1W41A

T. celer l30e e90a variant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGASRILALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electrostatic Interactions Contribute to Reduced Heat Capacity Change of Unfolding in a Thermophilic Ribosomal Protein L30E
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w41A00
1XBIA 1W40A 3NMUC 2QA4F 1Q81H 3CCMF 1VQ7F 1IPAA 1SDSA 2QEXF 2OZBA 4X3LA 1KC8H 3SIVA 2OTJF 3CCUF 1NJIH 1VQLF 4LCKA 1GO1A 3CCQF 1VQ6F 3OW2F 1Q86H 2OTLF 1YJWF 1YI2F 2BO1A 1NMUB 3OBYA 3E20B 2AIFA 1N8RH 3I56F 1T0KB 3CCEF 1W42A 4BW0B 3LWOC 5G4VC 1JJ2F 5GIPC 1W41A 1Q7YH 1X52A 3CD6F 4BY9D 3SIUA 3LWQC 3CMEF 5DCVA 3OBWA 5A2QM 5FJ4C 2KG4A 3HJWC 1X7PA 1E7KA 2ALEA 3PLAC 3CCJF 3V7EA 1K8AH 1VQKF 3CMAF 3NVIB 3IR9A 3LWVC 3RA6A 2KTVA 2LBWA 1X7OA 3LWPC 2KTUA 1M1KH 1YJNF 3CC7F 1DT9A 1VQMF 1S72F 1W2BF 1GZ0A 3J7AR 2WALA 3G6EF 3CCSF 1K9MH 1VQ9F 1YHQF 2QI2A 5GANK 1YIJF 1VQ5F 3ON1A 3CPQA 3V7QA 3NVKE 3NK6A 1QVGF 1K73H 2FC3A 3AGKA 5EO3A 3J81M 1RA4A 2LBXA 3NK7A 3CC2F 3CCLF 3I55F 3VI6A 2I6DA 3G4SF 1QVFF 5GINC 5G4UC 1GO0A 3FFMA 3PAFA 5IT9M 1M90H 2VGMA 5EWRA 2JNBA 4TZZA 1CN7A 1W3EX 1Q82H 2OHWA 3O85A 5GIOC 1YJ9F 3HAXD 2HVYD 3VMFB 4NUTA 3JCMM 3RA5A 1VQNF 4C4WC 3CCVF 1ZWZA 1CK2A 3GYQA 2CZWA 3J80M 3MCAB 3CXCF 3CG6A 5GAPK 1VQPF 1RLGA 1PXWA 3CPWF 1KD1H 1VQ8F 4X3MA 3CC4F 3LFOA 1YITF 3G71F 1KQSF 1VQ4F 3N4ZA 1VQOF 3N4YA 2VGNA 3JAMM 3CCRF 1H7MA 3LWRC 5FLXM 3WXMB 3E1YA
chains in the Genus database with same CATH superfamily
2BTOA 3VCZA 5JQGA 2QA4F 1W57A 4BT4A 4I55B 5GONB 3HKBB 1IPAA 2OZBA 3D01A 4E6EA 1GX1A 3QHDA 5EZYA 3QTYA 1Q8RA 2HS3A 3RYHB 1W5BA 3E20B 2AIFA 3S0WA 1N8RH 1T0KB 3CCEF 3GTZA 1W42A 4BW0B 3LWOC 1W41A 3ZP7A 4O4HB 3CD6F 4BY9D 3C9TA 3LWQC 3P0ZA 3CMEF 5LOVB 3SIUA 3WGMA 4IHJB 5A2QM 2VAWA 5AVMA 4HNAB 1IV2A 2BTUA 3S02A 2Z1FA 5LOVA 1X7PA 3V7EA 3C9UA 3CCJF 3C9RA 1K8AH 3P10A 1IV3A 4TV9B 1TUBA 3D54A 1VHAA 3RA6A 2ZODA 4ZHYB 2LBWA 4O4IB 1FSZA 1QU9A 3WPWA 1UI9A 5LP6B 3F0GA 3CC7F 1GZ0A 3HKEB 4B62A 3KHNA 4I55A 5GONA 4ZOLB 3RYIB 4C8EA 4YJ3B 5HXZA 1YIJF 1VQ9F 5CA0A 3S0HA 5EIBC 4DRXB 