3VOBA

Staphylococcus aureus ftsz with pc190723
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/inhibitor
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 105
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3vobA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vobA01
5JCOA 4M8IA 1FSZA 4WBNA 5C8YB 5CA1A 4EI9A 4E6EA 3JALB 4X20A 3VOBA 4O4LB 4ZOLB 3RYIA 5IJ9B 4TV9B 4X1YB 5CA0B 1RQ2A 4YJ2B 5EIBC 2VAWA 1FFXB 4IHJB 5JH7A 2XKBA 4FFBA 5J2TB 3HKDA 4TV8B 1TVKA 4YJ3A 5JVDB 4F6RA 5MN4A 3RB8A 5LA6B 5LP6A 5BMVB 5JQGA 4HNAA 3R4VA 4LNUA 2VXYA 2RHHA 3JATA 4I4TA 4O4JB 3E22A 1W5FA 3JASA 5GONB 3N2GA 3VPAA 4O2AB 4KWEA 3C8LA 4X1KA 4IIJB 4I50B 1W5BA 5EZYA 5MN6A 3V3TA 4DRXB 3HKEB 2VAMA 3UT5B 4O4HA 4WBNB 5KX5A 5CA1B 1JFFA 3HKBA 3JARA 4U3JA 2R6R1 4X20B 4ZI7A 3JAWA 3RYIB 3N2KA 4ZHQA 2RHLA 3RYCA 4EI8A 1Z5WA 5JCOC 3M8KA 3M89A 5EIBD 5JH7B 5ITZB 5EYPA 5KMGA 4FFBB 5LXTA 3HKDB 1TUBA 4I55A 1TVKB 4O2BA 4YJ3B 4F6RB 5J2UA 5LYJA 3JAKA 3ZBQA 2BTOA 5IJ9A 1RQ7A 2RHJA 4HNAB 5JQGB 5LP6B 4LNUB 3RYFA 3JATB 4I4TB 4B45A 3E22B 3JASB 2RHOA 5CB4A 3HKCA 3N2GB 5M7EA 1SA0A 4X1IA 1W5AA 4X1KB 5IJ0A 4U39A 2BTQA 3ZIDA 4O4IA 5FNVA 4TUYA 1Z5VA 5EZYB 5LP6C 5IYZA 3RYHA 3WGKA 3WGNA 3WGLA 3WGJA 4EB6A 4O4HB 1OFUA 2VAPA 5KX5B 3VOAA 5LOVA 4B46A 3VO9A 1JFFB 1W5EA 3HKBB 3JARB 4U3JB 4DRXA 4ZI7B 3ZBPA 3JAWB 5C8YA 3N2KB 3WGMA 4ZHQB 3RYCB 3JALA 4O4LA 4ZOLA 4XCQA 4EI7A 1W59A 4TV9A 4X1YA 5EYPB 5CA0A 5KMGB 5LXTB 4O2BB 1TUBB 4I55B 4YJ2A 1FFXA 4IHJA 5J2UB 5LYJB 3JAKB 1RLUA 5J2TA 2XKAA 2Q1XA 4TV8A 5JVDA 3RYFB 5LA6A 5BMVA 5CB4B 5ITZA 3HKCB 3VO8A 1SA0B 4X1IB 4O4JA 2GVIA 2BTQB 5IJ0B 5GONA 4O4IB 5FNVB 4TUYB 4O2AA 5IYZB 3RYHB 4IIJA 4I50A 2R751 3CB2A 2Q1YA 4EB6B 5MN5A 3HKEA 1W581 3UT5A 4DXDA 5LOVB
chains in the Genus database with same CATH superfamily
1JLLB 1R1MA 3G71F 3K8YA 5EHIA 3SHFA 1JR3E 1IAQA 2VXCA 3HB1A 3HYCA 3LOUA 4N7BA 3U7JA 3LH5A 3TM4A 4JYCA 1KOJA 5FV7A 4J1TA 2YUTA 1YZLA 3Q3IA 1I6MA 1NUPA 3C4QA 1KAGA 1V3TA 5IJ9B 2WMOB 4MW0A 3KQTA 5DEIA 4AZVA 1T6ZA 4QYXA 1R0ZA 3CNOA 5T3YA 3UHFA 3JYOA 1FNMA 3Q7SA 3UO8B 1FNNA 2FN8A 1F7UA 1WVMA 3B1WA 4JJIA 2PBRA 4MHSA 2GEFA 5H80A 5CGZA 3UMFA 2UVDA 2HRBA 3TUIC 1TEHA 2AQKA 2EHJA 4LNUA 1CJBA 1JI3A 2FP4A 3CLSD 4JB0A 4JL5A 4LQ4A 1WTAA 1ZXXA 3RAFC 1PNRA 3L8ZA 4KPYA 4QPZA 4YWHA 2X9LA 1U2EA 4QHSA 1E5TA 1YDEA 4IIJB 1JBEA 1WVIA 4ND4A 1MV8A 2Q2QA 1B73A 5BV1A 1CETA 3ZWWA 3LKVA 1M6EX 5HR5A 3AT1A 4DDKA 2XZPA 2EZ8A 5C2JB 2QZJA 3L3BA 3RG8A 3ZKAA 2IGTA 1C0IA 1BO6A 2WSIA 4HVTA 3LWVC 1U2RA 5COQA 3WYNA 3C16C 4R9RA 2GUGA 1Z7YA 1I0ZA 3C98A 3MBOA 2HHCA 1AK2A 3ESZA 3VTFA 3Q15C 3W90A 5K0CA 1KEZA 1N8SA 1HYEA 1P73A 2GM5A 2UYYA 3GFGA 4L8VA 2FMUA 2BR3A 1QLHA 2HLPA 3LU1A 2HSJA 2QXUA 3OMLA 4GXRA 2FXIA 4JVOA 2ZZMA 2H2AA 2DZDA 1U7OA 2G17A 2HREA 3FOAA 4UCQA 1XNJA 3F4BA 1HOXA 2YXBA 4FHEA 4CODB 5GMOA 5K6AC 3CS3A 4I14A 4LSGA 3DOIA 4B8YA 4GVXA 2FP4B 4S3MA 4LNUB 4OFWA 1K1EA 1GTG1 1IMJA 5DRTA 1LS1A 4KLRA 5IXJA 4ARZB 4P81A 1YB2A 3OEED 4Q19A 4YGYA 5IWCA 2H2WA 3JQFC 4FUQA 3WIUA 5EAZA 3D6NB 4DB2A 3RLFA 5IAEA 5JD6A 1GUYA 4RPGA 1EFUA 1W8DA 3EIFA 3U3RA 3NAQA 2WY2D 4GECA 1XWIA 2G5PA 1KHTA 2YIVX 4JODA 2D2EA 5FL7A 2F3RA 3E7DA 4ZVOA 3N59A 4YCNA 1GPBA 2AR7A 3QXXA 2ZXUA 1XA3A 1YO6A 2XGOA 1QRAA 1Q1EA 1M2WA 1X8LA 4GYYA 5L7YA 3ZNOA 4UTVA 6YASA 1SXJE 1YK1A 4E15A 3HFSA 1PNQA 4AS1A 1QCCA 3L1VA 1OKKA 1EJ6A 4G5XA 4BNNA 5H16A 3QHDA 1L5YA 1JEDA 3CMEF 2WAAA 1MAAA 4X5OA 5FTNA 3DCYA 1EA7A 2W8BC 1FFXA 3F6BX 3VR2D 3D7SA 4MULA 4G4WA 4C3ZA 3RS8A 3OTQA 3C8DA 3KKOA 1UDWA 4I4IA 1Q84A 1VG0B 2L19A 2WWGA 3ADOA 3G7SA 3JU3A 3ZCSA 1GDDA 2JLZA 4DKJA 5JECA 1OQAA 1QH1A 4E51A 4FHCA 2C61A 1F8YA 1GUDA 2YY5A 1Z5UA 1GADO 1FJ2A 2DETA 1FDVA 4M87A 4ESOA 3FVQA 4LE0A 1JQJC 3FNEA 3MMXA 1M2VA 5IM4F 4W5RA 3QTTA 3Q9UA 1A9XA 3NEAA 5JU6A 1SK9A 2V97A 1KQSF 2C2BA 5ILQA 3DMFA 2QTCA 2QENA 4QRIA 5JCOA 1U4SA 2WYVA 4F04A 1TMKA 2RK3A 5T4FA 2XOEA 4IIBA 2VBCA 3M4SA 4H17A 3ZU2A 3VI6A 2VP5A 2CBXA 3EW7A 2ZROA 5EKDA 1PFKA 1VPVA 1W96A 1YK0A 4S05A 4PYNA 3CJRA 2JAWA 3RS2A 1J0EA 4EX6A 5IPFA 2NSLA 4AJNA 1H47A 1YL6A 1FFXB 1XT6A 3T4XA 2OHJA 4Z4HA 3KXPA 3GZJA 1E7SA 1VE3A 2YJZA 4FHFA 3RIEA 3QU9A 1HLDA 3C8UA 3QE2A 2NU8A 5LP6A 2HBQA 4BW0B 3FF1A 4AMYA 2H0RA 4DQUA 1P2UA 4PG8A 1QH1B 1ZW1A 3I5YA 4NK5A 3OLYA 4MV6A 1VIAA 3ZQKA 2A0YA 2PFKA 4N5LA 3MQWA 1EXNA 4XLZA 2GAJA 1SUIA 3F7OA 4J4BA 1M2VB 1X9IA 2WJVA 3E27A 4N3CA 1A9XB 1N1DA 1SJ9A 2C9CA 4M0DA 4NNJA 1HE5A 1QZTA 3ZH2A 2ID8A 5JW6A 1Q1QA 1YQGA 3P2JA 2IPMA 4MUXA 4HH1A 4UVHA 2JCYA 5DX1A 10MHA 4E22A 3U3JA 2H8CA 4AYXA 4K8RB 5EIFA 3LF1A 2ODTX 1ESEA 5I5EA 2OYSA 3ZI0A 4KACA 4RIIA 4WJKB 3D6UA 1FFSA 4WLNA 4KQ2A 4KUHA 3K2XA 4AN0A 2EWVA 2VDNB 5GGYA 3AM1A 1APBA 4X45A 3AIOA 4L9WA 2HV9A 2DHRA 2GGSA 4HGPA 2PPLA 1A88A 1JMVA 1NMZA 4KRGA 3IE1A 5I7EA 2H1RA 3EJWA 1O9GA 2GZ2A 1UWCA 2NU8B 4E09A 5LP6B 4K9MA 4EHHA 5FB3A 2HADA 2WTXA 4QWWA 4CEIB 5JFGA 4ESVA 4OKSA 4ZK2A 4LDNA 3VU3A 2R8OA 1EVYA 5AHXA 4OK6A 4B17A 1JIKA 2HA5A 1RWWA 3HUFA 3RS5A 4BCBA 1SXPA 4KWCA 1JPVA 4HR7A 2WJWA 3ZY4A 2QAGA 1ZUNA 2CVHA 5AI0A 4C0SA 5KZMB 4JUCA 