3VOBA

Staphylococcus aureus ftsz with pc190723
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle/inhibitor
total genus 105
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3vobA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vobA01
4X20B 1RLUA 4O4HB 1SA0B 2VAMA 4ZOLA 2RHHA 3JAKB 4TUYA 4EI8A 3V3TA 4XCQA 3VPAA 4O4JA 5IYZA 1W5FA 3JALA 2GVIA 3HKDA 1RQ2A 4IHJB 4IIJB 3WGJA 3VO8A 2XKAA 3ZBQA 5GONB 5ITZB 5LP6A 3RYHB 4WBNA 1Z5VA 4TV9B 4X1IA 5FNVB 1TVKA 3VOBA 4DRXB 5JCOC 4LNUB 3ZBPA 5IJ0A 2R6R1 4O4IA 4ZOLB 3N2KA 3ZIDA 4TUYB 4U39A 5LOVA 4X1KA 4O4JB 5IYZB 1RQ7A 2Q1XA 3JALB 3HKDB 3UT5A 3R4VA 4U3JA 5EIBC 3JATA 2XKBA 5LP6B 5EIBD 5JH7A 4WBNB 4X1IB 5MN6A 1W5AA 1TVKB 4HNAA 3M8KA 5JCOA 5MN4A 1FFXA 2RHLA 1JFFA 3WGNA 1TUBA 5IJ0B 4O4IB 3N2KB 3WGLA 5J2TA 5LOVB 4X1KB 3WGMA 5EYPA 4EB6A 5KMGA 3RYCA 3UT5B 4DXDA 4ZHQA 4U3JB 3JATB 5CB4A 5JH7B 4O2AA 2RHJA 5J2UA 4HNAB 1FFXB 1JFFB 1TUBB 3HKBA 3JASA 5M7EA 3JARA 2BTOA 5J2TB 4EI7A 3CB2A 5EYPB 2R751 4EB6B 5KMGB 4YJ3A 3M89A 4X1YA 5JVDA 3RYCB 3C8LA 4ZHQB 5CA0A 5LXTB 5CB4B 3HKCA 3WGKA 4I50A 4O2AB 5J2UB 5LA6A 2VAWA 4B45A 3RYFA 5LP6C 3HKBB 3JASB 3JARB 4I55A 5LXTA 2Q1YA 2VXYA 3RB8A 5CA1A 5KX5A 4YJ3B 5EZYA 4X1YB 1W5BA 4O2BA 5JVDB 4F6RA 4M8IA 1W59A 5JQGA 4I4TA 5CA0B 4FFBA 1W581 1W5EA 5C8YA 3HKCB 3N2GA 4O4LA 4ZI7A 5LYJB 4B46A 2BTQA 4YJ2A 3JAWA 4I50B 4TV8B 3E22A 3RYIA 5LA6B 2RHOA 3VO9A 5BMVA 5IJ9A 4EI9A 1OFUA 3RYFB 4E6EA 3HKEA 4X20A 4O4HA 4I55B 1SA0A 1Z5WA 3JAKA 2VAPA 5LYJA 5CA1B 5KX5B 4TV8A 5EZYB 5JQGB 4F6RB 4O2BB 5MN5A 4IHJA 1FSZA 4I4TB 4FFBB 4IIJA 4KWEA 5C8YB 3N2GB 4O4LB 4ZI7B 2BTQB 5GONA 5ITZA 4YJ2B 3JAWB 3E22B 3RYHA 3RYIB 4TV9A 5FNVA 3VOAA 4DRXA 5BMVB 5IJ9B 4LNUA 3HKEB
chains in the Genus database with same CATH superfamily
4X20B 3AEUA 4NU0A 4Y2UA 1RYNA 5G53C 1BSVA 5THKA 4KH0A 1X2BA 3R8CA 3SHVA 3AKEA 3ZU5A 3TMYA 3WYGA 3OOYA 3Q7TA 3IUSA 1A9QA 2CB9A 1L3CA 3ME5A 3JVEA 3NAQA 3ICVA 4XD7A 1FDSA 4YN3A 3ZDEA 3SQWA 1CY4A 3OUTA 3HB4X 5DBHX 2WIGA 1HNWB 1PI3A 1TT5A 3PICA 1C3LA 4J0IA 4L9SA 1LLQA 2K2WA 3LFUA 5TV2A 5ETJA 4F8YA 4ENQA 1JHPA 3WK7A 2OUIA 1TIPA 1GWNA 2QRJA 1FJHA 4MLCA 4RPHA 1OJLA 1FW6A 4HMPA 2ICAA 3EZGA 2FEAA 3PEFA 4AZ3B 4CFSA 1G98A 2YL2A 1ADYA 5SZHB 1ZX1A 4BMDA 1I6MA 1X7YA 4MR8B 4BP3A 5FADA 1K7FB 4LF8B 2W2XA 4JIMA 1NDQA 1VMDA 2Z2YA 4Q9JA 5E7JA 3FDZA 3SM9A 3V5NA 2Y1FA 5CFOA 2VSFA 1KNKA 3KSZO 4B7UA 3ZWWA 3D43A 3D6FA 1N78A 1V1JA 2IQQA 4E2WA 1JE0A 1XA0A 4I1VA 1UQTA 3D8BA 4IIFA 4AJNA 4UPVA 2Y77A 2CF5A 3EQ8A 3Q3HA 4MULA 4RNCA 1OGJA 4DDKA 4QM7A 4G0YA 1QTQA 1PL6A 4TLLB 3HY4A 3OAAD 3WRYC 3NNDA 3HEAA 4LYHA 1ZD1A 3LKDA 4MV7A 3S8YA 5EP3A 4EKEA 1NVUQ 1J00A 2ZYIA 1BU8A 1QQBA 1G2OA 1T5OA 4FKBA 4C4PA 2F7SA 5I9SA 4R1SA 1PJRA 1JR3D 1EIZA 1L5FA 2CXTA 1X25A 3IB6A 3K1AA 1FP1D 3QYJA 4KOAA 3WTCA 1G4UR 3ZZ1A 3UJ9A 3NM4A 4FQ7A 3KM0A 1Z4NA 4RD2A 2GPJA 4KVAA 3T5AA 2I54A 3HA7A 3E3LA 4M76B 3O47A 4RDCA 5EWJA 4V1CI 2RD2A 1U4OA 1E9RA 1DRUA 4DV7B 4O0LA 3JVIA 4PPYA 4U00A 2J0UB 1ST3A 3O2QB 2W2KA 4IWNA 4I50A 1T9BA 2FG5A 2BDTA 3NB0A 1I6LA 1CS4C 3LUBA 1NBHA 4UM5A 4MRSA 2ZULA 4GX5A 3MT0A 3NDJA 4QC2A 1TE2A 4JVOA 1F0NA 4K9DA 5DW3A 1UPXA 1CUWA 5HS6A 4EG5A 1FSSA 1NURA 2PGDA 4C78A 3OF5A 1GEEA 2ZJ6A 5H5JA 1WV0A 5C1BA 1W8IA 2DWOA 2OM6A 1BEEA 1WB9A 2YW9A 1K88A 3IR9A 2W0SA 2ZB8A 4D6XA 3C41J 2ZJ0A 2E0IA 1SBNE 1T8YA 4O59O 2BMEA 4HX5A 5HCUA 1JTFA 4AZ0A 4HUJA 4YUVA 4B0OA 1J2YA 3AUJB 5E2BA 1Z2NX 2DTXA 4AZWA 1M73E 2QNRA 4MX8A 3FWPA 4R9RA 1SAYA 4ZO7A 4B5LA 4Q4AA 1K7YA 5KYYA 3D2LA 3ETJA 2VZ9A 1EK1A 1G8PA 4Q47A 2J4DA 3HJAA 3AJRA 4MUGA 4ERNA 4ZVMA 2OOSA 4LYAA 3COPA 3ZDQA 3CYPB 2X8WA 4KV9A 4Q3AA 2GZHA 4ZU6X 3F0GA 1AXGA 1V7PC 3TW0A 3EWAA 3C6QA 3TD9A 4C81A 2WF8A 3V9PA 4D8YA 1MXFA 2HP0B 1X7HA 1M83A 2YASA 3KOWA 3Q1KA 3BHJA 1KOJA 4BX2A 3ST7A 1QZ3A 3PGXA 1ZG3A 1G8YA 1HC7A 3WK6A 3EZFA 3K0FB 4I1UA 4BBPA 2WPDD 1PG0A 4C2UA 2GKOA 2MOKA 2YV3A 2DFNA 3EW9A 3UWDA 3SSNA 4IQ4A 4NKRA 3S81A 4EHKA 4BNUA 4D45A 1Z0IA 2JD2A 4XUGB 2XDQB 1YC5A 1C9EA 2ERXA 1EXMA 1SQGA 2XD4A 4JXJA 3U40A 1GPYA 4OLHA 4EJSB 2D0PB 2ORVA 2J9ZB 2EF0A 4MVJP 4M0MA 3U4CA 1B0UA 1RHMA 2VFAA 5FNZA 4B81A 4LK3A 5EHQA 3ZCRA 1L5KA 4C7JA 5ALIA 3ROTA 3LNTA 3RS7A 1QKKA 2BMJA 1ZICA 4UTNA 5KYXA 3E6AA 4R8LA 1PT9A 2OD9A 2H18A 2HK6A 5GVSA 1T3HA 4X95A 3WZMA 1LA2A 2ZRIA 2PYZA 2GLTA 1KC3A 2CWWA 4KPFC 2O0KA 1XALA 1QWOA 1OC4A 3OKCA 4GL2A 1FYEA 2BSXA 1FDIA 2V58A 1PEYA 3F4KA 4J07A 4AKEA 2W22A 3M8KA 2DBYA 2X5NA 3L7AA 3RT7A 4PWTA 4G5HA 1LK0A 3EUFA 4F11A 3LHIA 4O4IB 1C2TA 2BGTA 3CG6A 2ZJYA 3PFKA 3MELA 4NNPA 4R1TA 4PN3A 1HF3A 3O4RA 4JBWA 1Y9EA 2EGUA 2OZVA 3K2EA 4NQ3A 1X8KA 2BKXA 1H1TA 2L42A 2ZK7A 4MKGA 4IYJA 5B8FA 3C5WP 4PCVA 1E4YA 2ZS9A 5FWYA 4LZJA 3DHYA 1II9A 1MAUA 2OA0A 3KKQA 4Q7KA 3UMRA 5ARDA 2LBTA 2WP8J 4MW2A 4AMYA 5HKKA 3R9WA 3PR1A 1DIHA 5M7EA 5KS2A 3JARA 1N33B 4FYJA 3SF0A 2JG3A 3D3KA 3GEBA 4Q7EA 5AKIA 3LP8A 1EX6A 1VLHA 4YCBA 4RLFA 3HGMA 5EJ5A 2CDBA 3ERNA 1VSBA 3N2NA 3VTIC 1LD3A 4AAYA 3L7QA 2WK1A 5JSKA 5A6SA 3K1YA 1PZHA 5TPWA 1BD4A 1QG6A 2ZBEA 3PPXA 4YXFA 2EFGA 4L74A 1T26A 1ZH6A 3U60B 1DVRA 2AOWA 