5LA6B 1DBFA 1VQ5F 1YQNA 3ON1A 4EB6B 3CPQA 5JQGB 4ZI7B 4G88A 3HKDA 5KMGA 3U0OA 1RQ2A 5ITZA 1VH8A 2LBXA 3NK7A 3JATA 2LCAA 4U3JB 4FFBA 3K0TA 1J7HA 3JAKA 1QVFF 5G4UC 3PAFA 5IT9M 1KNJA 3UT5A 4X1YB 3MDOA 2JNBA 5JVDB 1Q82H 3O85A 2HRUA 3S06A 4TV8B 2N48A 5CB4A 1TVKB 4NWOB 1JFFA 4O4LB 4BT2A 4I50A 1VQPF 1PXWA 5HP7A 5HY4A 5IJ9B 2HP0A 3HKCB 3JALA 1FFXB 3N4ZA 4IIJA 2HS4A 2PMPA 3K2XA 3LYBA 3ESJA 5J2UA 3F0EA 2R6R1 3IMPA 1Z5WA 2VGNA 2RHHA 4EI8A 3RYIA 2GVIA 4IIJB 3LWRC 3JAKB 1W5EA 4BT7A 4EI9A 5IJ0A 2H8CA 2UZHA 2KGWA 1Q81H 3CCMF 3WGJA 4ZHVA 3WGLA 3RYCA 5HY2A 1VQVA 2QEXF 1SDSA 4X3LA 1KC8H 3CCUF 5LXTA 2HRYA 1VQLF 4LNUB 3CCQF 2CVLA 1IV1A 3VIUA 1Q86H 4EB6A 3WGKA 4ZHQA 1YI2F 2BO1A 3LDTA 3OBYA 4O4HA 5FNVA 1XRGA 1H47A 5GIPC 4G4YA 4YJ2A 3WPXA 1Q7YH 2RB9A 1X52A 2ZVZA 4F6RA 3BYQA 5CA1A 2H6LA 3E22A 4WBNA 3F6MA 4U39A 2Z1TA 3HJWC 3C9SA 3N2GA 1R1MA 3B6NA 2ALEA 4WBNB 3PLAC 3IEWA 4X1KA 2CW4A 5HP8A 2OTMA 4O2AB 2R751 3ELCA 5LP6C 3VO8A 5EB1B 5IYZA 3NVIB 1SZQA 1FNJA 3JASA 1JY8A 1X7OA 3LWPC 1OFUA 1M1KH 2Z1EA 5B8FA 5CB4B 1XHOA 2VXYA 3K12A 3G6EF 3CCSF 1K9MH 1U3LA 4RHAA 4BVSA 5GANK 5CA1B 4X1IA 1U40A 2Q1YA 4KWEA 2RHLA 3V7QA 4HNAA 3NVKE 2DYYA 3TD3A 2UYJA 4ZK7A 2RHJA 3KE1A 1QVGF 2QTPA 3EORA 2YXZA 3AGKA 5JH7A 2CHSA 2W8BC 3R0PA 4G4ZA 3QUWA 2HQSC 3CCLF 3VI6A 3VOAA 3G4SF 1GO0A 1M90H 1W581 2NMUA 2HX0A 2ZOVA 3V4DA 4I50B 1YJ9F 4BT3A 5GIOC 2PHNA 2G9IA 3HAXD 1RQ7A 4NUTA 3RA5A 1VQNF 3VOBA 3CCVF 1ZWZA 1Z5VA 3GYQA 4BVQA 3J80M 3MCAB 3N2KB 3CXCF 3CPWF 2K1SA 1VQ8F 2IG8A 2Q1XA 1KQSF 3G71F 3JAWA 4PWTA 2HP3A 4X1KB 2EWCA 3HKBA 3E22B 3N4YA 5KMGB 1TVKA 3RYHA 3CCRF 1VQMF 5FLXM 3E1YA 1XBIA 1W40A 5MN6A 5LA6A 3NMUC 3TD5A 5BMVB 4YJ3A 4ZHQB 2B33A 1VQ7F 5MN4A 3DC2A 4I4TB 5LYJB 1GO1A 3RYFA 1YJWF 1W55A 5JCOC 1H48A 3HTNA 3N2KA 1NMUB 3P4EA 4X20B 4M8IA 5J2TA 3ERNA 3I56F 2MQEA 5C8YA 5JCOA 3FD5A 3D00A 3HKCA 3JALB 5G4VC 1JJ2F 3DDNA 2UYNA 1XV2A 4TV9A 3CB2A 3KJJA 1ODEA 4G4XA 3V3TA 5IYZB 1ONIA 1W5FA 4X1IB 2KG4A 2ZF8A 1E7KA 2CHTA 3KIZA 4EI7A 3CMAF 5EIBD 3JARB 4O4JB 3LWVC 2FGYA 2KTVA 1NQ3A 1VK3A 3I3FA 3T80A 2P6YA 2KTUA 4DXDA 1OAPA 4BT6A 2CSLA 