3VOBA

Staphylococcus aureus ftsz with pc190723
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
304
structure length
304
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle/inhibitor
total genus 105
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3vobA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vobA01
4O4LB 1FSZA 5EIBC 3WGKA 4O2BA 2R751 4X20B 1FFXA 1JFFA 3N2KA 4O4HA 5LP6C 4F6RA 5JQGA 4X1IB 4EI8A 4I50B 3VPAA 3RYHA 5CA0B 5IJ0B 5LYJA 2XKBA 4X1KB 3JAKB 3CB2A 1Z5VA 5LOVB 4EB6A 3HKEA 5CB4B 4KWEA 5BMVA 5MN4A 4ZHQA 4X1YA 3N2GA 1W5FA 4TV8B 5LP6A 3HKDB 3JAWB 5FNVB 5JH7A 1TUBB 4EI9A 4O4IA 5ITZA 2VXYA 5JCOC 3JATA 2RHHA 5LXTA 2R6R1 3JALB 3RYFB 5IJ9A 5LA6A 4LNUA 4IIJB 4TUYA 4U39A 2RHLA 3VO8A 4U3JA 5EZYA 3UT5B 3WGNA 5CA1B 1TVKA 4WBNA 4HNAB 3HKCB 5J2TA 4I55B 5EYPA 3JASA 4I4TA 1OFUA 4O4JB 1Z5WA 5JCOA 5KMGB 2BTQB 5JVDA 1RQ7A 3E22B 4O2BB 4ZOLB 4X20A 1FFXB 3N2KB 4O4HB 4F6RB 3WGLA 3JARA 4X1IA 4IHJB 5JQGB 3RYCB 4O2AB 5CA0A 3RYHB 5IJ0A 4M8IA 1W581 4X1KA 1RQ2A 4TV9B 5IYZA 3RYIA 2VAWA 3ZBQA 2Q1YA 5LOVA 3C8LA 1SA0B 5CB4A 5BMVB 4DRXA 4YJ3A 3RB8A 2RHJA 4ZHQB 4ZI7B 3HKBA 4X1YB 3N2GB 1W5BA 3HKDA 3JAWA 5FNVA 3ZBPA 5J2UA 4DXDA 1TUBA 4EI7A 4FFBB 3VO9A 4YJ2B 3JATB 3VOBA 1W5AA 5KX5B 3RYFA 5C8YB 3ZIDA 5M7EA 5GONB 4O4LA 5EZYB 3UT5A 1JFFB 4HNAA 3HKCA 3WGMA 3JASB 4O4JA 3M89A 4I50A 4B46A 3M8KA 5MN6A 5KMGA 5LYJB 3JAKA 3E22A 4ZOLA 3HKEB 4EB6B 2VAPA 5EIBD 4XCQA 3RYCA 3JARB 4IHJA 4TV8A 4O2AA 5LP6B 1RLUA 5JH7B 2GVIA 4TV9A 4O4IB 4B45A 5IYZB 3RYIB 5ITZB 5MN5A 1SA0A 3WGJA 5LXTB 3VOAA 3JALA 5IJ9B 4DRXB 4YJ3B 1W59A 5LA6B 4ZI7A 3HKBB 4IIJA 4LNUB 4TUYB 2XKAA 4U3JB 3V3TA 5CA1A 5J2UB 1TVKB 2BTOA 4WBNB 5J2TB 4FFBA 4E6EA 4YJ2A 4I55A 3R4VA 5EYPB 4I4TB 2VAMA 5KX5A 2Q1XA 1W5EA 5C8YA 2BTQA 5JVDB 5GONA 2RHOA
chains in the Genus database with same CATH superfamily
1ZUNB 4B6JA 5IG2A 2WV7A 4GR5A 3ZDEA 5ERYA 4JKOA 3NK7A 3F0EA 5FFNA 5BVGB 5C32A 1CEXA 2OVFA 2HH9A 4MW6A 1QUEA 2J0UB 1F12A 1Z34A 1E0KA 4D4GA 3DZFA 3C24A 4GLJA 2VQSA 1EINA 5BW6B 4HC4A 2SECE 5LOVB 2HP0A 1JDTA 5K8IA 2PLAA 4OK6A 1X7PA 5IAJA 1V8BA 1AURA 3DKRA 4U7TB 3IPCA 3FPKA 2HWXA 3IVRA 3MLAA 2GPWA 2FTKE 3LM8A 1SELA 2I3ZA 5EJGA 1OAPA 1TFRA 5A3JA 4YAOA 4CIWA 3OU6A 1X7WB 3QEJA 4UUPA 3EA5A 3H1AA 2PA0A 1MIHA 4EVQA 3PFCA 2ORIA 4XH9B 5D3MB 3DOOA 4JWKA 1EFCA 1KP3A 3U31A 4BWVA 1O3YA 3QX8A 3QI2A 1MB2A 2C2KA 2NU7A 4K9NA 4M7RA 3T1OA 2W2OA 1PDVA 3HY3A 3T5GA 1XMOB 4WLOA 3P4UA 2ZTUA 2R7LA 4POAA 5IZCA 1JA0A 2ATIA 5AIAA 4UTPA 2FAXA 5KREA 2PRJA 1XROA 2FRDA 4CM3A 2XD4A 3REFA 1GLNA 2Q8NA 2EP8A 4IQ0A 4A2QA 4QASA 3U40A 2FW7A 2Q50A 2I91A 3AU9A 2FSVA 3JY6A 4OO3A 2H7YA 1SUWA 2ZIWB 2FP4B 1XQ9A 3NANA 1FFGA 3RYCB 1UDRA 4IHJB 3JWHA 5EE5B 4B3TB 2PZGA 3WR5A 4OQNA 4ZI2A 3FSJX 5IJ0A 2JGRA 3MFQA 2DHCA 4DLSA 3Q40A 4GLFA 4D5EA 2X5KO 4FQ8A 1QGUB 1Z6AA 4HWRA 4JSRA 1WAMA 1YIOA 2DTDA 1CUWA 1JJ7A 1CE8A 5F7OA 1D6JA 3RANA 1J70A 4P5EA 3VKUA 3QY0A 1T8WA 5HKKA 4JD5A 1W85A 4FDUA 1UMDB 1J25A 3FMGA 1TGYA 1B14A 1BKSB 3IT3A 1L5SA 3GLIB 1XZEA 4NBRA 1FJ2A 3DUFA 4R2KA 2PJDA 2ZM5A 4A10A 1K66A 5A5FA 4HQLA 1Q7RA 4PAMA 1LRJA 1L7QA 1UXIA 3ECSA 3EMDA 4JT2A 3LNTA 5FBHA 4B6EA 2EJVA 5ICCA 4IJVA 4U7DA 3KDPA 4M0EA 2XTJA 3KT0A 2WA1A 3QXJA 2BDTA 3CUKA 1LV8A 1ZVJA 2BEJA 1WXEA 4D99A 3L6RA 1K7EB 1M54A 4IIFA 2G1UA 3IR7A 1D2GA 5LBUA 3LO5A 2QRZA 2NNLD 3E9QA 2UZAA 1P6XA 1VRCA 2R60A 4HAWA 2JIZD 4L3VA 3V2HA 1F14A 2FEWB 2H9AA 2BE7A 2IYEA 4O0LA 1BVRA 2CL7X 2ATXA 1HI9A 1YJXA 1KTVA 2H1VA 2ZUCA 1C7IA 3QUWA 2D54A 4HPJB 1EGMB 1S8AA 1ZGBA 4M1EA 1X7OA 4WK4B 2P9TA 4MUKA 2QWXA 2CHQA 3OC6A 4N0PA 4H60A 5JBQA 4OH7A 3VR4H 3WFIA 1KOGA 2O2JA 3E70C 4EQZA 4DSUA 1XDSA 3KLMX 2GZAA 1G5FA 3FPAA 1XT6A 3PX3A 5C8DA 1LD3A 1WUIS 2G9ZA 2Z8ZA 5GV8A 3KJQA 1PHRA 1U5CA 1IL0A 1U8CB 4M9UA 1O9BA 4RTQA 3KYDB 2FSGA 4QUGA 1Q86H 4OLBA 4YRGA 3RSHA 1FNKA 1Y5NA 2G28A 3CR3C 3GN2A 3LP6A 1RQNA 4AJLA 5JWOA 4RY9A 5EJ4A 2WYUA 2C4MA 2I8CA 2JK0A 2OCYC 2XMBA 1FFEA 4TXMA 1IQRA 4CI9A 4M89A 4HV4A 5CVTA 3KO8A 1FC0A 2F9LA 5FTMA 1ZGCA 3SYMA 3B78A 3F5DA 3M5DA 4JFRA 4M1WA 3JQ7A 1QE0A 3N1UA 1SWVA 1HMPA 1P73A 5JALA 1LK5A 2H4YA 3DLTA 5FIUA 2NADA 4IIDA 2GN9A 3TZHA 2GZDA 5JMTA 5KTMA 2AZXA 1YR7A 5G4KB 3NEPX 3VU1A 3DOFA 1N2GA 3KALA 4UVEA 1WUTA 1V3UA 1XMJA 4HDCA 4MYDA 4OLAA 1TM1E 2GNAA 3WWEA 3ONEA 2HRDA 3K1AB 3OE1A 3GA5A 3L8FA 3WIUA 4A5SA 3OO0A 3F71A 2VK8A 2TMYA 1UBLS 4F1WA 5HUJA 2H00A 4NMMA 5KMGB 3QX7A 4URVR 1KEWA 4DQXA 2H1LA 4NCBA 1KFKB 3UJCA 3UMGA 4AJPA 4CMEC 2PGOA 4D6XA 3BERA 5I4CA 4CLDA 3L7CA 5EO3A 4CM9D 3VTAA 2IEIA 3LUAA 2EIHA 3BMQA 4JVMA 3JYLA 4ZK7A 4LKOA 1WZIA 1F60A 4TLDA 5K6TA 1OJ7A 2X6TA 5TQ2A 3GBSA 4JBLA 1W48A 4WK2B 2ZI3A 1Z18A 3CS3A 4LJ6A 2YZMA 1G20A 3VR0A 2O2ZA 1UBEA 2YWCA 3LCUA 2QHXA 1KAMA 3R40A 4XXHA 3T7IA 2XSZD 5KYWB 3ET4A 2GD2A 2W22A 3A4YA 5HVNA 1DKRA 4YS6A 3PTLA 1JJIA 3D4PA 2NU8A 4F3RA 5KB3A 3R9XA 3OETA 4S1NA 1OWMA 4YRCA 4C7OB 1DPGA 3IAXA 5I9BA 1SXJD 1YS4A 2HMWA 2NZWA 4HRXA 2AD5A 2NTJA 4G37A 1Y6JA 3C3YA 3H2IA 5C8YB 3RTDA 4HL6A 4I99A 2Z01A 5KC9A 4RSMA 1WPRA 2BKAA 4EHIA 3GU3A 5BNIA 1GLVA 4KR0A 3PJFA 4NS1A 