1ISMA 1L7XA 2CXPA 3AKDA 3G1TA 5HUJA 3ZW7A 3CEJA 2XA2A 5KYKA 2YMMA 4DQXA 3BK7A 1ENPA 3KJKA 4CMIA 3ED1A 1JHRA 3PQ8A 3DZCA 5F52A 1GSHA 2P9EA 5FLXM 2DE0X 2YOHA 2F1OA 4K8RB 2D59A 2H4JA 5T64A 4B8ZA 3SYRA 1FNMA 4ZVNA 2Q7DA 1BCRB 1N5JA 2ARKA 1DARA 4HQRA 1M6VA 1J8VA 2HGZA 1H2EA 3UNXA 1RPJA 2AI1A 4UBKA 4EP1A 4YPVA 1G19A 4XGIA 1UR5A 4MQBA 4B84A 1IY1A 4RZ2A 4G9BA 5BQPA 2HUPA 2NTNA 2VGNA 4M1WA 1H3FA 4ZI3A 1MO2A 3QFHA 1N6KA 5AKYA 5U4XA 1UAYA 1PVDA 2WD9A 3D3EA 2A4MA 3RROA 2YIDA 5FI1B 4CJXA 4ZGGA 3RYIB 1M1XB 1SVOA 3NIBA 5BY2A 1WL8A 4FDVA 4Q6BA 4JN6B 5TMEA 3UQYS 4GR9A 3ASUA 5EQDA 4YRQA 1ISPA 1PJTA 2QTVB 4QOEA 3V3TA 4DV3B 1QPZA 3GDWA 3UB2A 2GJ9A 2AFIB 3EA0A 4UEQA 3HKDA 1D4OA 3AUTA 1YZLA 5HNKA 1ZGHA 2CJXA 2FK7A 3HJCA 4OB8A 3GQBA 3T3PB 4ECAA 5BN1A 4BWYA 4EENA 3TPZA 2NSJA 1U2RA 4P36A 3LW8A 1YS6A 4KSYA 1P1BA 2HLHA 4REOA 5T4HA 1EG7A 2JA1A 4TSKA 2B92A 3PVSA 2ZJBA 3OZEA 4O1HA 5TQVA 1A2KC 1EK2A 4QOJA 3L0DA 1A9PA 1ZC4A 4X1KA 1QOZA 2PXAA 3T1OA 2A2ZA 2J3KA 1U4NA 4ABTA 2FF5A 3FF4A 5AM1A 3U5TA 1LWOA 1UJBA 4GXNA 3HVHA 3FIJA 3AVUA 1ZOOA 1W5AA 4GZ6A 1PGQA 5CDUA 3FFMA 1NVKA 1EAYA 2ZLBA 4CKZA 2ZRCA 2HYDA 2YH2A 3FHTA 1LLDA 5E6UB 3AOGA 3DEJA 2P90A 1BAPA 4E4RA 4W9RA 2COKA 3AX6A 1GZSA 1CUSA 2YXPX 1Y8RB 2VDUE 3JWHA 5A05A 5BNTA 2XSZA 2ZWOA 2W71A 2XITA 2D2VA 4LRTB 2C97A 4TPKA 3TPFA 4FDMA 2MMCA 4FFPA 3PFNA 2QY6A 2HEGA 3DMTA 4LG1A 5K7SA 5BSWA 4PBSA 3FPKA 1DU4A 1G3IA 1HFWA 3E82A 3KXLA 3RS4A 3LZDA 4O6VA 1ILEA 2YIMA 4HQLA 4S2EA 5BORA 3S02A 5LQSA 2FZWA 3DHEA 1I4EB 3E3AA 4JQYA 3VMMA 1ISIA 4CLRB 2EIXA 3MGCA 3AY6A 3CLHA 4UM7A 5FH9A 4HNRA 4WGGA 2QP3A 1OI3A 4NYIQ 5EMKA 1X94A 4V03A 2CFIA 4LC9A 4NXMB 1CQWA 4D3FA 3VSBA 1QIHA 2CMDA 2VK1A 2XOEA 4RS3A 1PXWA 3I23A 1P2TA 3H86A 3KYJB 3RFVA 5DASA 3FJ1A 3RIHA 1VJTA 4NYJR 2PFKA 2YWXA 3CF4G 4P58A 4M49A 3M6AA 2LCQA 5K8VA 2R25B 3IDSA 2BT4A 4FFLA 4X1YB 3IH5A 2QM7A 5J59A 2FI1A 3VZBA 4NE2A 3RQIA 3ZE2B 1SXJA 2A5YB 2BLNA 3VYVA 3T9BA 2BFNA 2DY0A 2MHCA 2UYHA 9GPBA 3UJBA 1UWVA 4LXXA 1XMPA 3CZ5A 3RRJA 1IXZA 3FUTA 3ZGNA 2D7CA 1NT4A 2BEUA 2OM2A 3RBXA 5IM4F 1I2DA 1FYFA 4XR9A 3VA7A 2GPBA 5IJWA 1LF5A 3SZLA 1Z5WA 4OXNA 1ZUD1 4IIXA 1H2AS 2JFVA 3PPYA 1MO6A 4TMWA 1OIXA 2X14A 3RIMA 1KEWA 1DAGA 3QU5A 4WXYB 1OZ0A 1AO0A 1VCHA 3KE1A 1Z25A 4FUQA 3GFSA 4QX6A 3RTBA 3QF4B 1KK2A 5BN4B 1RYFA 4WNYA 1RJ9B 1T2AA 1RWXA 1Y4ZA 4KXQA 3GRFA 4DV4B 2EFJA 1MX3A 2I8CA 3MS4A 1Y6QA 2A1TS 3F0TA 1D4ZA 2CJWA 2WAXA 3BFPA 4OMCA 4PO3X 4S1VA 4U7FA 4CM5A 3PLAC 2ONYA 4DREA 3SXPA 4BVTA 2FPUA 2ZR0A 1XMQB 4QTXA 3M6XA 4PPGA 2FOLA 3KEFA 1GJRA 2GOYA 4I19A 2JFOA 5GONB 4NP6A 1RMYA 1NW4A 4BVLA 2Z9DA 4L08A 4YT2A 1Y8ZA 4C7OA 2QRZA 1YRAA 4X3LA 3CZ4A 5BSEA 4RKWA 2QD1A 4J0EA 1DOAA 1NBME 2VATA 4B1FA 2XZPA 1GPWB 5LP6F 3RRNA 2CCGA 1P2SA 2VQFB 1FNCA 4XGKA 3AHDA 1L4UA 3EBOA 1N4DA 4UHCA 5KINB 2YVQA 1IHPA 4QJIA 5JS7A 4TVKA 2QLMA 4K9QA 5DGCA 4BNWA 2I4MA 2R48A 3OFKA 2F1HA 4H6WA 3MSXA 3WA6A 1CEXA 3WJ2A 1HDRA 2H8GA 3AEQA 3JYNA 3V9AA 2JFFA 1XXHB 2DBRA 2VKTA 3LXRA 3NOOA 4RZHA 4NYMQ 1JI3A 3PNPA 4KGVA 5AW3A 5BV7A 3MJVA 5IXSA 1JHDA 2QTHA 4D9HA 1H5NA 2RG7A 4XEUA 3SD7A 3FGZA 4GMDA 5IDQA 5K2OA 1UC9A 3FUWA 2AXPA 1GNVA 1JLLA 2IELA 3D54A 1LF0A 1V11B 3AFNA 2BJVA 3R3UA 4YMHA 4ZJZA 4QSHA 2R4QA 1JYSA 3AVYA 2IOYA 5GMOA 2WOOA 1S72F 2YJNA 1GFSA 1NN5A 2CLMB 4LF6B 2WT8A 4MWBA 1VP9A 3GCWA 2FP4B 8OHMA 3BM5A 4MPDA 3WIBA 2VRCD 3FOEC 4P08A 4JWTA 3M1LA 4WXPA 1RACA 2YFQA 4HLUA 3RJ5A 8AT1A 4W1PA 4ZEOA 4ZCRA 2BGLA 4PPNA 5LQAA 5CITA 4XWTA 3BICA 5LFAA 3R7FA 1HYQA 1OLUB 5GM2A 3IIIA 4Q24A 1SOAA 1P1FA 1Q7BA 2B1RA 3OTHA 3Q0TA 2HD4A 4DDUA 3QBTA 1OKKA 1SHJA 2WIJA 2AA3A 1G42A 4N6OA 3B5JA 1DWOA 4CLRA 2FUNB 3GGSA 3N6XA 1CZLA 4X60A 1KYZA 1OFIA 2G0NA 5AKJA 4QDOA 3PQCA 5TMDA 1MAHA 3EIQA 3AVTA 3AHJA 1T0JB 4EG4A 5JALA 3O92A 2Q1YA 3OE4A 4RSGA 1GA4A 1EUYA 1TMKA 2ZGVA 3DLAA 4F6RA 1J99A 1E1QA 4J29A 4TKUB 2GN8A 3JVHA 4JDUA 1W5EA 2R8RA 2ZJZA 2VDQB 5IVKA 2VNJA 5CYFA 3ETEA 1MABB 4HQFA 3PNOA 3MLBA 1R0SA 2ONZA 4V38A 2Q41A 1IQRA 3KD3A 5K0EA 3OONA 3ASVA 3R9XB 1PEDA 1HKUA 4TOIA 2XR1A 4I9HA 1VPVA 5AIAA 4ALKA 4CCYA 3IDOA 3INYA 4FFMA 3S6JA 4ZEMA 4A2QA 2H65A 3HLKA 4CUKA 3CF2A 3H4TA 5D1HA 2E4ZA 2KE5A 4KBYA 3ZNPA 3GLTA 3SIVA 1RAAA 4IH4A 5AVKA 1X6VA 1XN4A 5TT0A 3STTA 1EGAA 1GEGA 1ZOSA 2E4VA 3V2HA 4UFNA 2FRXA 5DEOA 2FJUA 1CX9B 5AKXA 1E7QA 5ESDA 3IR5A 3TD6A 3C3AA 4BVFA 1NI4A 5JU6A 1XP8A 5K0LA 1FMLA 3H5NA 4B2IA 4JVMA 1L4GA 3KOMA 1PX0A 1QORA 1VG8A 1QRAA 3DXZA 2CSUA 3R3VA 3V2GA 3OX3A 1ILWA 4HPJB 3GEGA 1KDPA 5JMWA 5KPJA 2VYVA 1VQMF 1NHWA 4NEGA 3IELA 4NEHB 2AEFA 2XKAA 3E8XA 2BIFA 1QCYA 2DG2A 3HU5A 3CRW1 4GZ3A 4DR1B 3GAAA 5AICA 4BWGA 1RLGA 2JIMA 4PYOA 2Y0CA 4N3GA 5KWJA 1Q0RA 3CH5A 4F3YA 5IABA 1RRFA 2JIZD 3PS9A 4HB2A 1U0LA 2WKPA 3PI6A 5LNK6 3GT7A 1JQLB 1SFRA 1XN1A 4RPGA 4TTAA 2P6NA 2Q1XA 1L8OA 1R2QA 3EY4A 4LHZA 3IBCA 4R4JA 3SPXA 2WG1A 1W94A 1Z6XA 2JCXA 4ERHA 1AMOA 3TCKA 1Q15A 1C8LA 4GX0A 3P20A 2GEJA 4BZQA 1TCCA 4BVKA 5C5DA 4DA6A 2V6MA 3E3MA 4HD8A 1THZA 1W9MA 4MUHA 4DV2B 2IJGX 1ZVQA 2BMVA 4KYTA 5G0TA 1EJ0A 2JI4A 2GVDC 3IC5A 2ZPTX 1QAQA 5C18A 2FPOA 1IEXA 