3NMUC

Crystal structure of substrate-bound halfmer box c/d rnp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
molecule keywords NOP5/NOP56 related protein
total genus 29
structure length 121
sequence length 121
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nmuC00
4TZZA 5G4UC 3OBWA 3SIUA 3LWVC 3MCAB 3PLAC 3PAFA 1YJNF 2OHWA 3CCRF 3FFMA 3LWOC 1IPAA 2CZWA 1W42A 3OW2F 2VGMA 5GAPK 1VQLF 3E1YA 1GO1A 3SIVA 3CCEF 2BO1A 3JAMM 1RA4A 1VQNF 3CCSF 1GZ0A 1K8AH 3J7AR 1PXWA 3CCJF 1W2BF 3LWRC 3VMFB 2ALEA 3VI6A 1QVFF 1YIJF 5IT9M 4X3LA 1Q86H 3CMEF 2HVYD 1YJ9F 1X52A 3JCMM 1S72F 3NK6A 3I55F 5FLXM 3CMAF 3HAXD 3NVIB 1VQMF 1JJ2F 1K73H 2I6DA 2WALA 2KTUA 2VGNA 1Q82H 1ZWZA 1K9MH 3V7EA 1SDSA 2OTLF 2KG4A 5G4VC 2OTJF 5FJ4C 1VQ5F 1CK2A 3CC4F 5GANK 2JNBA 3NVKE 3LWPC 3LWQC 1E7KA 2QA4F 4BW0B 3O85A 3OBYA 3CG6A 2OZBA 5A2QM 5GIPC 1VQ7F 2AIFA 3J81M 5GINC 1YITF 1X7OA 1W41A 1NJIH 1YJWF 1M90H 1VQ6F 5DCVA 3CCMF 3CC2F 1VQPF 1KC8H 2QEXF 1W40A 1M1KH 2FC3A 3CPQA 1H7MA 3I56F 4NUTA 3CC7F 4BY9D 3CCLF 3G6EF 1Q7YH 3CD6F 2QI2A 3V7QA 3AGKA 3N4ZA 2LBWA 2LBXA 3HJWC 3CCQF 1W3EX 3G4SF 5GIOC 1YHQF 1DT9A 5EO3A 3RA6A 1KD1H 1XBIA 1VQ4F 3J80M 3NMUC 3WXMB 3CCUF 5EWRA 3IR9A 1Q81H 1N8RH 1NMUB 3GYQA 3CCVF 1VQ9F 1GO0A 4LCKA 3LFOA 3G71F 1KQSF 3NK7A 3N4YA 3CPWF 1RLGA 1QVGF 1CN7A 3ON1A 3RA5A 1X7PA 1VQOF 4C4WC 1YI2F 1VQ8F 3CXCF 1VQKF 1T0KB 3E20B 2KTVA 4X3MA
chains in the Genus database with same CATH superfamily
4TZZA 5J2TB 1FNJA 4U3JA 5G4UC 3OBWA 3PAFA 1ONIA 3P0ZA 1U3LA 1XRGA 5CA1B 3OW2F 1SZQA 1R1MA 5CB4A 3ESJA 3E1YA 3WJRA 2CVLA 4EB6B 3SIVA 1U43A 1OFUA 3IEQA 4E6EA 1GZ0A 1PXWA 3CYQA 1W2BF 3RYFB 3LWRC 5HY2A 2HP0A 1RQ2A 2BTOA 4XCQA 1Q86H 1X52A 2VAMA 3FPIA 4IIJB 2IQQA 5FLXM 4F6RA 4TV8B 1VQMF 5EZYB 2G9IA 2WALA 4YJ3B 5LA6B 5IJ9A 2VGNA 3IEWA 3S0HA 4B5CA 2UYKA 1QD9A 1K9MH 2CSLA 2HS4A 1Z5VA 3ZOPA 1H48A 3K2XA 3RYFA 5JQGA 5BMVB 2OTJF 3RYHA 2N48A 2IAFA 1CLIA 2KGWA 4ZK7A 3B6NA 2QA4F 4IHJB 3O85A 3IMPA 2OZBA 1VQ7F 2AIFA 3J81M 1YITF 1X7OA 3KIZA 4O4HB 4X20B 