1YJNF 1S72F 5IJ0B 3OONA 3J7AR 2WALA 4BVTA 4C81A 3S03A 2VAPA 4C8IA 3M1XA 4B5CA 2ZVYA 2Z01A 3MCQA 2UYKA 5J2TB 3M4SA 3IKFA 1K73H 2FC3A 1JN1A 3ZOPA 4O4IA 5EO3A 1SA0A 4O4LA 1JFFB 3M84A 1RA4A 4ZOLA 4O4JA 3I55F 4TV8A 2I6DA 1TUBB 5GINC 5KX5B 3FFMA 5BMVA 3ZO8A 1IV4A 1CN7A 3RE3A 5EYPB 1X25A 1FFXA 4IHJA 4BT5A 2BTQB 3CYQA 3KJKA 1RLGA 2H8EA 2L26A 2DT4A 3LFOA 1YITF 3I7TA 1VQ4F 4ZI7A 2HS0A 3RYCB 5LP6A 4X20A 3F0FA 1VQOF 5FNVB 3UT5B 5JH7B 5JVDA 1U43A 1H7MA 1RLUA 4LNUA 3F0DA 2RHOA 4FFBB 4C82A 2GLZA 3WJPA 3WJQA 3VYUC 3FD6A 4ZHWA 2AMTA 3VYSC 2VAMA 3SIVA 2OTJF 3WJRA 3LMEA 1NJIH 4LCKA 1VQ6F 2HP0B 3MBMA 3OW2F 3CYPB 3FBAA 4TUYA 2OTLF 1UFYA 4G4WA 1W59A 5EZYB 4I4TA 3HKEA 1PF5A 3MQWA 4O2BA 4U3JA 2AIZP 1SA0B 3TD4A 5EAZA 5J2UB 5DCVA 2V9YA 3JVHA 4X1YA 3OBWA 1QAHA 3RYFB 5EB0A 5FJ4C 3JARA 5C8YB 2IQQA 5EYPA 3VTIC 3ZP4A 3JASB 5ITZB 4B45A 1VQKF 4C8GA 4XCQA 3FPIA 3JAWB 3Q8HA 4YJ2B 1YGYA 3IR9A 5KX5A 4G4VA 3N2GB 3HWUA 4DRXA 5CA0B 1DT9A 2ZAUA 1W2BF 3S0YA 1YHQF 5MN5A 2QI2A 2I6RA 2UYPA 4F6RB 3IEQA 5LYJA 5HWEA 2Z1UA 3NK6A 1T0AA 1COMA 2CWJA 1FNKA 2F9ZC 3J81M 4TUYB 3GHZA 2UYNB 5HXUA 3CC2F 2IAFA 4O2AA 1CLIA 3WGNA 5IJ9A 2VGMA 5EWRA 5HY1A 4TZZA 4R40B 1W3EX 1KNKA 2OHWA 1U3PA 2HVYD 3VMFB 4BVRA 3JCMM 4NQ3A 4C4WC 3L7QA 1CK2A 2CZWA 4ERHA 4B46A 1QD9A 3CG6A 5GAPK 3C8LA 3K14A 1KD1H 3CC4F 4X3MA 2LBTA 1W5AA 3JATB 2YYEA 3VYTC 1JD1A 3HKDB 4RQOA 5HY0A 3JAMM 2GZLA 4O2BB 5LXTB 3WXMB 3IKEA
chains in the Genus database with same CATH topology
4EI9A 1XBIA 1W40A 2GLZA 3NMUC 2QA4F 1Q81H 3CCMF 1VQ7F 1IPAA 5HY2A 2QEXF 1SDSA 4X3LA 1KC8H 2OZBA 3SIVA 3CCUF 2OTJF 1NJIH 1VQLF 4LCKA 1GO1A 3CCQF 1VQ6F 3OW2F 1Q86H 2OTLF 1YJWF 1YI2F 2BO1A 1NMUB 3OBYA 3E20B 2AIFA 1N8RH 3I56F 1T0KB 3CCEF 1W42A 3D00A 4BW0B 5G4VC 3LWOC 1JJ2F 5GIPC 1W41A 1Q7YH 1X52A 3CD6F 4BY9D 3SIUA 3LWQC 3CMEF 5DCVA 3OBWA 5A2QM 5FJ4C 3V3TA 2KG4A 3HJWC 1X7PA 1E7KA 2ALEA 3PLAC 3CCJF 3V7EA 1K8AH 1VQKF 4EI7A 4XCQA 3CMAF 3NVIB 3IR9A 3LWVC 2FGYA 3RA6A 2KTVA 2LBWA 1X7OA 3LWPC 2KTUA 1M1KH 1YJNF 3CC7F 1DT9A 1VQMF 1S72F 1W2BF 1GZ0A 3J7AR 2WALA 3G6EF 3CCSF 1K9MH 4BVTA 1VQ9F 5HXZA 