1KI8A 1IM5A 2G5CA 3GHYA 4NAUA 4EHAA 5PNTA 3JQ6A 3KT0A 1YS2X 3L82B 4DZTA 3G6EF 5F3DA 1NTOA 1E62A 4R40B 3GUZA 3IPRA 2AN1A 5C7OO 2WNIA 1VQKF 4IOMA 4Y0VA 4JODA 3GLSA 1W85B 2ZI5A 1RQPA 5E38A 2AGVA 4TS9A 3M4ZA 1VJ1A 3ELBA 2XUZA 4DKJA 4AZVA 3Q5GA 1N36B 4F2GA 5J1SB 3MGKA 2EWWA 5IT4A 2OORA 1T1RA 5AHXA 5J4HA 5JECA 3ON1A 2CVQA 2IL1A 2I91A 3NORA 1W57A 4LCEA 2OQVA 4ADSG 3M0EA 1KE2A 1Z5PA 3T9AA 1U9IA 4WMLA 3KTDA 3LPNA 4B75A 4NARA 3KYCB 2X5OA 4FR5A 5DBOA 3VJLA 5EXPA 4G0MA 3GVIA 3TKLA 4Q3DA 4NJEB 3OPQA 2EJTA 3C9UA 5CW1A 1DT9A 3NEAA 4JR1A 1C4XA 2W4QA 3CNNA 1TU3A 1GGJA 4HJXA 4E32A 4I55A 4CMJA 3CM0A 2J3LA 3MLEA 4C21A 3IE1A 4FLMA 1NVMB 1HOXA 2VS1A 5CAEB 1R5BA 4YJ3B 1KQ3A 3PVZA 3I9V6 4X54A 2HF8A 4CF6A 2FWIA 5JZBA 4FFDA 3CPHA 2OO7A 2QX9A 3Q2OA 2ZSJA 1YB2A 4CKXA 3K05A 2X4IA 1LRJA 2AL7A 2Y27A 3LQKA 2C94A 2ZQZA 4DIKA 1QZUA 3LOUA 4HG2A 1H7MA 1QF6A 3H2GA 3GHHA 4I4TF 1BWRA 5JUWA 3BHNA 1G9TA 1T5BA 3RS8A 3FPIA 4N3NA 2I9PA 2Q3FA 2IZZA 1DJNA 2PUAA 1U6IA 4FFNA 4JP3A 4BGIA 2F48A 3RTEA 4BNNA 2BP7A 3L05A 2DHCA 5ADWA 1TJPB 3RAJA 2C3PA 1X1QA 2CHSA 2AMJA 2VXOA 4MKHA 1J39A 2PSJA 1Y7LA 2YV2A 4DLUA 5KTPA 4QU8A 3CB4A 4QD3A 3C7TA 4RVGA 3V8RA 4AS1A 1Z4OA 3OQMA 1VSTA 1IQUA 3FCUB 1CRPA 4LV6A 4TRMA 3G5MA 2A4KA 5AO9A 3SNKA 3TCNA 4IXTA 1QOPB 4L7QA 2O2CA 4FCCA 3K0CA 3B1WA 1Q74A 4HUQB 1T1EA 4JB2A 4HS9A 4KCGA 4ZDWA 1PW5A 1Z2OX 1SG6A 5A4DA 1JLSA 3PUVA 1I80A 1Z38A 2AIRA 2CDCA 2PS1A 3D2AA 3SXJA 3CVUA 3KQTA 2DOKA 3EB9A 1V6SA 4RL4A 3WFJA 4AWAA 3LWVC 2A8YA 1C9KA 4B0PA 3I8SA 1OW3B 1YU6A 2FPPB 3P4YA 1IXKA 5ANRB 3G2PA 3ORHA 4G1CA 4BX3A 1ZIPA 2JKVA 4WK4B 4ALLA 3R77A 3IKEA 2ET6A 5HP8A 2DT4A 3MWEB 5KNDD 3QIAA 4QZVA 3E9DA 4GP7A 4S24A 3VNBA 1R6DA 3QE0A 5AW2A 4OJNA 1SK9A 2HBYA 2FR8C 4JBNA 1V2HE 4HQNA 2ATCA 3BB1A 1JH8A 3FYUC 3PFWO 2HCTA 3A11A 1O0SA 1BS2A 2VLIA 1KYXA 3CWCA 1T10A 2X58A 1J97A 3U4DA 4HGNA 2C7OA 4D82A 1M10A 3D3WB 4FWBA 3MOIA 4ZOCA 5HTOA 1NLFA 5SY9A 4UTPA 3L7YA 2WIBA 1XXLA 3MJCA 1RRPA 2XMZA 3STXA 4KZPA 1U0NA 1EVYA 1E89A 1Q7CA 1Z06A 1EVLA 1ZINA 2JKZA 3CUEF 4J91A 3DA8A 4RK5A 1CB7A 2QZPA 3MPUA 3R40A 5B30A 2QM8A 1A97A 3MCUA 3PXXA 3U4QA 1DO0A 4MGKR 3WQQA 5GGXA 4DJTA 2GWHA 1Y63A 2IPOA 2V9ZA 1R5OA 5C5CA 4FIZA 1MQAA 1KNQA 1IMJA 3C1TA 3ESXA 4R6WA 3U2QA 4PS0A 4ALIA 1AUQA 1WPGA 3JQGB 4R1PA 2P2LA 3FPGA 1Z6AA 4TLMB 3Q10A 3WIOA 1RP1A 4K5QA 3PDIA 1GAXA 1GQSA 2CLCX 3KEMA 4IF4A 2XCIA 1I33A 1LNZA 3L49A 1UANA 3N58A 1K06A 2ZAYA 3FAZA 3RS5A 2A9PA 1L7BA 3R0XA 4OSPA 2HPHA 1M1NA 1N9GB 1QVWA 3RB8A 4UXIA 2GR9A 4U7TB 3DB1A 3H5TA 3NI2A 4A1OA 1F6BA 3MD9A 2AWOA 1Q6YA 1YCFA 3F8WA 2NZ2A 3RA5A 1LQUA 2UVPB 4PQGA 3ZOPA 2JFUA 5D01A 5F3RA 1ZP6A 4EKNB 5CDFE 3TTTA 5IJ9A 1J56A 1YKSA 2CLKB 2QL6A 4D26A 3TVDA 3ONWA 1KXZA 3L2OB 4D9GA 1UXHA 2XZDA 1HL3A 3LMEA 1T29A 3GA0A 2AYXA 3QUCA 3VOTA 5FEUA 3S5UA 3IAEA 2HRCA 3OCZA 3QW4B 2FSSA 4R0VA 5C4GB 4EGSA 3TSAA 3KLPX 5A5DA 5LD2B 3ANSA 5IVIA 2F4VB 5AVYA 4KHPB 1RJGA 3LQ2A 4XWOA 2IZ5A 5LYJF 4DLAA 1CUVA 2OP0A 3TLKA 13PKA 1QCCA 1NLZA 5FD8A 4W9NC 4JHXA 4F1WA 1SR8A 4XLTA 2QY9A 1OGYA 1JHUA 1SHZA 3A1EA 3A9VA 3MAAC 3O3MB 1HDCA 4LF4B 1PEKE 2EERA 3OA0A 4MW9A 4ZHVA 1PTKA 5JY1A 2O07A 4GNRA 3VO8A 2FE1A 2KS6A 2IYXA 4FFVA 5LZ9A 3FSGA 3AXSA 3I55F 5HOEA 5KJCA 1E2QA 4OHXA 1JR3E 3CTMA 3PUWA 5IXYA 4YRMA 4M60A 4URVR 1D4AA 1KNXA 1HG1A 1HQKA 2JLWA 1GR1A 2UYPA 1FBNA 5JADA 3OJOA 1VFNA 3B1JA 5K8LA 1R8YA 3LDTA 4IFTA 1P5HA 3Q3GE 4LMAA 5K1ZA 4OPMA 3UJ3X 4N7MA 1AQJA 2OPHA 1T1IA 4B9AA 4KIJA 3LDAA 1AF4A 3A0RB 4U9UA 5GM1A 3ZCQA 3M6FA 5IC5A 3W4KA 3B1FA 3E35A 2VXCA 4HDOB 3IJ5A 1DKLA 2C4KA 2GN1A 2IUTA 4HEA6 3ZW8A 2KYRA 4I46A 1MX5A 3MT8A 2PGLA 4GBED 2ZVYA 4INJA 4KGXA 5EOVA 3GRYA 2ACEA 4EAAA 3EVEA 1CJKC 3ZVKA 1ORRA 4S1NA 4U0JA 3QY9A 4TKVB 3UXYA 2CT8A 1KI6B 4ZHQA 4RD6A 3DV0B 1SPBS 2XWJI 1U3VA 3BE5A 3F6CA 3NT2A 3FBAA 3N2EA 1TUEA 3FYHA 4KX3A 4F4CA 1GNPA 2PSEA 1E79D 1VHAA 2X7HA 1H2RS 1IV2A 4RZXA 1FBTA 5FBRB 2PMCA 1SB9A 1D0SA 2PWBA 4TQAA 1NF3A 2A14A 2G9UA 4WERA 4S0ZA 2C98A 2BTOA 2PX2A 1IAVA 3V7NA 1XA3A 2VDJA 4CGZA 3NR2A 2H31A 5KWSA 2ZTVA 2WSSD 5M34A 4N41A 1RM5A 2OSBA 2ZAMA 5U1PA 3BHMA 4E30A 2WMOB 2JLXA 3VR5D 3RU9A 1PJSA 4H4DA 2DBZA 4ZOAA 1ZIYA 1WNTA 2Z58A 3ANLA 3NM6B 3T1YB 1SUEA 4PGHA 1A7AA 3AF3A 2Y0BA 3CNHA 3RRFA 4PFSA 4YRLA 1ECGA 1J20A 2IYOA 2VPXA 2V1XA 2D0IA 2GNPA 2Z98A 3DE1X 3MGAA 3IP7A 4KJXA 5ESWA 4Q1DA 1PFYA 3SBDA 3AP1A 3ICCA 1GGVA 2D1RA 4L8FA 1JQEA 1PIWA 4IICA 2GM4A 1PS9A 5JQGA 3QUQA 4EEXA 4I5EA 4UCXA 1HURA 5FF9A 5J40A 4MRMB 4RJIA 1EGVB 1LW7A 1WQ3A 4XPIB 5C8YA 5K8IA 4TTPA 1US8A 3V2UA 4OYHA 4EPRA 1XZ8A 3BCRA 3W1WA 1RKQA 1ZUNA 1IXYA 2TMKA 2YMQA 4PBRA 3QVGA 3HYLA 2R47A 1H23A 3PC3A 2Y9MB 4HMQA 2VT3A 3QKUA 3CZQA 4R41A 2VJYA 5CLJA 1K92A 3G2LA 3IAAA 3AM1A 4GBJA 1T8TA 3C8HA 2BMWA 4D9JA 3P32A 5K0JA 2AFHE 1MRNA 3IOMA 3CCUF 3L1JA 5AI9A 5HA5A 3KQLA 1G20E 3EFOA 4LDPA 3PP8A 1W76A 1ODLA 1CDDA 1UM9B 2OCKA 3I01A 2CHGA 4IH1A 4DLZA 5I51A 3ZG6A 3QELA 5AT1A 1Y9AA 2CXUA 1VA4A 4CMKA 2HREA 2NSLA 2PA3A 4GLLA 4GS5A 3WBJA 5B1HA 4BNXA 4NWIA 4E2FA 4B76A 4G56A 1R16A 3IQXA 1DOZA 2IP2A 1NBWB 4PNPA 3I6MA 1QQ7A 3W2HA 1LDEA 