4YJ2B 1W41A 2ZVZA 2F9ZC 1VH8A 3RYIA 2GVIA 3I3FA 3CC2F 2ZOVA 4DXDA 4B45A 1RLUA 1JN1A 2PHNA 3VYUC 4X1YA 4I4TA 3UT5A 5HXUA 2K1SA 1H7MA 3I56F 5JVDA 1TUBA 4C8IA 2UYNB 3K14A 4ZI7B 2AIZP 3G6EF 3P10A 2ZAUA 3IKEA 4LNUB 3WGMA 5HY1A 2LBWA 2LBXA 3HJWC 3CCQF 1DBFA 5FNVA 3E22A 3KE1A 1W55A 3F0FA 3WGKA 4O4LA 5IYZA 5GIOC 1YHQF 1DT9A 5KMGB 3RA6A 1KD1H 3J80M 3CCUF 5EWRA 3ELCA 1Q81H 5CA0A 4C8EA 3JALB 1KQSF 4X1KB 3CPWF 4TV9B 5JH7A 3JARA 3GTZA 5IJ0A 1QVGF 5GONA 3HKDA 1CN7A 3RA5A 1X7PA 3VTIC 1VQOF 4BVSA 3CXCF 3C9UA 2OTMA 3MQWA 3MBMA 3QHDA 2CWJA 1T0KB 5EB0A 2CHTA 2Z1FA 5KX5B 4TV8A 1PF5A 3C9RA 1VHAA 2ZODA 3JATB 2OHWA 3JAKA 2ZF8A 1IV1A 1KNJA 3LWOC 5CA0B 1W42A 2BTUA 3D54A 3VYTC 4HNAA 3CB2A 1GO1A 3C8LA 4NQ3A 1YQNA 2Z1UA 3JAMM 3TD5A 1K8AH 4I55A 3S03A 1QVFF 4X20A 4C81A 2UYJA 2RHLA 3KJKA 3CMEF 2HVYD 3RYIB 1OAPA 3JCMM 2Z1TA 3JATA 1JFFA 3CMAF 4KWEA 3S06A 2I6DA 1FSZA 2R751 2Z01A 5J2UB 3P4EA 4BT7A 2KG4A 1IV3A 3HKEA 1JY8A 5ITZA 1U40A 4G4XA 1W581 2HX0A 3OONA 3E22B 3FD5A 3NVKE 3LWQC 2R6R1 4R40B 3QTYA 3R0PA 5GIPC 2RB9A 1VK3A 2B33A 2P6YA 4X1KA 1YJWF 1M90H 1VQ6F 5DCVA 3GHZA 1SA0B 1KC8H 2QEXF 5LA6A 4FFBA 5EZYA 4ZHQA 1M1KH 5C8YA 1H47A 4BY9D 2HP3A 1VQVA 3DC2A 3V7QA 3AGKA 5JQGB 3VIUA 3TD4A 4X1IA 5LP6C 3C9TA 3HKCB 3ERNA 4HNAB 3VO8A 3HWUA 3N2GB 5HP7A 5LP6B 5KX5A 1JD1A 2VXYA 1W5FA 3IKFA 4ZI7A 5C8YB 3CCVF 1VQ9F 2MQEA 4LCKA 2Q1YA 3HKBB 3NK7A 3N4YA 4U39A 4EI9A 5FNVB 5JVDB 4O4JB 2UYNA 4O4LB 4X1YB 2LBTA 5HWEA 5IYZB 2NMUA 1VQ8F 1FFXA 1ODEA 1IV4A 2HP0B 1XV2A 3WPWA 3WJQA 3F0EA 5HXZA 4O4IA 3MCQA 3PLAC 3SIUA 1YJNF 3QUWA 3S0WA 4RHAA 3CCRF 4BVQA 3JASA 1IPAA 4BT4A 2QTPA 4G88A 2RHHA 3HKEB 3JARB 2VGMA 3VCZA 5GAPK 3L7QA 3N2KA 4NWOB 3CCEF 1RA4A 3LMEA 1W5AA 2V9YA 3J7AR 4O2AA 4EI8A 2FGYA 5GONB 4EI7A 5JCOA 2HQSC 5JH7B 4WBNA 1YJ9F 3V4DA 5EIBD 1COMA 4I50A 4G4WA 2KTUA 2ZVYA 4EB6A 1Q82H 4YJ2A 3N2KB 4TUYA 4BT2A 4M8IA 2Z1EA 2HS0A 5HY4A 4O2BB 1SA0A 4PWTA 4FFBB 3ZP7A 1W5EA 5MN5A 1CK2A 2EWCA 3CC4F 5HY0A 2JNBA 4I55B 1E7KA 2BTQB 4BW0B 4BT3A 1QAHA 3N2GA 5A2QM 3JAWB 