5K20A 4B32A 4DWWA 4LF9B 2RJNA 3ZCRA 2Z09A 3G0CA 3GK3A 3BEDA 4QJIA 3DTVA 1R0XA 4RCYA 4WVFA 1L7XA 1U7TA 5EY5B 1ADJA 3ZHVA 2RGEA 5BNWA 1P7VA 4A6DA 1N5KA 1DAKA 4D4JA 2P8SA 1N2SA 1KZGB 3EXIB 3MYRA 8ADHA 3G7UA 3ZTWA 5HPYB 2QPTA 2Y1XA 4RPHA 4X60A 1XDWA 2I9PA 3UCEA 4ILKA 1MC4A 2AH5A 2FP3A 2FQ1A 2P2YA 3DR5A 3SXUA 4G0OA 4UC0A 1X2BA 2GHIA 2NU6B 2WD8A 1PQWA 4WK0B 3VHLB 3WGYA 1DMSA 2J85A 2X19A 1BKDR 3EEQA 3R4CA 4JXKA 3Q11A 2WEKA 2PRKA 2WWWA 3G85A 3WYEA 3B3AA 4TTVA 1GVNB 4AROA 4EL5A 3OBIA 4ZT2A 4YAGA 3K9LA 2FPWA 1T8YA 4QULA 2GAFA 2FB9A 2O3JA 4LTDA 3UCFA 1TK9A 1JKFA 2F1HA 4DC0A 4N76A 1SG9A 3CZ9A 3AVXA 3C3CA 3VYUC 2OLKA 4QUAA 3ZKAA 2PD6A 4FZRA 4F2PA 3ZUPA 3OE4A 1EFVB 5MF6A 1I6MA 2GVDC 2ZRJA 2G76A 3T3OA 3FTCA 4V0SA 4C8IA 3CNOA 4PLCA 2JI6A 3IUEA 4DZRA 3F96A 4N41A 4UMDA 3M1IA 2IY9A 4MARA 1P77A 3H2JA 3HQ4O 4X84A 2QJFA 4KI0A 4C4XA 1L7RA 4RETA 2OBBA 3N8HA 1S4QA 4OHBA 4QSHA 4GC5A 4E0BA 2YWRA 3QXSA 4A0HA 3K2IA 1YF3A 1G0NA 3DE0X 1XJWA 2ZYUX 1YJWF 1A5ZA 2XF2A 2D2FA 1DIBA 1EJ2A 1KZ4A 3NHUA 1VQKF 3HV0A 1XMXA 3QF4B 4CWAA 5JZSA 1R00A 1AKUA 2JBAB 2KI5A 3LWDA 5DBFA 3IOCA 3TOZA 1IUOA 4WQMA 4GSKA 1BN6A 1W88A 2BGJA 4RO0A 3VMFA 2X15A 1WKBA 3HG7A 4LA4A 1XTTA 3CMAF 4R40A 1C5KA 1RCUA 4C2BA 1E1CB 5LWHA 2BMDA 1Q82H 2JLCA 1L2TA 3MAAC 2A0WA 1L4UA 1YK0A 2XV1A 3EA4A 3KS9A 4H7IA 1IAQA 1ESZA 2B9VA 1OLUA 5G1OA 2XUPA 3B7WA 3NPMA 4D02A 1DFIA 1HOTA 3TX2A 4NTZA 1VECA 4CLRB 5LSAA 2YMPA 4GEGA 1PJBA 2KBFA 2RG7A 3TSYA 2IH4A 2YWHA 2FLWA 2ZI7A 1E0DA 3EMBA 2M2IA 4IFBA 4UNSA 5K0ZA 2JLRA 3QBDA 4NBNA 5GIOE 3ITNA 4OL9A 2JVJA 2VHZA 1R6BX 5F51A 2V7TA 6ADHA 3CNQS 3MUOA 1VDZA 3CT6A 2AFHE 1W4BA 2P6NA 3DPSA 4RV9A 3G0IA 1XPJA 2XNSA 4TKLA 1YDEA 5K2MA 4GG1A 2C0PA 4B2YA 3KJZA 1ZUHA 1JECA 3AERB 4FI3C 2VQFB 3DMRA 4KO4S 3NEYA 4UKDA 3SM3A 1VE3A 2VEOA 3GEGA 1VIYA 2CUZA 2I0FA 3O8LA 4OHCA 3TLBA 3I0ZA 3ZJTA 3AVTA 1XMQB 3KOUA 4AUEA 2WHQA 1FTWA 4IIHA 3FPBA 4LC1A 2FXIA 1XG5A 1RE0A 2DR3A 4RDIA 2HHLA 3OF5A 3QX9A 1FF9A 1E6LA 1KBOA 3DD5A 3ORQA 4BFZA 5CLFA 2J33A 4W5QA 1SCUA 3DDZX 2JJQA 3QMVA 4LZAA 5I45A 1D1QA 3CMEF 4X5OA 2XUIA 1X38A 4BDTA 2REBA 1GZ3A 1U4SA 3NZEA 2VA8A 4B5LA 4QBIA 4F38A 3OX3A 3PQ6A 2SCUB 1NVBA 3QEMA 1HDCA 2FH5B 3L5OA 4GI3A 4OUDB 5JS2A 4RMGA 3FCUB 3E82A 2ZRLA 1CHNA 1Z73A 1N2BA 2EZUA 3KKOA 1XRNA 4Z0NA 3TIVA 3M70A 3QHQA 3BIFA 4IGEA 1S2GA 1T9BA 1UL1X 3LUJA 5LMUB 4L07A 2J5XA 1B2RA 2ZAMA 5L6MB 3EG9B 5CH3A 1UPBA 3K0AB 1NVAA 4UU8A 2ZDHA 2F48A 4PAGA 3WLIA 5JVDB 1ZIPA 2QTPA 3IERA 1I4WA 3OEHA 4R1TA 2PE5A 1IPEA 1NW4A 3CO5A 1VL8A 2AFIB 2IV3A 3NHPA 2VDWA 3ZKWA 1H8HA 1T2FA 3LBYA 5F1KA 4H2DA 4C88A 3F98A 2G4CA 2J5QA 4GYWA 2YY5A 2I80A 1P0IA 4ENVA 2BV3A 1PN3A 2ODPA 1R2QA 5IH3A 3Q2IA 4JGGA 4C4OA 4EZBA 1I3NA 2KPOA 2XZLA 2C4VA 3WKAA 1O89A 2JHPA 1JDVA 4QHYA 5A2GA 1G0OA 2O3RA 4Q12A 5KTOA 2DBZA 4JX8A 2XWJI 3M6IA 3QKWA 2C2BA 1V9LA 4NESA 4D8YA 2WHRA 3I56F 4PG4A 1DIAA 3GC6A 5AR1A 4WH0A 3T3HA 3ZO8A 3DFMA 3L43A 4TROA 1PNQA 3ZCVA 5EWMB 1O94D 1AV7A 4KIUA 4E13A 2ZIFA 4W9NA 1IV1A 3HKCB 2NVWA 3ZU5A 4CODB 4E03A 4RF4A 1MR3F 1HNXB 2FKNA 1SQ6A 2J3JA 4MK4A 4RLFA 5E4TA 2QYHA 5L53A 2IEAA 1PRYA 3KWLA 3OQMA 4PHCA 1KDRA 3N0WA 4H16A 2FSPA 1WE2A 1VE5A 4PFQA 3LYAA 3TZQA 3R3YA 1ZXBA 2VK4A 2HQSA 1X0XA 4HNSA 1DO2A 1WCIB 5AM0A 2NYRA 2JZOA 3DE3X 4PG7A 5ENZA 4Z1MA 4EKGA 4F0JA 1FBTA 1GTZA 3JZFA 3OKPA 5CRIA 3PFGA 1OH8A 3QU2A 1F20A 2CVFA 2WWYA 1NLYA 2JC3A 4GC9A 1HDRA 1OXMA 1TYDE 7ABPA 3U2QA 2IW1A 1BCRB 2Q3FA 3PJDA 3FBTA 1ZMOA 3PUWA 4YUZA 4FEEA 3VTZA 4MAMA 2WQZA 2Z6AA 3JWGA 3WZ2A 2DPXA 4X63A 2YXEA 4D3ZA 1G7RA 4XFDA 4ZO8A 5G0SA 1GKIA 4WLNA 5C4GB 1P6UA 1Z15A 1C9DB 5DKFA 3ZS9A 4L5BA 3HR7A 1H2EA 5EKXA 5AM2A 2Q0HA 4UXJA 1M0WA 4N5MA 3MMNA 2HZBA 2Q6KA 2GLTA 4HUQA 3TCKA 4LPSA 1RQXA 4F2HA 5L4SA 4EMTA 2H1SA 4HFJA 3ENQA 3H17A 3CKLA 1K8XB 1U4OA 4D26A 4ALIA 1VL0A 2D6FA 3IKEA 4KRGA 1PJCA 3ZX4A 3ZIUA 5C8ZA 1GPNA 4XLTA 5LP6B 1QPZA 1NIPA 2P91A 1MHPA 1WUHS 4QOHA 4WMLA 5KWVA 1LBEA 1PU2A 2DR2A 3ZHYA 4NXMB 1YVDA 5I47A 1E9DA 3S2EA 5JYBA 2VNHA 2LBWA 3NW9A 5J58A 5K1ZA 4YXWA 4ZALA 1E3EA 2I62A 2QM3A 2VO1A 1T3HA 5K6AA 3K0FB 2IDMA 3D8SA 2F3RA 2O2XA 3EQ7A 1TCBA 1T3GA 2FW6A 3CGGA 4RSHA 4B81A 4WXMA 2JB9A 5SZJA 1IN4A 3NDJA 4J4TA 5JO9A 4LV6A 4OATA 5C53B 4JJ4A 3MCWA 5ALJA 1HBJA 4YQEA 4CDNA 5G1PA 3G1WA 4BGEA 2P40A 3KEFA 3QVVA 2ZWIA 1SBQA 1GYQA 4GM0A 1LDGA 2J6IA 1QX3A 1U8XX 5B58C 1FUIA 1KARA 1V4BA 1PGOA 2EF0A 2NXEA 3DHWC 2ATEA 3CC8A 3DV9A 4GBMA 4JOQA 1N33B 2GN8A 3PFHA 4HWKA 1IBLB 3LWPC 1G3UA 2YNMD 3BEOA 4MO2A 5GGYA 1OBCA 3Q4GA 3JD4A 4LXXA 1OI7A 3CSDA 2RONA 5KQGA 2IEYA 4RWZA 4UDXX 4MWZA 5FWNA 1U8FO 3LUHA 4Z99A 5A3RA 3G7SA 3AQIA 3AUAA 1T2VA 2RBEA 2FPUA 1I4OA 4J76A 1GRCA 2Q28A 1U7XA 2OFWA 5KYYA 3U7HB 5BMOA 1ZM9A 4P5DA 2FSSA 2E21A 3RYFB 1A7UA 5JYEA 3V80A 3U6BA 2JARA 1XZPA 4GGOA 1NJ1A 3LQ2A 1KVTA 4F9TA 1OH5A 2V6BA 5BOVA 3RHTA 3TB4A 1VPTA 4J7UA 5T41A 3T5BA 3X1KA 3TF5A 1UDBA 2VJCA 3L8MA 5EQFA 1D7OA 1L4FA 1I33A 1IZ0A 3P96A 4PY2A 5JAIA 3DVRX 3OZSA 1U8ZA 2OYCA 3T4EA 3IO5A 4AQDA 3FPFA 1OD6A 4EO7A 2BO1A 2CXTA 1I14A 1RTKA 3G8DA 4MYUA 4F4JA 3N6RA 3JD1A 1XNHA 2WALA 4CLOB 4FDLA 