1WEHA 1Z75A 2DFVA 3SQOA 1QHXA 4WZAE 4GYKA 2I80A 3MMPA 4LIPD 4UAJA 3C6KA 4QBKA 4BJ6A 4CV1A 2AYYA 2Y93A 3FWZA 3HVUA 3FPFA 4P3KA 4YIKA 1C8VB 4BLWA 4EUNA 4J0DA 1WEKA 4PG8A 1EUDA 4IINA 3LBNA 3IVRA 5JS1A 4HLDA 3IJPA 4K3VA 5F5LA 1XU4A 2QI9C 3LY8A 3VUEA 2AC2A 2WVAA 2X15A 4DLYA 1JWAB 4MV9A 3KTAB 3WKCA 4MO2A 1FU4A 1FZTA 2HL6A 5EMLA 1J8YF 3P10A 3DL0A 2FZ4A 3QVJA 3ER9A 1LDMA 3VNSA 3DKPA 1WULS 2CC2A 3OX1A 3VZQA 1UJ6A 1KORA 3NDRA 2I55A 1FU7A 2FMIA 2Z2IA 4OFWA 2SKDA 4H18A 4WZAA 3N8GA 4NBNA 1GV1A 2HJWA 5GIOE 3EPLA 4F5WA 4BV9A 3IR7A 2W6MA 4GM4A 3QLVA 1O0BA 2W2OA 2RHMA 1GUZA 1NVTA 3K8ZA 4JUDX 1UXGA 4ZCPA 2X5JO 4NPCA 3A6GA 1RQGA 3L6CA 4EOGA 3DHWC 3LBHA 1JIIA 4ZYTA 2I2BA 1RR6A 4CIWA 4AURA 3M3PA 3PX2A 2YWGA 1MFZA 4I1RA 1RYBA 4YRTA 4BQRA 4Q0MA 2VWHA 5KQRA 1U8YA 1GRNA 1W0JA 1KS9A 1XV2A 5J2TF 1EX1A 2CXQA 3DS8A 1SBYA 3MQ2A 4KE9A 5ALFA 1ICEA 3RDPA 2Z1EA 1O94C 3UTCA 4IZIA 4UULA 4RTOA 4KPGA 5HY4A 1FDVA 2QF7A 3P9KA 1W9HA 3GNQA 4FDUA 4GR4A 3WGUA 4YREA 3K73O 1M74A 3FTQA 1JXOA 4LVUA 3RC1A 2NZJA 4WJZA 1JV2B 4CVNA 3AINA 3PU6A 4URUR 1H4SA 1CY8A 4K1LA 3TZLA 2XCLA 2ZSHA 5REQA 1IOLA 1FLNA 3OCXA 1KR2A 2J9GA 2CXHA 4LTDA 4RVNA 2YC2C 2WF6A 4EHFA 4JLJA 3TX2A 3C3XA 1RJEA 2DT5A 4P4LA 4PWYA 3MNFA 3IUJA 1QNLA 2JZCA 4KFSA 4ZT7A 3TE7A 1W4LA 2A0YA 3MWKA 1PNOA 1HTTA 4PO9A 5DO9A 3PQ6A 2B34A 4MRAA 4YCLA 4Y6RA 2IP4A 4NU5A 5I47A 4RTJA 3FKSA 1XNRB 1WCV1 5K0GA 4I9NA 3ZGLA 4BFYA 3I6QA 2C1EA 2C4NA 5A9RA 1CQJB 5BNWA 1S9DA 3A3OA 5KYUB 4BDTA 4JJFA 3AHEA 5IU6A 3GELA 4XGNA 2G82A 4OBXA 1DFIA 3UH1A 2XH8A 2R8XA 3L1KA 3B12A 4K6MA 3PDWA 1AB5A 1H2BA 3KKPA 5CVUA 4CM1A 3ABRB 4KQJA 1M2KA 4RHYA 2WWWA 3HU3A 2P35A 2Y1WA 4ZREA 5EHNA 3COJA 4LBZA 3A36A 3CVJA 2PQ0A 1E2UA 1F2UA 5I48A 1J09A 2CHVA 3K5IA 4IJKA 4NZPA 4XR4A 1V8PA 2NGRA 4PZDA 4QO8A 2D5BA 4WDRA 4MPPA 4ZOEA 2GS9A 3VR2D 3KPVA 3K8QA 3E22B 2IP1A 3OMWA 4FI3F 3WBBA 1W47A 4IY1A 1V43A 5ALGA 1D2EA 1NM5A 3W5DA 1L0BA 1OBOA 1OLOA 4IVNA 3SS9X 2DLNA 1UK8A 1FVXA 4JJIA 1YFJA 4MLZA 1OX4A 4N6NA 5CT4A 5AUQA 1TRKA 2CN1A 3FOCA 1G66A 4H35A 4I3FA 4I55F 2ZIGA 4CL8A 5A4AA 5E7MA 3VU9B 3SVTA 2JAWA 1GCAA 3T3HA 3FZEA 1UOEA 2FH5B 1PLKA 2G7MC 2PYIA 4GKVA 1XZJA 4H08A 4I6GA 1Z8DA 4UUQA 1F8UA 4BAUA 5CDSA 2YW2A 1XMVA 3C5HA 5BPFA 4F6LA 5B5SA 4AY4A 3RI3A 3OFND 5JXWA 1FTQA 3UK2A 3SKYA 3W5UA 1WP4A 4EB8A 2VRNA 2VCEA 4RTQA 3KALA 5FUWA 3TL6A 4BPBA 2FPLA 5G40A 4KLZA 2W2NA 3DE4X 4M6WA 1OU0A 4EA7A 1K75A 1OYYA 1Z7WA 3STWA 1EU1A 2EFCB 2PUBA 3W3AD 1MHTA 4O8CA 1QPBA 4RAOA 3GLRA 3TRDA 3OP4A 4YYEA 2OCGA 2ECOA 5GQSA 3NT5A 4XVRA 1LBEA 5SV2A 1UFVA 3BF8A 5CYPA 4MS3A 5K3AA 3U9SA 3RRBA 1HE3A 4NULA 5C37A 5A0VA 2C04A 1DHRA 1OXSC 2QK4A 3PXDA 3IBTA 3WNVA 1OVGA 1X14A 2A1TR 2V7EA 4HBGA 4C7MA 4DPMA 4DS3A 1OH6A 2FFAA 1CETA 3QQPA 2JGDA 1H9CA 1GL9B 4HXGA 2WHEA 1S7GA 2CMGA 2EW2A 5FA8A 1PWYE 4Q7MB 3TR6A 1YKGA 3JQ8A 4HO1X 4IWYA 1Y3HA 2ZI4A 2ZT5A 3AB8A 4N5HX 4R83A 4W5WA 5B7GA 2E89A 4ALMA 5HK8A 2C99A 3UC5A 3BXFA 2IH5A 1JA9A 4FILA 2QN3A 4HDCA 5H3CA 2ZFUA 3B1ZA 1GSOA 3VC3A 4L5CA 1VYHA 2Q27A 4UTXA 1EWRA 3VC7A 9MHTA 2WU0A 2IYZA 3L0CA 2PX8A 3WGKA 4HAIA 2JI7A 1K3TA 1GL7A 4URFA 2B1QA 3CT6A 1A1SA 1NAHA 2IVFA 5D3MA 1IONA 4KQEA 4BWVA 5IBPA 2OQIA 3N3BC 4M8LA 3SC2B 2EAUA 3R24A 4KAXA 4UARA 2PBZA 3QNUA 3C48A 1Q3KA 1TO6A 2XDYA 1WTAA 3H9BA 4ER7A 1XRRA 3IPCA 3H42B 2EG5A 2CYBA 2GCOA 3Q9SA 1ZHOA 1NV8A 5DYTA 1Y9ZA 2CD9A 2NNWB 2HRRA 1EDEA 3NTOA 4C6TB 2F55A 1X39A 2CUTA 3G0DA 5IVDA 4KAJA 3KXIA 4RABA 3BXOA 1IHXA 3D0RA 4QBHA 5F77A 2H54A 2WJZB 3SJCA 4BFXA 1LTHR 2XNKA 3O4JA 2QL5A 2WF9A 3LQ1A 1LX7A 5D2CA 1T1JA 1T3ZA 2HYIC 1FPMA 1HSOA 2BF7A 2ZB3A 3HI6A 2VYQA 4TMVA 5H02A 3TVTA 3VFDA 3ZHUA 1RIFA 3PPWA 3R4CA 3LDFA 4BNDA 2IYNA 5A2QM 3E0XA 1ZQ9A 3JYOA 5GJWC 4ZCSA 3KJZA 1Z0SA 4PNHA 4LJYA 3LUGA 4KX5A 5A4KA 1IY0A 4G6ZA 4JT8A 2FGYA 1D1TA 4Q4DA 3DLCA 2FMHA 3OMLA 4PFJA 3FZNA 2H29A 1SELA 3TL2A 2NMVA 4XCQA 3OT4A 2IYFA 4Y6SA 5JS6A 1J33A 1T5LA 1MJ5A 2M6SA 4JNCA 2ZVZA 4ZWNA 3W5HA 4DSUA 4W1QA 1F3OA 4ZC8A 1K5PA 3UENA 1ADJA 1K9VF 3EBPA 1XMOB 2BR3A 3PE3A 2WJ4A 1X7ZB 4A0RA 4ZMBA 3LUKA 3ABZA 5JCOC 4D57A 3BH0A 2I6UA 4LNUB 2Q07A 3K32A 2Q4OA 3O93A 2OSVA 3A6LA 3T8YA 5DZSA 3Q8KA 4AYTA 2H00A 4HJRA 1VGVA 5F3WB 3KCQA 3F4LA 3I5AA 2RHBA 1KDRA 1WG8A 2QD4A 4FXPA 4NONA 3F74A 2VAVA 4QXQA 1GZUA 4OHZA 1PJ8A 1X1AA 1QVZA 3W8EA 1H6DA 1EFUA 5KTSA 2WQZA 1D1QA 1TEHA 3GOQA 3HDTA 4KR3A 5LP6B 1DTSA 3GAFA 4BFUA 2L18A 5EESA 4XSVA 5KTYA 1CVIA 2RHRA 1N2JA 4LYFA 1EB8A 3LQRA 4DQKA 2NXWA 5CFPA 3IBYA 4KE6A 5TEVA 3AWIA 3A1FA 3EIEA 4LJRA 3W5AA 2O8FA 1T3TA 4J1NA 1ZMBA 2IEAA 2FY8A 2K87A 1FRZA 1ZXBA 1A69A 2MSLA 4PRYA 2DTDA 1BD3A 5L3ZA 3V32A 4A9AA 4AULA 5K0BA 4II2A 4I5FA 4KACA 4D9MA 1H65A 1P18A 1NOKA 2X7JA 4ISCA 2OZEA 4EK9A 1VOTA 1GD1O 2WT4A 5FWDA 5IARA 4Q3NA 1YVRA 4GUDA 1BVHA 2HDNB 4ZV7A 5G0UA 1EE1A 3O82A 1BW9A 4HX9A 4TQUS 3ZZUA 1OLXA 1FFXB 1TX4B 1MGOA 2GTHA 3B9PA 4TSFD 3PFIA 4FWTA 2P9FA 1PT8A 3H5WA 4L6AA 2P3QA 1BIFA 2DYYA 4KFCA 3WYCA 4V0KA 3TRJA 4B7AA 5GAPK 2LBWA 2P3OA 1QHIA 2X13A 1MW9X 2A57A 2W2MA 1KFKB 3C3CA 5TMBA 1G3MA 4AJPA 1MRSA 3BFXA 1XJCA 5BVHB 1IUOA 1VJRA 