4BVSA 1YHQF 2QI2A 5GANK 1YIJF 1VQ5F 3ON1A 3CPQA 5HWEA 3V7QA 3NVKE 3NK6A 1QVGF 1K73H 2FC3A 3AGKA 2F9ZC 5EO3A 3J81M 1RA4A 2LBXA 3NK7A 5HXUA 3CC2F 3CCLF 3VI6A 3I55F 2I6DA 3G4SF 1QVFF 5GINC 5G4UC 1GO0A 3FFMA 3PAFA 5IT9M 1M90H 2VGMA 5EWRA 2JNBA 5HY1A 4TZZA 1CN7A 1W3EX 1Q82H 2OHWA 3O85A 5GIOC 1YJ9F 3HAXD 2HVYD 3VMFB 4BVRA 4NUTA 3JCMM 4NQ3A 3RA5A 1VQNF 4C4WC 3CCVF 1ZWZA 1CK2A 3GYQA 4BVQA 2CZWA 3J80M 3MCAB 3CXCF 3CG6A 5GAPK 1VQPF 1RLGA 1PXWA 3CPWF 1KD1H 1VQ8F 4X3MA 5HY4A 3CC4F 3LFOA 1YITF 3G71F 1KQSF 1VQ4F 3N4ZA 1VQOF 3N4YA 2VGNA 4EI8A 5HY0A 3JAMM 1H7MA 3CCRF 3LWRC 5FLXM 3WXMB 3E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBI A;  1W40 A;  3NMU C;  2QA4 F;  1Q81 H;  3CCM F;  1VQ7 F;  1IPA A;  1SDS A;  2QEX F;  2OZB A;  4X3L A;  1KC8 H;  3SIV A;  2OTJ F;  3CCU F;  1NJI H;  1VQL F;  4LCK A;  1GO1 A;  3CCQ F;  1VQ6 F;  3OW2 F;  1Q86 H;  2OTL F;  1YJW F;  1YI2 F;  2BO1 A;  1NMU B;  3OBY A;  3E20 B;  2AIF A;  1N8R H;  3I56 F;  1T0K B;  3CCE F;  1W42 A;  4BW0 B;  3LWO C;  5G4V C;  1JJ2 F;  5GIP C;  1W41 A;  1Q7Y H;  1X52 A;  3CD6 F;  4BY9 D;  3SIU A;  3LWQ C;  3CME F;  5DCV A;  3OBW A;  5A2Q M;  5FJ4 C;  2KG4 A;  3HJW C;  1X7P A;  1E7K A;  2ALE A;  3PLA C;  3CCJ F;  3V7E A;  1K8A H;  1VQK F;  3CMA F;  3NVI B;  3IR9 A;  3LWV C;  3RA6 A;  2KTV A;  2LBW A;  1X7O A;  3LWP C;  2KTU A;  1M1K H;  1YJN F;  3CC7 F;  1DT9 A;  1VQM F;  1S72 F;  1W2B F;  1GZ0 A;  3J7A R;  2WAL A;  3G6E F;  3CCS F;  1K9M H;  1VQ9 F;  1YHQ F;  2QI2 A;  5GAN K;  1YIJ F;  1VQ5 F;  3ON1 A;  3CPQ A;  3V7Q A;  3NVK E;  3NK6 A;  1QVG F;  1K73 H;  2FC3 A;  3AGK A;  5EO3 A;  3J81 M;  1RA4 A;  2LBX A;  3NK7 A;  3CC2 F;  3CCL F;  3I55 F;  3VI6 A;  2I6D A;  3G4S F;  1QVF F;  5GIN C;  5G4U C;  1GO0 A;  3FFM A;  3PAF A;  5IT9 M;  1M90 H;  2VGM A;  5EWR A;  2JNB A;  4TZZ A;  1CN7 A;  1W3E X;  1Q82 H;  2OHW A;  3O85 A;  5GIO C;  1YJ9 F;  3HAX D;  2HVY D;  3VMF B;  4NUT A;  3JCM M;  3RA5 A;  1VQN F;  4C4W C;  3CCV F;  1ZWZ A;  1CK2 A;  3GYQ A;  2CZW A;  3J80 M;  3MCA B;  3CXC F;  3CG6 A;  5GAP K;  1VQP F;  1RLG A;  1PXW A;  3CPW F;  1KD1 H;  1VQ8 F;  4X3M A;  3CC4 F;  3LFO A;  1YIT F;  3G71 F;  1KQS F;  1VQ4 F;  3N4Z A;  1VQO F;  3N4Y A;  2VGN A;  3JAM M;  3CCR F;  1H7M A;  3LWR C;  5FLX M;  3WXM B;  3E1Y A; 