4Y67A 4HLUC 4RF2A 4ZEXA 2P2LA 2QRUA 1DS6A 1NI4A 3AR3A 2JGLA 3MIIA 1M2NA 2PH7A 3MJ4A 4LNAA 5F64A 3IV9A 1TW2A 1G17A 1T9HA 4G0XA 3VR4D 3WTBA 4OFBA 3LLVA 3IOMA 2HS0A 5C5CA 3O3CA 4EMBA 2ZJ7A 3L79A 3GWZA 4FZJA 4ZCLA 4ZEMA 4EHFA 4JELA 1JNYA 1G3MA 2FRVA 4LRWA 1CLIA 4XDYA 1V7ZA 4WY5A 3NWJA 3REQA 3VPHA 1VSVA 2IOHA 2I4MA 4D0GA 3IQZA 1U0GA 5K09A 3ORFA 3EWIA 4K0KB 3F90A 1DBFA 1Z2DA 2ODBA 3NUGA 1LCIA 1QLHA 3BWVA 4REMA 2PU7A 3RSCA 3W6NA 2A1IA 1GJRA 3FWKA 1D4AA 1I1QB 4NBWA 3A2KA 1FMFA 1L4HA 4FNMA 2DKNA 2QTVB 1UBFA 4MB6A 3G49A 5HP4A 3ZHZA 1AUVA 3NFRA 4ID9A 4EB6B 5E4JA 3R5FA 4Y0NA 5C1IA 3V6LA 4QBHA 1JR2A 1DC6A 1JHOA 2GKOA 2YV4A 4JVOA 3CT4A 4KL8S 5K4AA 3IHTA 5AKIA 5C4MA 1WSWA 1A96A 2VSFA 2GCEA 2I99A 3A9VA 1XVAA 1YH3A 2Q45A 1PJ2A 3KOOA 4B7AA 3LIIA 1YNSA 3E3LA 4O5OA 5L3QB 4A36A 3BE8A 1NE2A 2A0XA 2XUFA 3A6DA 3P52A 4IDOA 4HWOA 1GNPA 3EXHC 4QDTA 4R54A 3HXTA 3NUZA 4IDAA 3G59A 4E70A 1Z2AA 1S2NA 1JJAA 3MCTA 1NJ2A 2X9VA 3VU3A 1T1EA 3QUQA 3CQ9A 2MINA 1C8KA 1YMUA 5TJ9A 2BTQA 3S68A 3U3RA 2BF4A 5FA6A 2JLXA 1L5FA 1FS4A 1Z7GA 3OA2A 1YRYE 4B3DA 1A9QA 3SY8A 3KETA 2BGTA 1M2VB 4MYSA 1TU4A 3KSDO 2X8AA 3MWYW 5H8WA 1OZGA 4P54A 4NULA 3HXLA 1ORVA 1RXUA 2ZGVA 4V2IA 5JE8A 1B26A 2OCKA 4WBSA 4B47A 1CN7A 4L5CA 4NAUA 2D5LA 3MBKA 1T5OA 3CZMA 2GWRA 3GFTA 1H8EA 5C35A 5AKZA 4HJRA 1AHIA 3C9TA 3DLCA 2WSLA 4Z6KA 1R8JA 4QC2A 3QNMA 3GZJA 1CUVA 3VYTB 2RB4A 4PPQA 3NLLA 3CSUA 4EYSA 1VBKA 2MYUA 2EATA 4QO8A 4WGGA 1JQDA 3A2LA 3ONNA 5B7GA 5IT5A 2ZUEA 5I3ZA 3I2JA 1TFUA 3AR5A 3FFWA 2H2FA 2B99A 2CUKA 4FNAA 2GF0A 5I8ZA 5TPZD 1E6MA 2AYXA 4B62A 3HBFA 3PYLA 3O6VA 1SHTX 4LNUA 1AHHA 1NVTA 1ZL2A 3PA8A 4QWMA 2FQYA 3NCHA 1F6DA 3K5IA 1QHNA 1ZRNA 3HWUA 4P35A 4ZVOA 3W5HA 5DBHX 3I8XA 1N5LA 1QGOA 3OIVA 1Z17A 5B64A 4MKZA 1T2DA 1R5JA 3WTCA 1WCXA 2NUAA 1T24A 5IULC 3RSGA 5JNSA 3I3OA 1GV1A 3TAHA 2PUHA 2FKAA 1NMSA 3M4SA 1O58A 1TVEA 2BBWA 4N18A 3E1SA 2BPOA 5THQA 3UOGA 3WGUA 3VNVA 4Y0VA 2QLMA 1I1HA 2VDLB 1F2UB 3LF2A 3IE1A 1EFRD 1E1RA 2QORA 3WAJA 4G1MB 2Q7DA 4IF4A 4URFA 3A06A 4YO7A 3ZU4A 2O7SA 2EIXA 1R12A 4ETIA 3JAMM 2ZJ6A 3C8LA 3WGQA 2I67A 3U4QB 4XSVA 5E9JA 4KFUA 1RW4A 2GJSA 5CDYA 3CF4G 4X1YB 1MT0A 1CZUA 1PWYE 1JFRA 2CXHA 1JKJA 2LKDA 3CURA 5KTRA 3IEWA 3C3KA 1A7AA 4NZNA 6CHYA 2QEQA 2IZ7A 2PIAA 3PVCA 6NULA 1M66A 4G0QA 3VR5A 5KOYA 3BS4A 2EGUA 3I4CA 1KEZA 2QBYA 3DOUA 3OJWA 1XEAA 5TS3A 5F4BA 3BCSA 2Q41A 3CYFA 1VCIA 1RXVA 1G5RA 1A9PA 2QN3A 4U6NA 3AVUA 4RFSB 3ZC3A 1R4NA 2LTAA 2VUTA 4E31A 4B3GA 3IODA 4J0IA 2AG6A 4AZ0B 3HKEB 1JEOA 1SU8A 4PRKA 2Q5EA 2VRNA 1Z0DA 2YBEA 1XL0A 3ZG6A 2DPMA 2I4RA 1E9SA 3F49S 4URUR 4TV8A 2EBHX 221PA 2BFFB 3AYZB 4QWWA 1E6UA 1NLUA 3GQBA 2W8BB 4G2NA 5DLPA 3DDCA 3KSZO 1MO4A 1MCZA 1A88A 1O5TA 1LDYA 3D4NA 1YAHA 1IBSA 4OKSA 3TWOA 4EB3A 2OGWA 3PCXA 2AOVA 2B1GA 3QMMA 1ESMA 4PC7A 3DHNA 2LV8A 4ZI3A 3QE4A 4RABA 3DEJA 5F7XA 2X7XA 1P72A 2ZSFA 5A0FA 3BXGA 4WTOA 1R15A 4YRJA 3TQRA 3O4GA 3HDJA 3L7MA 3OPNA 3PSHA 3RU2A 5KYTA 2JA2A 1NPTO 2ZJ5A 3ZW7A 1ID8A 1EUDA 1QVVA 2DQZA 3G4SF 2X8JB 3OQHA 5A9TA 3WKDA 2OXTA 3ROEA 4UE2A 2DETA 2O5VA 4HVAA 1FQKA 2G1KA 4LKRA 2HS4A 1N2CA 1ZNZA 4XJSA 4OQFA 1CQIA 3OUTA 3CRRA 1KZ9A 1J8DA 1QO7A 3I9NA 3ZE2B 3C6KA 1DV1A 3AJ8A 2VTBB 2VHYA 1PIWA 2FPLA 2O5RA 4PO3X 3RG2A 1ZGHA 4LF8B 1CR2A 2ZF8A 1EG2A 5EXEA 1O0SA 1ADFA 3N2GA 1AQLA 2ZI4A 1NMEA 5AMXA 3BQNB 1O4WA 2A3NA 3E2MA 5H68A 3GRAA 4AS2A 3RVBA 4C6TB 4FZ5A 1EFLA 3EIFA 3KOYA 2G9IA 3U4HA 2TMGA 3JATA 2IUEA 2CZQA 1SQ0A 2ZYSA 1JHXA 3PVZA 1VJ5A 2JFPA 2PRZA 2F8MA 2JFZA 2Q3MA 4BEWA 1XZGA 3GGOA 3B6ZA 3SE7A 2UVPB 3GMSA 4UZFA 2O2SA 2FFHA 4HXGA 6PFKA 4NCAA 3WDLA 3UY4A 5BWMA 2YWFA 1DKOA 2IQQA 4MUIA 4EHBA 4X62B 1UOQA 1W44A 4ZEOA 4B9EA 1JXOA 1LC3A 1U7WA 3SGLA 1PZHA 5BUCA 1Z74A 4IDCA 2VWQA 3KXDA 4CNQA 1JMVA 2Z04A 1IJBA 2ZUUA 1FTYA 2WD7B 2DJ5A 2K4MA 5JNUA 2W6MA 4N7BA 1NR1A 5CLJA 4FM9A 3QKTA 4JC5A 1RKBA 4Z9BA 3NVIB 2D1TA 2RB5A 3DMHA 4LXUA 3BRQA 5DLYA 2R96A 3HCAA 1RSZA 2VT6A 1FJXA 2WSIA 1J0XO 1I3CA 4OHVA 2PV0A 2X9QA 2ZRFA 3IKMB 4NF2A 4J9VA 2FWRA 1I4DD 1QH1A 4IW3B 2WFLA 3HZRA 4JEIA 4KO3S 3JW8A 3COVA 5EEGA 5ES3A 2M1ZA 4QNMA 3IUYA 3N7UA 4BB5A 1YJAA 1K6XA 1UANA 3V7EA 3EVBA 1RAHA 3RIXA 4J1SA 3SICE 3AI7A 5G0VA 2FR8A 1UMBB 3VIUA 1BE1A 1N6IA 1DRVA 2X3YA 1Y4SA 4JL5A 4L3WA 2JL1A 1JMYA 3HMKA 2C9BA 4HJXA 3GJ6A 4IMPA 5JV5A 5DDIP 2XQGA 1U7DA 2O8FB 2IPAB 1I6LA 3ZBUA 3K4PA 3W4IA 4HNAA 4KDCA 2O0LA 1Z7WA 4DT1B 3E48A 1MX9A 1A95A 3DVQX 3MB5A 2NVOA 3V32A 3KU1A 3SEZA 3ZQ6A 1P17A 2VNJA 2O8EB 2HP0B 3KK0A 3CCEF 1DWOA 4UEQA 4KP7A 4H08A 1YQGA 3MTGA 4FOLA 4UHFA 2OBNA 3DZHA 4MWCA 2QTMA 2CDNA 1I24A 1U28C 4ZYXA 3B48A 2I2AA 3G2MA 3MWEA 3PIDA 3E4CA 5EVJA 4K2HA 3I61A 3CYQA 5HWSA 1XA0A 1YL7A 4WN9A 4CT0A 3H5RA 5DXAA 1TA4A 1BH6A 3NBFA 4DA8A 3KQTA 1EWTA 2AN1A 1Z38A 3M33A 4RTLA 1PDWA 1NVDA 4RMIA 3STHA 1MAVA 1N2JA 4M46A 5SZIA 1T1GA 2NU7B 3BGOS 4QXOA 2CZCA 3LRTA 4QQFA 1BO6A 3QPBA 5I9MA 1JHPA 3LGSA 1QO0D 1DOHA 2RH9B 4TMWA 5HG0A 4KXLA 2G09A 2EWMA 3HXPA 4G8BA 3W34A 1DB3A 1TD1A 2TS1A 3SX2A 4M1SA 2DF8A 2HHCA 2R87A 3AR9A 3R3VA 2Q2QA 4RVCA 3ROMA 1U0SY 3AWDA 2F17A 1TMYA 2DVMA 1BNCA 1F2TB 