3HKBA 5EB1B 4X1IB 4G4YA 5HP8A 2IG8A 4DRXA 4ERHA 4O4JA 3LDTA 3BYQA 2VAWA 3RYHB 4NUTA 5J2UA 5EAZA 5LP6A 5LYJB 3CC7F 2PMPA 1Q7YH 3CD6F 2HS3A 5J2TA 3N4ZA 3VYSC 1W5BA 3M4SA 3F0DA 3G4SF 4C8GA 1UFYA 4ZHQB 3VOBA 5CA1A 1VQ4F 3WGJA 3FBAA 5LOVA 3IR9A 2L26A 4ZOLA 3UT5B 4C82A 3GYQA 5LXTB 2LCAA 1IV2A 3KJJA 3LFOA 5EYPA 3G71F 2UZHA 1RLGA 3WJPA 4LNUA 1FNKA 3ON1A 1YI2F 3S02A 1VQKF 3E20B 2KTVA 4X3MA 1XHOA 4ZHVA 3LWVC 3MCAB 5IJ9B 2YXZA 4B62A 3FFMA 2CZWA 5LXTA 4IIJA 1UI9A 3D00A 3JVHA 3WPXA 1VQLF 2VAPA 2DT4A 2DYYA 1GX1A 4G4ZA 4G4VA 5JCOC 3RE3A 2BO1A 2W8BC 1VQNF 3CCSF 2UYPA 4BVTA 3CCJF 3CYPB 3VMFB 2ALEA 3VI6A 5ITZB 1YIJF 5IT9M 4IHJA 4X3LA 3VOAA 2YYEA 1S72F 3K0TA 1FFXB 3NK6A 3I55F 3ZP4A 4DRXB 3HAXD 3NVIB 1U3PA 2Q1XA 1JJ2F 1K73H 3ZO8A 4BVRA 1QU9A 2AMTA 4U3JB 1ZWZA 2CW4A 2HRYA 5MN6A 3V7EA 1SDSA 1NQ3A 5EIBC 5CB4B 5MN4A 3JASB 4BT6A 5G4VC 2OTLF 1RQ7A 3Q8HA 3F0GA 2GZLA 5FJ4C 1VQ5F 3TD3A 3K12A 4I50B 5GANK 3LWPC 4YJ3A 5LYJA 4ZHYB 3DDNA 2I6RA 3OBYA 4ZOLB 2CHSA 3CG6A 4O2AB 2H8CA 5GINC 3HKCA 1NJIH 3FD6A 1Z5WA 3RYCB 4TV9A 4WBNB 3CCMF 5EYPB 1T0AA 1VQPF 3WGNA 3KHNA 3C9SA 1W40A 2RHJA 4F6RB 5KMGA 2FC3A 3CPQA 5IJ0B 3M1XA 3MDOA 4TUYB 1KNKA 2RHOA 1TVKA 3CCLF 1J7HA 1W57A 3EORA 5B8FA 5BMVA 3JAWA 3JALA 2QI2A 4O2BA 3I7TA 1W3EX 3HKDB 1X25A 3RYCA 5EO3A 4I4TB 4O4IB 2H6LA 1XBIA 4B46A 3NMUC 3WXMB 2H8EA 4BT5A 3F6MA 1NMUB 3M84A 1N8RH 1GO0A 1TVKB 4ZHWA 3JAKB 4O4HA 1YGYA 3S0YA 3T80A 3LYBA 3HTNA 3U0OA 3D01A 1Q8RA 3WGLA 4RQOA 3V3TA 4C4WC 1W59A 5AVMA 1JFFB 1TUBB 2HRUA 2GLZA 5LOVB
chains in the Genus database with same CATH topology
4TZZA 5G4UC 3OBWA 5HXZA 3SIUA 3LWVC 3MCAB 3PLAC 3PAFA 1YJNF 2OHWA 3CCRF 3FFMA 4BVQA 3LWOC 1IPAA 2CZWA 1W42A 3OW2F 2VGMA 5GAPK 3D00A 1VQLF 3E1YA 1GO1A 3SIVA 4NQ3A 3CCEF 2BO1A 3JAMM 1RA4A 1VQNF 3CCSF 1GZ0A 1K8AH 3J7AR 1PXWA 4BVTA 3CCJF 1W2BF 3LWRC 4EI8A 3VMFB 5HY2A 2ALEA 2FGYA 3VI6A 1YIJF 4EI7A 1QVFF 5IT9M 4X3LA 4XCQA 1Q86H 3CMEF 2HVYD 1YJ9F 1X52A 3JCMM 1S72F 3NK6A 3I55F 5FLXM 3CMAF 3HAXD 3NVIB 1VQMF 1JJ2F 1K73H 2I6DA 