#chains in the Genus database with same CATH topology
 2BTO A;  3VCZ A;  5JQG A;  2QA4 F;  1W57 A;  4BT4 A;  4I55 B;  5GON B;  3HKB B;  1IPA A;  2OZB A;  3D01 A;  4E6E A;  1GX1 A;  3QHD A;  5EZY A;  3QTY A;  1Q8R A;  2HS3 A;  3RYH B;  1W5B A;  3E20 B;  2AIF A;  3S0W A;  1N8R H;  1T0K B;  3CCE F;  3GTZ A;  1W42 A;  4BW0 B;  3LWO C;  1W41 A;  3ZP7 A;  4O4H B;  3CD6 F;  4BY9 D;  3C9T A;  3LWQ C;  3P0Z A;  3CME F;  5LOV B;  3SIU A;  3WGM A;  4IHJ B;  5A2Q M;  2VAW A;  5AVM A;  4HNA B;  1IV2 A;  2BTU A;  3S02 A;  2Z1F A;  5LOV A;  1X7P A;  3V7E A;  3C9U A;  3CCJ F;  3C9R A;  1K8A H;  3P10 A;  1IV3 A;  4TV9 B;  1TUB A;  3D54 A;  1VHA A;  3RA6 A;  2ZOD A;  4ZHY B;  2LBW A;  4O4I B;  1FSZ A;  1QU9 A;  3WPW A;  1UI9 A;  5LP6 B;  3F0G A;  3CC7 F;  1GZ0 A;  3HKE B;  4B62 A;  3KHN A;  4I55 A;  5GON A;  4ZOL B;  3RYI B;  4C8E A;  4YJ3 B;  5HXZ A;  1YIJ F;  1VQ9 F;  5CA0 A;  3S0H A;  5EIB C;  4DRX B;  5LA6 B;  1DBF A;  1VQ5 F;  1YQN A;  3ON1 A;  4EB6 B;  3CPQ A;  5JQG B;  4ZI7 B;  4G88 A;  3HKD A;  5KMG A;  3U0O A;  1RQ2 A;  5ITZ A;  1VH8 A;  2LBX A;  3NK7 A;  3JAT A;  2LCA A;  4U3J B;  4FFB A;  3K0T A;  1J7H A;  3JAK A;  1QVF F;  5G4U C;  3PAF A;  5IT9 M;  1KNJ A;  3UT5 A;  4X1Y B;  3MDO A;  2JNB A;  5JVD B;  1Q82 H;  3O85 A;  2HRU A;  3S06 A;  4TV8 B;  2N48 A;  5CB4 A;  1TVK B;  4NWO B;  1JFF A;  4O4L B;  4BT2 A;  4I50 A;  1VQP F;  1PXW A;  5HP7 A;  5HY4 A;  5IJ9 B;  2HP0 A;  3HKC B;  3JAL A;  1FFX B;  3N4Z A;  4IIJ A;  2HS4 A;  2PMP A;  3K2X A;  3LYB A;  3ESJ A;  5J2U A;  3F0E A;  2R6R 1;  3IMP A;  1Z5W A;  2VGN A;  2RHH A;  4EI8 A;  3RYI A;  2GVI A;  4IIJ B;  3LWR C;  3JAK B;  1W5E A;  4BT7 A;  4EI9 A;  5IJ0 A;  2H8C A;  2UZH A;  2KGW A;  1Q81 H;  3CCM F;  3WGJ A;  4ZHV A;  3WGL A;  3RYC A;  5HY2 A;  1VQV A;  2QEX F;  1SDS A;  4X3L A;  1KC8 H;  3CCU F;  5LXT A;  2HRY A;  