2Q2QA 2AS0A 2ZBFA 1EK0A 3ZD6A 2F8SA 3H7AA 1EBFA 2R7LA 1J0DA 3A6FA 4KGDA 4GNKA 1OH5A 1ND6A 3OT1A 2XCQA 4MQ4A 3FFXA 1GXSB 1Z18A 2B4TO 3TAUA 2PE5A 3U4AA 1I3MA 1B74A 1IV1A 4NQZA 4P32A 5KX5A 2GDJA 1SQ5A 1JEYA 5E0KB 4R5HA 1XMXA 4JJZA 1JB9A 4G0UA 2B7CA 3BWEA 3HYTA 5FIUA 4ZHQF 1CP3A 3GLHA 3QPDA 3JQCA 1M0SA 2VTEA 2OK8A 2O2DA 4JX8A 1DCKA 2AN9A 3I1FA 4JGBA 3VHXA 3K9LA 4XIJA 5C3UA 2RIPA 4L3OA 1PTJA 4H3VA 2Y6UA 4XDGA 1JT2A 4IQFA 4FE3A 4CI0B 2HMUA 3PRJA 3N2LA 3TXXA 2W8BA 3E7WA 2V4MA 2NO9A 4GZ5A 4LQ4A 5SYMA 3HSSA 4UUPA 5AKHA 5FOTA 1TADA 2AC4A 3V1KA 4CCAA 2BM8A 1HFKA 1K97A 3T3IA 1O95A 1U81A 3BL6A 5ALWA 2OGSA 3ROEA 5BUZA 1MV8A 2BV3A 5KB3A 5G0SA 4KE8A 3SMQA 2II6A 2QRVB 4BO4A 3FAKA 3R74A 3QFTA 1USKA 3LDGA 1BWSA 1GNRA 2W4MA 3GGDA 3ACBA 5C1PA 1PEAA 3U1BA 3PWZA 1IU9A 1P91A 5JQGF 2CYCA 3T7TA 2H92A 1P8AA 1N9KA 3X43A 5ITWA 5E1BA 1MDBA 1Q3TA 4JP5A 2HFJA 2RFLA 5C8YF 2IIQA 5JSHA 2RGRA 4ERXA 1XC7A 1KZGB 3NRJA 1Y5MA 2FE4A 2V6FA 2HBZA 3ZVLA 4EAQA 1ADFA 1IIRA 5EN4A 3N2KA 4U2KA 2O4UX 4U39A 1JQKA 3U37A 1BX3A 3TG2A 1JEJA 3EIHA 5ERGB 2VRWA 3EK2A 4PU0A 1Q1GA 1BYUA 3FLAA 4U5QA 2GWRA 3ORYA 4RF4A 1JJAA 1QVFF 1F2DA 1C7QA 1PJBA 1Q44A 1VMKA 1JSZA 4ZCQA 4UUNA 1I30A 2BFEA 5FHRA 5SZKB 4AMBA 3AVWA 5COAA 4RKRA 1BDHA 2QLTA 3GTZA 1CRQA 4BGDA 5CHEA 4MUNA 4Y6LA 2CMKA 3HJHA 5BN3B 1Q7EA 1YI0A 1FPQA 1CPYA 5EWMB 3TOXA 1FRQA 4WAUA 1C30B 1D2GA 1E3WA 4JI3B 4YV0A 2MMGA 2DAPA 1L5OA 1IZ0A 1H1DA 5DMHA 3PKIA 4C01A 4DA7A 1QKJA 4XAQA 3ZU3A 4ZHYB 3KK0A 3NTUA 4V0LA 1UJ5A 1O6BA 4XB1A 2I62A 3BJZA 4Z9XA 2YYEA 1I5RA 1ZOIA 2UZ0A 2WM8A 3QOFA 4G07A 3BJEA 4ZZ2A 1A5AB 1XD8A 3WIDA 5K3FA 4ZDIA 2WMDA 2WYUA 4FHCA 1EHYA 3BIWA 3A6PC 4DW8A 1J8QA 2IHTA 3K6SB 4ZZ1A 5BSVA 3FG9A 1LPAB 4D4GA 4M7WA 3HWUA 1JJBA 4PFKA 4BX0A 2ZIXA 3EXFA 3H3JA 4WOCA 1KS2A 4YB8A 3MBIA 2JEOA 2PL1A 3QKSB 1Y37A 2ZIUB 2JJYA 4N8DA 4X44A 4EY6A 2DB3A 4M1SA 3AY0A 3K6JA 4CCWA 3LX6A 3SJ7A 3AF2A 3BL8A 1DINA 5KWEA 4TTJA 3FZGA 3EPPA 4CQMA 1CZOA 1HTWA 5BUQA 2R1ZA 4BBZA 4YPFA 4ZV9A 5TF4A 5K03A 1FFEA 2I71A 2FEKA 1C1DA 1V1MA 4KO1S 4M8NE 2GF2A 4RZIA 5H16A 2V9YA 4X8MA 1N2CA 1UBUS 4IJ6A 4MO9A 3U44A 1RS0A 3H2YA 3MDOA 3LF1A 4U6NA 4ROSA 1DBRA 2QZ9A 2OBLA 2YINC 3Q7IA 1RQXA 4DNPA 4AL4A 4EJMA 1IDN1 3TZBA 4DQ0A 5FOXA 3TZHA 3RYFB 1GHTA 2JHGA 2NZUG 3AEKB 4QO7A 3A27A 4XCXA 4YRKA 4YIHA 2P0AA 4O4LF 5KIAA 3MLAA 5TJ9A 1FYDA 3LRXA 1YAJA 1ZPDA 3FSEA 3I72A 4J0KA 3TTSA 3ZWBA 1WS6A 1WDTA 1GZ4A 2QRLA 2X7XA 1CXZA 4KXWA 1RXUA 3ZD8A 3NW9A 5DTMA 4I4TB 5DW0A 1EFVB 3AVVA 3NEJA 1EJBA 1LPMA 1QP0A 3NO4A 3JVVA 2OC4A 5EFZA 4FGZA 4TV9A 1ECBA 2EG9A 2HU7A 2ZAGA 5BMVB 3Q3EA 1XLUA 2RGYA 2ZR7A 2IKQA 3L40A 2FZLA 3S1LA 4CM9D 1EVZA 3LHKA 2WUVA 3B3FA 1NA5A 2F64A 4KPYA 1SHLA 2CUKA 3FDFA 1N6PA 3WMEA 2PZLA 2OVBA 1BN7A 2GN4A 5FTWA 4QOFA 3PXBA 3UK0A 2QG6A 2Q5LA 2X8BA 3V1YA 1SKMA 4FMPA 1K73H 5TSDA 3WXMA 2YZNA 1HV8A 2IUFA 3OTQA 5GOTA 1CIJA 3AI7A 3RF6A 3NYQA 1CQPA 4RU1A 1PQPA 5BSUA 2DBQA 4NBWA 3OBBA 2R6R1 1PLLA 2OB2A 2N75A 2WWFA 3EIOA 2JC3A 4GPAA 1SCJA 1N34B 3JQ9C 4L50A 4XYEA 4IVPA 2O7RA 3DMRA 3C74A 3AVOA 3FTFA 1G7RA 2R5NA 1N5DA 2HU5A 2YFHA 3ZWXA 3WMFA 1FTYA 1ZO8A 5EUBA 4BEVA 3ELCA 4GSYA 3GJ8A 2VDWA 3C3JA 2P6MA 3DYVA 4UPDA 2HWUA 1E5QA 1JQBA 1ZNXA 3DMDA 1JMYA 3HLYA 4RD4A 3WGGA 2QZJA 4GO1A 1DBFA 1SQ6A 3KVYA 1UIMA 2A0XA 4P31A 4IIDA 2FGJA 4G65A 2R79A 1N3YA 3GIWA 1B0ZA 2HY7A 2H85A 3KWMA 2P4UA 3O38A 1VTKA 3NASA 4H60A 3PVCA 5BUSA 4DB2A 4MVXA 3T5GA 4IDAA 3HP7A 4LZAA 1M1YA 5I45A 5ICSA 1P33A 4JVSB 1CUCA 3HFJA 4MARA 5EWMA 5KU7A 2PGAA 4NESA 3EYAA 3FSRA 3ZZMA 1UT6A 4MICA 1M2OB 2GLUA 2ZS7A 1Y82A 1A5TA 3OU6A 4ND7A 3LLMA 1YS7A 1J07A 5KZMB 5LU9A 4GYWA 1KPHA 3OX2A 4ZI2A 1Q0HA 3G7UA 2R1UA 4QGFA 1KJIA 3L06A 1GNTA 5BYAA 1BVUA 2XWQA 2ZOVA 1B0PA 1LC3A 2TSYB 1VDZA 2O2IA 5TE9A 1I01A 1ZU4A 4F3CA 3OO1A 2WALA 3GVXA 3ZOZA 2GBPA 1EFCA 2A84A 1XBTA 1G4AE 1M6WA 1L8XA 2V0GA 1K6EA 4MQ5A 1ZOPA 4RWZA 3D6MA 1LPPA 3VYTB 4Q66C 4ZK2A 1JZSA 3IOYA 3KEOA 4IMJB 1R9JA 3P4UA 5DT2A 5AVOA 3GRCA 1NC3A 4PAOA 1XKTA 2NTYC 4QUIA 1BKSB 3B3GA 2BEJA 5JFTA 2P9CA 2XE8A 4YJ2A 5HQ3B 2GKGA 2H2DA 4AMGA 5JI3E 2AYZA 2GFIA 2AHRA 3PD7A 4QSMA 4U2EA 1PFQA 2FXIA 3I6BA 1T35A 4JWKA 3KSBC 3HNRA 3UMFA 1Z7GA 3NAMA 3W2IA 4P0QB 2NZVG 1SUPA 2XQGA 3CUYA 2X1VA 4M0CA 3TUIC 3KTOA 3TLAA 1TKCA 3ZE7A 3ID6C 2IZ1A 3C3BA 4RANA 1ZBQA 1G4HA 1Z34A 1KJWA 1JHMA 1GFIA 1MIOA 3EFEA 4LBYA 4KAFA 5SZIA 3ZLUA 2PRYA 1PJLA 3JTMA 3W2EA 4FZ5A 1WHTA 2VP2A 3RVKA 1JQDA 3HUUA 3ICEA 1C3OB 1ECPA 2ZAUA 2ORED 1Q1QA 3ILYA 3RAPR 1RYHA 3MUNA 2G83A 5KTMA 3OOWA 4QJBA 3L4EA 1R0BA 3I34X 2ORWA 4LSGA 4DANA 4DLXA 4QGBA 4F6CA 3JALA 2C2HA 2F59A 4GVPA 2CEAA 3EVBA 2NX2A 3FMPB 3MJRA 3V7QA 1Q2UA 3RBAA 3A1WA 3N86A 2Y9PB 5F33A 4OB7A 1MMFB 2ZYSA 3ZWNA 4LFBB 5IWAB 3SJUA 1I9CA 4LMRA 2J7PA 4BVBA 5CD9A 3B60A 3K31A 3SXUA 2QBYB 2RK6A 3UMBA 4QUJA 4RK4A 4W99A 3OOJA 2G4VA 5JSUA 1E3EA 5LOVA 1MT3A 3GRVA 4GM1A 4U7DA 3HXMA 4A8PA 2VZEA 4F38A 3SZ3A 4GDMA 1U7DA 1IOWA 3F5MA 7REQA 1V45E 4ATNA 2IOFA 1O5TA 3A9SA 4EHJA 2ZE7A 3PQ5A 2FK8A 1XL1A 2C7QA 2HZ7A 4OQEA 3ZGYA 3V6MA 4Q4CA 1WF3A 2FSVC 3G7NA 2O8NA 4Q4JB 4RPJA 4JLKA 