2QZPA 2CNKA 2H29A 4HDCA 2JLAA 3H1GA 1PTJC 1CU1A 1ZD1A 2AR0A 3G2QA 3HACA 5BUCA 2OEPA 2BFBA 2PX5A 2WIGA 5GJWC 3VYRB 1JJVA 5T7BA 1P9NA 4G1CA 4EYKA 4FNGA 1JIJA 3QTLA 4FYHA 3X1KA 3RC2A 3RNOA 4MYDA 3I01A 2FPXA 3LS2A 3H2JA 5KTMA 1ILEA 4XB1A 2HUNA 1FDUA 3W8EA 3UTCA 1PKXA 2GHTA 3DP7A 5CA0A 2QU7A 2JFUA 4FZ5A 2PMEA 1YCHA 1VHQA 1PFQA 2CLOB 3KZMA 421PA 1GNTA 1BCSA 4NC9A 4LYGA 5KVSA 3WWDA 3OI7A 2ZI6A 4GNKA 5D5PA 3GRCA 5DTEA 2CL6X 2HA6A 2ZDHA 4J43A 5DN6A 2YZNA 2W6JD 2VCYA 4KO3S 3NTQA 5IBRA 2G9VA 3KZ1E 3IEQA 4DLPA 3PAFA 1FSSA 2Z3VA 1UQRA 1ZUNB 2QAGB 2RFLA 3LQ2A 3YASA 1LU9A 3ZHZA 2OQRA 3WWPA 3BA6A 1USWA 1ZH0A 4NDAA 4OHUA 1EJ2A 1P2GA 1PO7A 3EIXA 4LDQA 2QGFA 4QFMA 1F0PA 1JU4A 1BJTA 2C7PA 1TMOA 1P1KA 1XVTA 2BFBB 1JWAB 2WKWA 3R7NA 6REQA 2I0FA 2C4HA 1QWSA 1UBHS 2IODA 1OFUX 2JNWA 2HA0A 2O1SA 4INAA 5CW1A 5KC9A 4MW6A 4QGGA 3ISVA 3PI6A 4DDWA 4Q93A 3BCRA 3FCUB 1GQ2A 2E6KA 2H0QA 3CU5A 4BQRA 2XNDA 1PR6A 4YYZA 4X60A 3FKSA 5CA0B 2JGDA 4EKIA 1J56A 5SICE 1L5LA 3M5CA 1LS6A 2C5AA 2CNDA 1MG5A 4D9NA 1A76A 1U9ZA 4ML3A 1BCSB 4FGKA 1B3BA 1YWGO 2HBYA 2NAFA 2QB5A 3BKWA 3JWHA 3ETLA 1QJCA 3BTSA 2ZCVA 3TGWA 2FWPA 1XA4A 1MPXA 2XZOA 4XOIA 2GB4A 3EIUA 1YQDA 3F5FA 5LOVF 2P91A 1BU5A 3BVPA 2BI4A 2ZUCA 3WLEA 2REBA 5IANA 3LX5A 1GU1A 4MINA 3PF8A 3B3GA 3O95A 4YO8A 4WRRA 3LF2A 3Q7QA 4L0CA 1N7HA 2NT3A 4QJ5A 3T9EA 6CHYA 1Z0IA 1SRRA 5B7GA 6REQB 2EYQA 5ARDA 2XZLA 1OWMA 4S1WA 4FVTA 2XV1A 1E5XA 4B33A 2NZVG 2ALEA 1ZMTA 2HCRA 4NX2A 2I34A 1RPTA 2OUIA 4M0KA 5E0OA 1C4OA 1AA6A 3E15A 1C5KA 1SUFA 3AG5A 2BZSA 2YXDA 3D3QA 4RPCA 3OZFA 2JGDB 4L0DA 3T9AA 1CUCA 3OD1A 4ZAWA 1K7XB 1NA5A 3A4TA 2RIRA 4HCJA 4J0EA 4JJ6A 4F3CA 3AR8A 3BXZA 1EDEA 4D8TA 1BSVA 4UULA 3IR6A 1P7YA 2C1EA 3X1ZA 2WNSA 3ZCRA 4NU0A 1E2FA 4JSYA 1IV3A 4XGRA 5NLLA 1GT6A 3CUSA 3MUNA 3OUUA 4MTLA 2OZLA 1XFAA 4MITA 1TM7E 2IW1A 3C4VA 2B8JA 4BX9A 5K8JB 2BTQA 1PGOA 2E1RA 2IUTA 1V71A 2ZYAA 4LMPA 1ZD3A 3ZGLA 4TWRA 1EK2A 2ADMA 1GTSA 3D8BA 1YRQA 4X61A 4KDEA 3T9BA 1DC8A 1S9HA 1SZPA 1XD9A 2R1UA 3RSGA 4QU0A 1SQGA 2A6PA 3MGKA 3QI2A 3CNHA 1CS4C 3EARA 4BQOA 1FSGA 4G0WA 1XCGB 3TZBA 1T2CA 2VWGA 3CLVA 3ZOKA 5C8YA 2QQFA 3FIUA 4YI3A 1EDZA 4A3SA 5IEBA 5BOSA 5IAKA 3AR7A 3QMVA 1EVKA 5AKIA 4DUZB 3L4SO 4ASUD 1S2MA 3H7AA 4XCQA 3EASA 4WV3A 4JXXA 3S29A 4RTRA 1ACMA 4W6ZA 2KM1A 3BQ9A 1F51E 3A58B 4GXNA 2JFVA 1MJFA 2KB0A 2BCEA 5FORA 2IBSA 4OLAA 1TYAE 3FJ1A 2NXNA 2DKOA 1T1IA 5LP6F 2RJNA 3ICWA 4K05A 1ML4A 2C4UA 2OZLB 1DCFA 4HZIA 1GQRA 4I5FA 2AA3A 4BATA 1G63A 3L9WA 4GDMA 1HBJA 3SSNA 2GASA 5DFAA 2BTQB 2O7QA 1NW8A 1W1WA 3QXJA 2I54A 1POXA 4HEA6 4MDFA 4ZHYB 1KAMA 1IJKA 1DO8A 2ZJ2A 1V41E 2W2PA 4FFRA 5FYQA 3AVWA 1HR0B 1N2XA 2G06A 5EKXA 3RRMA 1CY6A 1QCDA 1YZUA 4BFZA 1EUQA 3ROPA 1VCHA 3KVNA 1U8EA 4YXWA 4FFNA 4TXJA 1KERA 4IHKA 3COPA 4IIEA 1T5HX 5C8YB 1PNOA 1U2SA 3E1KA 5FUYA 3TSCA 2PD4A 4U2DA 3Q8HA 2YL2A 1QIEA 4GO1A 2X22A 2IYFA 4KR9A 1JVBA 1AMNA 3IB6A 2G1UA 3IODA 1N92A 2QLJA 3D3JA 3GJYA 4HYTA 1MNQA 1HZZA 3TLCA 2F9FA 2CLFB 1H42A 2AR9A 4FZJA 3A3NA 1COWA 1L3IA 3AU9A 4ZA2A 3G9XA 3MILA 5TQJA 4AJ2A 3CZMA 2YZKA 4Y98A 5C51B 2Y05A 3OQJA 4MV8A 1I5OA 5C80A 2YIJA 4TZZA 1CQPA 4KO8A 5IAJA 3RC8A 1HYBA 3QX8A 1PDVA 1G19A 3RF6A 4CKCA 2NGRA 4NOMA 4C7OA 1WXDA 1HYQA 4WEQA 1UL1X 2QTAA 4M37A 1GM5A 4AG6A 4DRYA 3IT1A 1HUQA 1RDFA 3DMRA 3LY7A 2Y9PB 1K27A 4YREA 4XWKA 4W8HA 2J32A 3HR8A 3A2NA 1EQUA 3I9OA 3VTZA 2IOFK 1P60A 4WLVA 5LQJA 3EPLA 4C7MA 1YF3A 4O29A 1PIWA 3GYQA 2VDQB 2Y1GA 3GPCA 4JOCA 5CNJA 5KKNB 4GG1A 4O2RA 2VF2A 3PNKA 1EWVA 3VTIC 5SY9A 5TT0A 1DG3A 2WZQA 4WNAB 3KG2A 3PKIA 4M49A 4Q4LA 3ANTA 2CSXA 1P17A 4A2WA 4BT2A 4MWTA 3EH1A 4G88A 1U8FO 4JJGA 2Y6UA 2ZR9A 4HMQA 5DXFA 1AURA 4CM5A 4ALNA 2AN5A 3IJEB 1A98A 1IBSA 4JIGA 3IQFA 3ZDZB 4D0GA 4LHXA 1QTQA 4N01A 3BXGA 3FJYA 4LRWA 4CKCB 2CBGA 1EESA 1NTRA 4QXOA 2FJPA 5EFOA 4DLXA 5L95A 1R9JA 3PEWA 4C7OB 2AZ4A 4IQ8A 3HY4A 4L8YA 4NV0A 3WGYA 5BR4A 1B4DA 1DU4A 3NJ8A 2O52A 4R71A 1Z5ZA 5JDIA 3CT6A 4LCKA 3ZU5A 3PEFA 3PRYA 4FQ5A 5ENVA 4YMTA 1E2QA 1LC0A 4GU5A 5A71A 1L4EA 4ROTA 1OGYA 2PSJA 3EIEA 3LPAA 1MOPA 4JL8A 3WGZA 3FUUA 1NAHA 3ESBA 2X8JA 4D4IA 3JVEA 1DX6A 1IXSB 4Q7LA 4GBED 4RMGA 1ODFA 1K63A 2WTMA 2QGNA 4RH1A 3FDZA 3W8RA 2Z08A 3CSSA 1M3SA 5T3UA 1X9GA 1AKYA 1QVVA 3PENA 5TX7A 3ZGOA 2WSLA 5HJ2A 2V1XA 1SHUX 1T0UA 1SZDA 5AW6A 5KCZA 1CR1A 3ZWNA 3L5KA 4NPAA 3AG6A 3UGQA 2VJBA 4ZVVA 4B3CA 2H8KA 3IQXA 3OHSX 4KFTA 4WFIA 1J33A 3W34A 3V7QA 5IDYA 2GTPA 3FGZA 4NYMR 2Q5FA 5T4BA 5E9JA 3W77A 4AF8A 5KNDA 2EL7A 4BKPA 2WYUA 3ZVKA 3HYLA 3KOMA 3Q7PA 1OUMA 5KQSA 2P6RA 1VJDA 2P69A 4E46A 2M1XA 1E20A 2W2XA 5JMWA 2Q9UA 4E88A 5CG2A 3E61A 1D2CA 3HKEA 1K89A 5DI3A 2EIXA 4BWVA 3EPJA 4PZ0A 2Q29A 2ZJ1A 4M7PA 2IQQA 3IKFA 4EI9A 2X8JB 4KX3A 3IOMA 1RE1A 1MDBA 3NKFA 4ZCPA 3SVZA 3ZDYB 1EP9A 1T4GA 4JUDX 1XZIA 4BMVA 3FDZB 4C0JA 4C21A 4P1ZA 5D7BA 1FOEB 5EWRA 2HX1A 3P96A 3VNAA 1WUIS 3CMMA 1PWHA 4KVFA 3T5CA 2PZJA 1CB7A 4IYRA 1IZZA 2CJPA 3H83A 4MP6A 4PEVA 5HS4A 1CEYA 3EY9A 2AE1A 2H2GA 4Q3EA 3CCMF 4N8DA 3EYAA 5F3WB 1R18A 4C88A 2RHHA 2FSPA 3USZA 4CIYA 3ZCUA 1U99A 4ND1A 4PE5B 1EXVA 4K88A 4N0QA 