1W35A 3F4KA 3ICWA 3MJHA 2D74A 1CDOA 1FNSA 5F73A 3DDNA 1QVRA 1M6VA 3Q7IA 4AY2A 5FR2A 2R4TA 1R27A 3UMRA 4F5ZA 3QUSA 4FHCA 2VHCA 3GMDA 1YZNA 1WOYA 5IJ0B 1EVLA 1GG2A 3GDGA 3GNSA 3JVVA 4GR9A 4GKAA 3W7BA 2KMLA 2DM6A 4YUWA 1J7KA 3K6KA 4HEHA 1VBNA 4AJNA 1CE8B 5BMVA 1KS2A 2IJGX 3RT7A 4G4GA 4NU5A 3H9QA 1EWKA 1IVYA 3UWOA 4QARA 4QYMA 1W85B 5EXXA 4C2AA 1PV1A 1FSSA 4H9GA 1U3FA 1H69A 3BJMA 1CEQA 1SJ9A 1SBHA 2GHQA 3BTOA 3TI9A 5CBKA 1KWKA 3BSSA 3DUFB 5E8JA 3TG2A 3R0QA 3CX3A 3ZOKA 4YMSA 3MWKA 2XNKA 2HDOA 3DOHA 3TINA 4RMNA 4BYGA 3A0UA 4IYRA 4I8XA 2MSNA 1XTBA 2B4YA 1QZUA 1A5BB 2PYIA 3HVKA 3OM1A 4OBXA 3WLQA 3F6EX 2WYWA 4CV1A 2OUIA 2XXJA 1WLSA 3P20A 3FZYA 5B36A 2BY4A 5DBEX 5L9AA 5F5NA 1J1IA 3GFPA 1YHYA 1ZU5A 5F1YA 5EIWA 4M98A 4OI2A 5A06A 4F4IA 3OTWA 4CDGA 2X42A 1OUMA 4QDJA 2X9LA 4PR0A 1TUEA 3NXKA 4JEUA 4WJLA 1R50A 5CM9C 4YLYA 1T4CB 1WULS 4ERHA 3EXG1 2XMPA 5ADWA 5LDDC 1CG6A 2H07A 2HU8A 2XT9A 4MQLA 1SVUA 2AL7A 3ETHA 1MVLA 4FBLA 3COSA 2CMFA 1W52X 2R1TA 5AVRA 1NT2A 1EXWA 3CIFA 3CN9A 4J16A 4JL6A 4MVJE 4Z7QB 5BW8A 1ZL0A 4M21A 3WAGA 1USIA 3VPFA 4DFDA 3O8RA 2OV1A 4A03A 1RYDA 3OW2F 2OORA 3WRVA 5TLSA 1C0PA 2BGUA 3ZQ4A 3ADDA 4RK5A 1T0JB 1KU6A 4IJWA 3CUWA 3JZMA 2VQ3A 2LRHA 2IYXA 1ZD9A 1K92A 1G5TA 4DLYA 5J5AA 2F64A 4J6EA 4XWKA 3BULA 1J23A 4RTPA 2HLPA 3LQFA 2FPSA 3WRXA 2KTVA 5B8FA 4EQ6A 3U56A 3UBTA 1K0FA 3TIIA 1O87A 5BT8A 4YUVA 3RQIA 3OEYA 4HAOA 4HDNA 2QP4A 1DCFA 1P2VA 4KV9A 1K06A 4L2IA 3O8DA 3TR5A 4Y6LA 1T0UA 1ZA2A 2VP6A 4NYMR 3ZE7A 5SY9A 5JMPA 4EDFA 2C9OA 1DXHA 3TS1A 4C9BA 1ISGA 2JCVA 1HDIA 2YHBA 3FF1A 4V0LA 1OLXA 5EP2A 2CYBA 2H63A 4EJ6A 4P1ZA 3PPYA 2WUDA 1LSJA 1PT8A 1BXKA 4IICA 3I34X 4TV9F 2OCBA 4I55A 3BGDA 1E2IA 2R1ZA 4I6GA 4U2GA 5KYXB 4RACA 1X9IA 5BVHA 3LTEA 1LDEA 5FO1A 2DECA 1HQCA 3O03A 4FKMA 5ARBA 5EIBC 1JI3A 1G8FA 4LJ5A 2GVZC 4GMFA 3SBDA 4CMAA 4ZAGA 4QFCA 3BMQB 5TVKA 2REQA 3SSMA 4PCVA 4LS3A 1LK0A 4QYIA 4D57A 5TQ2B 4DRYA 1J33A 1RRGA 2OHGA 1PG2A 2R8XA 3EGVA 1YR2A 2HU7A 1YJ9F 4F7DA 4RTOA 2AKAB 5HXAA 5CLIA 1N4AA 1J0BA 1D09A 1EFTA 1N6HA 2PU5A 3FHJA 5AVOA 2ODAA 2ZT8A 1D3AA 1N5DA 1QCDA 4KYVA 1E3MA 4AWAA 4FOPA 4KGZA 4ZZIA 1V1RB 2CK3D 1W75A 2V5VA 2XGOA 1N7HA 2NU8B 3R9XB 1BYIA 3C2QA 2QL6A 1L5MA 3RFUA 1ZEJA 3AF2A 5I7AA 4Q48A 2RG1A 1VI5A 1X7HA 3WPXA 3R7DA 4MOWA 1CXZA 1NUHA 4PLYA 4YJDA 1DTWA 1TZ2A 3MJTA 2O3TA 4M53A 1JEYA 2GM4A 1G8YA 1SBIA 4JWTA 3LDTA 1EH5A 2A14A 5E1BA 2AXQA 1B74A 2ZSEA 1MV5A 1GR0A 1U98A 4UAGA 3WMWA 4BTLA 5A9SA 3G5LA 4I4TA 3GBVA 3D3WB 3MCUA 1NUAA 1YQWA 2BMEA 3ANNA 1QUFA 3DTVB 3URKA 3CCJF 1V35A 2GD0A 3FHTA 3H5AA 5EHQA 4B4KA 2QRGA 3A1TA 4G89A 1WPGA 2XA9A 3C7CB 5CJJA 5DHUA 3PNBA 4X1IA 2Q4OA 3TW0A 1X15A 2PLFA 3ED1A 3NDIA 3PQ4A 5FTWA 1R9GA 2FMIA 2FK8A 1IM8A 1PFQA 2FZVA 2ZB3A 3FHCB 1R10A 3GLTA 3L6CA 4UMEA 3IUBA 5CNJA 3RS9A 5L51A 3BFJA 3ABQB 3GT3A 3Q2OA 2CFSA 4OHPA 3AIKA 1KI1A 2NTVA 1GZ6A 3SC4A 3GP5A 4LRTB 2C5EA 3FFBA 5FAKA 1XZFA 1GZUA 2E37A 3UCXA 2Q0QA 3TZLA 3GAFA 2XQKA 2QD5A 4D6YA 2AN9A 1PWEA 3B1FA 3TBFA 4UUMA 3BXPA 1A98A 3U4IA 1M1XB 5LQSA 5TX7A 3UWPA 3ZIDA 3SZOA 1DNPA 2YBDA 3KKPA 4MWDA 3BD7A 2BKEA 4D74A 1P1HA 3AVPA 3KTDA 2IUFA 1Y98A 3BH7A 3O5AA 1TAHA 4GYJA 2C7VA 4R8KA 3TKLA 2Q5IA 2ZODA 1JALA 2GRUA 1UIRA 1BOFA 1CSEE 3F6CA 3CTMA 2HFJA 4I3GA 5DGIA 5H82A 1B8UA 1ZH8A 3E0XA 3FUTA 5D00A 2G67A 4EYEA 2ONKA 3HRKA 4G23A 3H05A 1XAGA 2QR3A 2BBTA 1C1XA 3L8EA 3MT0A 2JFUA 3PIIA 1LEHA 2I6TA 4UUQA 5AJXA 2GEDA 2G80A 3EJWA 4MQ6A 4RXUA 2CDAA 3I3FA 2Q0XA 4GRAA 4DKXA 1ZFNA 5DIZA 5FV4A 2BM9A 4EPTA 2O48X 4RMJA 1FNJA 3RYIB 3DGEC 1O6GA 3SF0A 1PEKE 3EFHA 4B17A 4B79A 3TL6A 1KORA 1FRFS 2A0UA 3R6DA 1N3YA 3C8UA 1TEZA 3DL7A 1GO2A 2G5TA 2IYSA 1YOVA 2O05A 2QJTA 1GTL1 1HFWA 3QEKA 1C0KA 4MUHA 4IIUA 1W88B 3U0VA 3BRCA 1VQOF 1JZSA 3WA6A 4FIDA 4Q3LA 4F91B 2JW5A 4R40B 3QJ5A 1AXRA 3UB2A 1QKIA 2IVFA 4RTKA 3FH0A 3G2LA 1AA6A 4MUJA 3FYSA 4RE6A 3RSLA 1TZKA 3T7EA 4Y2PA 1USGA 1TQHA 3I5AA 4IOJA 2ZBGA 1OLUB 1SG0A 3WB2A 5FLYA 4G9GA 3VKFA 3MCVA 2RGNC 3D6JA 5TXGA 4EGSA 1PVVA 1VMKA 4QPJC 4WZAA 3SHFA 5CD1A 2GEFA 4TTAA 1TM3E 4PCLA 4EYGA 5JBNA 2PTGA 3WFZA 3WHIA 3P9QA 2NN3C 1PXWA 5JCJA 1CQZA 4EUKA 1FRNA 3TG8A 1LBSA 3FLEA 4FXOA 3P8ZA 1Y8ZA 4JLUA 5E6RA 3GCZA 2Q4BA 1Y4ZA 4L8VA 4CT5A 4DM7A 4AP5A 4IIGA 2PUFA 1BGVA 4JJ7A 5TIIA 3GTZA 5KJ1A 2N9UA 3HHPA 4QNNA 1BCSA 2HBZA 1S3IA 3A27A 3NBYC 4AKEA 3ZQKA 2RI1A 1G18A 1ZM2A 4KGVA 3H99A 2O7RA 1DBSA 5LZ2A 4I9HA 3DAGA 1QH8B 2HXGA 4C1NA 5LA6A 1XZJA 4PNPA 4MQ4A 5ARCA 2XIJA 3ZTTA 3HLYA 4NOKA 4QXMA 1H1LB 4JB8A 1K86A 1X8KA 4C4YA 2C3PA 4DBVO 3K0EA 5ALZA 2ETXA 4MJ3A 3WYNA 1Q2XA 1TEVA 2F1RA 5AHKA 2HC9A 1XSEA 4FXPA 1RT9A 4R5HA 1PJQA 1Z7YA 2QLNA 4UM9D 4CN8A 2MOKA 2ZCVA 1UXGA 1SCUB 3N2KB 5D1HA 1E3TA 4GMHA 5KWJA 1AS0A 1U9IA 3I58A 2VCYA 2OBXA 3T7JA 4ER7A 1XELA 3OUUA 2XDAA 3IEPA 1JVNA 3D0KA 4DN6A 4E5YA 1ISPA 2QN7A 2ZRDA 3KTAA 3G6EF 4HX9A 1JF8A 1W4AA 1HZZC 1R0KA 1EK0A 2DWUA 3DTNA 3QEMB 1Y1SA 1U5BA 4K6FA 3RG8A 2BUCA 3VYVA 3PLAE 2PH3A 4JUFA 1U8TA 1LSSA 3EIEA 3GEMA 3L4BC 4LV8B 5BN4B 3R7SA 3IBFA 5EMNA 3W3AH 3W5BA 4UHCA 5KSYA 1L4EA 3TRHA 3MTIA 5EJ5A 3GOHA 3NS7A 4K28A 5F52A 3KPYA 