3FYSA 3IEKA 1ULZA 2V59A 4EB6A 1H69A 4E94A 1T4GA 1WM1A 2GBCA 5D5PA 4HFNA 1MC8A 4BL5A 2HF7A 4LJ9A 5KOHA 1U28A 3GLIE 1ZH8A 1JSCA 1PWEA 1QYWA 1NQUA 2PXXA 3WLIA 1DV2A 2JCGA 3F7NA 1EWKA 1MP0A 3IVXA 2B3TA 3CKLA 3AUXA 1SXQA 4N47A 4A2PA 2JBWA 2OV3A 3ETDA 5ALPA 3MRXA 3WNCA 3ZUGA 1OH8A 4B6OA 2NUAA 3GZTB 3PJDA 4HYQA 4JLBA 3O2SB 3OIUA 5CVDA 2O19A 1MIHA 5B4TA 1S2GA 2Z57A 3WJ7A 1PLJA 1T15A 5ES4B 1QHHA 2CK3D 5L3QB 4ECEA 1AY0A 1C4OA 2GNOA 3T7IA 4UPEA 2P67A 4KUGA 2AIFA 1WCIB 3EJWA 3A4VA 1MVLA 4HX2A 2W00A 4PS1A 5K3OA 2H1VA 2FRVA 3CCBA 3BWDD 3IVMA 3QU2A 4I14A 3DCIA 1WA5A 3F2VA 3SEAA 1N6RA 5JMOA 2GI4A 3F5FA 4G4JA 4LTMA 2CHEA 1KO7A 1PT6A 4HH4A 5CUQA 1A2QA 3FZQA 3UPUA 1J8DA 2C2YA 1W5BA 5B7NA 3I56F 4QVKA 4A82A 2IA5A 4F06A 4ZT3A 2E87A 3WA7A 2BGKA 2Q99A 2WYOA 2XUPA 3GGGA 3MWYW 1R9NA 3IHWA 4ENSA 3D7RA 2Q4DA 1Z0ZA 4PR0A 3LPAA 1H0HA 1XEXB 1HT1E 1UFOA 3ZUPA 1OFUA 2CDNA 2JGEA 2WWIA 4K7JA 5L8VA 1VQ6F 1A7UA 3GCGA 1JEQA 3CH6A 3EDQA 4CM7A 4J16A 4NDAA 3GLKA 2NPFA 1VG1A 3GMSA 1S2NA 1G18A 3I45A 3KVVA 3MMXA 3WLTA 1P4HA 2WU4A 1LUAA 3IAS6 1EI9A 2IHVA 3AO0B 3FCYA 3PA6A 4BUCA 4E7PA 2HSGA 3EISA 3DMPA 1W2GA 1E92A 1XTZA 3QNMA 1ZD8A 2CF6A 2HP3A 2QR5A 1IXRC 1HETA 2V3WA 2X5XA 3RD5A 2KBEA 2ZTHA 4URXR 1DLIA 2OV2A 4R68A 4BVJA 5AVJA 1UMBB 4ZKDA 3COZA 2NU6B 1ZUHA 1SK8A 5KX5F 3NP7A 1CUIA 2C0PA 1U2DC 1XTJA 4RS4A 1C3OA 1ISSA 1LK7A 5D6OA 2PS0A 1O58A 2FHPA 3N59A 3PRHA 1VQOF 2IE8A 3S68A 2I2WA 1J0AA 3VHLB 4F12A 2ADFA 1U3LA 4P3OA 2YN0A 1Z5OA 2OV4A 4KFUA 2FW0A 1GP2A 3ESAA 5H68A 1L5RA 3OQ6A 3RS3A 1SC6A 1TYDE 2HOQA 2J32A 1UOOA 4BNFA 4RKFA 2DQZA 1UDBA 5G4KB 2ZODA 4KNYA 3JQ7A 4RZUA 3EZ6A 4QUDA 2NU8B 4EUSA 5FR1A 4HTAA 4HDSA 4YCAA 5J5AA 4B17A 4CMHA 1ISHA 3JQDA 1SQ0A 1LX6A 2H8EA 2PWPA 4WE3A 4Z49A 2R00C 1PUXA 2WB4A 1VYTA 2WP0A 3FNQA 1OFHA 5CLHA 1U99A 4MDHA 2GXSA 2AG6A 5LQUA 2P4SA 3PC8A 4X93A 3QTBA 2FPKA 3ITDA 3N70A 1UCFA 3DB2A 3M3HA 2CHTA 4JHLA 4UCQA 4B6FA 3B6MA 4BFVA 4ZOQI 5EYPA 1W5TA 1VKHA 3WAKA 4E33A 3UK1A 4DUZB 2HIMA 2I22A 4ZZ3A 2WJWA 2I67A 4OQDA 5EZ5A 1R12A 1LFAA 3N05A 3EH2A 1Q1BA 5LLTA 4Q1FA 4MYCA 4NXNB 3QUTA 3CPWF 2WKQA 2ZKIA 1FDOA 3P0HA 1TUBB 4KRGA 3PF8A 4TXHA 2LDBA 1AKTA 3ZCXA 3ZK9A 4S05A 5IAOA 1N0VC 5J2TB 3K6RA 5J4KA 4BVQA 2D5IA 4OBWA 1FP2A 5BWCA 3JX9A 2BBTA 2WWVD 3U1TA 3K96A 2HFKA 2V74B 2ILVA 2J07A 3B13B 4YMIA 5HZKA 5JXJA 2Q45A 3UXMA 1CJTC 1LNSA 2E3JA 2HZBA 4WESA 1KEEA 5AK3A 2VA9A 3UOWA 5F73A 2GVZC 2AJ8A 2R5FA 4FFOA 2POQX 4GSLA 3WL8A 5E6RB 2IY8A 1IM2A 1KDTA 2IEGA 3CX3A 4YROA 4MSUA 4P4UA 1H5UA 2UYGA 1CQZA 2Z1NA 3VTKA 4ZJPA 1GIAA 1DC8A 1VQLF 3KUKA 4M1OA 5K8CA 4OYRA 5CNKA 3BRQA 3GBPA 3ODGA 1JKXA 4R9VA 4Z7JA 1JDVA 5E9QA 2GZLA 2O3SA 4A0QA 4C0LA 1FE8A 1TD1A 1SU4A 3KT8A 4RE6A 2QS9A 3PGLA 4LOAA 3RFXA 5A7GA 4ZFNA 3NYIA 5IWCA 1E3JA 1RM4A 2ZB2A 3LI2A 1K0FA 4FLFA 2Z4RA 5CM9C 5DCUA 4QVIA 2E9SA 5EGSA 4LK2A 3H11B 2Q3MA 1C9DB 3CEAA 1AV7A 1OBHA 3IIKA 3OCYA 3GMIA 4UATA 3RT9A 3IKMB 1GO1A 2HRZA 3JD1A 3TDKA 3I32A 3ILVA 3C4JA 2P2NA 2VJMB 2E5FA 2FWPA 2WD8A 4RJTA 1DO8A 3EEBA 4XZ3A 5KOJB 4UU8A 2R6JA 3W5IA 4UHHA 1Z7BA 3QVKA 3KDSE 4Q3CA 3MTBA 1W41A 1E18A 1OBFO 3VU1A 4ASUD 1IN7A 5CLFA 1QX3A 4TUYA 1QB7A 2GAOA 4MQEB 4DBZA 1SDSA 3E27A 4ZVKA 4EKYA 3ENNA 4BT4A 2G6TA 5AW6A 1DX9A 1M2HA 4C4XA 4MTCA 1JTEA 3N0TA 4AP5A 3PTAA 3W2TA 2RK4A 1G8FA 4ODIA 3NWOA 3CRNA 3GJSA 4WCFC 4QPPA 3ZIAA 3LGSA 2IYUA 3BXXA 2VHVA 2YJZA 3BD7A 3FGNA 4PR3A 3RUDA 3S1AA 2OVFA 5CIQA 5AM3A 1ZAYA 3AXTA 2XW6A 2OTCA 3ADPA 5DGTA 1TGVA 4TWBA 4TS3A 4X41A 4D3DA 1FVFA 1W48A 1XYYA 1C9NA 2HJRA 1QHFA 4DNXA 5C7YA 1PBNA 3P0FA 3T9EA 4MUMA 1EVKA 1NYRA 1P60A 3IHKA 4C2AA 3F7MA 1XHLA 3GGOA 2G9ZA 3IQWA 3KKNA 4UD2A 2JIBA 5FPPA 3T5MA 5TQJA 3GRUA 3IE2A 3UB4A 5DHQA 5J4VA 2H1SA 2EYUA 1VECA 3KB2A 2C7BA 3D1VA 3KJNA 4R1QA 3CA8A 4TV9F 5ENVA 3WKDA 3CGGA 2WWHA 2Y1DA 3T7KA 4HFMA 3EXG1 3ZXYA 1X1SA 2XTAA 2ZJ7A 1UBEA 1VZ3A 1ZMTA 2RGDA 2WTMA 4Y7DA 1N2IA 5TXGA 2PO7A 3I2FA 4BZXA 4IXNA 4PLPA 3VNVA 3LH5A 3U7QB 3OIWA 2F43A 1P72A 2V7TA 3FPEA 1MLDA 3T5TA 3A37A 5GANK 4AUEA 4NENB 4QXRA 4EITA 1E8MA 5LIRA 2EATA 2QYTA 1WZEA 1QYDA 3BA6A 2LWIA 3URKA 4TLDA 2BW0A 4ENWA 2FTKE 4C3VA 1GUAA 2J4FA 4Z4GA 3QJYA 3N74A 3C7KA 3DV2A 1W34A 3EGDB 4YC7A 1LSJA 5DM1A 5JLAA 1OJ7A 3THXA 3HUFA 1NPTO 3CX8A 3QW2A 1WW3A 3GJZA 2QUIA 3EUWA 2YJ5A 4FCTA 3M7IA 4S0XA 3C7CB 1SCIA 4QOSA 4M2LA 5ALZA 1QO9A 3LBFA 5JSYA 3HJWC 1JG6A 1M2GA 2F3QA 2HBRA 3K14A 3LQYA 4KQXA 4J2TA 5DGHA 2GZMA 2NU9A 2AR9A 1B26A 2F9MA 3FA2A 3KZKA 3DZDA 1U9CA 1XCJA 5BT9A 2HHCA 1HY3A 4MITA 3EA4A 1XWWA 1R0LA 1UPFA 3N2GA 4ZI7A 3DCYA 4U7PB 3AVXA 5G0VA 1DQRA 3QUSA 5T4FA 3VV3A 3RSCA 3WWDA 3IP1A 4CR7A 1EE2A 1XEAA 4ZP1A 3LL4A 2H9AA 4CDGA 5JFOA 1B76A 3PB3A 2IIPA 4C0AC 1KI2A 3BYZA 3D64A 3AQ4A 2QJRA 4G24A 4K87A 5IVHA 2GM3A 2Q9AA 4HWPA 4PXSA 3CBGA 2BRUC 5KSWB 5DGDA 3MJTA 4RHAA 4Q9IA 5E9AA 4YX9A 5JZMA 1L7RA 2BAGA 3INRA 5IX8A 1BHQ1 4F8EA 4HH0A 3TKYA 1R4MB 4N0MA 4FD3A 2FSIA 3CZPA 2FPIA 2Q29A 1JW9B 2AUTA 3B6ZA 3ILSA 3O91A 3DAPA 2LPMA 3QPCA 4JB8A 4GPD1 1T2UA 3P9CA 4TV8F 4CLHA 1W36B 1NJFA 3D2BA 4UHDA 2QMUA 2Q3EA 4IHJF 3WWOA 5MHTA 1NSYA 1RZ3A 