3AL3A 1U65A 2WKSA 3HABA 1DEKA 3DLPX 4YP1A 5KIAA 2P62A 4J7XA 4PZUA 2PZFA 3Q41A 3HKEB 4XQCA 4ZAFA 1W76A 2WU1A 4BNLA 4GM1A 3RADC 2PEYA 9ATCA 2FFQA 2YMMA 2E4VA 3HWRA 4IKEA 2RC6A 1LJLA 3DL4A 1NUQA 1HQKA 5HJEA 1SKYB 3M82A 1M2OA 1WSAA 2AEFA 3I8SA 4LCEA 3ZOPA 1VMIA 2O06A 4GPAA 4PIPA 2D5IA 3K6RA 3AW9A 3HJCA 3K0FA 1YJNF 1JSLA 4HX5A 3UAWA 5TIIA 4HUQA 4Y2VA 1ECFA 1ZGJA 4UE2A 1EFTA 2H4YA 3H2KA 5CB4A 2G9RA 3QWBA 3R2JA 1QP7A 3QBDA 4JP2A 4I1YA 1NOKA 4TZTA 2Q5CA 5EE5B 4P92A 3V5NA 3VKGA 2VT3A 1GGMA 3FHCB 2O5EA 2P5TB 1YVUA 3AI7A 4OMCA 1KPIA 3INTA 3PJDA 5L6MB 2IYOA 1J23A 4JQYA 1KSHA 3OSZA 1U9CA 1PZFA 2PK3A 3DDSA 1I14A 3MVEA 4PQYA 3BDAA 1BRTA 3UMJA 2E6UX 3HJNA 1L8QA 2VAPA 3B12A 1Q74A 1YIAA 3O7WA 5ICFA 4MLZA 2NZXA 4W5WA 1V6CA 2Y68A 3IEXA 1U0FA 1Z18A 3HV0A 5DKFA 4Q1FA 4BT5A 2QIPA 3RUFA 1M5RA 4AB1A 3L4JA 2DLNA 2M9MA 1G3RA 1QIHA 3DMNA 2ZYRA 1CVRA 5BSKA 1GRRA 3ILSA 3HGTA 2WHQA 1G20E 5BQ5A 4E32A 2W4QA 1CJCA 3AWDA 1P5ZB 3IVGA 1M2OB 3JTMA 4HDRA 2NMUA 4UFPA 1G3QA 2O5VA 1I32A 3EGXA 3GEGA 4KXVA 1G8AA 1VYHA 3KUXA 1P2VA 3K0FB 3N7UA 2IIQA 3N8DA 4Y18A 4Y9DA 2C9ZA 1BGXT 5THXA 2OWEA 4HUQB 2XT0A 5F7XA 3OONA 4B81A 2HAEA 5CB4B 3S7TA 2OO7A 3EPRA 4DMCA 1OY1A 1RQLA 1P45A 4Q00A 1J24A 2OENG 4PO8A 5JCPA 3PNLA 4OQLA 4RVSA 3T99A 4CF4A 4CXMA 4K86A 4LHYA 4BLUA 4OJKA 1YVRA 1VL1A 2PGDA 2XTNA 3IMKA 1J99A 4FW8A 4K9SA 1ZS9A 4KGVA 1HKUA 3A3KA 3EVBA 4HS4A 5SZHB 3IMFA 3IAXA 5CFPA 4YDHB 1M2HA 2WLSA 4HDRB 5A0TA 2JCXA 3LUGA 2CK3D 5B7NA 5M2QA 1DE0A 5M29A 1CZLA 1X7XB 3F3SA 2XVAA 3EGXB 4G37A 3GEPA 4MWOA 3WRXC 4WPGA 2HQBA 4KAAA 4MAFA 3RB8A 4BT4A 3JR3A 4HMPA 1OTHA 3CCJF 2QVBA 1L8AA 3T7JA 4P5DA 1CUFA 3C1UA 3D02A 3RVNA 5AOAA 3UOAB 1EVIA 4R51A 3A7EA 2W2LD 1K06A 2LGJA 5K5EA 2JCGA 1Y3DE 3L6CA 4CM4A 3PNQA 5HP8A 4EVRA 4IDFA 2JD2A 1YB4A 3WGGA 5EE1A 3HXTA 3I39X 2DUWA 3MSCA 3G1WA 2XUDA 4R98A 4OB6A 5SYAA 5I7VA 3KEOA 5CX4A 2XITA 1K9VF 3G6WA 1IWPB 2FW6A 3JQQA 3WLRA 4NR0A 1O9HA 1XQ1A 5LNK1 3AKYA 5BR8B 3SIPA 4UBIA 3UWSA 3HHPA 2GARA 1E63A 2VRNA 5EJ9A 1O57A 2H85A 4LJ4A 1FA9A 2G5CA 1DI0A 1VZ3A 2PFSA 3CGWA 4QL3A 4F3YA 4RZQA 3QOYA 4YLEA 4ZV4A 3EMKA 1G5HA 4FQ8A 1FTYA 4R7TA 1XEAA 3T0GA 4JXZA 5TPWA 4DCMA 2FSIA 1A9RA 5F76A 5HW0A 3MJFA 1K7FB 2F3PA 2CGEA 2QM7A 1ONBA 4O08A 2VDVE 3HJRA 3MFYA 4Z3DA 3JAMA 4YHHB 1H3EA 2ZBFA 1JQLB 1O03A 1J8VA 1RI5A 3GLHE 2CLMB 3KR0A 5C8ZA 5EMMA 1USVA 2MOKA 1KIMA 1THGA 3WTCA 2K4MA 4CM4B 4ADSG 3VJRA 2GF0A 1JU9A 2QPLA 1FDTA 4P80A 4WXPA 1WY7A 4INOA 5HKBA 4EZIA 5SV2A 1Z8FA 4INZA 1F0KA 1NMXA 3CJQA 1VI2A 4LBYA 4RA9A 3HJWC 1GILA 2EBUA 2WHYA 3BSFA 5F33A 5FBZA 4FEYA 4QQFA 3DCNA 4R1OA 3CCSF 2OA0A 5C46F 4ABYA 4ER3A 1HQDA 4JYMA 3TI7A 1XPOA 4F12A 2OP0A 3KLPX 3TTVA 3QHQA 3SIWA 2YCLA 2ZSFA 4N8EA 4ZYVA 1DAHA 3OFNA 4EAAA 3ADBA 4P08A 1AKTA 3C41J 4G5SA 1QVRA 5KPDA 1WZIA 4ZMBA 3M81A 3MINA 1G5QA 3PGJA 4EPTA 4Y0AA 2GM4A 4E0BA 4D8YA 5LQKA 3QPVA 1GGKA 3QFFA 3NMUC 1RAIA 5A3QA 1LV8A 2NO1A 3HL4A 1QVFF 1XQ6A 3E9ZA 3R8XA 3DXZA 4G4ZA 1WXGA 4RA9B 4DZTA 2ZM5A 4EPWA 3VSCA 4HRAA 5SYMA 1UMCA 1X74A 4P35A 1VQ8F 2VRCA 3JX9A 2ABWA 3LDAA 3PNVA 3VFDA 5KDOA 5JAUA 2ZIZA 3IJPA 1AOXA 5C5DA 1L1QA 1JLHA 3CG0A 3WO0A 4PZLA 2YOHA 3GFVA 5BSMA 3JD1A 1E1YA 1GLVA 1ZVKA 1U8TA 3QUCA 4BO4A 5AQEA 2YOGA 3NB0A 2QZ4A 5TDHA 3WBJA 1EX6A 3QEOA 2G83A 3IAS1 4Q01A 1QK4A 3J80M 4K2AA 1YJBA 3QX3A 3EDYA 1GAJA 4B5LA 4IOKA 1MXFA 3MINB 1FMTA 1SOWA 1PWYE 2PUVA 1EP2B 3C3JA 4A0GA 1TRHA 2QTRA 5KHLB 1PNVA 2XDQA 4QUEA 4ZO6A 3NIGB 3RBAA 3JD4A 3A2MA 5CB4F 5I51A 1TU3A 4NBSA 3N2GA 2OL4A 1CDEA 5TMEA 2VXOA 1P8AA 1LLFA 4OIMA 5F7JA 3KEQA 4IUBS 2ZBQA 3DMTC 1JHQA 3QOWA 5D00A 1LBHA 3ZKWA 4EA6A 3GROA 2JJMA 2WTBA 5KKCA 2WWYA 2VNKA 2O1EA 5CD1A 1ENZA 1JQBA 2P6NA 1SD2A 1WJGA 2B7CA 1B7GO 1UMCB 4N7JA 2P0AA 2XT9A 1IEQA 4HDOB 2OD2A 4DJFC 2Q62A 3M6AA 4D56A 3F4LA 4YRTA 2FJUA 2AV6A 2OQ2A 4XD7D 1YZGA 1HMPA 4R69A 4YAKA 2DWQA 2IY7A 2Y66A 1G7SA 1NWCA 4NF2A 1LI4A 4RK6A 4Z0PA 3WPWA 1US8A 1K4YA 4LXTA 4BT7A 4TLDA 2MT9A 1YE5A 2R7KA 3C6XA 4B6RA 1Y1QA 1P1IA 4Y67A 1FP6A 4BO1A 4V0KA 5AJTA 1KI7A 1RAFA 4HI0E 4DC1A 5K20A 3Q5EA 2BV3A 3KDSE 4NYMQ 2BGKA 4MDHA 4NBUA 3OUTA 2XDQB 1HFJA 2DCUA 1L1FA 4J3JA 5FJJA 5HRAA 4BMZA 1YZFA 4KREA 3N2GB 1BEEA 2E5FA 1KJIA 3U3KA 2JLRA 4B75A 2VR1A 1TEVA 5K0GA 1ZESA 3KXLA 4AY4A 2KGWA 4QOFA 3SHTA 3CF2A 4IQGA 5DCLA 3ZKWB 1QE0A 1MJGM 1AE1A 4EO7A 1F0YA 4J2OA 1GEEA 2HA4A 1NF2A 5DWQA 2XKKA 3QI7A 3O3OB 4I4LA 1FJGB 3DPIA 1OWOA 2V6JA 2NTNA 5DHRA 3L7KA 3DHVA 4IFTA 2H2HA 2P27A 3A3PA 4QLOA 3TTWA 5HXZA 1MC8A 3HCWA 3RSQA 3H2HA 4EO9A 5ALFA 2F8TA 3MWFA 3TRKA 2J3HA 1UMKA 1US8B 1SHJA 5EJIA 3FOBA 4XM0A 1MH9A 1U9IC 1COZA 2H07A 3H2YA 4OJMX 1PGPA 1SUWA 2V7VA 4E13A 5JOQA 1HNWB 5HBRA 5FXMA 3U3DA 2DFDA 3UN1A 3W6OA 4X0EA 1Z8NA 4AJIA 1JZTA 3FTNA 2HXYA 5G4UC 3GDGA 3N2EA 4X8LA 5H9VA 3CE9A 5JXJA 3UBTA 2QRVA 2O48X 3A70A 3D6JA 3R09A 4L57A 3ZE2B 1EUDA 3K6KA 5ARBA 3EUEA 3G2OA 3GJQA 2LBXA 1V95A 4MI9A 3LZ6A 3OW2F 2ATXA 1TYDE 2Q7XA 3F6EX 4RYDA 5EQJB 2EW8A 4OFBA 4E5YA 5E38A 4X97A 3G5LA 1CPYA 5IABA 2RHTA 2ZWVA 4FFVA 2QX6A 3PUVA 2P77A 4ETIA 4PIVA 1JDNA 4J2HA 3UAVA 3WB2A 3SFZA 4Y7DA 1O0SA 