2J3EA 3HWX1 4R0NA 1K63A 2Z58A 1O2DA 3MHPA 4R2MA 5J59A 5KCMA 1N8NA 3TDNA 4CTNA 1VB5A 1HGXA 2O1SA 5FI5A 5B3AA 3R6GA 2CB9A 2GMWA 3D59A 2Y05A 2VDWB 3GJSA 3ZHTA 3KX2A 3LYHA 4F96A 2GFIA 1VLZA 3R0XA 5SYAA 4HT3B 3CRW1 2Q7XA 2WT4A 1K7YA 1YB7A 2VEDA 5F2OA 4Q18A 1FPMA 4L4XA 3LBHA 1HT1E 3ZGLA 1FNCA 3JQAB 4KQ2A 3R7NA 3TVDA 2NLOA 2M6RA 5BQ3A 5K3FB 2PUJA 3WPWA 2R79A 2UYGA 2JVIA 3CLHA 4H15A 1Z6TA 3E3MA 4IJUA 2XBUA 3UFBA 3IMEA 5BWOA 2KYRA 3MERA 4HX2A 3TKAA 4EJSA 1SXJC 1ZD1A 4F86A 3BXFA 3JRXA 4RA9A 5JCZA 3AL0C 1VYTA 2VTDA 3BB1A 2X1HA 2MHCA 3AQ4A 1DVRA 1REQA 1W30A 3AZQA 2HU5A 4L5AA 5AUNB 2IRWA 5L7YA 1XZAA 4JROA 3WL6A 3HVIA 4X0EA 3IP3A 2X13A 1LH0A 2C77A 4DDTA 5J4VA 3NJ8A 4QG7A 3ABSB 4D45A 2C99A 2YVQA 1TRKA 3G2QA 3N07A 3KQMA 2B4KA 3KKNA 1SEPA 5KVCA 4HZGA 3LVQE 1P2TA 2XUZA 1IN5A 3F97A 1A9RA 3OCZA 4QTXA 3UJPA 3WI7A 3UKDA 1XQWA 2IF2A 3ZOZA 3RPEA 5KVVA 4FKZA 4URHA 2GXSA 3RS4A 2QTRA 2ZWMA 3ZY5A 2QTNA 3DE1X 1X92A 4G4XA 1X3SA 1AGRA 2HIHA 3E9EA 2JJ2A 4XARA 5CDSA 2Y68A 2Y0PA 4G4IA 4RY2A 2PUTA 3IKLA 1DIGA 4KFSA 3D7SA 1YCFA 4R68A 2WF5A 3UUWA 3ZE1B 1QKJA 3NIWA 5CLGA 3DOCA 3LP5A 5EXPA 3RLIA 3SJZA 4XEHA 1SOAA 1GRRA 3AF5A 3CRVA 4PWYA 1H2XA 4Q3EA 1E6KA 1KKUA 1WY5A 2HY7A 3SYTA 4Q4DA 1YOBA 3KELA 1T8TA 5CIQA 2NP7A 4Q4HA 2QLTA 4BKQA 2PCLA 4IX9A 3IQWA 4WXRA 3FAKA 3HN6A 5IC5A 2E6UX 4Y1EA 2MSLA 4I08A 4NOJA 1KC1A 4I9UA 4WEQA 3ZY2A 2RMKA 3NNNA 2IS6A 3R09A 2J6HA 3EFOA 5AKJA 1FDVA 4D3XA 3ZLBA 4JCCA 3V8PA 4TSFA 1CY7A 5C1BA 1T3LA 3GLHA 1LI7A 4E08A 5HQJA 4X20A 4EG1A 1JG3A 4DMRA 1QH9A 4BV3A 4CHGA 2O6LA 5KPJA 4BQFA 2P0AA 5G02A 3FKJA 4C6RA 2HV9A 4QPPA 1U3CA 3E7DA 5BQPA 2G3YA 3W1EA 4K9PA 1CUCA 4G3XA 1P9RA 4LHVA 2C8VA 1RQRA 3CH7A 2DQSA 5ILQA 3T7RA 1PZEA 2DB3A 5EP4A 1W73A 2XAAA 2AIFA 4C7BA 2QAGB 2UZ0A 3EZLA 2DFTA 5JPDA 5KOJA 1GU1A 1CNEA 1UC8A 4XZ3A 4Y2RA 2ESRA 5AKKA 4D9HA 3ADBA 4IYJA 4DGSA 1P45A 1TLLA 5H3LA 4XYGA 2YWEA 2ZKLA 3ZHQA 2OBFA 4ZO7A 5AJYA 3I23A 1PYGA 2HRQA 2J1LA 1BXRB 2WKRA 1MIOA 3K0CA 5DB4A 9ABPA 3ZVKA 1B6TA 1NI3A 1GKKA 3PFBA 4X1OA 4JEMA 3S6JA 3D02A 3N6VA 3ORYA 3JWPA 1KI4A 4N7MA 4TOIA 1QU9A 3UT5A 4BMYA 2IHUA 1YZKA 4F71A 1QPGA 1DEOA 4UD2A 3S29A 2R6JA 5LUAA 3HJGA 1WEKA 1WIWA 1FFSA 2JNBA 2POQX 3QYAA 3VV2A 5JO0A 4EHHA 1R9JA 3LCJA 3G5MA 3M81A 3U7RA 2Y99A 4XPIB 2FR0A 1W34A 1Y3FE 5EC8A 3SSOA 4A1FA 4DG8A 3PCTA 1W57A 5JPCA 4W5TA 3JARB 2GSDA 3EIXA 3Q3JB 4QGGA 4DJFC 2XCTB 1V6CA 3HI6A 4FNOA 1Z6GA 2FEAA 2V6GA 2YZ2A 3DD1A 4MYRA 4KFCA 3PHIA 2UZIR 3QKSA 1WCYA 3NVAA 2LGJA 4C5AA 2JAOA 4D8TA 3O3OB 4OOEA 3ABIA 4JT4A 3TW4A 1JR3A 4LRUA 3LBIA 2C5GA 4UNIA 5FUYA 2QMOA 2Y77A 3K0KA 3N28A 3WYCA 4DG9A 1BDIA 1KVSA 1U02A 1U7OA 5F2KA 1FUYB 2W6ZA 2ZSAA 3OFND 2NXCA 4P0TA 3ZH2A 2J7PD 5BMVF 1WTCA 3VNAA 4BTVA 2P5TB 4Q3CA 2WINI 3KLBA 4EO4A 1KJYA 1Q83A 1U4NA 1P80A 4UZSA 4OBBA 3VTKA 5LVAA 4MB2A 4R9VA 4EI2A 1I0LA 4ZMSA 2PUEA 1DC8A 2OBLA 3EZFA 3QU7A 4KIWA 2HBRA 4PC1A 1B8PA 2X2PA 1FTNA 3DB1A 4LHEA 5B5SA 3H2KA 4XJXA 3WFJA 4BNGA 3N6XA 3PKIA 4Y98A 4GSYA 4NFYA 1EGVB 1GTVA 4UNRA 3SWWA 3FD6A 1Z28A 4Y6RA 1F2VA 5LPNA 1JQAA 3A4MA 3GJ4A 1QYVA 4C4WC 2AKYA 4X3OA 4DMLA 4RJJA 1E7YA 1XQXA 4NE2A 4XVCA 4YDRA 5DX0A 4IOLA 5FCDA 1QFJA 3PU6A 4O4IA 3Q7RA 3REQB 2Z4RA 1NURA 3ELUA 1DX9A 5BORA 2VDKB 4INAA 9MHTA 4YDHB 5A5EA 4B8WA 2O0HA 4LYGA 4JUIA 4OJYA 3E23A 1XDZA 4JZKA 2WU8A 1VE7A 4AX4A 1DRKA 2O0KA 1EI9A 2W2XA 1Q19A 1KEEA 4RTNA 3S0JA 5H7XA 1YR6A 1PZGA 3H8WA 3P27A 4RNCA 3BXXA 1F1JA 2DWPA 3OZUA 4FNGA 4ACBA 2H5JA 1G6Q1 6REQA 3DQZA 3HSYA 5M34A 1I3OA 3C8ZA 3N0RA 1U94A 1XZNA 1ZK1A 2C3UA 2MMGA 3ORSA 1VYHA 4PWZA 4PQGA 4QPZA 2JLQA 3K0TA 5DN6D 4P38A 1T6YA 5BNZA 3UGJA 5BYAA 1B16A 4Y2QA 4BU1A 5DV9A 4YACA 5IT9M 4YI3A 5KJCA 3NBUA 1Y1RA 1QFYA 3ETJA 2K7FA 2B1JA 3OOYA 1Z0ZA 1ZESA 4MA4A 1O94C 1YU6A 1GRQA 1QC5A 2WRZA 2WKPA 2FX2A 1YVRA 1XCPA 4N0DA 4IKPA 4DCCA 4IP0A 3TGPA 8MHTA 1R0LA 1ZCFA 4V0RA 1Z2EA 2A86A 2DBVO 1HEIA 2MINB 3IB6A 3TXAA 2PLNA 3ZNPA 4CMKA 3IT2A 2JI8A 4YCCA 1XPOA 3VOTA 4QUDA 1KVRA 3T8YA 3ZVRA 1OH7A 3GFOA 1NM5A 4KZKA 3G2KA 3E84A 1F8FA 1NZDA 1VCHA 2H11A 5IT4A 4J29A 3H8VA 4WZBA 1SKUA 2NSJA 2VSNA 3O2SB 1G7TA 4FVTA 1ZGGA 2J6BA 4HATA 4KXVA 5FAXA 4BZZA 4DEVA 1G2IA 3LQQA 4I5IA 3AR8A 4IDDA 3J7AC 3HFSA 2WHYA 2WWTA 4YP9A 3L0CA 2YASA 2EVWX 5F3RA 1G21A 1C7QA 4FWTA 4I55F 3AY7A 3BMOA 5BYBA 3KT8A 2YS6A 3D8RA 2G4VA 4Z2AA 3NGLA 5LLTA 3FGZA 4KMOA 2BM8A 1JEYB 2E18A 3PC7A 1TKCA 3JAMA 2Z1FA 4DRXB 1LTHR 2I2FA 3DE6X 4K9LA 1JG1A 1J0CA 4LNUB 1PFVA 2MSKA 4OJQA 3UH0A 4NNOA 2CNDA 3FI0A 4W6ZA 3D00A 2QUZA 5ECYA 3RUHA 5LIRA 4XE5A 1NF9A 5M5BA 3ZVNA 2FG5A 1PJ8A 3PFIA 2VNAA 1E58A 1SVOA 4WZAE 3LKVA 3W5SA 1X7ZA 2ONZA 3G9QA 4KIJA 1HLDA 2NUAB 5JC8A 4GBED 3CB4A 4C30A 1Q44A 3EGXA 1IM5A 3LIPA 5GOZA 1SZQA 1T6BY 3LV8A 3Q98A 5EJMA 2PV7A 3TJZA 4C7KA 4NWOB 2JGDA 1V8PA 3AOEC 3KB2A 1OXVA 4LYFA 5SV2A 5T57A 3W7VA 1J20A 1ISFA 1QYWA 1TDJA 4I81A 1PQUA 4TVKA 4DQVA 3CV3A 5L3RA 3IEMA 1BEZA 2X5JO 3VC3A 1TMGE 3WLMA 4E5SA 2JFXA 3NO4A 3G1TA 4PPYA 1ZRMA 3LMEA 1FY2A 1ONBA 3U81A 3KUKA 3K94A 3KL2A 2Q46A 4PSUA 2PZLA 2HLDD 2VXCA 3EDOA 3T0IA 2QIPA 3RVRA 3T6KA 1YVPA 4KQJA 4GMKA 1JKJB 