3E9MA 3G1WA 2WZDA 5HIMA 5JISA 3QEAZ 1S3IA 5CEJA 5EZQA 4Q9KA 3B6NA 2HSDA 2OCIA 5IYZA 1E2KA 3NP9A 4ZEVA 2JCVA 1V8OA 1K8ZB 2D2FA 3H5RA 3OEYA 5GP1A 1DQYA 3P0EA 1Y34E 5C32A 1ZCBA 4XIGS 2ZUFA 2WTXA 3ML1A 3OZCA 4FMDF 1J2RA 1ECJA 5AVSA 4P3YA 2NZWA 3CO5A 3O8NA 2QPOA 4ZJUA 4RHUA 1P6QA 1RLTA 1QZTA 3T34A 5A1TA 5KOYA 4YR9A 3WB1A 5KQGA 4IO0A 2BGNA 4WZBA 3PHBE 1G5QA 3K5PA 5DYIA 2AOXA 5HG0A 3K9FC 4G23A 4Z3KA 1RTKA 2B1JA 2G77B 1LI5A 3GEHA 3MSCA 1G6KA 4ARZA 4ENUA 5GINE 2V7UA 1XD2B 1GQ2A 1MKYA 2IYEA 3A25A 1E9SA 3I73A 4KI7A 4NEQA 1OWPA 1ZL0A 5BYJA 2IXBA 2JJQA 3AFOA 3GEIA 4YAFA 4W63A 3V8PA 3C6ZA 3HRIA 5BWBA 4G41A 1JFFA 1RAHA 2GD2A 2GCPA 3G5TA 4QECA 1QFYA 1E2JA 1YI1A 2WUGA 1QX4A 2WYHA 3D8NA 1PDOA 3QPAA 4RBNA 1U2SA 1HLPA 2DRIA 2PCLA 4QDXA 2O8EA 1DCFA 5KMGA 4ZCIA 2R8EA 5FQNA 4ESHA 1KETA 1ZSNA 2ORIA 2L19A 2O54A 1EB9A 2PXCA 5DM2A 4BT5A 4N65A 1KY2A 1T9ZA 5M3BA 3RWBA 4DWWA 3RT1A 3OIVA 4HTFB 1TZ2A 1U8FO 1CZRA 4GWGA 3C3WA 2NXCA 4KR9A 2RBKA 4YRAA 3IDFA 2VNHA 1GQOA 2WWGA 3AKCA 2AF4C 4X84A 3QYPA 5JD5A 3ZWOA 3EZYA 1HA3A 4EJSC 2IYPA 3QXHA 2RDMA 4DYDA 4ITRC 4QTUB 1BVYF 2C95A 5LOVF 3X1WA 3H9CA 1YQDA 5IAGA 4N01A 5C34B 5C31A 3ZN2A 3IBGA 2WRZA 2BFDB 2QL7A 3O3OB 2DP4E 1MC5A 1FTWA 2BY4A 4KO2S 1JDTA 5K8UA 2AT1A 1H8EA 3PD1A 5F7XA 4FYXA 1JIQA 2XRYA 4PC2A 4YJDA 4Q9LA 4M0PA 1QHGA 1DQNA 1SN7A 2N3ZA 4EF6A 1UP6A 3UBTA 4RULA 4P4SA 2VBCA 5ER9A 2O06A 5HGJA 2VPIA 5A3SA 4L4UA 3T35A 2NMUA 3EHEA 4DADA 2A6PA 3TL3A 1WXXA 1A4RA 3G7SA 4IDGA 1J0EA 3U26A 4H6VA 4IUBS 3QLTA 2NXNA 1WLSA 2ZIWB 1WXEA 3OMXA 3G68A 1XYVA 3W7BA 2CBZA 4C5CA 2JFBA 2GH1A 5LKAA 5JSZB 2VDRB 5CK5A 4UBIA 5HBRA 1U5AA 4UNRA 3BE4A 2IX9A 1MRZA 4MYHA 3EG9A 2OECA 3QMMA 1G2IA 5F64A 1FSZA 4N76A 2FMXA 4I4IA 1J22A 1GGEA 3GOHA 1WKBA 1K4KA 4P82A 3UZUA 3VAAA 3VJMA 1FNJA 1MB3A 3AH8A 4FE4A 1T9KA 4QATA 5EJ2A 3V4ZA 2YWFA 1XPRA 2PHZA 5FUBA 3NGMA 4F93B 4O4HB 4QEDA 5DYNA 4DRYA 3ROMA 3IEMA 3AUKA 1QK4A 4DUYB 1DRWA 2I7XA 3TI9A 1KEZA 4Z4HA 3GP8A 1F17A 3NKLA 4QULA 3BD8A 1BGXT 3G49A 3GAMA 3H5VA 2FPSA 1KAMA 2IQIA 1FUUA 3KR9A 1DEHA 5FEMA 1TMYA 1DBSA 1UEJA 1Z56C 1I4DD 4KREA 3RYHB 3AKYA 3AWDA 3SZUA 3P9QA 2EFHB 1LQ2A 2D62A 4ZYXA 4U0KA 1EBUA 3N3AC 3TW8B 3HK2A 2MTBA 4ZYYA 3ZWQA 1L4MA 1PN3A 2PKRA 1Q92A 1QC5B 3EBLA 4P38A 1K5GA 2SKCA 3O8OB 4G5FA 2C20A 4WK0B 5K6AC 4KRYA 2DPGA 3CMMA 3JWEA 2B36A 4EMUA 2XVXA 1PZMA 1ZGBA 1P4SA 3ZIUA 2AOUB 3GPBA 4CL2A 1KKUA 2AVDA 5F1PA 5JYEA 3TLZA 1NW9B 3PUZA 4MRVA 4YONB 5JJIA 1XLWA 2P3LA 2G9VA 3ZVRA 1U0OC 2FSUA 4KQHA 5EJ6A 2FR1A 3O26A 1XQVA 4UEWA 2Z9BA 1WW2A 2SBTA 3L8MA 4CKBB 1E6LA 3OE7D 4JLPA 1VPWA 1VA5A 1RI5A 2NPOA 3IALA 3RG2A 1L7VC 3IP8A 1ZCZA 3IJRA 1FQWA 5ESRA 1ZC3A 2E82A 4YXWD 1W42A 4IDNA 2F9LA 5ALJA 4Y0AA 4UHBA 1I7QB 2YHBA 4FYWA 4FW8A 4QU9A 2QM3A 5DHTA 2AFHB 4AWXA 1Q21A 3JY6A 3EXHA 3HEMA 4H7KA 1VQ7F 1G20B 1I94B 1V4NA 3CVVA 1KHTA 3QM1A 4TROA 3MJ4A 5CB8A 3DFKA 1YQEA 5EMHA 1R4ZA 3R5HA 3EVTA 3OVMA 3NFYA 4HDRA 4IZOA 2V03A 3KB6A 3O90A 4LGVA 4YJFB 2OYCA 1XNGA 1OXMA 4U2CA 1E0JA 1PYOA 4IHKA 4I9UA 4L22A 5FBWB 4O2AB 1PJCA 5B58T 4EHBA 5I7OA 5FBQB 3TLMA 4I66A 4LHSA 2WHPA 4B8YA 4CIXA 4CKWA 1MTZA 1YT5A 3CJTA 1J21A 3ENZA 2X2FA 4TT3A 5TMPA 2QZSA 4K46A 3EDRA 5KHAA 3GNLA 4PEVA 3IKLA 1YRBA 1XWFA 3H1TA 1VQ5F 4JMPA 5JD3A 4OCZA 1LCIA 2DM6A 4IV8A 4W7HA 3K92A 3QE4A 2W83A 3MWDA 3PUIA 4V39A 1G5PA 1CQXA 1YRWA 3V1MA 3VSCA 4DVGA 1E1YA 1MR3F 3RVLA 5FOQA 3N4YA 2GETA 4I1OA 3VTFA 3VKWA 3VJRA 1NUPA 1JG1A 5LA6B 1Q0ZA 4J0HA 3F6EX 1PG5A 3QMPA 4I08A 1EP1B 4P9NA 4EUFA 5GIPE 2LKCA 1H1LA 1NZFA 1T9GR 4GICA 3VDXA 4AQYB 821PA 2FDXA 3KKKA 3CMCO 4YAWA 3VJKA 2W2LD 4Z53A 3OQPA 2ZSKA 1YOVA 2IBTA 4UAVA 3I9FA 4RDHA 4YS6A 2RB5A 3D0KA 4EBBA 2JGKA 1XVVA 5HXZA 4O4LB 1KGSA 1NMYA 1RC1A 2EZ9A 3K9NA 4K2AA 1UKCA 1PJ2A 2X2OA 3UA3A 3ZQ4A 1YMVA 1NFRA 2DC1A 2N9UA 5F12A 3OI7A 3KJGA 2HA6A 1YQQA 2CDRA 2O2EA 2H5EA 3BILA 3VAYA 4DMGA 2Q0HA 4EI8A 3KKOA 1DKRA 1GUYA 3I5UA 4Q05A 4EFLA 2EARA 1QFJA 4Q12A 4XM1A 5JY6A 3LK6A 2Q1WA 1MQ8B 3H97A 3LIPA 3WGJA 2Z8ZA 2BTUA 1QUFA 4JSTA 4F56A 1JAYA 3LXMA 4EW3A 3DBVO 1LB1B 2AEMA 3ZY3A 4G5GA 5SZJA 3OU2A 2HK7A 4LFAB 1AS2A 2GM9A 2ZANA 4HFRA 3H9QA 5M2QA 2VHXA 3RODA 5IAEA 4OHMA 1TFUA 2XT9A 5BN3A 5LNK1 3VVBA 1GYPA 1G63A 2EZ8A 1ONPA 3O75A 1U2TA 3GI1A 1QHYA 3RIXA 1I13A 1U5CA 3P2OA 1CUGA 1RQ7A 1P7VA 2BKAA 2ZUVA 5K3CA 3LCRA 2OR3A 4P6VF 1AQIA 1OAKA 1K5DA 5EKXA 5HR5A 4MWSA 4QGHA 3W6PA 3T5PA 1U80A 3F8SA 4MEAA 2G1PA 2AE2A 1BWPA 1C3VA 2FX3A 3O74A 1LJ8A 3O9MA 3WMXA 4FFRA 4QJ4A 5FUMA 4AUMA 1H85A 1P9LA 4C1NA 4ML3A 1U3FA 2I0FA 2QW0X 5EIFA 5AUOB 5TPZD 1OZAA 3DT9A 2X9VA 1XTQA 4NCHA 4NECA 4XYMA 1L8LA 1VE7A 1YTLA 4NZNA 2EDCA 4DQUA 3C5VA 4G5YA 3OLZA 4QXAA 4WZZA 3VDMA 4ZGBA 5LKRA 2B1IA 4RC9A 3N0VA 4WI1A 3PCXA 3TTYA 2B4YA 4PPFA 3L1IA 1KVSA 4C4ZA 5B6JA 1FP4B 1NFFA 2V5VA 3AM4A 3KXDA 3LPDA 1CRWG 3RVNA 3UHJA 4WXEA 1VLQA 1U7UA 1KFEB 1SH7A 3HKBA 2OO5C 3G2OA 3E2PA 1W5SA 3GN1A 2FAXA 5EL0A 3LT1A 3HL4A 4BASA 4QDZA 1UFKA 1CNMA 4F9TA 2ESRA 1OXXK 3D3NA 4HAXA 4S1WA 5JVDA 2NADA 2WDZA 4FKMA 1V5IA 3JQAA 4U2FA 4Q7QA 2FWNA 2JK0A 2VYND 5IAJA 3IVGA 4MS1A 2QZ4A 4R3UC 4AZTA 