4 A;  3FD6 A;  1IV1 A;  2G9I A;  5J2U B;  3S02 A;  3WGJ A;  4B46 A;  4EI7 A;  4RHA A;  2H8E A;  5GIP C;  5CA1 B;  4C4W C;  2H6L A;  1H48 A;  3VYT C;  1SA0 B;  5EYP A;  2GZL A;  3K14 A;  4FFB A;  5J2T A;  5KX5 B;  1VQ6 F;  1J7H A;  1W5A A;  4G88 A;  3C9U A;  2UYP A;  2H8C A;  2HS0 A;  2UYN A;  1QVF F;  1T0A A;  2Z1E A;  3F0D A;  2YYE A;  4LNU A;  4B45 A;  3NVI B;  4IIJ A;  3Q8H A;  2Q1X A;  5GIN C;  2FC3 A;  1W42 A;  4O2A A;  3CCL F;  3I7T A;  1VQ8 F;  5AVM A;  4LCK A;  4DRX B;  4F6R A;  4O2A B;  2CHT A;  3G71 F;  3FD5 A;  2RHL A;  3ZO8 A;  1Q81 H;  5HXZ A;  4I55 B;  3P4E A;  3WGL A;  3JAM M;  1CN7 A;  4G4W A;  4C8G A;  2QI2 A;  3CCM F;  3RYC A;  3I55 F;  3CCV F;  3HKD B;  3CPQ A;  1FSZ A;  4U3J B;  2BO1 A;  1XBI A;  3TD5 A;  3ZP7 A;  2MQE A;  5JVD B;  3CCR F;  3CCE F;  3VOB A;  4FFB B;  5J2T B;  3WJP A;  4TZZ A;  5FNV B;  3TD3 A;  3F0E A;  3SIU A;  1YHQ F;  1U40 A;  3BYQ A;  4X3L A;  1M1K H;  3CD6 F;  3RYH A;  1CLI A;  4KWE A;  3HKE B;  1VQV A;  3FFM A;  4I50 A;  4BY9 D;  1GZ0 A;  3ELC A;  4O4L B;  2LCA A;  1Q86 H;  2N48 A;  2EWC A;  2GVI A;  1IV3 A;  1JFF A;  1W5F A;  3J81 M;  3CC2 F;  3LDT A;  3IEW A;  5CB4 A;  3P0Z A;  3JAR A;  1VQO F;  1YJW F;  5KMG A;  3LWO C;  4TV9 A;  1W58 1;  1QD9 A;  3ESJ A;  2VGM A;  4ZK7 A;  3S03 A;  3HTN A;  5LYJ B;  3G4S F;  1VQP F;  1KD1 H;  1FNK A;  2BTQ B;  1IV2 A;  1ZWZ A;  2I6R A;  2OHW A;  3B6N A;  4O2B A;  4TUY A;  3UT5 B;  3VI6 A;  4YJ3 B;  5MN4 A;  4F6R B;  1JN1 A;  2DYY A;  5EIB C;  5EAZ A;  5CA0 B;  1H7M A;  5ITZ B;  3CB2 A;  5FNV A;  2RHJ A;  4G4V A;  1TUB B;  4X20 A;  4HNA B;  4U3J A;  1T0K B;  2HQS C;  2L26 A;  1QAH A;  3KJK A;  5FLX M;  4BT7 A;  3GYQ A;  1X7O A;  3RYC B;  2IAF A;  3VYS C;  1RLU A;  3N2G B;  3S0H A;  4G4Z A;  4O4J A;  4EI8 A;  4ZOL A;  4O4I A;  5EYP B;  2ALE A;  1VQK F;  1FFX A;  3F6M A;  3CCQ F;  4YJ2 A;  5CA0 A;  5JQG A;  5IJ9 A;  2I6D A;  1N8R H;  1YJN F;  2OZB A;  3NK6 A;  4B62 A;  3CYP B;  2GLZ A;  3K12 A;  4IHJ B;  3JAL A;  4IIJ B;  3JAT A;  4DXD A;  3RYI B;  3C9T A; 