4HFRA 3GH3A 3HBMA 1QDEA 3DVRX 2IYQA 2QR3A 3OKPA 2MMGA 3BGVA 4A4DA 5B2EA 4KHPB 3RYIA 1OTXA 3ROFA 1M1YE 3O0TA 2OCGA 2WNIA 2W83A 1M0WA 1LD3A 2VYVA 4DV4B 4G0OA 3N75A 4PONA 3V7NA 4MWCA 2O2ZA 5K3AA 1J39A 3GPIA 3IIJA 1Y1TA 3JVDA 3QBJA 4NHOA 1S8OA 3I53A 3FTFA 3I52A 4IEIA 4URHA 5AM4A 4CMIA 1PFGA 3OO1A 2QRVB 5AVMA 3R4VA 1EUDB 2SNIE 5TF4A 2R4UA 3I42A 5MDHA 3W3AD 1JDBB 2VSYA 4OLFA 3N3BC 2NWQA 5IT5A 4KWEA 2XX3A 3QRWA 2BEJA 1BOOA 4YRDA 1FS4A 4ZK6A 2I2DA 4ZDJA 4WQMA 5FH9A 1SPXA 1VBFA 1NDQA 1PF7E 3AP2A 2D13A 4HTAA 2CMHA 2OM2A 4JGBA 1HQCA 4ZO7A 4TTRA 2PUEA 2A9JA 2ZB3A 2L0XA 4MLDA 3LKDA 5BN3A 1LBTA 1OBFO 1YZKA 4LY3A 2WF6A 1K8XB 1TJYA 2F43A 4LAFA 3RYIB 1T0AA 5CFZA 2WOOA 4WH0A 4ZO8A 5EXPA 2FHSA 1JDSA 4MS1A 4ZAGA 4HFJA 3U81A 1UT8A 1VE5A 1ZH2A 2BMEA 3JCMM 4EUFA 2WU8A 4LYFA 3QIAA 1TAGA 4RD0A 1LDBA 2ES4A 2ISSD 2HPAA 4RIFA 1CY2A 3ACBA 2D2IA 5AXDA 1E6KA 1IVYA 1ZMRA 4CMIB 5DSXA 4GSLA 4RVFA 4FN4A 1YHQF 4ECEA 5IT9A 3V4FA 4BJ1A 3L0BA 1E2HA 1O58A 1XEFA 5KB3A 2YV2A 1UAAA 3CRW1 3PHCA 1ADBA 4DY6A 2KMLA 1Z06A 3ENWA 4EKNB 5ELXA 1NULA 3ETHA 3IL2A 4TUYA 2PBFA 3JQEA 5FUMA 3I55F 1ETHA 1SD5A 2CC2A 2XAAA 3OKFA 3LVBA 4ZWNA 3ZU3A 1SQFA 3KHKA 3HA2A 1AB5A 1L1EA 4G4SO 1QQ7A 2PMKA 1OFUA 3A1CA 3SJAA 5BN3B 1YQWA 1S1MA 2C2YA 2XKJE 4TS3A 1TJ4A 1U5CA 3Q8XB 4X8OA 2F43B 3ZD8A 5FWXA 3RHTA 1G7RA 1ZIYA 2P3SA 3M9XA 3P4EA 2IYEA 2XMSA 1QPGA 3E3AA 2J3QA 1M6NA 4MS1B 2XNHA 5E2BA 1KWGA 1SUBA 4BE9A 2O2GA 4TTIA 4AUNA 4UBNA 2WSYB 3T5PA 2CHGA 1L7DA 4FBGA 4WLUA 3EXEA 3TD2A 4XTCS 2GEDA 4BEWA 1CX9B 3VR3A 5GV7A 3UUWA 4I1VA 4MA4A 4OLBA 5CVTA 5KVVA 5GGXA 3CPEA 5A6VA 2E4ZA 4FFSA 2EHDA 4KDFA 4R1NA 4G0VA 1HZJA 1XV5A 1EZZA 5D86A 3LT4A 4HAWA 3L8DA 4YONB 2GO7A 2YJ5A 3UWPA 3NKLA 3SFTA 3BFKA 3PA8A 4WNIA 4Z1MA 1B0AA 4KVAA 4TUYB 1UC4B 5I5GA 3QSYA 5B53A 2XYVA 4GMXA 2WB2A 1LTHR 2Q1YA 4AU1A 1RRFA 4HEJA 1QGUA 1VL8A 4BN0A 3QVXA 3A9UA 2MWMA 1N8RH 2X42A 1Y8ZA 4C20A 5KYXA 1WZNA 4CMEC 2XTAA 2IL1A 5FOXA 2IUUA 5CFOA 1ZN9A 1JEAA 4C3VA 4Z1OA 4G0PA 5FWXB 4CT5A 2X6TA 1RI1A 5J4LA 1P0MA 2CN1A 2OV2A 4XYMA 1CXZA 1NZDA 4OGGA 1JEOA 4P4GA 1DX4A 1Q7RA 4MKRA 3RJ9A 1QG0A 1U1CA 5JYBA 3AO0B 3PLNA 1K9SA 1NQVA 3CQ9A 3TLXA 3EXEB 3HG7A 5K8VA 1JE0A 1ZY2A 2QRQA 3AY0A 3GO4A 3M2TA 4FFBA 4S1OA 5E6SA 2FRDA 5FTJA 4E1AA 5JZSA 2ZRAA 1K86A 2V59A 2CB0A 1HRKA 2QYTA 4DCCA 4HNAA 4QOEA 4XIJA 2IPLA 4UUAA 4JK3A 1TYEB 4IHJF 2SKEA 1Z38A 2LUOA 3ILXA 5JSUA 3KLBA 3B51X 4ILEA 5IJZA 1Q95A 4RMNA 4WK2B 4BNYA 5C8VA 1UXGA 2B0CA 4Q6WA 2HWXA 5SY6A 3VVLA 4F2HA 1C3JA 1G5TA 2QLNA 4N47A 4AKIA 1QGUB 3UATA 3A6DA 5CT4A 3RT7A 2ZVYA 3FD6A 2ASEA 2VPZA 2ZSDA 4KV7A 4W7SA 5G41A 4Z5XA 5KYXB 1U98A 1OGJA 2OTMA 3OWHA 4U7FA 4ZAVA 4GLJA 1XV2A 2WYHA 2P9HA 1P33A 2PX6A 4Q3AA 5B4TA 1ZX1A 2B92A 3F8TA 3EEIA 1VQPF 1DJOA 3H3JA 3KCQA 3D8TA 2NP6A 2DG2A 1JF8A 3N07A 3ETJA 3AVVA 5KJ6A 3LT0A 4GI5A 3FHLA 1UMDA 4QPDA 4TXLA 4JH0A 1ZO8A 5E6SB 4FFBB 4YB8A 1GZ0A 3NDJA 3KBOA 1OR8A 1J22A 3DZ8A 3A37A 1KDZA 1O9BA 2IYZA 4HNAB 5DGHA 3F5SA 4BZQA 4YUAA 3DDZX 2P8SA 2VQSA 2I78A 1ESCA 1SUEA 1V0JA 2PMPA 3MD0A 3OE5A 4IR7A 1N2IA 5A4JA 5IDQA 1HG1A 1RYZA 1E0DA 2HCJB 3PLAE 4F38A 1E6WA 2JKVA 4PQEA 3RQIA 3F97A 5TGZA 4D9KA 1IPEA 2VL7A 5C8DA 3RYHA 4KTVE 3ZWAA 4BFWA 2B5WA 4V24A 4MVWA 2P2DA 1Q7YH 4XYGA 3AETA 4LCBA 2F9MA 3PTAA 4QFDA 1NW6A 4K28A 1F2TA 1S3IA 2ZQZA 1YRHA 3PXUA 4IRUB 5DBIA 3LWRC 1RMTA 5DBOA 5IU6A 1SVWA 2AKEA 1FLVA 1CV2A 1FDRA 3BOSA 1R4ZA 3F7NA 3DW3X 1QKJA 3P4UA 4H3SA 3WLFA 3FVTA 3S8EA 4QM6A 2XYGA 3FMPB 4RZUA 2JI6A 1KI3A 4J29A 1PRYA 3P9SA 3O4IA 1C3VA 1UMDB 1XKTA 3ZDAA 3ZJYA 1KQNA 1MB3A 3PT5A 2PT9A 2N46A 3DQPA 1O94D 4JAVC 5I01A 1JMYA 3ACCA 4TRNA 1LNSA 4JBYA 5H3CA 1WTCA 3UJCA 1Z29A 2XKAA 4RK1A 1QF6A 1Q0RA 4YMUA 4LRUA 5IVHA 2Z5FA 3B1KA 3C15C 3JS5A 2MU1A 4BL5A 2G7ZA 4B3TB 1Z4QA 2P9EA 3IE0A 3U6KA 4Y0VA 4KEAA 1DBIA 3UAOA 1W36C 4TWIA 1A7AA 5IS2A 3LY8A 4ZC8A 2FFBA 3RYHB 3KZVA 3VX3A 5I7HA 3UG7A 2WQ7A 1QBKC 1TADA 2EZUA 3LLCA 4EJFA 4FLEA 2J5XA 1B0ZA 3AETB 3L4EA 1ADYA 2G4CA 1FU4A 4N7MA 4Q9DA 4WXYB 1F2TB 3MFQA 1JTFA 3B48A 1SBTA 3CG4A 3Q10A 3WADA 1QX4A 1A77A 5A06A 2P4SA 4XUGB 2C95A 3ZWYA 4MDYA 4F71A 2WWHA 1K8RA 5JCJA 3V1KA 3GFOA 3RA5A 3RJZA 1R6BX 2AWOA 3GFBA 3BE5A 1A4UA 2C8JA 2W8BA 2IX9A 2AZTA 4O33A 4TWZA 4WKCA 4A7PA 5B57C 3NBMA 1OH7A 4IH9A 3RLIA 2BFFA 3FYTA 2A7XA 2O5RA 4ZOLF 3GDFA 5B2ZA 3OF3A 2EAUA 2WICA 4GKVA 1UWVA 4IDAA 2H2DA 2O3RA 3LT2A 4IIVA 1A8SA 4QAQA 2FX3A 3TE7A 3AUYA 2ZIEA 4KSYA 4V0NA 1QV9A 4L5BA 3SG0A 4QXPA 3L7LA 4XDYA 4UD6A 1Z17A 1UWLA 1FVHA 4BVLA 5KJ1A 1PLJA 1G8PA 2GJ4A 1VCOA 4CN9A 4IJVA 2HF8A 3L04A 4A8TA 4YDSA 3L84A 2OYRA 1L4HA 3FSGA 2BGLA 4P4NA 3D6AA 1UZUA 5ALYA 3H5AA 1KTIA 4D79A 4KXYA 5TF0A 4QD3A 3TZHA 3RK4A 4BHTA 4IUYA 5E1BA 3T80A 1JDVA 1RAAA 4QGFA 4DAOA 2I7XA 3EOZA 5BNIA 4BT6A 4FQ7A 1XWFA 4ZEXA 4DM3A 3IEVA 2WV7A 1TCUA 2G1AA 3KKZA 3HJUA 3TDKA 1YJ9F 2BFFB 5D1HA 4Z8XA 2P68A 2EX4A 1NX6A 3EA0A 1DZ3A 4FOLA 4RMJA 4YAEA 5C1BA 3WA7A 4J0IA 1ODKA 4MHTA 1U1IA 4HV4A 1AZSC 1WEHA 1ACLA 3DE6X 1VQ1A 5KOIA 3FMVA 1LJ8A 2HLDD 2EWMA 3CJTA 1JH9A 2WI8A 3U56A 1TCCA 3SPXA 3NHFA 5CVEA 4TMWA 1T2FA 1E1LA 3GAAA 5K2MA 