2WALA 2KTUA 4BVRA 2VGNA 1Q82H 1ZWZA 1K9MH 3V7EA 1SDSA 2OTLF 2KG4A 5G4VC 5HY4A 2OTJF 5FJ4C 1VQ5F 1CK2A 3CC4F 5HY0A 5GANK 2JNBA 3NVKE 3LWPC 3LWQC 1E7KA 2QA4F 4BW0B 3O85A 3OBYA 3CG6A 2OZBA 5A2QM 5GIPC 1VQ7F 2AIFA 3J81M 5GINC 1YITF 1X7OA 1W41A 1NJIH 1YJWF 1M90H 1VQ6F 2F9ZC 5DCVA 3CCMF 2GLZA 3CC2F 1VQPF 1KC8H 2QEXF 1W40A 1M1KH 2FC3A 3CPQA 5HXUA 1H7MA 3I56F 4NUTA 3CC7F 4BY9D 3CCLF 3G6EF 1Q7YH 3CD6F 2QI2A 3V7QA 3AGKA 5HY1A 3N4ZA 2LBWA 2LBXA 3HJWC 3CCQF 1W3EX 3G4SF 5GIOC 1YHQF 1DT9A 5EO3A 3RA6A 1KD1H 1XBIA 1VQ4F 3J80M 3NMUC 3WXMB 3CCUF 5EWRA 3IR9A 1Q81H 1N8RH 1NMUB 3GYQA 3CCVF 1VQ9F 1GO0A 4LCKA 3LFOA 3G71F 1KQSF 3NK7A 3N4YA 3CPWF 1RLGA 1QVGF 4EI9A 1CN7A 3ON1A 3RA5A 1X7PA 3V3TA 1VQOF 5HWEA 4C4WC 1YI2F 1VQ8F 4BVSA 3CXCF 1VQKF 1T0KB 3E20B 2KTVA 4X3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZZ A;  5G4U C;  3OBW A;  3SIU A;  3LWV C;  3MCA B;  3PLA C;  3PAF A;  1YJN F;  2OHW A;  3CCR F;  3FFM A;  3LWO C;  1IPA A;  2CZW A;  1W42 A;  3OW2 F;  2VGM A;  5GAP K;  1VQL F;  3E1Y A;  1GO1 A;  3SIV A;  3CCE F;  2BO1 A;  3JAM M;  1RA4 A;  1VQN F;  3CCS F;  1GZ0 A;  1K8A H;  3J7A R;  1PXW A;  3CCJ F;  1W2B F;  3LWR C;  3VMF B;  2ALE A;  3VI6 A;  1QVF F;  1YIJ F;  5IT9 M;  4X3L A;  1Q86 H;  3CME F;  2HVY D;  1YJ9 F;  1X52 A;  3JCM M;  1S72 F;  3NK6 A;  3I55 F;  5FLX M;  3CMA F;  3HAX D;  3NVI B;  1VQM F;  1JJ2 F;  1K73 H;  2I6D A;  2WAL A;  2KTU A;  2VGN A;  1Q82 H;  1ZWZ A;  1K9M H;  3V7E A;  1SDS A;  2OTL F;  2KG4 A;  5G4V C;  2OTJ F;  5FJ4 C;  1VQ5 F;  1CK2 A;  3CC4 F;  5GAN K;  2JNB A;  3NVK E;  3LWP C;  3LWQ C;  1E7K A;  2QA4 F;  4BW0 B;  3O85 A;  3OBY A;  3CG6 A;  2OZB A;  5A2Q M;  5GIP C;  1VQ7 F;  2AIF A;  3J81 M;  5GIN C;  1YIT F;  1X7O A;  1W41 A;  1NJI H;  1YJW F;  1M90 H;  1VQ6 F;  5DCV A;  3CCM F;  3CC2 F;  1VQP F;  1KC8 H;  2QEX F;  1W40 A;  1M1K H;  2FC3 A;  3CPQ A;  1H7M A;  3I56 F;  4NUT A;  3CC7 F;  4BY9 D;  3CCL F;  3G6E F;  1Q7Y H;  3CD6 F;  2QI2 A;  3V7Q A;  3AGK A;  3N4Z A;  2LBW