1VQL F;  4LNU B;  3CCQ F;  2CVL A;  1IV1 A;  3VIU A;  1Q86 H;  4EB6 A;  3WGK A;  4ZHQ A;  1YI2 F;  2BO1 A;  3LDT A;  3OBY A;  4O4H A;  5FNV A;  1XRG A;  1H47 A;  5GIP C;  4G4Y A;  4YJ2 A;  3WPX A;  1Q7Y H;  2RB9 A;  1X52 A;  2ZVZ A;  4F6R A;  3BYQ A;  5CA1 A;  2H6L A;  3E22 A;  4WBN A;  3F6M A;  4U39 A;  2Z1T A;  3HJW C;  3C9S A;  3N2G A;  1R1M A;  3B6N A;  2ALE A;  4WBN B;  3PLA C;  3IEW A;  4X1K A;  2CW4 A;  5HP8 A;  2OTM A;  4O2A B;  2R75 1;  3ELC A;  5LP6 C;  3VO8 A;  5EB1 B;  5IYZ A;  3NVI B;  1SZQ A;  1FNJ A;  3JAS A;  1JY8 A;  1X7O A;  3LWP C;  1OFU A;  1M1K H;  2Z1E A;  5B8F A;  5CB4 B;  1XHO A;  2VXY A;  3K12 A;  3G6E F;  3CCS F;  1K9M H;  1U3L A;  4RHA A;  4BVS A;  5GAN K;  5CA1 B;  4X1I A;  1U40 A;  2Q1Y A;  4KWE A;  2RHL A;  3V7Q A;  4HNA A;  3NVK E;  2DYY A;  3TD3 A;  2UYJ A;  4ZK7 A;  2RHJ A;  3KE1 A;  1QVG F;  2QTP A;  3EOR A;  2YXZ A;  3AGK A;  5JH7 A;  2CHS A;  2W8B C;  3R0P A;  4G4Z A;  3QUW A;  2HQS C;  3CCL F;  3VI6 A;  3VOA A;  3G4S F;  1GO0 A;  1M90 H;  1W58 1;  2NMU A;  2HX0 A;  2ZOV A;  3V4D A;  4I50 B;  1YJ9 F;  4BT3 A;  5GIO C;  2PHN A;  2G9I A;  3HAX D;  1RQ7 A;  4NUT A;  3RA5 A;  1VQN F;  3VOB A;  3CCV F;  1ZWZ A;  1Z5V A;  3GYQ A;  4BVQ A;  3J80 M;  3MCA B;  3N2K B;  3CXC F;  3CPW F;  2K1S A;  1VQ8 F;  2IG8 A;  2Q1X A;  1KQS F;  3G71 F;  3JAW A;  4PWT A;  2HP3 A;  4X1K B;  2EWC A;  3HKB A;  3E22 B;  3N4Y A;  5KMG B;  1TVK A;  3RYH A;  3CCR F;  1VQM F;  5FLX M;  3E1Y A;  1XBI A;  1W40 A;  5MN6 A;  5LA6 A;  3NMU C;  3TD5 A;  5BMV B;  4YJ3 A;  4ZHQ B;  2B33 A;  1VQ7 F;  5MN4 A;  3DC2 A;  4I4T B;  5LYJ B;  1GO1 A;  3RYF A;  1YJW F;  1W55 A;  5JCO C;  1H48 A;  3HTN A;  3N2K A;  1NMU B;  3P4E A;  4X20 B;  4M8I A;  5J2T A;  3ERN A;  3I56 F;  2MQE A;  5C8Y A;  5JCO A;  3FD5 A;  3D00 A;  3HKC A;  3JAL B;  5G4V C;  1JJ2 F;  3DDN A;  2UYN A;  1XV2 A;  4TV9 A;  3CB2 A;  3KJJ A;  1ODE A;  4G4X A;  3V3T A;  5IYZ B;  1ONI A;  1W5F A;  4X1I B;  2KG4 A;  2ZF8 A;  1E7K A;  2CHT A;  3KIZ A;  4EI7 A;  3CMA F;  5EIB D;  3JAR B;  4O4J B;  3LWV C;  2FGY