#chains in the Genus database with same CATH homology
 5HY2 A;  5HY4 A;  3OBW A;  1Q81 H;  3CPW F;  1W3E X;  5HXZ A;  3JAM M;  3CC7 F;  1CN7 A;  2QI2 A;  3O85 A;  3V3T A;  5HY1 A;  3CCM F;  3CCS F;  3I55 F;  4NQ3 A;  1CK2 A;  5DCV A;  3CCV F;  3CPQ A;  5GAP K;  1JJ2 F;  2BO1 A;  1XBI A;  1S72 F;  2F9Z C;  3CCR F;  3CCE F;  1W41 A;  5HY0 A;  3V7Q A;  2OTL F;  4TZZ A;  4XCQ A;  1RLG A;  1IPA A;  3CCU F;  1YJ9 F;  3SIU A;  1YHQ F;  3CXC F;  5HWE A;  3J7A R;  4X3L A;  3AGK A;  5EO3 A;  1M1K H;  1Q82 H;  3CD6 F;  3RA6 A;  2WAL A;  1KQS F;  3FFM A;  4BY9 D;  1GZ0 A;  1VQM F;  2KTV A;  1W2B F;  3CC4 F;  5GAN K;  1YI2 F;  1SDS A;  3CME F;  1NMU B;  1NJI H;  3CMA F;  3LWP C;  1Q86 H;  5FJ4 C;  3E20 B;  1VQ7 F;  4X3M A;  1K8A H;  4BVS A;  3HAX D;  1RA4 A;  3J80 M;  2FGY A;  3J81 M;  3CC2 F;  1K9M H;  2OTJ F;  1VQO F;  1DT9 A;  1X7P A;  2CZW A;  1YJW F;  1QVG F;  3LWO C;  3G6E F;  1YIJ F;  1M90 H;  1K73 H;  3N4Y A;  2KG4 A;  1E7K A;  3SIV A;  5G4U C;  2VGM A;  1YIT F;  1Q7Y H;  3JCM M;  3LWV C;  3G4S F;  1VQP F;  1KD1 H;  1VQN F;  3CG6 A;  5EWR A;  1ZWZ A;  5G4V C;  2OHW A;  3VI6 A;  1VQ5 F;  3LWQ C;  5A2Q M;  3LWR C;  5IT9 M;  4EI9 A;  4BW0 B;  2LBW A;  3MCA B;  2QA4 F;  1H7M A;  3WXM B;  2KTU A;  1KC8 H;  1X52 A;  3HJW C;  4EI7 A;  3LFO A;  5GIP C;  3D00 A;  3OW2 F;  3IR9 A;  3OBY A;  4C4W C;  1VQL F;  2VGN A;  1T0K B;  3ON1 A;  5FLX M;  4BVT A;  3GYQ A;  1X7O A;  1VQ4 F;  1GO1 A;  2LBX A;  4BVQ A;  1VQ6 F;  3RA5 A;  3NMU C;  3CCJ F;  2HVY D;  4EI8 A;  2QEX F;  3PAF A;  1QVF F;  3PLA C;  1GO0 A;  4BVR A;  2ALE A;  1VQK F;  2AIF A;  3CCQ F;  1PXW A;  3NVI B;  3NVK E;  3V7E A;  3I56 F;  2I6D A;  1N8R H;  1YJN F;  5GIN C;  2OZB A;  2FC3 A;  1W40 A;  3NK6 A;  3N4Z A;  2GLZ A;  1W42 A;  3VMF B;  2JNB A;  5GIO C;  3E1Y A;  3CCL F;  1VQ8 F;  5HXU A;  4LCK A;  4NUT A;  3NK7 A;  1VQ9 F;  3G71 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...