4YASA 5CDHA 3QLTA 3ON1A 1P1JA 3BRWD 4YROA 4FDTA 1E9VA 2YWXA 3N8GA 4UHFA 1LXCA 4C30A 1NJ2A 3TJZA 4YAUA 5JRJA 4C8GA 2VNHA 3H0KA 3UJ3X 3WICA 3SIRA 4DCTA 4RTOA 5EZQA 2PRJA 1ZISA 3WX0A 1QQTA 1DAIA 1TUGA 2BKEA 5H59A 1VQ7F 5EHZA 4JLOA 3Q3JB 3ZWVA 1VSUA 5SZJA 1ULZA 2PR7A 1B6SA 4LGCA 1SDSA 2VJLA 4G1EB 1Q1GA 3FPFA 3MGGA 121PA 4RVGA 3RVDA 4R0MA 4G3XA 5C3MA 3NIBA 1T3LA 3HLYA 3RRXA 4X91A 1KYWA 1YH3A 4FPXA 1KH1A 2BGTA 3ZR4B 2VDMB 2YKGA 1PBNA 1SBCA 1EJ0A 3IT2A 3LUPA 1NJ1A 1CZKA 3DLTA 1UK9A 5TRTA 1CY7A 5I8PA 3HDJA 3B6NA 2WMDA 3R3ZA 2EWWA 5ESDA 3ICVA 3MGBA 1YR3A 3Q0IA 1GGJA 3B2NA 1NVUQ 3GX1A 2QTHA 2HKIA 2V9PA 1KP3A 4I19A 4MQLA 5IBCA 4H7DA 1U2QA 2GJ9A 4JZYA 2BJHA 3Q7TA 5FO1A 1E5DA 3AR9A 4RKEA 4BAUA 4HGRA 4PX2A 3E4CA 4AKEA 2RBGA 5LQAA 4BU1A 2YJ6A 1W0KD 4JI6B 3V1LA 4OVKA 3RABA 1XBIA 1F8FA 3N6XA 3DB2A 3GY0A 4QYTA 3KZXA 5CW2A 5LD2C 2O5CA 3HDGA 3M5PA 4YV1A 1KU0A 3Q1LA 3L7BA 2V0CA 4C0LA 2C7VA 3MWGA 4ZVTA 1Z4JA 4GI2A 3DEIA 2BZGA 4NHEA 3QG5A 4HYQA 4PAQA 3UJAA 1RPJA 2ZW9A 2R6FA 3O8LA 3BD9A 1FFCA 3H97A 1XE3A 3H2IA 1RHUA 4U2FA 4D41A 3AONB 4GQIA 4RF2A 1QRRA 4FR5A 3E5NA 5EFZA 4M1YA 3LWNA 2Q41A 4XYEA 2WAYA 3BRSA 5B6PA 2PA3A 2HJ9A 1KKLA 1BE1A 4F45A 1I4WA 4BEBA 3WFJA 1J9GA 5JATA 1KYQA 1GPNA 2ZS7A 3GA7A 3G5MA 3GK3A 4JLUA 4QBHA 4FE3A 1C8BA 1GDTA 2KQUA 1T0PA 1YR2A 3TBFA 3SIVA 3E8SA 4IJ6A 5L3VA 4XSVA 2D8MA 2GWHA 5FBHA 4PZEA 1JJIA 2CHFA 3G2MA 3WNDA 3PKZA 1CJSA 3BAFA 2OORC 2DQYA 2Q07A 4CV3A 5BY2A 2B5OA 3ZG6A 3HBJA 1QZ3A 3GT0A 2QJRA 3UUFA 4XPIA 3C3BA 4OP2A 1IXZA 3CYQA 1KZ1A 2ZI3A 3IA7A 1L7RA 3I72A 4CDGA 3HMKA 5JIBA 4FKMA 4B4VA 1Z83A 4K6CA 4H60A 1XRSB 4Z4FA 3VKHA 3CXRA 3ORFA 4AKHA 1GU0A 3A3OA 2RCYA 2XB8A 3TVYA 1M2GA 1YI1A 1ZL2A 3BK2A 3QLUA 4OKNA 4LGVA 2ZAUA 3REGA 5JLAA 2AXNA 3DCJA 4OFZA 1QRTA 2OHIA 3EXIA 2LTAA 4QU5A 1XMOB 3I0MA 5IYZA 2C5HA 3PC8A 4N82A 4N3AA 4WZ6A 5U4XA 4D8VA 4EAQA 4RMHA 3OIYA 1Y37A 2OB2A 5JV5A 4P4TA 4DCNA 4EB6A 1ZAKA 2WV9A 3PVSA 2ZGVA 4FGUA 1PR3A 3UHPA 3P0HA 5GAJA 4TN5A 2QN7A 4CVNA 1GA4A 2QUZA 2YWHA 1YMUA 3IDFA 3L6RA 4H0NA 4TRMA 4XGKA 5EJ7A 3F6YA 3R40A 4BXOA 5I9IA 3JQCA 1NUUA 1ZGGA 1J06A 3LAWA 1UODA 4WN9A 1LK7A 2QRZA 3AEZA 2FG7C 3CZ5A 3IUYA 4XPIB 1T0JB 3V7FA 3TN7A 1LLQA 1RYMA 1J49A 1P0CA 3WL4A 4ALMA 4JEIA 2P75A 2FUCA 4II2A 3UQZA 3OJCA 4ZVUA 3N0VA 1O8CA 1RACA 3WBFA 2XE4A 5I45A 4FZVA 5KSPA 3BXOA 2HP0A 1VKJA 3BB4A 4Y2GA 1H6BA 5EP1A 2CVFA 5F78A 4DBZA 1WMSA 5AW4A 3EXIB 3EOBI 3MRSA 4DR3B 1GQSA 1OASA 1AM4D 1PBTA 5IYZB 1U3DA 4LYEA 4UAJA 1N5DA 2GM3A 3DV9A 2FPIA 3EBOA 3KXDA 3DVSX 4MR7A 4RC9A 5CIYA 1G8FA 4EB6B 3CYPB 1OWPA 5DULA 5LQUA 2R6GA 2QY9A 4XM2A 5A3SA 3JWJA 2WR8A 4DMFA 4Z54A 4TLAA 1H2ZA 1CYDA 1PD0A 4URVR 1Z6PA 4BASA 3NX4A 4K87A 3UT0A 3GFSA 4F06A 4BXOB 1VL2A 3U44A 1V5WA 1Z35A 4GH5A 1F12A 1HE3A 1NJSA 2PL1A 4K0RA 4WN9B 3UA3A 1FUKA 1NYRA 2H5LA 4I8IA 1A5BB 1B2LA 2MDTA 2ZJZA 3LVQE 3DMYA 3WQQA 1GFSA 1VTKA 3K9GA 3QWFA 5HIAA 1JZQA 2QEQA 2NTEA 3W9UA 1N5JA 3Q1KA 4B2YA 5BQXA 4IFIA 4H4DA 4EG4A 4G4VA 4UQPA 5EUCA 2HP0B 1SCQA 3PQCA 3RFVA 4NFSA 4Z4GA 1DQNA 1XTUA 1YL5A 4F9EA 1AKVA 4AIRA 3TZCA 3L5OA 2BD0A 4MR7B 1W7AA 1ZN8A 2FPIB 2VH5R 3OEWA 4G4XA 3OQ6A 3VPSA 3UUGA 3C1TA 1RPZA 5K4HA 3LPNA 2D0IA 4MQ4A 1OAOA 3LKZA 4Y2HA 1MAUA 4Z9YA 1DAEA 5FRDA 2N1BA 1V6AA 4BLQA 5HY2A 1ODSA 2QSZA 4A5SA 2R00C 3NTXA 4NJOA 2ONZA 4IIGA 2KS6A 3KALA 1SQ6A 3DLBA 2MSWA 4M9QA 2GZ3A 2HSWA 3U44B 4QECA 3KVVA 1A95A 2IEAA 2NPOA 3NBYC 3FDFA 1XSEA 1ODEA 2VLIA 3EIWA 4ZJUA 4B2IA 1CS0A 3FNRA 4UFOA 1MF7A 3HP4A 3G4SF 1E69A 2O19A 2BCGY 3H0CA 1L8OA 5A4IS 1R6UA 3OCWA 2HXGA 4MPTA 3IKMB 1OI7A 2BEKA 2OFXA 2QTLA 3Q7RA 2IOFA 3N6RA 5JH7F 4BE4A 2J59A 4QXAA 4H16A 1N0VC 1N0UA 3HKCA 1O2DA 1IV4A 1XOIA 1ZK0A 5KEIA 3CGGA 3DC2A 1AK9A 1KZHA 1RXUA 1XRNA 3HCDA 3P5BA 1KK1A 1P6XA 1H5UA 1XDBA 3KM0A 3K6SA 5DI9A 4JQOA 4M1KA 4Y2TA 3WK5A 4EGQA 4R1PA 3CV3A 1LWOA 3LCCA 4H4CA 4JX9A 1E6UA 2NU6A 4JMLA 2W2TA 1NU8A 2FMFA 3P2YA 2WNHA 4KQJA 2A1IA 1K8QA 1J7JA 2B2CA 4ZRNA 2XVYA 1WCV1 4AYWA 2JIBA 4JVNA 5AD1A 1R9GA 1SHKA 4CQMD 4H1UA 1CS0B 2UZ3A 5CVDA 2GD6A 3NRJA 2H2FA 2VJQA 1ES9A 3NDPA 4IM7A 1MVOA 2YCBA 3CPHA 3NHJA 1QOPB 2BISA 1T3GA 2CFCA 4CMAA 4ENVA 2GZLA 1JAYA 5TQ0A 5FYDA 5G40A 3AESA 1EVEA 1QB8A 2GZDA 1Y5IA 3GR6A 2J7PD 2FSHA 3MLBA 3O5AA 3B1JA 1RM5A 4KQMA 3HKCB 3DZDA 2I4IA 3ACDA 1UM8A 2C0CA 1T3HA 1Z62A 4C0BA 3QXGA 3K0CA 5CDGA 4WCFC 5T4HA 4DYHA 1LGYA 1BDBA 1ITZA 2JAOA 1B43A 4UU1A 2Y0BA 3ZHCA 5B6IA 1AKQA 3K6SB 4PLZA 1E2NA 2G9ZA 2RGYA 3S0JA 3I2KA 2PU5A 4QREA 4OYYA 3TIIA 2NU6B 2BC9A 1Q86H 1R0LA 1RP1A 2GAAA 1CE8A 1HYGA 3HB0A 3I58A 4U00A 1WSWA 3K5HA 4QICA 4Y1FA 1M54A 3K0BA 2H08A 3ZN2A 1OLXA 3OX1A 2VHQA 3MTBA 3NC0C 3QEBZ 1KZGB 3HP1A 2JJ2D 1QO9A 3DLAA 3LDGA 4LJ9A 4EG0A 2IYAA 1R37A 2ENUA 5IHPA 2FSVA 3VX4A 1F4LA 1FS5A 2Z9BA 3SJZA 3KKMA 2AFIA 3WKBA 2WWRA 3GLKA 2QT0A 1OLOA 2YASA 4RHYA 1W4BA 5TQ0B 3AFNA 1WDLA 2PUWA 1Q1NA 4MWBA 3BGOS 1T5IA 3IQWA 2VJOA 3KQLA 3F9RA 2GZMA 3O7MA 2JGAA 3DSRA 5DU2A 2VSNA 2OFPA 2ZBRA 4CE6A 4LF8B 2N48A 1EI9A 4P9NA 3QELA 2V4MA 1WX1A 1YQQA 3NT5A 1NE7A 2OV6A 2E48A 1CE8B 4KXUA 1AKEA 4MVJG 2E5WA 8OHMA 2PLRA 4MIOA 