5K8UA 4BC0A 4OJTA 5ITZA 3DL2A 3DWIA 3TW6A 4B2LA 4LBZA 2BFDA 5DYYA 2B98A 2ZWOA 3IJRA 3LW8A 3N2IA 4ROSA 1E5TA 3CEMA 2P27A 2VPYA 2QBYB 1YZUA 1LTKA 3WJ2A 5LBIA 1C8BA 1XVUA 1ZMXA 2J4DA 1SRRA 3NRBA 4FGLA 4G0YA 4TT3A 4B83A 3V2UA 4M8KA 3F78A 2FPGA 1YBHA 3V00A 3AEYA 2UYYA 4A0RA 1R4NB 1U2DC 2ATVA 4DLVA 3MWFA 4QBKA 4BLQA 1H94A 3OCWA 5DI3A 2IU3A 1VLJA 2VXBA 3H7AA 1E77A 3A11A 1Z5NA 1WSDA 5K6RA 1RBQA 2PL9A 3SU8A 3VGPA 4BVQA 1WU7A 2XWBF 4LBWA 3GAZA 3RLFA 3UUGA 1T91A 1RQ2A 2ZS9A 3M6WA 5EIFA 3WJAA 5JDIA 3UJ9A 2NTYC 5KU7A 4C04A 4FP9A 3SX0A 5J47A 1R1DA 3C1UA 3GHYA 3QW4B 3ET5A 4H3KB 4N9QA 2PGLA 1NSFA 3NNDA 1Q3KA 5HE8A 3VR2A 3ZDDA 1QP7A 3VUEA 1RYMA 1UJ2A 2NZJA 3EYWA 4KV7A 1RZUA 1TUBA 2R66A 3VC2A 4R9NA 2AC4A 2EKLA 1QIMA 2RHBA 5EJFA 3VO9A 5IFKA 1BE8A 4IMJB 4WEOA 1M74A 3PEUA 1J0EA 1Z25A 3G8AA 3P9KA 4NECA 2B20A 2D2EA 4OGGA 2C4UA 5IBCA 2CXSA 3T1NA 4DLLA 1KMHA 3ZV4A 5CDFA 1U0TA 1WB5A 1NR5A 3P5SA 3RT9A 3BWEA 3DFZA 3F47A 2ODNA 3QFTA 1Y82A 3SR3A 3T9FA 3WLJA 3DVLA 4KOAA 1N2CB 2WWRA 3KAJA 2V7WA 1CY1A 1CQIB 3H9GA 3PHHA 1Y1LA 1SVMA 1YUBA 3CPSA 2A1TR 2BOVA 1GSIA 3VZBA 1GCUA 1FLVA 3LUDA 3UA3A 2IC5A 4HN4B 5C8VA 4UEWA 4CT4B 3QSGA 5EJ8A 2AK2A 1Y8QA 4MV0A 4DA6A 1VQ7F 1WXIA 3B1KA 1KDZA 4E2YA 5JDCC 3DUWA 3VZCA 1ZNQO 4QRHA 1T0BA 2VJYA 3TNYA 3NDBB 1NRWA 3O38A 4NZYA 4BAGA 1U1IA 2QVYX 2EFGA 1IZ7A 4AT1A 5FBVB 2O3UA 3G17A 1J8MF 3FFAA 3HEBA 4ZI7A 3QVTA 1D04A 1JZQA 3BB3A 3A3KA 4G5QA 4F5WA 5FLKA 1TT5A 1AK1A 2P7IA 3RRMA 1AKWA 4YFYA 4C0BA 3ZP7A 2G08A 4CLOA 2A58A 3UV7A 4XJVA 1ZI8A 3VM6A 1CFZA 5CT5A 5E4YA 4RK6A 2Z8XA 3OQOA 1U0NA 3OHSX 3BIXA 1MQ8B 1TLFA 1UP6A 3BSFA 4RH0A 2P30A 5AHXA 1VE9A 2FZ4A 3CRNA 3D54A 5E3IA 3SNHA 3TTWA 3W5UA 3Q8LA 5A71A 1W9HA 1VIDA 3IIEA 1TF7A 4YGXB 3T9EA 5JUWA 1B00A 1ODIA 1ECLA 1GCAA 2E0IA 3EB9A 3HJTA 2H17A 3G8YA 4Q05A 5FP0A 3HC7A 3CB2A 3S02A 4FYJA 4PIMA 3TQOA 3W3AD 3ZWXA 5JS1A 1IEXA 3RQSA 4UHDA 2CJWA 4MRVA 3CZ5A 4KWEA 1QH1B 2BZ1A 2DFDA 2IYVA 2ZJZA 3C8MA 5HKKD 3IJEB 3KAQA 1UFYA 1FP2A 4R1QA 3KJJA 2QZ9A 3KVYA 4ZCTA 1SG6A 1CRLA 2Q2VA 2OPHA 4P81A 1V1MA 1N0WA 1HH4A 5LIPA 2JI4A 4JT8A 3LWBA 4F72A 4MTCA 4OKIA 1E1QA 1HORA 1N1EA 2JLSA 2O14A 4J0EA 4AUKA 5CG2A 4IZHA 4H6PA 3GLHE 4U39A 5EERA 4UFPA 4DR2B 1PGNA 1GNLA 5EMJA 3OF3A 1O97D 2B37A 1JTVA 4HNAB 3OX2A 4TTRA 5CJPA 5FBZA 2JHCA 3TFQA 4AZVA 4B4OA 4ZQCB 5BW5A 1VQPF 1BD4A 3LDGA 4CQMA 4JBHA 2SNIE 3HO8A 4KJZA 4QA9A 4YJGB 2CCJA 2O2GA 3GI1A 4NY1A 1DFHA 2ZIZA 1DQYA 2EF1A 1II0A 4Q5IA 4LJ8A 4TUYF 3CUVA 4J1NA 3V5NA 3B3GA 1QFMA 3O4HA 2YR0A 1TCVA 1OTHA 1YZHA 2DFKB 1ZOPA 1JFVA 2D8MA 3HSSA 3Q3VA 3GAMA 3R1IA 4HP8A 5CBPB 3GRFA 1KF0A 1TE2A 1RHRA 1YHNA 2D1SA 3OJOA 3PNMA 4Q01A 2E4YA 4XR4A 4HYQA 5FOVA 3VFDA 3VH1A 1GWNA 1PZNA 2HA5A 5DN9A 4ILEA 1KAHA 1T8UA 1VKNA 2QTGA 1FA9A 3I01M 3EVDA 3BK7A 3MTQA 2C1EA 3DHEA 1LA2A 1YB1A 5GINC 1Q1ZA 4U0KA 2CNBA 3P0FA 4NDAA 1LPAB 1Q95A 2QTAA 5JFOA 2GAIA 1V8FA 4TS1A 3OZAA 5I01A 1ORHA 2YXDA 5GWXA 3IT1A 2QTFA 1FL9A 4EFNA 3HB9A 3S8YA 3A0RB 4G56A 4KUEA 2YZGA 1I7QB 4B6GA 1RIIA 3OICA 2XB2A 5FNVF 4I9NA 2E1PA 5LQUA 3ZHXA 1M6VB 5H4GA 3IDOA 5IAAA 1JWAB 4Z5XA 2B7LA 3BWYA 3SYLA 3E8MA 1IBMB 3TIFA 4U1RA 1IATA 1M6WA 1I3KA 2EHDA 2OO5C 4WERA 3EGCA 4DSAA 3SBEA 4MVJH 5KVSA 1RHMA 5EAZA 4Z9YA 3NEJA 5G3ZA 4HMQA 1YI1A 3MGKA 4UUBA 1XU9A 4RK4A 4XCQA 2NMVA 2A9KA 3GVXA 3MQ2A 4RNDB 5F98A 5DBOA 1KI9A 4YLGA 1RLIA 4ZOCA 4GKJB 1NFFA 1HL3A 1RLOA 2FR1A 2G9UA 1L5KA 4MWOA 4X7RA 2Y0EA 1OFVA 1RI5A 4AP9A 2QAIA 4EPWA 3IHWA 5H80A 1G19A 2E55A 2XMQA 3VPDA 2HSWA 3K16A 4MTLA 5DP2A 2XZDA 2PWAA 1YFKA 3ABRB 3FDJA 4RHYA 2CD9A 5BSTA 2AFVA 4HFRA 4UEOA 3THOA 3QG1A 1GPH1 3A2MA 2PMKA 3UATA 1NF2A 4X90A 5FUVA 1QHEA 3VH3A 2X23A 2AC7A 1Y6QA 3TUZC 4FYMA 1ENPA 4RIEA 3W77A 3U3ZA 3DT9A 4ME6A 2GLUA 3ISTA 4ECAA 1GT91 2N75A 1GL7A 1X1RA 5BQFA 3NIFB 4BMVA 2VF7A 2Y0CA 2F43A 1QH0A 1PJAA 3EPJA 1KA9H 2QGZA 1LRLA 3BHMA 3CBQA 1XKXA 4KQWA 1Z8FA 1N6OA 2C5SA 1U81A 2I5PO 4KWIA 3F8SA 1GG5A 4KWHA 3RODA 3KV1A 4INJA 5J43A 4YY3B 1GQFA 2GZ1A 2CY0A 3AFMA 4G07A 3W2HA 3UA4A 1I94B 2AI1A 2FF5A 4MXDA 4RH3A 3WLEA 4E21A 3GVHA 9GPBA 1JNXX 1V39A 1EFDN 3PXXA 3I0NA 5AK5A 4E12A 3SC3A 4TL9A 2GZSA 1T5DX 1P3Y1 2C29D 3P2EA 3GJYA 4Y2TA 4D5GA 3BK1A 1FIUA 2DU8A 1GPLA 1GUDA 4EI9A 1TI7A 2CHEA 1VQ6F 3FNEA 2AE1A 3OMXA 5EHIA 4ZVNA 4D4HA 2IX9A 5JT1A 1L4GA 1UPAA 2V96A 3FI9A 5CM8B 4KX5A 4L5JA 5HQTA 5JAUA 4ASUD 4LXGA 2Y1EA 4L16A 1W7AA 2QYTA 2HTFA 4GXNA 3HDVA 4OEHA 4U3JA 3AUYA 4JT9A 4YRSA 2G72A 4UFOA 4R9SA 3AFOA 4XQCA 3I12A 2YYAA 4TZ6A 1U2QA 3WIDA 2EDAA 2GYUA 5DYNA 4MVJP 1ZUD1 1ZK3A 2X0JA 3PC8A 4ZTUB 2IQIA 5EWJA 4DDVA 4B3XA 4EQ6B 1KH1A 1N2ZA 2F8SA 2P79A 2GBLA 1NJFA 5K0JA 2HXYA 2H48A 4H7PA 5KKAA 1EUQA 4HDNB 3KQOA 4BX3A 2CFCA 1SIUA 5ESWA 2PS9A 4BVEA 4M8IA 1V43A 2W2VA 4X1KA 4URWR 5BUSA 3IAS6 2PS1A 4B5KA 2Y6UA 4L50A 1TOAA 4JP1A 2C9ZA 4DCSA 3NAZA 4LMBA 1IG3A 4O1MA 4NFLA 3SYKA 4JI2B 1U2GC 1QV7A 1OGJA 1U9JA 2OWDA 3R44A 4HR7A 1W5BA 3N0VA 3N2YA 4WKCA 5DGHA 3SZRA 4CCWA 3U1BA 1B0UA 1KDTA 3F46A 4H1VA 3GG9A 3M4YA 1CCWA 2BEVB 1ZD8A 4OREX 4MWEA 2Y67A 3GUUA 1RYEA 2HT6A 2EX4A 2P7HA 4WZBE 5BVHB 4TWZA 4EHKA 1C30B 