1UKYA 3Q3VA 3Q7EA 5P21A 4FYIA 1REQA 2VAWA 4AXBA 2CFOA 1VLLA 1JWLA 1JG2A 4L4RA 1FU8A 1SNYA 1HYEA 3WE7A 6PFKA 2O05A 5AJUA 1DWQA 3D8HA 1CY6A 2QQEA 1UXKA 2PEZA 2BHSA 3I9V1 1I7NA 1NQXA 3VYSB 1IV3A 1R0KA 5LQKA 1G17A 3R41A 3VR4D 5LPNA 5M5BA 3FSJX 3E15A 5LR6A 2YUIA 4CKYA 5ALYA 5B57C 4M0LA 4NCBA 1VE9A 3T95A 3TH5A 1JDSA 3MRTA 4LRUA 5EHXA 1XNHA 5EQTA 3ILXA 2V97A 3KWJA 1KVTA 1RLJA 1PZNA 2DQYA 2Q9UA 3EGXB 3FTNA 5ECYA 2D7DA 3RU7A 4EUHA 3F49S 4XJTA 3CEHA 3T5DA 5HKBA 1YJ9F 3PL1A 8ABPA 3CUKA 4WXMA 3GLGE 4UMEA 1EWYA 1YZUA 1JJFA 3E9NA 3SJAA 3JQQA 4O2BB 2PZFA 3OEHA 4P2GA 2X9NA 4UVEA 5LJIA 2YV5A 4GRDA 1DELA 2I65A 1TLFA 1A0OA 2C3MA 2RGUA 3C6BA 4OBEA 1G9SA 3T3MB 2XMPA 1Q83A 1EFHA 3MAJA 3NNSA 1C29B 4XRRA 2DYKA 4YECA 3DPSA 3LFOA 3IO3A 4GLFA 2I9KA 4UDOA 3UXHA 1QFSA 4M8KA 1L4LA 3G2MA 2GRUA 1FRFS 2B33A 1V7ZA 3JQEA 4JC5A 1UEIA 1P0CA 1HUQA 3I58A 1W40A 4OFZA 4XGRA 5T41A 3U3KA 2BMAA 3EEFA 3GLGA 2YBDA 4FDLA 1P81A 4YJGA 1H9AA 4M0UA 4FNMA 2XJ9A 3BIFA 1GX1A 2OYSA 4ZI7F 5HGXA 2DEUA 4BBAA 1T8SA 2HK8A 3K6KA 2XXAA 3HCDA 4L16A 4ED9A 3CPQA 1PT7A 4D41A 1PR5A 1Z2CA 2Z8YA 2ZUTA 2WTEA 3DMFA 2WTBA 4QFDA 1U2ZA 2GCEA 3HTXA 1PDWA 4CU2A 4F5ZA 1OTXA 4O4JB 4RJJA 2IS1A 4L8GA 1VIVA 3CTPA 4QNMA 4H59A 4QARA 4L28A 3OCCA 2I03A 3OLVA 3P45A 1T8PA 3A70A 4FT2A 4XOUA 1EWQA 4A91A 1DL5A 3HLTA 1OZHA 4ISBA 4D0LB 2X8JB 3PI7A 3W0LB 1JECA 3I4LA 2ADMA 5C80A 4RJLA 4BNHA 3N75A 4C03A 1TCUA 1XELA 3BTOA 1U9JA 3P19A 4NBVA 4X6UA 2J5XA 4YRRA 5I9TA 4Z1OA 2D6FA 3I0MA 4NE9A 1AVTA 4JB3A 3IT1A 4N5NA 4LQLA 5EE1A 3O1HB 5U9CA 4Q5IA 4MYTA 2O6HA 3WB0A 2J3HA 4U3JB 4BKMA 4IO1A 5BRJA 5CB4A 4WJKB 1J70A 4CKEA 2QVXX 2ASVA 1JHQA 2XPCA 1Z0DA 3UEOA 3V48A 4DE5A 3B7WA 3G59A 5BSFA 5IKXA 4D6PA 4IUYA 1I14A 3DC2A 4BEBA 2IITA 3IUNA 1ODKA 2P1RA 5AVXA 3BYQA 2UZ1B 4I2VA 3WLFA 4CEHA 3BCUA 1RQRA 2H52A 3GJ7A 2AIZP 4DNOA 4HRXA 1VFPA 5C1IA 4PLGA 4JI1B 1H47A 1YGPA 4N8EA 1F4LA 1TKBA 1R8SA 3ELUA 2B6NA 3IFSA 2J0EA 4W5JA 1EHCA 3RSGA 1VJGA 4MVJA 3V3KA 3VHRA 4D2IA 1CB0A 1RAEA 3M4YA 2YNMC 1NVVQ 3IPYA 3HSKA 4ZD6A 5DB4A 3RK4A 2V6IA 3HO8A 2X2EA 1PRYA 3QX9A 2W48A 1AHHA 1H42A 3EHDA 4G8BA 4MK4A 1KOLA 1JE1A 1VPDA 4WLNA 1DS6A 5B4VA 2P6YA 1Q1NA 1R6TA 1LFDB 2WA1A 2HX1A 3FOBA 4KH1A 1E4EA 4RD1A 4RK6A 4JU8A 4UHKA 4FOTA 5FXMA 1V16A 2FR8A 3MHPA 1W88B 4M1EA 4KQIA 5TY0A 4YA6A 1KEUA 3X2EA 1ZITA 3FYUA 4Z4CA 3U7FB 3JAWA 3EQ9A 3CLSD 4RVUA 4DEXA 4LVNA 2WPNA 1L5VA 1Y3BE 3W5VA 3PHLA 1AUOA 1F2VA 2QN1A 1Y1SA 3ENQA 4A2CA 1E0DA 2W7TA 1ND5A 3CS3A 4QQFA 1MW8X 3IQIX 3U0BA 4TZKA 3JAKA 3K3PA 4MR7A 5IS2A 3TN7A 2UXDB 1CLEA 4TTVA 3CCLF 4DLBA 5MN5A 1XTSA 2NQ8A 2J67A 4DNQA 5E1MA 2PVSA 3L4BC 3CO0S 1XZQA 1OOEA 4ZEWA 3CEPB 1PCXA 3QHAA 2JI9A 2JRLA 2PQ6A 5CJ2A 2WHRA 3QWFA 3C70A 3LY9A 3G2NA 5CX4A 3WV4A 4Q16A 4GI3A 1KQGA 1CVRA 3EZNA 3OLQA 1UDAA 1Q1AA 3RVQA 2ZTLA 4C5AA 3FZYA 2BELA 1LI7A 2Q2WA 2VAMA 3IMCA 2FN8A 3HJBA 4JUIA 5E9WA 3SYLA 1Z37A 3VPDA 3S2UA 4B6GA 4P5EA 4MQUA 3WGOA 3OZIA 4WLEA 4BLTA 1QGZA 3EPRA 4EATA 1ZM7A 1SZJG 3MT7A 4EKGA 1N8TA 2PGJA 4HI0E 4XQ9A 4MVJH 1JP7A 2I4OA 2F8MA 2QMQA 5E2AA 1LBIA 3LHDA 2KW5A 4RY2A 4GP6A 3W3ZB 1TJNA 1TJ4A 4WW0A 4B62A 2QD5A 3I52A 1CE8A 2R6AA 3PYMA 4KSCA 3SFZA 4CI9A 2LZ0A 2IHBA 4WRRA 3MTDA 1XAGA 2ZYRA 3QVXA 4HB0A 2ONKA 2GLZA 1OXKB 3NPMA 5FOUA 5CVCA 2E1RA 3HCFA 4D3SA 2ZCJA 1LS6A 2ZDHA 3JATA 1TM1E 1NVAA 2XUOA 2G7ZA 2WF7A 1Y6FA 4TZZA 2XMCA 4NG5A 4HEA1 1KO1A 5H0IA 4R71A 5JMPA 4F0JA 5MN4A 1VE6A 3MGGA 3ZWVA 3EPKA 3S2FA 4B6PA 4EKIA 1N2SA 3G6KA 4EBFA 1ZWLA 3WGLA 2RHGB 4C0HA 3NPAA 4KOEC 3UMMA 5DIFA 4I1IA 4D0NA 2Q2VA 1RIIA 1XRLA 4UKDA 3UJAA 3PNLA 3EMBA 4BQNA 1SZQA 3ZH2A 4Q34A 3ROXA 3N2YA 1JVSA 3SOPA 3NUQA 3FCAA 4K81B 2VGMA 4RXMA 1FNDA 3AL0C 3NHUA 1E58A 1YL6A 2EZ4A 1PJZA 2DULA 3AIKA 4DWJA 1Z6PA 3FYDA 3MHTA 1X1EA 3AOEC 1GTJ1 1COMA 4N82A 4ILEA 1G7TA 3QH4A 5CCDA 3PIDA 3LIIA 4Y9DA 3M89A 2Y0EA 1YZTA 3OM9A 4XVCA 5G3ZA 2KI5A 3QOXA 5EXEA 4I4CA 4AYWA 1XRSB 4TX1A 1BJRE 2DGDA 4YGXB 2UV8A 4K26A 2IWRA 3ZWCA 2IRWA 4W1RA 4XX1A 1AE1A 3BD9A 2NUTB 5IN5A 3NNNA 2RKOA 3ZS8A 4DBLE 2QLBA 3J7TA 4WOKA 2F4NA 1ZK0A 1PG2A 2FPRA 1IG3A 4BO0A 1FVHA 1BEZA 2BUBA 5GADl 3CLVA 3K0EA 3OQIB 1RPZA 3VSDA 1V1RB 1XNQB 2VXYA 4P22A 4LX0A 2YWDA 3IPAA 1FNSA 1ZNQO 1JPJA 4FX5A 4F3KA 1T8UA 2N1MA 2Z8XA 2ZYGA 2YZMA 2GSWA 1YA4A 2LV8A 3TBFA 4IRXA 1GNLA 4PGAA 1ZGJA 5D1NA 4YPOA 3EE6A 3A9CA 4OXXA 4WINA 1CD5A 2WQ6A 4QQKA 4ZN6A 2YVUA 1CLIA 4EZIA 1ZYUA 2A86A 1AHIA 1EXWA 1RBZA 3CZAA 4NJMB 3RIEA 4QYIA 4E6EA 3KSMA 4WFQA 1SQFA 2XB4A 3GEMA 4IEIA 3DO6A 1TKRA 2EBUA 3CN7A 3EFHA 3U16A 1YRYE 1DAOA 3J80M 1SURA 1VHQA 1W75A 1TQ6A 4DYVA 2XF2A 4GD3Q 5GJVC 1FFAA 2G4CA 1AC5A 1CTQA 2IHZA 3LC7O 5FKJA 2ZCVA 4H3HB 5AJHA 4CHGA 1SVSA 4PYJA 4PV7A 1PNTA 2BBOA 3OZSA 3IO5A 4ZOLA 4NNOA 4B74A 4B3GA 3DAYA 1X8JA 3S99A 5LDGA 3P9XA 3UKOA 3OPYB 3ABIA 2WG0A 3MINB 1VCOA 4F8JA 4E21A 1PSDA 5T6MA 2EBHX 3WG9A 3H18A 3ZBQA 5HYVA 2MINB 2H3EA 2UZAA 2XNDD 3EXEA 1WRBA 3B7GA 3LX5A 5AVQA 1NMQA 4LOJA 1QFZA 4EG7A 2Z6UA 2DQ4A 2G5TA 2FQXA 2Q9CA 3F5QA 3R23A 2C9CA 5AHKA 5EJGA 3V7YA 4JI8B 3P5SA 1ZOLA 1E98A 5F9HA 5IAKA 2SCUB 2XV1A 4J0JA 2IODA<