1VFNA 1OLXB 2BGJA 3S4YA 1UFKA 4AIIA 1Q3HA 2C0QA 3BFJA 3CCRF 1YZNA 4LZOA 3NFYA 4H3KB 4IWYA 2ZAMA 1P4JA 4PVDA 3AUJB 2CVLA 1UBNA 2R6DA 3IBCA 4M1TA 5AXBA 3L7YA 1AC5A 2W93A 3CBGA 3T3EA 2C7RA 2X86A 2AFIB 2LR0A 1TQ6A 5HEKA 3V32A 4M1SA 4I55A 1W19A 3R9WA 1OHHD 4A8PA 4PVCA 1NV9A 4QYIA 2UUBB 6LDHA 3IR9A 1O08A 2C3YA 1XTRA 4JP8A 1OTYA 3VYVA 1DJNA 1RADA 3IEPA 2QY6A 3LL7A 4M1WA 3V7WA 1FB5A 2WSSD 2YMPA 3D8NA 2C2ZA 4U39A 3ZIDA 1PE0A 2DULA 3QELB 1GWNA 5TGTA 2PGLA 3DEYX 3SEAA 3LUAA 3MUEA 1E8MA 5LLDA 3NONA 5CEEA 3KZKA 3Q9LA 4KI7A 2ORVA 1B8OA 4ZCRA 3LGXA 3WHPA 1RJDA 2FZ4A 1MUUA 2YY6A 3AMVA 1T9AA 2PCJA 2BEUA 1F4PA 2Q8NA 4JA0A 4O2LA 3AUFA 5BUZA 3WGMA 3IUPA 5JJ5A 1UQTA 1RZVA 4PYRA 1N3LA 3S02A 3HAXD 2FQQA 2I6QA 4OEHA 3PNPA 4A23A 1JHUA 1AKMA 2VJYA 4I55B 1T0KB 3OEEA 4G24A 3IERA 1XZMA 4QYIB 4YRJA 4E5UA 4RTMA 1HK7A 4FT4A 4DIDA 1NDUA 1LX7A 1SUAA 2RARA 3AUSA 4CV2A 1MAHA 2UXCB 3L7QA 4N0DA 3U1VA 5HZHA 1CUBA 3JYLA 2EKZA 1ZSNA 4RXTA 3LDUA 1JH8A 1MC5A 1UEJA 4ZEMA 5A9SA 2O2XA 1J42A 3CCVF 2YFKA 4EYSA 2C31A 2OG2A 5ECDA 1G59A 2RHWA 1U0TA 4MWZA 4CGZA 5DGIA 2YFQA 3KUUA 5FBRB 1XTIA 2IYVA 2JPDA 3GA5A 1T6XA 3L7DA 1NNSA 1IHPA 3DWGA 5AVVA 5CJ2A 1IBMB 1TZCA 3DPUA 2BEUB 4U2CA 4QGBA 4A8JA 1F8UA 4LUCA 3VR2A 4UM9D 1MN6A 4X44A 3HBAA 4ACAA 1NKTA 5FOTA 3K35A 2OHGA 5DXJA 5C0OE 3AFIA 3RG2A 2EFHB 1K66A 1HEUA 1D07A 2YWCA 3MWKA 3SBOA 3QBTA 4QELA 2ZS9A 4X84A 1XJ5A 1W41A 1KJJA 1RQRA 1SVMA 1XZGA 2EYUA 2OTCA 2PKXA 1VOTA 2ZBGA 4FIDA 4KK3A 4Q66C 3SYRA 3ZE8A 2Z6UA 1R64A 5JQGA 1C9YA 1UBRS 1V5FA 2CXUA 1CHDA 4JKYA 4LX8A 4PU0A 1J2JA 5F1OA 1VB3A 3E82A 3S1AB 3I23A 1ZD2P 5ALKA 4UHEA 3ZC3A 1QKKA 3IEUA 1I3NA 3DZHA 4FGWA 5A9SB 4B74A 1XAIA 4BC1A 3GN2A 1WAMA 3BL8A 4FYPA 4Q34A 3AFGA 3OESA 3QMWA 3CC4F 4UU8A 1KVQA 3RU3A 4WKBA 4BZXA 3N0WA 2W48A 4ZKDA 3ZWBA 3TUZC 2Q6VA 4RS4A 1B8VA 5K3SA 4F11A 5DMHA 2VRWA 1VSBA 1VXOA 2ZIWB 4LI3X 3OQ1A 4A8JB 5AKZA 1KQ3A 3Q9SA 3W4IA 5ITSA 2YHSA 1T5BA 4BV2A 4FWTA 2CNLA 4AX4A 5BW5A 3M6VA 3WGOA 2UZIR 3QUTA 5TNXA 3UWMA 1N33B 4FYVA 1GFZA 2QVYX 3E0XA 4HN4B 4U7JA 4DABA 5CBPA 4RAOA 5J2UA 4RV9A 5D2CA 3U9SA 4WINA 2HWYA 4CEJA 5JQGB 3RS7A 3AR3A 2K5UA 4XA8A 4I9NA 1H0HA 4LJ7A 1QLJA 5EGSA 4KN8A 3HPQA 1NVWQ 1YJAA 3C5WP 1RWVA 1VJ1A 2ODWA 2JFNA 1RRVA 4EJSA 2DUUA 1BW9A 4JUIA 1Y3IA 4OHCA 4O0MA 3SYTA 3WP0A 5LDHA 1KDTA 4FI3C 4LJAA 2A7QA 2PL5A 3FCSB 3GNTA 5DF1A 2QX8A 5B58C 3C9SA 3QYAA 3HJHA 5FI0B 2IIVA 2YS7A 5CT5A 2JFWA 3KSMA 1Y9JA 3DMPA 3P0IA 2F8MA 3LVFO 2LCAA 3GAFA 5SZIA 3TEJA 3FOZA 3WLAA 1IEVA 2RGXA 4YRKA 3H17A 1SXGA 4X8MA 3HCRA 2A1TS 1Y42X 2BGMA 5HP4A 4B3FX 1YNSA 5K3EA 2TRSB 1XZ8A 2J5RA 5GM1A 4M7WA 4YJ2A 2Q45A 3ZWMA 4PIMA 4KHZA 5CBPB 2CUTA 1H3FA 1DWUA 1JFLA 5J2UB 1RKQA 4OXYA 5ALMA 1MOZA 2PLNA 2YXZA 5J2TA 1TIBA 3ETCA 1WXHA 4Q0MA 1D2GA 5AESA 1NF3A 1SKQA 3G9QA 5T64A 1V8PA 4CKEA 3PEYA 3ROMA 5K8LA 2NVWA 3FYHA 3LUDA 3ER9A 2HV8A 1KK2A 3DKPA 4ISBA 3F1LA 5JD5A 2QN3A 5JI2E 3L49A 3FZYA 1C4WA 4IV8A 2FQWA 3GA0A 2IEBA 1K7CA 1Q19A 1QV7A 1ZLXA 1PR5A 1CD5A 3NG1A 4U5QA 4EJSB 2UUAB 1BW9B 1U5AA 2QMEA 2WFLA 5JZMA 5GINC 1XCPA 4DCSA 3NHPA 3PWKA 3ZE6A 2WM2A 1GRNA 1P2TA 3B53X 1IBLB 5ESWA 4QVGA 1T1GA 4XCVA 2M1ZA 3CX8A 1T9GS 3IB3A 4KE8A 1LSUA 1DPGA 2IJGX 2AUMA 3VU8A 2FZ5A 2C07A 2FK7A 1Q17A 4U2GA 1CN7A 4XWTA 3TRFA 4G5OA 3RTBA 1SHZA 1FTSA 4FK8A 2VGNA 3GXBA 4U2BA 2OWDA 4Z8YA 3WIDA 4YJ2B 1ZIDA 3L40A 4PWZA 2W6JA 4RIEA 4HQ0A 4BRWA 4TZ0A 2P9YA 3D7MA 4WWHA 5J2TB 1DG9A 3C1OA 1Y8CA 3KRTA 2ZBUA 2AL7A 4CKEB 3T5DA 4TKMA 2VNJA 1QH8A 4IG9A 1ODCA 5BWLA 1NY6A 4B09A 1Z0DA 4IVPA 2E1PA 4FD3A 1NURA 2CYBA 3G8AA 4HYYA 3AP1A 1WV1A 4PYMA 1IC6A 3ZYCA 2WFLB 3A6HA 4AS3A 1RKVA 2QA5A 4BX8A 2FVXA 2JHCA 2VK4A 1DAPA 3PUIA 3R9XA 2ZJYA 1NNLA 1PFWA 3E20B 4H59A 3K94A 3H2BA 3MTIA 1QFMA 3O75A 2VNAA 2YOFA 1M83A 1V2HE 3NO4A 1K5HA 4MUNA 4OL9A 4RLHA 1I9CA 3A32A 3QJYA 2QMUA 1KE2A 3WNVA 2AFVA 1KK0A 5BUSA 4FLFA 3K70D 1XU4A 4RGYA 1RP7A 2C99A 5FPQA 1OPRA 1ZNYA 2X0IA 4FYXA 5TY0A 4H0FA 1KY3A 3M89A 4IIDA 4L9RA 1O1YA 5EN4A 4EY6A 2P3OA 1BU8A 2FZGA 2JKYA 2VP6A 2XTMA 4FYIA 2PLFA 5ALUA 4BNXA 1OWNA 4LVOA 2ZKIA 4C6TA 2QSYA 4JOSA 2C5LA 3DL0A 4MUIA 4H08A 4NVRA 3CTPA 2C1ZA 1I1NA 1KI8A 1L4MA 1QH8B 2JJ1D 1D2EA 2I4LA 3AR5A 3P2EA 3P20A 4G2NA 3ZXSA 1T43A 2BSQA 3HXOA 1TAQA 4LBVA 3PL1A 4NTZA 4OIFA 4OSPA 4QNNA 4MVYA 5K3FA 5JAHA 5EZSA 4FYJA 1OAKA 3Q0TA 4FZRA 2MR6A 4JP3A 3SD7A 2GPSA 1TYZA 3OPNA 1I7PA 3ETGA 1NBIA 3R9XB 2JFPA 4KBYA 3UB4A 3OKCA 1LFAA 1GA1A 2YXEA 3AB8A 3L1IA 3U3ZA 3LRXA 5D85A 3GP8A 1D1TA 3ML1A 4DDUA 1PEDA 3NGMA 5L45A 2FPKA 3KYJB 1P9RA 2ZAGA 4Q47A 3GT7A 3P9RA 3TZ6A 5ADWA 4PCLA 1TTPB 4YP9A 1AKWA 3BEDA 3L0IB 4CLOA 2AXQA 4NBTA 3I37X 5FR2A 4C6TB 3A4NA 5M5BA 4JU9A 5JHGB 1VG1A 4M7OA 5JVDA 3VBEA 5IC5A 1DKNA 2IUSA 2IYXA 4PQRA 4TTAA 4L78A 5DVZA 2AK3A 2N47A 3DAFA 1KXJA 3CW2A 3HCPA 4ZRDA 5K3FB 3WWCA 4LV5B 4EBFA 4PLYA 2WALA 2AJDA 3ENKA 2ZRQA 3G9ZA 3A1FA 4HWSA 4JASB 4RDHA 5FBWB 1T2EA 4OFXA 4QUAA 4RF3A 4GVPA 5HM8A 3OO0A 3E2MA 3SCZA 3IPCA 4NZPA 4MUGA 3GCZA 5DX8A 3TW4A 3PXDA 1UJBA 1ND5A 4I5DA 1RWBA 2PXCA 3ONVA 1D04A 4PW0A 1FUIA 4FKBA 2ASVA 3ELBA 1HDCA 4ASUA 3W79A 