1Q57A 2PFSA 2ROQA 2CXPA 4M9RA 4PZUA 3VJLA 1EZ4A 3PKZA 3BA6A 5L3VA 5K05A 1T6XA 4JLOA 3I8OA 4MKXA 3RBZA 1BJRE 3JU3A 1JD1A 3D9QX 5TY0A 3E9ZA 4OM8A 4QYIB 4AX8A 4R7ZA 2YFQA 1FMCA 3MSXA 2YW2A 2ET6A 3L46A 3JXEA 3U0OA 2FQXA 2A84A 4NS4A 3SKYA 5LDGA 1BJKA 4RL4A 1DEAA 2B8TA 1CJVC 4YEDA 3I6MA 5ALTA 1QOZA 2UZ4A 3W2FA 5HTOA 1ISSA 1PZXA 3QKRB 3AF6A 2IA5A 3KQSA 5TARA 1Y63A 2HREA 1N1MA 4P4UA 3GUHA 2Z3ZA 1RJ9A 1R88A 1UQRA 3KJGA 1G8SA 3P9CA 4JHXA 4DKJA 1GTSA 1DTWB 4ZRMA 2EGHA 3FOBA 4L8LA 1GM5A 5B2EA 5HUQA 3NEAA 1G3QA 1QCZA 1VJ1A 2WPNA 1ZN2A 2PX0A 3F7NA 5AK6A 5A9SB 1JLMA 2WNSA 4GSLA 1E0AA 4I4TB 1JHUA 3CBGA 3GFFA 4RVNA 3W05A 2DYKA 1GPBA 2VCEA 2ZZKA 1BHJA 2ZB7A 3KB1A 3KPVA 2YFHA 5T4BA 1IOLA 2ABWA 2Z3WA 4R83A 5AOVA 2HVYD 1PSDA 1NATA 4ZHVA 1A5AB 1CP2A 1W0JA 1QDLB 4X1IB 1CLUA 1THGA 3DZGA 4LUCA 4BEVA 2QN9A 3EWSA 3ELDA 2AI2A 3F8WA 4JP2A 3ESXA 1NPDA 2EFCB 1F0NA 1PL6A 1QK4A 3GG2A 4KE7A 4QOGA 4TKMA 4BLPA 2E4UA 4LF7B 3L18A 4KDRA 3A6KA 4RVHA 1W2GA 2ZR0A 2AWOA 3OZRA 2E82A 4JVLA 2NO6A 4Q3BA 1RPJA 2R00C 1F17A 3FCSB 5F7JA 3RC3A 3VR1A 4DAEA 5B4TA 3AOGA 1ZAYA 4OOFA 4GL4A 2J41A 5BSRA 1L1QA 2WIDA 1H47A 3CPQA 1SPXA 1H2YA 1SXGA 4JSYA 2HMTA 4G85A 4MV6A 3PX7A 4IIJB 4NZ9A 3DLBA 1X6VA 3AW8A 4OVKA 1M1ZA 5A4IS 2OMEA 3K8QA 4CDRA 4CIDA 5JZVA 5H9WA 2XB9A 4RU1A 3I32A 4M36A 3AWIA 1S89A 3T94A 2WK1A 3QLVC 1KYYA 4KK3A 4JJAA 3H2ZA 1N8SA 5I7SA 1XDDA 1RWWA 2IY7A 1PTJC 1B43A 1C1XB 1ZP6A 2ONYA 3CCRF 4BECA 4KPYA 4OXIA 1CB7A 2W2TA 1W1WA 5HJEA 1LGYA 1BA3A 1J21A 1OKKD 3WNCA 1FS6A 4F8YA 2FX5A 3AH8A 3SNKA 3T7AA 5LC1A 4UREA 3U09A 3KHUA 5FUWA 4G5SA 4MPPA 1RA4A 5CDFE 3RJZA 4ABTA 4QDXA 4AKHA 1XN1A 2ZB2A 4DDMA 2A5YB 4FS8A 4QAQA 3H7IA 1E0SA 2Q21A 4MV3A 3EXFA 4RANA 4K6GA 4PAWA 5E2BA 4OD0A 1TL7C 1Q8RA 1KO5A 2A6PA 3O74A 3ENNA 1Q7EA 2RH5A 421PA 1II8A 3LYLA 1N25A 1MGPA 2WJPA 2QVZX 4UBMA 5LQRA 3ZD6A 4TMTA 4U5XA 5GV7A 4J3NA 5C18A 1G1AA 4WZAB 1ML3A 4TMZA 1YQTA 3JQAD 4LXQA 5CFNA 3VH4A 3WICA 3IDAA 2OYSA 4CU5A 3S03A 4UDYX 5DCLA 1YCGA 3WLTA 1FFDA 2J3HA 3KB8A 1E2BA 3LE8A 1VKJA 4WRRA 3DDSA 1GNSA 4Q4JA 2R7NA 1BCSB 2NSDA 5D6NA 1ZJYA 4J7CA 4PIVA 4DCOA 1GNVA 1Q22A 1IN6A 1T1IA 1QHFA 2IYUA 3CY6A 4RGVA 3UQZA 2RGGA 3WYGA 3ZHCA 3A28A 3U19A 2H51A 2OGTA 4GMGA 5LA6B 2ICAA 5LMNB 2YN0A 3CZAA 4CR8A 5CFRA 2XRZA 2OO7A 2YKGA 1LSOA 4W5HA 4MPJA 4XPZA 4FB4A 2BTEA 5B3LA 1PL0A 2H9IA 3RYTC 3PLRA 1C0EA 3UB3A 1DTSA 3U4GA 1GDTA 1Z06A 3AETA 4FFSA 1AVTA 1K75A 2DKFA 2IIVA 1FNBA 3D01A 2VSOA 3ZJUA 4YPFA 5ELMA 4FE7A 2VP2A 1B3RA 3MOIA 4WOPA 1HM5A 3M6FA 2VA9A 3HXMA 4EB8A 3HJCA 4UAVA 3NX4A 2HSJA 4DXAA 3UJDA 1T43A 2NO1A 1YVUA 2D5BA 4BOYA 4Z7JA 5EQTA 3K6SA 1OJLA 2JH3A 3URMA 1IXYA 3UC9A 1U5BB 4GM4A 3QLTA 1LNSA 1YZGA 1S72F 4BB9A 3ELYA 1NDHA 4HVLA 2R2AA 2R85A 3BIOA 1NBHA 1I2CA 1ZN9A 3NOVA 4K8RB 4RPGA 2ZTHA 4ZARA 1JJFA 2G36A 2C5BA 2WA2A 3GOQA 3IBSA 1FX1A 2A1TS 4IL5A 2HD4A 3CMMA 5LXTA 4HB4A 5A1JA 5C8XA 4NBTA 4FQ7A 1O4VA 4D56A 5H81A 4GO1A 4KVZA 5E9WA 5COAA 5EINA 3ESQA 3AVYA 1XOIA 4JODA 1UKBA 5CA1B 4LDAA 3D2CA 3IUMA 3C3XA 3KZOA 1H3FA 2HPVA 5E38A 1HLPA 3UNXA 2OV8A 4TLEA 1OFUA 4II3A 4LY9A 3AKCA 1Z5WA 2UYNA 5ICMA 3LWVC 1HRKA 2M9MA 3W2IA 5EGNA 3D8UA 4MR9B 1PL7A 4XKJA 2H6LA 1CF9A 4FD3A 3FWZA 3ZI0A 4XB2A 5LD2B 1H66A 1N3LA 4LTMA 1XD8A 4OHXA 2WT8A 4M1YA 1P9OA 2BC9A 4WFKA 2QG4A 3BMXA 3T99A 1RAGA 2JVKA 4MLDA 3ZV3A 4EJMA 4FR5A 3DAPA 2ISSD 1RWKA 3OQPA 4P08A 1UK8A 1G9TA 1REQB 3ZE0B 2X5XA 3A2NA 3WOVA 2NVUA 3PE3A 3VR6H 3FTNA 5DW3A 4CKCA 3VKHA 1TLTA 3E20B 1Y5MA 2JASA 1Z4IA 3O9VA 1M1NA 4AM8A 1CNFA 1JQJC 5HJ5A 4E7OA 1RMQA 1MB9A 2FCAA 1VSQA 1FXUA 2Q4TA 5IC6A 3X2SA 4PPFA 4LJYA 3HXOA 1KQ3A 1Q1AA 1WBJB 1D6MA 2AYZA 2JFVA 4NBSA 3SDSA 4RLQA 5IF3A 3RD5A 2Z56A 3FLBA 3GF4A 3QP9A 2HJ9A 3GXBA 3WBJA 3X1XA 3UH1A 1CIVA 3E7FA 2G9QA 5AOCA 4TWIA 4BNWA 5BURA 5KCZA 2BFNA 1U7UA 4O4JA 2XCRB 4I50A 1GUFA 3OBBA 2QI9F 1QFXA 1Z07A 2RAFA 3STYA 1GGEA 4R7TA 4R1SA 1QZZA 3FW1A 5TMBA 1EX7A 4MYCA 5BR1A 1AKYA 4BNKA 3WSVA 1PZFA 5CYPA 5HY2A 4PPGA 4RIFA 3HVUA 1RKVA 1VCMA 4ZVUA 3TZCA 1I5EA 2DRIA 1LVHA 2FE4A 2GVIA 3IR6A 3D3EA 4FEGA 4BKMA 1RM0A 4BVLA 1DKPA 2HAEA 1QGYA 2P5UA 1IV4A 5K0GA 2O50A 1HQKA 2W11A 1A0OA 3O75A 3KJHA 1XK6A 1QB7A 2AHOA 3LKDA 4HDSA 2JHGA 3ZY6A 3CX7A 1T2UA 3QFFA 1XF9A 2NQ8A 1YSCA 3ICOA 4KQ9A 3EFOB 5KYUA 1TKAA 3ZNOA 3CVJA 2XMZA 1JAIA 2ZIAA 2ZJOA 5KX5A 1I6WA 3OHMA 3HDTA 1QR6A 2GBCA 4RC9A 2GA8A 1L7OA 2PSSA 4KVAA 3GDWA 1D5WA 3GLHB 2O20A 4X20B 4LF5B 3LCRA 2C1ZA 3LGXA 4LSZA 3RSQA 3CA8A 2ENWA 3ACCA 4KLAA 3W4KA 2B8JA 2F9FA 1ZR4A 3BYQA 1O95D 1YXMA 2QMQA 3MINA 1Q0LA 2OCPA 4XDHA 1KI3A 5GMOA 5IEBA 4LJRA 1QANA 1XJQA 4GYYA 1XRLA 2JGFA 1JFLA 5HQ3A 3TLJA 4FN5A 5AICA 4AN4A 1RHQA 3THWA 2RJOA 3PZRA 4BBZA 4YIHA 521PA 2FEXA 4CKBB 1KFJB 5BOSA 1VMIA 1YUNA 5ANRB 5IF9A 3JQ8A 4INOA 5JJ5A 2E5LB 3AJ9A 2GPTA 4PSAA 1N8KA 2R25B 5I5EA 1EVEA 5AK3A 3BTVA 3CW2A 3C6BA 4LDRA 3HBMA 4I1IA 4MDFA 4RZHA 4TWJA 2CKDA 2XCUA 4NCXA 3IALA 2CV2A 2HSEA 3NIGB 4NHEA 2NYAA 3QE3A 1AQUA 1ZO8A 2RHLA 2IYYA 2YXPX 3AI2A 4HDOB 4WAUA 1CS4C 3UT5B 3RE3A 1DC7A 1Q0RA 1TO6A 1C9NA 1ESEA 4R1NA 2XUKA 2E4WA 2OTLF 3WMXA 3UWMA 3PUVA 4JJGA 