A;  2KTV A;  1NQ3 A;  1VK3 A;  3I3F A;  3T80 A;  2P6Y A;  2KTU A;  4DXD A;  1OAP A;  4BT6 A;  2CSL A;  1YJN F;  1S72 F;  5IJ0 B;  3OON A;  3J7A R;  2WAL A;  4BVT A;  4C81 A;  3S03 A;  2VAP A;  4C8I A;  3M1X A;  4B5C A;  2ZVY A;  2Z01 A;  3MCQ A;  2UYK A;  5J2T B;  3M4S A;  3IKF A;  1K73 H;  2FC3 A;  1JN1 A;  3ZOP A;  4O4I A;  5EO3 A;  1SA0 A;  4O4L A;  1JFF B;  3M84 A;  1RA4 A;  4ZOL A;  4O4J A;  3I55 F;  4TV8 A;  2I6D A;  1TUB B;  5GIN C;  5KX5 B;  3FFM A;  5BMV A;  3ZO8 A;  1IV4 A;  1CN7 A;  3RE3 A;  5EYP B;  1X25 A;  1FFX A;  4IHJ A;  4BT5 A;  2BTQ B;  3CYQ A;  3KJK A;  1RLG A;  2H8E A;  2L26 A;  2DT4 A;  3LFO A;  1YIT F;  3I7T A;  1VQ4 F;  4ZI7 A;  2HS0 A;  3RYC B;  5LP6 A;  4X20 A;  3F0F A;  1VQO F;  5FNV B;  3UT5 B;  5JH7 B;  5JVD A;  1U43 A;  1H7M A;  1RLU A;  4LNU A;  3F0D A;  2RHO A;  4FFB B;  4C82 A;  2GLZ A;  3WJP A;  3WJQ A;  3VYU C;  3FD6 A;  4ZHW A;  2AMT A;  3VYS C;  2VAM A;  3SIV A;  2OTJ F;  3WJR A;  3LME A;  1NJI H;  4LCK A;  1VQ6 F;  2HP0 B;  3MBM A;  3OW2 F;  3CYP B;  3FBA A;  4TUY A;  2OTL F;  1UFY A;  4G4W A;  1W59 A;  5EZY B;  4I4T A;  3HKE A;  1PF5 A;  3MQW A;  4O2B A;  4U3J A;  2AIZ P;  1SA0 B;  3TD4 A;  5EAZ A;  5J2U B;  5DCV A;  2V9Y A;  3JVH A;  4X1Y A;  3OBW A;  1QAH A;  3RYF B;  5EB0 A;  5FJ4 C;  3JAR A;  5C8Y B;  2IQQ A;  5EYP A;  3VTI C;  3ZP4 A;  3JAS B;  5ITZ B;  4B45 A;  1VQK F;  4C8G A;  4XCQ A;  3FPI A;  3JAW B;  3Q8H A;  4YJ2 B;  1YGY A;  3IR9 A;  5KX5 A;  4G4V A;  3N2G B;  3HWU A;  4DRX A;  5CA0 B;  1DT9 A;  2ZAU A;  1W2B F;  3S0Y A;  1YHQ F;  5MN5 A;  2QI2 A;  2I6R A;  2UYP A;  4F6R B;  3IEQ A;  5LYJ A;  5HWE A;  2Z1U A;  3NK6 A;  1T0A A;  1COM A;  2CWJ A;  1FNK A;  2F9Z C;  3J81 M;  4TUY B;  3GHZ A;  2UYN B;  5HXU A;  3CC2 F;  2IAF A;  4O2A A;  1CLI A;  3WGN A;  5IJ9 A;  2VGM A;  5EWR A;  5HY1 A;  4TZZ A;  4R40 B;  1W3E X;  1KNK A;  2OHW A;  1U3P A;  2HVY D;  3VMF B;  4BVR A;  3JCM M;  4NQ3 A;  4C4W C;  3L7Q A;  1CK2 A;  2CZW A;  4ERH A;  4B46 A;  1QD9 A;  3CG6 A;  5GAP K;  3C8L A;  3K14 A;  1KD1 H;  3CC4 F;  4X3M A;  2LBT A;  1W5A A;  3JAT B;  2YYE A;  3VYT C;  1JD1 A;  3HKD B;  4RQO A;  5HY0 A;  3JAM M;  2GZL A;  4O2B B;  5LXT B;  3WXM B;  3IKE A; 