3UAYA 3J80A 2Z8XA 3K4PA 5CYFA 3RUDA 1MO2A 2QG4A 1JIIA 1HM5A 2JGRA 5L3ZA 3SOPA 3EQ7A 3DMDA 1X15A 3OD5A 4KXFB 4TS1A 1QUEA 4EX7A 5DGCA 2XWQA 2ZJ7A 1RHRA 4RJKA 1U9IA 3COSA 3K2IA 3H16A 4S2EA 5EIOA 4CLOB 1RQ2A 4RQBA 3ENVA 3OX3A 3UY4A 2AJTA 4BEVA 3I0ZA 5L8VA 1OX5A 2ZS8A 3KHUA 2PL9A 5J2UF 5JVDB 4O59O 3BE8A 1JSRA 1UKVY 5KYNA 4Y7CA 2HP3A 4TM7A 1JDZA 1O6FA 1T9HA 4DJJA 3E22A 4ESEA 3F98A 1NUHA 4ZMRA 1B6GA 1A9QA 1I6LA 1YHYA 3IT3A 1TRKA 1FTGA 3AV0B 2X4GA 3FXAA 1XEXA 2UYKA 2D5AA 2AXEA 1TIKA 1Y4SA 1E6CA 1QTNA 2FE4A 2YICA 1RWNA 3OJXA 3EZGA 2UYJA 3P2IA 4YRRA 5ED4A 2CMDA 2R1TA 3VM6A 3HCBA 1ZUD1 4GQBA 1LTKA 5ERYA 1D4FA 5EPOA 2OCKA 2UUPA 5EB0A 3C3KA 5DB4A 1NLMA 3OUZA 1RWQA 2ADOA 4N49A 1JS1X 1PT5A 3UJPA 4P22A 2D1TA 3LZCA 1ESNA 4X94A 1WSDA 2F00A 4HXGA 4KC0A 3IQZA 5D6OA 1FFHA 1NQUA 1TNDA 3BN3A 4L8WB 2VJDA 2YINC 4YJ2F 1RRPA 2R85A 3K72B 4H4EA 2BE7A 1ADJA 3B6MA 4G0YA 5F2NA 2OMEA 3BBPA 1CC1S 1WM1A 1Z0SA 2PNFA 3MRXA 5J2TF 3D54D 1MJGA 1ZUIA 3OETA 3ZZTA 2FF5A 2EBWA 1R66A 2GPWA 3B20A 3UZUA 2OAQ1 2JFXA 3C6BA 4GEKA 3K9WA 5BNFA 3E22B 3GH1A 4Q4JA 2POCA 8AT1A 2V3WA 5AVYA 5L4NA 3U61B 1OPXA 4DLYA 4E11A 1YU6A 1XEXB 4ZQBA 3CT4A 4BNWA 2VK8A 4UXJA 3DKIA 3DAPA 3EIQA 4KODA 3FWZA 4HMOA 2R1TB 1LPAB 3LM8A 1RJEA 4DA0A 4EMBA 4N0PA 1DIHA 1V9CA 1YONA 5JSFA 4KLAA 3TQHA 3VOAA 2P9GA 5EZYF 4AO7A 5FOVA 4B83A 4HGYA 5FDFA 1I01A 4BN5A 3D8UA 4MQ5A 3ZJ4A 3S5JA 1YBMA 3JZDA 3ZWDA 4ARIA 4JVSB 3SKXA 4NYIQ 1JG1A 1QHXA 4KJZA 2BKAA 1OZ0A 2XQFA 3JWPA 2Z1NA 4ZEWA 4CMBA 5JZBA 1NQOA 1VRVA 2AFIE 4G8CA 1XNQB 3EUFA 1G2IA 3INGA 3DBVO 3U26A 5BURA 3D8SA 4EUHA 3LK6A 3LWZA 3K7EA 1E0SA 2P0YA 3JCZA 4Q4JB 1DAFA 4U9UA 3WYBA 4I7EA 3DVAA 2C4NA 2H4JA 4LDPA 4ZMSA 2YVAA 4HQOA 5B1IA 3RJTA 4DJAA 3NMUF 4F9TA 4O1IA 3KIPA 3M4XA 1XZEA 1TC1A 1SEPA 1SUPA 4TYQA 1E1RD 1CJKC 1QFYA 1WIWA 2NTVA 4PQFA 3TAXA 1KDYA 4WUVA 3GT4A 5TGDA 3SLKA 4O6VA 5K0ZA 3ADDA 1AG9A 1BFUA 1NP7A 4GPEA 3RVPA 4CEIA 4JSTA 2X0JA 3I9NA 3PBKA 4NYJR 1I80A 2Y1CA 1VCIA 4OMDA 5TQ2A 3WI7A 1NVMB 2X41A 4IX1A 1QRSA 1R5JA 1XP5A 4IILA 3PC6A 2QNBA 3GCDA 1CY0A 4JEMA 4COOA 5DTQA 3UV3A 3VH1A 1DKPA 4LMRA 1P7VA 3FFMA 1KGDA 2EWCA 3BCHA 1KKMA 4FSDA 4TN1A 1P0FA 1LF5A 2TMYA 3EVDA 3ITDA 1X1AA 3CE6A 1SELA 4GGPA 5CIWA 3S55A 1LH0A 2J4DA 3T5MA 4MCHA 4QEZA 1USKA 3O2NA 5BMOA 2ICAA 2OGWA 4CMJA 3DVAB 2QS9A 1KDVA 1TQ8A 5DH9A 1I6KA 2RI1A 3PE4A 2PLWA 4ZQGA 4Q3KA 1KSJA 1W25A 4JD5A 5ULLA 1VJ0A 1N7JA 3GVCA 3V8RA 3BCUA 4OCZA 3UJ9A 4RJTA 1ONIA 1JAZA 4YGXB 2ORWA 1HDIA 2VLBA 3EGVA 4B3HA 1V8DA 2PD6A 4K5QA 4Z7QB 4IIXA 2YYYA 3G89A 3FG9A 4AROA 1T1RA 1IOWA 2GZ1A 5AKGA 1T4CA 4G36A 1WXWA 4DJEC 4EB3A 2ATIA 3BB1A 1I0LA 3V1UA 3G02A 4OREX 5IWAB 5TQ2B 1C0LA 2A30A 4BJ6A 1A9OA 2BH2A 4J0GA 4P7GA 2FDCA 4A2PA 5JNWA 4LRYA 3PS9A 3RI3A 3ZWOA 2PS0A 2XQJA 2CV2A 1WCXA 4ZHQA 2L42A 2FTKE 2ZUUA 4ITUA 4UEQA 1UBOS 1XJQA 3HNRA 4DR1B 2VH2A 4FOPA 4DCJA 1EAMA 1M8KA 4PZCA 3ZHRA 1G9XA 1YMQA 3QNUA 5ALXA 3T7KA 4CKBA 1V39A 1XF9A 1V47A 4NXMB 1EDBA 2ECPA 2W4IA 4HNQA 1JALA 5KOJB 1IUNA 4IV5A 4BV8A 5JVDF 4C5CA 1Z4LA 3EVFA 3H75A 4JMPA 1S7CA 1GZ6A 4YJGA 3ZBTA 4RHUA 4D3DA 2QPOA 5BSFA 1T8PA 2B83A 5DYGA 3PDHA 1DS6A 1SAYA 4CL2A 4O4IA 1N57A 1RWPA 4Z2YA 1UBLS 2ZPUA 3BRQA 4POAA 4PYOA 1GPJA 2DQKA 1QM5A 1OFGA 4FD2A 4WASA 1HL7A 3K3PA 1MO6A 1TXGA 1TUIA 1I36A 1T4CB 3Q2IA 1OH6A 1QPBA 4FINA 3D4NA 3FA2A 1ISSA 4YTEA 5BW6B 1UADA 3DOJA 3S5UA 4YQFA 3WNZA 2D0DA 3F3MA 4NE9A 1BNCA 2DE0X 2Y4NA 2NUBA 5A4MS 2G72A 4ZHQB 2V55B 3PX2A 1GPUA 1U7DA 2XECA 4PNPA 2CXNA 3C9UA 1PJZA 4O4LA 1DXQA 4KH0A 5DGXA 3GL9A 1RKXA 2O2YA 1A5AB 4CKBB 4JL6A 1FVXA 3CN9A 3H86A 2Z58A 3A9VA 5JXWA 3WAJA 5K2OA 4ZYTA 5KTNA 3JQ9A 4HWPA 3BJZA 4U1RA 3WAKA 4UW9A 4GS5A 4YJGB 3TF5A 1SVOA 2F1KA 1AKUA 4AJJA 1G9SA 2J87A 1DNPA 3OQBA 3A36A 3L8CA 3DZIA 4JITA 4JEHA 4O4IB 1IN7A 1KR5A 2Y71A 3VZBA 2X8AA 4D74A 6ADHA 1PWEA 1N2OA 3W8DA 3NWJA 2IHNA 4JENA 4WK4B 1D9XA 3EB9A 2P9QA 5CGQB 3KJEA 2WPDD 2I7DA 1D4OA 4G09A 5EMNA 3ZI4A 1Y6ZA 4L85A 1Q11A 4W6QA 3M4NA 1U40A 4AMZA 4WJZA 5J59A 3U4AA 2GPBA 3A9CA 1L7AA 1XA0A 3GNQA 3PTZA 2COEA 3SK0A 2G4LA 5CFRA 1IZ9A 1XK6A 4QTTB 4O4LB 2I2WA 1A3CA 1NATA 3D4OA 3X44A 4R2HA 1J2RA 1V6SA 2H1OA 4R4JA 4M9RA 2JH3A 1KYZA 3KUCA 5TXGA 4JJZA 3L8YA 3AVXA 2I7TA 4CLXA 2VDKB 3O4GA 4NU8X 4CU2A 4JCCA 1CFJA 2X40A 4RGBA 4G8BA 3I2JA 2ON6A 3CWQA 3NK6A 4UE3S 3KJNA 3KSBC 4Z53A 4ZO9A 2IYRA 3JV7A 1C50A 3HRHA 3HXPA 2B6NA 1XLVA 3KKLA 4YBRA 5HG0A 1AIPA 2YWJA 4MMYB 5B1HA 4ZQFA 1IB0A 2BBWA 4REOA 5ELLA 1AQJA 4ZC1A 3EVZA 3P2KA 1ZD9A 2C2WA 2WKRA 2VOJA 2NSDA 1FXUA 4JHXA 3NUGA 3EZ6A 3OCJA 2HXSA 4WDRA 3H65A 1ZOIA 2OD9A 4GPTA 4GQAA 3GOQA 1LBEA 2E4XA 2VAMA 4OQMA 1IL0A 5D3QA 4YRIA 2I3BA 5BYBA 3DE2X 3QPBA 5HY1A 1F14A 3ZNNA 3ZTTA 4DARA 4D5GA 3ELYA 1HORA 3M4YA 2WIKA 2CK3A 1MOSA 3KB1A 3UXEA 4EJ2A 1IQPA 1EX1A 1YGPA 3FR7A 4HH3C 4DJTA 5MHTA 4MZDA 3QKSA 4DLWA 1V48A 4PLWA 4UHDA 4EI8A 4YRPA 3HR7A 1CULC 3WWOA 2WFAA 5FPPA 2YDYA 1SBNE 3GRAA 3IMGA 3M8KA 2Q1SA 3DNMA 3E3OA 3OCUA 4KO2S 4MEJA 2FW7A 1OXUA 2CL5A 3AF3A 1IBKB 4O2BA 3UMGA 3S44A 2W2LA 2W6MA 3HA7A 1G38A 1SCUA 1YE3A 2BVNA 3UTDA 3BIJA 3PPYA 5FBKA 1C7QA 