A;  2LBX A;  3HJW C;  3CCQ F;  1W3E X;  3G4S F;  5GIO C;  1YHQ F;  1DT9 A;  5EO3 A;  3RA6 A;  1KD1 H;  1XBI A;  1VQ4 F;  3J80 M;  3NMU C;  3WXM B;  3CCU F;  5EWR A;  3IR9 A;  1Q81 H;  1N8R H;  1NMU B;  3GYQ A;  3CCV F;  1VQ9 F;  1GO0 A;  4LCK A;  3LFO A;  3G71 F;  1KQS F;  3NK7 A;  3N4Y A;  3CPW F;  1RLG A;  1QVG F;  1CN7 A;  3ON1 A;  3RA5 A;  1X7P A;  1VQO F;  4C4W C;  1YI2 F;  1VQ8 F;  3CXC F;  1VQK F;  1T0K B;  3E20 B;  2KTV A;  4X3M A; 
#chains in the Genus database with same CATH topology
 4TZZ A;  5J2T B;  1FNJ A;  4U3J A;  5G4U C;  3OBW A;  3PAF A;  1ONI A;  3P0Z A;  1U3L A;  1XRG A;  5CA1 B;  3OW2 F;  1SZQ A;  1R1M A;  5CB4 A;  3ESJ A;  3E1Y A;  3WJR A;  2CVL A;  4EB6 B;  3SIV A;  1U43 A;  1OFU A;  3IEQ A;  4E6E A;  1GZ0 A;  1PXW A;  3CYQ A;  1W2B F;  3RYF B;  3LWR C;  5HY2 A;  2HP0 A;  1RQ2 A;  2BTO A;  4XCQ A;  1Q86 H;  1X52 A;  2VAM A;  3FPI A;  4IIJ B;  2IQQ A;  5FLX M;  4F6R A;  4TV8 B;  1VQM F;  5EZY B;  2G9I A;  2WAL A;  4YJ3 B;  5LA6 B;  5IJ9 A;  2VGN A;  3IEW A;  3S0H A;  4B5C A;  2UYK A;  1QD9 A;  1K9M H;  2CSL A;  2HS4 A;  1Z5V A;  3ZOP A;  1H48 A;  3K2X A;  3RYF A;  5JQG A;  5BMV B;  2OTJ F;  3RYH A;  2N48 A;  2IAF A;  1CLI A;  2KGW A;  4ZK7 A;  3B6N A;  2QA4 F;  4IHJ B;  3O85 A;  3IMP A;  2OZB A;  1VQ7 F;  2AIF A;  3J81 M;  1YIT F;  1X7O A;  3KIZ A;  4O4H B;  4X20 B;  4YJ2 B;  1W41 A;  2ZVZ A;  2F9Z C;  1VH8 A;  3RYI A;  2GVI A;  3I3F A;  3CC2 F;  2ZOV A;  4DXD A;  4B45 A;  1RLU A;  1JN1 A;  2PHN A;  3VYU C;  4X1Y A;  4I4T A;  3UT5 A;  5HXU A;  2K1S A;  1H7M A;  3I56 F;  5JVD A;  1TUB A;  4C8I A;  2UYN B;  3K14 A;  4ZI7 B;  2AIZ P;  3G6E F;  3P10 A;  2ZAU A;  3IKE A;  4LNU B;  3WGM A;  5HY1 A;  2LBW A;  2LBX A;  3HJW C;  3CCQ F;  1DBF A;  5FNV A;  3E22 A;  3KE1 A;  1W55 A;  3F0F A;  3WGK A;  4O4L A;  5IYZ A;  5GIO C;  1YHQ F;  1DT9 A;  5KMG B;  3RA6 A;  1KD1 H;  3J80 M;  3CCU F;  5EWR A;  3ELC A;  1Q81 H;  5CA0 A;  4C8E A;  3JAL B;  1KQS F;  4X1K B;  3CPW F;  4TV9 B;  