#chains in the Genus database with same CATH homology
 4EI9 A;  1XBI A;  1W40 A;  2GLZ A;  3NMU C;  2QA4 F;  1Q81 H;  3CCM F;  1VQ7 F;  1IPA A;  5HY2 A;  2QEX F;  1SDS A;  4X3L A;  1KC8 H;  2OZB A;  3SIV A;  3CCU F;  2OTJ F;  1NJI H;  1VQL F;  4LCK A;  1GO1 A;  3CCQ F;  1VQ6 F;  3OW2 F;  1Q86 H;  2OTL F;  1YJW F;  1YI2 F;  2BO1 A;  1NMU B;  3OBY A;  3E20 B;  2AIF A;  1N8R H;  3I56 F;  1T0K B;  3CCE F;  1W42 A;  3D00 A;  4BW0 B;  5G4V C;  3LWO C;  1JJ2 F;  5GIP C;  1W41 A;  1Q7Y H;  1X52 A;  3CD6 F;  4BY9 D;  3SIU A;  3LWQ C;  3CME F;  5DCV A;  3OBW A;  5A2Q M;  5FJ4 C;  3V3T A;  2KG4 A;  3HJW C;  1X7P A;  1E7K A;  2ALE A;  3PLA C;  3CCJ F;  3V7E A;  1K8A H;  1VQK F;  4EI7 A;  4XCQ A;  3CMA F;  3NVI B;  3IR9 A;  3LWV C;  2FGY A;  3RA6 A;  2KTV A;  2LBW A;  1X7O A;  3LWP C;  2KTU A;  1M1K H;  1YJN F;  3CC7 F;  1DT9 A;  1VQM F;  1S72 F;  1W2B F;  1GZ0 A;  3J7A R;  2WAL A;  3G6E F;  3CCS F;  1K9M H;  4BVT A;  1VQ9 F;  5HXZ A;  4BVS A;  1YHQ F;  2QI2 A;  5GAN K;  1YIJ F;  1VQ5 F;  3ON1 A;  3CPQ A;  5HWE A;  3V7Q A;  3NVK E;  3NK6 A;  1QVG F;  1K73 H;  2FC3 A;  3AGK A;  2F9Z C;  5EO3 A;  3J81 M;  1RA4 A;  2LBX A;  3NK7 A;  5HXU A;  3CC2 F;  3CCL F;  3VI6 A;  3I55 F;  2I6D A;  3G4S F;  1QVF F;  5GIN C;  5G4U C;  1GO0 A;  3FFM A;  3PAF A;  5IT9 M;  1M90 H;  2VGM A;  5EWR A;  2JNB A;  5HY1 A;  4TZZ A;  1CN7 A;  1W3E X;  1Q82 H;  2OHW A;  3O85 A;  5GIO C;  1YJ9 F;  3HAX D;  2HVY D;  3VMF B;  4BVR A;  4NUT A;  3JCM M;  4NQ3 A;  3RA5 A;  1VQN F;  4C4W C;  3CCV F;  1ZWZ A;  1CK2 A;  3GYQ A;  4BVQ A;  2CZW A;  3J80 M;  3MCA B;  3CXC F;  3CG6 A;  5GAP K;  1VQP F;  1RLG A;  1PXW A;  3CPW F;  1KD1 H;  1VQ8 F;  4X3M A;  5HY4 A;  3CC4 F;  3LFO A;  1YIT F;  3G71 F;  1KQS F;  1VQ4 F;  3N4Z A;  1VQO F;  3N4Y A;  2VGN A;  4EI8 A;  5HY0 A;  3JAM M;  1H7M A;  3CCR F;  3LWR C;  5FLX M;  3WXM B;  3E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...