1XTQA 1AUPA 4MVJD 4MAAA 4R51A 2IDJA 1PBTA 3EF3A 4GKVA 3C9UA 4DIEA 2XKJE 4FHZA 3W6ZA 2OEPA 2Q1TA 3KIPA 1RZ3A 1DJMA 3EVCA 2GYVA 3AHCA 1DO0A 2BUAA 4MMYB 2OHJA 1GZ7A 3ZDXB 4EA7A 1OFUX 5B3JC 5D01A 2AJLI 1GSOA 2Z2YA 4LSMA 4ZXFA 1K8YB 4BT3A 2F00A 1NAIA 2YJTD 3GYQA 2QX7A 2ZRMA 4EOGA 1IXZA 1EA5A 2J3MA 1N6RA 1Z4NA 4FR0A 3U39A 5HTKA 1FDOA 1QZTA 3OP4A 1MX1A 2V1UA 3VSDA 1CUSA 1ZBQA 5E7JA 3FBWA 4KH0A 3WJ7A 4E33A 1R5OA 3HCBA 4P7BA 1EJ6A 1D2AA 3MSCA 1A7JA 2BGKA 3DEYX 1TJPB 3ONDA 4KQXA 4RD1A 4UVDA 3MCQA 3N3AC 4NOMA 1P5FA 1XZCA 5CT8A 3UK7A 4RHAA 5TPWA 2UKDA 1WP9A 1DBQA 2O1XA 1WHSA 4L4SA 4H7FA 3FN4A 4QYTA 4D79A 5I51A 1PUIA 4RE5A 3PJEA 5BQOA 1M73E 1MNQA 5DZSA 3OM8A 3R3XA 4QTTB 4EHJA 4YV1A 2ZUVA 1RXSA 2GXQA 3SVLA 2AG0A 2BDUA 1M8PA 4DL9A 3T3IA 1Y7LA 1EFKA 3WQSB 3NV7A 2A0KA 1JKXA 4FFPA 3SQOA 4JYBA 4AY3A 4DIDA 4ZYWA 1IIRA 4C7MA 4IILA 4Q3AA 3KNZA 2NNWB 2PEYA 3W2EA 3JQDA 1TT7A 3S2ZA 2AMFA 4FBGA 4CMEA 1TADA 3KVVA 3ZGXA 1XJ5A 1ORIA 3H4MA 4F12A 5GQSA 2JRLA 5LB4A 5G4UC 1L4NA 3R3HA 5K0BA 3DOJA 4O4IB 2CNWD 4PZAA 3S2FA 4TZ0A 3KOWA 3LHFA 4BV9A 2IGTA 4CYMA 2H0QA 4HMOA 4WI1A 5IT9A 3ZXSA 2VF8A 4MINA 5J9FA 3ZH9B 1AV6A 1XHEA 1C29B 1ECPA 2OESA 1MN6A 2ZBPA 4AULA 5HNKA 4LW8A 2NO9A 4JUCA 4N3NA 2BFBA 3VI6A 4QHTA 5CFOA 2NO7A 4YJ2A 2YJ6A 3C9SA 1CQJB 2OHHA 4PSCA 3OE7A 4D0SA 5HIAA 3CCMF 2GGSA 2FA9A 2PLRA 3G02A 2FLKA 3ITKA 1X7GA 3G0BA 4QQKA 4BE4A 3CRZA 1DBVO 1X25A 1PYDA 1NW5A 1LS1A 1H6BA 5EHGA 2BBSA 5T4EA 1DIHA 1IHXA 2W70A 1Z5GA 4H17A 5LP6C 4YI5A 3RFVA 3SQDA 3VC7A 1OF1A 3JQFC 4Z51A 2CV0A 2BE9A 1KSFX 1WU8A 3I04M 3ABZA 3K09C 3L41A 4U7PB 5EZ6B 5A4DA 5GIPE 4TWAA 5LYJA 3CUYA 1G1MA 3MUNA 3DO8A 4WECA 4PFJA 3WWZA 3QWIA 4A2CA 6LDHA 2A3RA 1BWPA 1GTMA 4ON9A 1NQXA 3PR2B 4G84A 3UAYA 2M6SA 4M4SA 4NCKA 1ENYA 3HJNA 5SZHB 3RABA 4PFSA 4X3CA 3RNLA 3FAZA 5AQ1A 2COUA 4X7MA 5FJIA 3VR5D 2FUG6 2VXYA 3BZBA 4MUMA 1HQYE 3GCWA 2BFWA 3AUFA 3AX6A 3O73A 2GO1A 2NO0A 1OW3B 1XVVA 2GK6A 1OHHD 3GARA 1OSNA 2CXQA 5H02A 1JDJA 1M33A 1Q5PA 4LYEA 4PLWA 3NONA 1EE2A 4GQBA 1ZZEA 3OE5A 4HEQA 3I45A 2KWIA 5EYPA 1IULA 2DT5A 4YP7A 2JAQA 1VRVA 3IQXA 1GY8A 3N7AA 3R0ZA 1V3TA 2VATA 4Q3KA 4WZBB 4E5MA 4POOA 1UIMA 3ICCA 1JSCA 1UJ6A 1H0RA 1RHJA 2J3QA 2ZJAA 4WVLA 1IWBB 5D51S 4DLWA 5AVKA 3T5TA 5HFJA 2P3OA 1L1FA 5EIAA 2AQHA 4IGAA 3MNFA 3BMOB 5FYQA 1XWIA 4Y1FA 4RF3A 1DJLA 2ZRQA 2QN8A 3Q7PA 3PNLA 3HE3A 4IV8A 4BQRA 2DFNA 3U80A 2BI4A 3R0VA 1UI9A 2CW4A 2X0KA 3OOSA 1CR0A 4Z4IA 1FFBA 2BJWA 1UCFA 1O03A 1QAOA 3FBGA 3AEUB 3LD9A 1LDNA 4BS9A 1IHOA 1J7HA 1K7FB 2BMAA 3NC4A 1GPKA 4PX9A 4KMSA 4ND6A 1X7ZB 4JN6B 3HV2A 5CXUA 2GQ0A 2QM8A 2RI0A 3R6TA 3GJ8A 2AUNA 3IDSA 2BHSA 3O91A 1ENZA 1AK2A 3I37X 1F7UA 2PRYA 2BI8A 4LI0A 4OMCA 4MB0A 2GPYA 1F1BA 3QK7A 2JGDB 1XZIA 3INNA 3BRWD 4HZUA 2Q5JA 4MMZB 5DTEA 3I9KA 4EPXA 1CUIA 2WWHA 5ABPA 1DRJA 1BXGA 4XI9A 3Q6MA 1JDSA 1UZMA 1WVIA 3T5DA 4AJ2A 2WP8J 5AESA 4ZPXA 2E3JA 2V9YA 3IHLA 4BVFA 4N48A 4FIZA 5LZ5A 4D9CA 5ENVA 3G3EA 4TKUA 3EIWA 1C9JA 5ITZB 2PIDA 1Q1GA 4EHNA 4BP8A 2IP2A 3E1KA 2BD0A 5EJAA 5FL7A 2QRHA 4ZC8A 1GPYA 4RK0A 2QRQA 4CIBA 3K9WA 4FDTA 5AM1A 4O8ZA 2FPGB 1Z6ZA 2HHAA 4AK9A 3R7FA 3H19A 2QE7D 3INRA 3D0QA 2VPQA 2HK9A 4UE3S 2YXNA 1CULC 1K73H 2VJNA 1QD9A 1F7VA 5I6DA 4YRDA 2GETA 3L7QA 5D87A 1ZAKA 2QMHA 4N0MA 5ALLA 2I2XB 1ZJ5A 4UPEA 1ZBDA 3CW9A 4NBUA 2JAWA 1D9ZA 2P9HA 1PV2A 2GN6A 3AILA 3D1JA 3K32A 2Z8YM 1YHQF 3DMTC 4M1QA 1W40A 2WAOA 2IOYA 4I0WB 1MJGM 5JANA 1JEQB 3KWJA 3O0TA 1NNLA 4U7WA 2IU0A 1T5LA 4ID3A 1P7PA 3M1LA 1SUIA 4Y7DA 5DNEA 4XM0A 1TUBB 1MC1A 3C85A 1WB4A 1AXEA 1RQGA 1UM9A 3Q7QA 1BGWA 3C6XA 4MW7A 1RFLA 4AWBA 2G9RA 4AS3A 1ZS9A 4S3MA 4G1FA 4YPVA 1OI2A 4JASB 1ECJA 3K31A 2J08A 1U40A 4RAQA 5EZYA 1RI2A 3VNQA 3IHKA 5I48A 2SBTA 2H8CA 1C3JA 1T4BA 2QV7A 1T5HX 1U6KA 3FYTA 3I53A 3L0YA 1PJRA 4KKVA 3FB1A 3VYRB 1QK3A 5SICE 2GILA 2CMDA 4RD0A 3KQHA 3WMFA 4CMGA 4G8DA 3VYTC 4ZCQA 1OWNA 2K5UA 3N7TA 4ZAYA 1VLQA 4YO8A 5F9FA 3DE4X 5DM4A 1OX4B 2VCHA 4D9MA 1ODCA 1B6RA 2XQIA 3TSWA 1G66A 5KTNA 4M38A 2O19A 1PP4A 4S0XA 1S2OA 3L4JA 4ONEA 1OU4A 3A6EA 3C48A 2J9RA 4OU4A 4PAOA 4RJLA 2Q9CA 3A7EA 2W6JA 5F4ZA 5H59A 2IKSA 1Y3HA 4M9QA 3D7MA 2GN1A 4R71A 5JHGB 1H3EA 2GJAA 2ZAGA 4YJ3A 4ZI7B 1Z2CA 4LFAB 2GF2A 4FJ2A 1TT5B 4K40A 1IEWA 4FPXA 2OHIA 4DSNA 2AV6A 1C3LA 2A4MA 3NXSA 4G1EB 5J5VA 1J0DA 4MHSA 4TS3A 2R6GA 1KK2A 1SC6A 3ME5A 3QVUA 3UXYA 1IY9A 1IBCA 3DG9A 1GL9B 1C9YA 3M49A 4QDKA 4ZCSA 5ELLA 1NBME 2Z6QA 2W5UA 4C14A 2HMSA 4NARA 1AS2A 1EZZA 3IIJA 2G63A 2L82A 3M9LA 5CVDA 1X86B 2FC3A 2IWRA 3WGMA 1SAYA 3UJNA 2C4WA 3SBOA 1Z5UA 2WPDD 1DI0A 3UGKA 2C7BA 5IANA 3DBLA 4LJAA 3CVWA 2X58A 4V1CI 1EVQA 1V9CA 3A9CA 2VAPA 1Z0SA 4RV4A 2VYNA 3FHOA 1RYBA 1YKSA 1UJNA 3B1ZA 2GT1A 1XD2A 3KJXA 4L51A 3FPIA 5B57C 1YKFA 1FFAA 4BQQA 4ZJPA 3UMVA 1P2BA 1UKAA 3ASVA 1S9DA 4H59A 5IMBA 1V1MB 2M1XA 2M98A 3FCCA 3IV6A 3QELA 4J75A 2QR2A 3FPCA 3ROPA 1WPXA 5JYDA 2A67A 1JQKA 1L7BA 3BG5A 5FUXA 4LBYA 2IS1A 3L7IA 3H5VA 5AW1A 4R1OA 4X41A 1BX1A 2FMUA 2GJ9A 4FWIB 2ZB4A 3C70A 2R4UA 2WIBA 2ES4A 3MJVA 5HZGA 3DZIA 1GEEA 4HMPA 4DY4A 5EKUA 4GDFA 5IW8A 3IAM6 1HDZA 4D3DA 2ZYTX 2VLIA<