3FPHA 3W9YA 1UR5A 2FGYA 2H11A 2HO4A 3KPJA 5AIBA 3K9LA 3J7TA 1G64A 1RQPA 4GFDA 1V8FA 4DT1B 4PHHA 4ZDKA 2KLHA 2ZYIA 4FR2A 4UKDA 1BX0A 2HNBA 2W71A 4ND6A 1UP7A 4H18A 4V0QA 4TX1A 5C9ZA 2XCTB 4K3VA 4CM6A 4E4YA 4AWBA 4IS2A 1IRIA 4G65A 1X7GA 3MUOA 1KO4A 3QE9Y 2QP4A 2NTJA 2V7GA 3KOZA 3O1HB 4JLBA 3RTAA 4AN1A 2UXDB 2R8RA 4FMBB 4PICA 5LQDA 2ZTVA 4KOAA 4KRFA 2B78A 1MDFA 3QKSB 5J23A 4V2IA 4JB3A 3IP1A 3NBAA 2JFHA 1F8GA 1KAEA 1TJ3A 1I7LA 4FEGA 4PPGA 1QQAA 1VIVA 1YL7A 1C7ZA 3GWGA 1PJSA 1S89A 5DBGA 3U37A 1IJFA 3L7NA 4O2BB 1ZN2A 1CLEA 5EY5B 3D2LA 1IV2A 1RZ3A 1Z2EA 4HPXB 4QJBA 4CTJA 3OURA 1OZFA 3WV5A 2AEEA 1C0KA 1SCUB 1UPTA 5C34B 4JELA 1RWMA 4X00A 1YIJF 2HMVA 3W2GA 3IE2A 2GLTA 3KQWA 2VJMA 4XR9A 5AVWA 4GRIA 2PQMA 3H11A 3GI1A 5EQTA 3Q4GA 5LQNA 3K9FC 1TKRA 1L1RA 1E3IA 1ZJ6A 2BH9A 2OOKA 2ZSBA 2NTYC 3BFXA 2Z2KA 3GLQA 3LXRA 3PUWA 4HC4A 2XSZD 3LCJA 4PZ9A 4QOJA 4QVKA 3O8CA 2HPHA 2G9UA 2ZTSA 5BSVA 2XMDA 2CF6A 3DTTA 1VQMF 4AMBA 1SVKA 2ZRBA 1D8AA 2FR8A 4M8IA 2Q27A 2WIJA 3EEFA 3FZGA 4RPLA 5KNBD 1RE0A 3IDOA 3LW7A 1DRKA 4RDXA 2EBHX 1T9DA 5A7GA 2AC2A 5HE8A 5IW8A 3DG9A 4NUTA 2QUBA 2R25B 2OGZA 3PR1A 4XLTA 3TD9A 4JYZA 3PSHA 4EPVA 1C2TA 3WK4A 4GKAA 1A04A 3G0HA 2A2ZA 1WLYA 2AQHA 2W2QA 1VYUA 4DILA 5B4VA 2CDAA 1VLVA 4DIUA 2WTNA 1HE2A 2AW3A 1ONOA 1GZ4A 3AZOA 1TZBA 3BE4A 5LQCA 4FE4A 1AX9A 1Y3BE 1LI7A 2EP8A 3JRXA 4AP5A 5AK0A 2HMYB 3BILA 1UPAA 2TMKA 3QPDA 4FMCB 5D6NA 4M0PA 4A0RA 4MUMA 2VJMB 4RS3A 2AN9A 1YITF 4JQZA 3H11B 2JD1A 1KEUA 4O4IF 4P34A 1TTHA 1M7HA 3PXXA 5EVCA 2AFRA 3LP5A 1G8MA 5DNUA 1BH2A 1M34E 1N32B 2LCFA 4EG1A 1WCYA 4O2AF 1IPAA 1VJ5A 4TTSA 2I4TA 1EEHA 4UQOA 4RTLA 5EXDA 1HPLA 4RUKA 2XRZA 3IULA 3TXXA 1GUZA 5CXXA 2DMRA 2OTLF 2X2PA 3DM9B 4BO9A 1K8AH 4H7IA 1FNCA 1U9YA 2JLQA 4O4LF 4Q1AA 5EIBD 2AGVA 1MO5A 1S8NA 2QJWA 4KV9A 4QULA 5TE9A 1PSDA 2HMTA 4J1TC 1OILA 3FJOA 4E21A 2DR2A 2ZQ5A 3ODPA 1PQYA 3IBTA 3M4JA 5LQSA 3TOSA 4M88A 4X7PA 2NNLD 3GLIA 1MRNA 3QQPA 1M0SA 3I1FA 4TLBA 2DB3A 1EUCA 3OF2A 3F6SA 2BDEA 4B44A 3PFCA 4PPQA 4ARBA 4EH1A 1XHFA 3UWKA 5H02A 4GXTA 1Q50A 4C7VA 4Q12A 3ET4A 4HRXA 4DIBA 3B78A 3HU1A 2PO7A 5GANK 3DOUA 1Z74A 4OAPA 1Y3FE 3BQNB 3L8HA 5CMLA 1V4BA 2X2OA 3L7MA 1LZLA 4KNVA 1X1SA 1O95D 5U4QA 1XNRB 1M2KA 4XD7A 3AINA 1S4QA 2ZRGA 2ZBDA 1N7IA 4S0XA 5F1PA 2NSYA 4QKQA 4U6NA 2YYSA 2IHTA 2JFGA 4QPJC 4UAUA 1IG3A 1OV4A 2IEYA 4EYOA 2XEDA 3GC6A 2Z95A 4G1UC 3DE7X 3KFXA 1U63A 2GFHA 3BD6A 2IS6A 1FXWA 5IX8A 2FZLA 2MIIA 621PA 1SIWA 1Z2CA 4W5TA 3LDTA 5AI4A 4MJLA 4MTCA 1YR1A 1KVUA 3IUQA 4RCZA 3PFGA 1EFHA 3ESDA 4KLCA 1OC2A 1MNAA 2PLAA 3GLIB 3QE3A 5J5CA 1EUCB 1JHAA 2JAHA 3H3XA 1E3DA 1ZIPA 2WG0A 3ODGA 5EOVA 3HVJA 5G1OA 1FLDA 1KZ6A 2ZRNA 4POOA 4CMHA 1NI5A 1JL3A 4KQWA 4DHWA 3E0QA 3ESRA 5KQRA 4GMFA 3EH2A 2AZXA 4XARA 3E1GA 3F9IA 3NRBA 4BVFA 1OBVA 2VJPA 4X6UA 3MDOA 4DYDA 3SQXA 1A1VA 1CUEA 1VRWA 3CKYA 1F0NA 2HU7A 2EP7A 2WUDA 1DB3A 4LHSA 3J7AC 1H2AS 2D0PB 3E05A 3A9TA 3MWJA 4HWRA 1PP4A 4I2NA 4YECA 3X2EA 2BHNA 4UTZA 1FYDA 3OFSA 3GU3A 1SQ0A 1N6KA 2YMLA 3KKPA 4JOBA 3G0DA 3HB9A 2HS3A 4V1CB 1CDOA 4XLLA 2C82A 3S2YA 5J4YA 2UUOA 1I0IA 4UQLA 4BMNA 3UXMA 4NEQA 3ZS8A 1LPBB 5CJPA 1Z6ZA 3AIKA 1KARA 4A26A 4F93B 1XBTA 2VP9A 1A4RA 5JROA 5LL6P 4O2BF 1NOIA 4LZPA 1T10A 4MLPA 4QGHA 3UUEA 4ZYYA 1NW5A 2HBRA 3A4IA 3HJBA 3SAJA 4EFKA 2I6XA 4EEKA 4F6LA 1P7PA 2B35A 3EZ2A 2AVNA 2B4RO 3FPEA 3PC7A 1SOUA 2WSBA 4YH1A 3KE1A 2NVUA 3O03A 2WJGA 4YQEA 2FWRA 3QU4A 2E49A 1E2JA 3C8HA 4GWGA 4IP0A 4L5IA 1PZXA 1WL8A 4UNQA 4R9NA 3D8RA 1KSGA 1L5GB 4BJHB 1Z6YA 4BMPB 5JMOA 1HE8B 2BFPA 2VF7A 3DAGA 1EX9A 3PPVA 3QFHA 4R9VA 3G23A 2A5YB 3GCXA 5ICCA 1Z63A 2DLCX 2EQBA 3BZBA 2IELA 3I5AA 4EGSA 1MA3A 1O0BA 1IDN1 5DNAA 2HMAA 3AVPA 2O9JA 1SGWA 3A05A 5KBYA 1A97A 1IZ7A 3PNSA 2IEZA 1R8SA 1PLLA 1FMFA 2WUGA 3LDFA 5MF6A 3T8YA 3H87A 5JCOC 5FWYA 2I2BA 1EP3B 1P9LA 4ND8A 5JFOA 2ZYTX 1KY2A 4NULA 3TBKA 5BSEA 3L18A 2Z9CA 4QDUA 5JUWA 4ILKA 3N5CA 4B73A 3N2NA 3W3AA 4P53A 3FWPA 1J7KA 4V38A 4B5KA 5BPFA 3BHNA 3OCXA 5IAGA 3BEOA 2D1RA 3HWUA 4F1KA 1TM4E 2F3TA 2PJZA 4FX5A 3E7XA 2F62A 4D81A 1XZNA 4JT4A 2ODAA 4YMGA 2NVUB 1GTL1 2XXAA 1Z2NX 2A14A 1QNFA 4M9UA 2FMXA 2XCIA 1QBGA 4KYUA 1XCOA 5FNVA 2IVZA 2BKLA 3T7DA 5LP6C 1BRMA 3O3CA 4IOJA 2AIZP 1YTLA 3S0WA 5LBTA 4PLVA 3WV4A 4E5VA 1IXYA 2DJ5A 1P7WA 3F0GA 2KG4A 2GMWA 5AM0A 2Y1OA 1TX4B 2FWNA 4EHAA 5AUNB 3L06A 3CEJA 5B3AA 4KYVA 4D4HA 3JQPA 3COVA 1B14A 3N7TA 2J5BA 3P0EA 3ZV6A 2JG3A 3RKSA 1ECGA 2JS7A 1OB5A 4QYSA 1QAQA 4HXYA 5FWYB 4ND8B 5K1ZA 1OIWA 2JIZD 2CDCA 1NVXQ 1JU3A 1OF1A 2B2XA 2HIMA 2XLBA 5DPMA 2DH6A 5F3RA 3U49A 1OMOA 3I92A 3WFIA 2A78A 1G2QA 4RD4A 5JAPA 3BTUA 1YZVA 1YTUA 2C58A 4IKPA 1H94A 4BFSA 7ABPA 1GV0A 4OTZA 2D62A 2PUDA 1J5PA 2ZVZA 2H3EA 2UXBB 5HF6A 3NBXX 3NW9A 4CIVA 2JCVA 2XXAB 4PX9A 2ZYHA 5P21A 2J31A 1K5GA 4ZCSA 4BO0A 2I9KA 5FNVB 1VMKA 1XRLA 2GPAA 5JSZA 1JFRA 1LLUA 3FCEA 4DNPA 1QIDA 2JI8A 4GRAA 4ZAZA 2PBZA 5EE3A 1W2GA 2P1ZA 1N5IA 3QA9A 2JHAA 2F17A 3I56F 2WTAA 4JLVA 3PYXA 1F1JA 4MV4A 5BN1A 2JLVA 1RYDA 4BQFA 4PO1A 4Z4CA 3CZ4A 3EAFA 2ZB4A 4MP3A 1WCIA 3NTOA 4JQSA 2QAGC 3ZVRA 1T8UA 1TAHA 3LD9A 1QI