5JH7 A;  3JAR A;  3GTZ A;  5IJ0 A;  1QVG F;  5GON A;  3HKD A;  1CN7 A;  3RA5 A;  1X7P A;  3VTI C;  1VQO F;  4BVS A;  3CXC F;  3C9U A;  2OTM A;  3MQW A;  3MBM A;  3QHD A;  2CWJ A;  1T0K B;  5EB0 A;  2CHT A;  2Z1F A;  5KX5 B;  4TV8 A;  1PF5 A;  3C9R A;  1VHA A;  2ZOD A;  3JAT B;  2OHW A;  3JAK A;  2ZF8 A;  1IV1 A;  1KNJ A;  3LWO C;  5CA0 B;  1W42 A;  2BTU A;  3D54 A;  3VYT C;  4HNA A;  3CB2 A;  1GO1 A;  3C8L A;  4NQ3 A;  1YQN A;  2Z1U A;  3JAM M;  3TD5 A;  1K8A H;  4I55 A;  3S03 A;  1QVF F;  4X20 A;  4C81 A;  2UYJ A;  2RHL A;  3KJK A;  3CME F;  2HVY D;  3RYI B;  1OAP A;  3JCM M;  2Z1T A;  3JAT A;  1JFF A;  3CMA F;  4KWE A;  3S06 A;  2I6D A;  1FSZ A;  2R75 1;  2Z01 A;  5J2U B;  3P4E A;  4BT7 A;  2KG4 A;  1IV3 A;  3HKE A;  1JY8 A;  5ITZ A;  1U40 A;  4G4X A;  1W58 1;  2HX0 A;  3OON A;  3E22 B;  3FD5 A;  3NVK E;  3LWQ C;  2R6R 1;  4R40 B;  3QTY A;  3R0P A;  5GIP C;  2RB9 A;  1VK3 A;  2B33 A;  2P6Y A;  4X1K A;  1YJW F;  1M90 H;  1VQ6 F;  5DCV A;  3GHZ A;  1SA0 B;  1KC8 H;  2QEX F;  5LA6 A;  4FFB A;  5EZY A;  4ZHQ A;  1M1K H;  5C8Y A;  1H47 A;  4BY9 D;  2HP3 A;  1VQV A;  3DC2 A;  3V7Q A;  3AGK A;  5JQG B;  3VIU A;  3TD4 A;  4X1I A;  5LP6 C;  3C9T A;  3HKC B;  3ERN A;  4HNA B;  3VO8 A;  3HWU A;  3N2G B;  5HP7 A;  5LP6 B;  5KX5 A;  1JD1 A;  2VXY A;  1W5F A;  3IKF A;  4ZI7 A;  5C8Y B;  3CCV F;  1VQ9 F;  2MQE A;  4LCK A;  2Q1Y A;  3HKB B;  3NK7 A;  3N4Y A;  4U39 A;  4EI9 A;  5FNV B;  5JVD B;  4O4J B;  2UYN A;  4O4L B;  4X1Y B;  2LBT A;  5HWE A;  5IYZ B;  2NMU A;  1VQ8 F;  1FFX A;  1ODE A;  1IV4 A;  2HP0 B;  1XV2 A;  3WPW A;  3WJQ A;  3F0E A;  5HXZ A;  4O4I A;  3MCQ A;  3PLA C;  3SIU A;  1YJN F;  3QUW A;  3S0W A;  4RHA A;  3CCR F;  4BVQ A;  3JAS A;  1IPA A;  4BT4 A;  2QTP A;  4G88 A;  2RHH A;  3HKE B;  3JAR B;  2VGM A;  3VCZ A;  5GAP K;  3L7Q A;  3N2K A;  4NWO B;  3CCE F;  1RA4 A;  3LME A;  1W5A A;  2V9Y A;  3J7A R;  4O2A A;  4EI8 A;  2FGY A;  5GON B;  4EI7 A;  5JCO A;  2HQS C;  5JH7 B;  4WBN A;  1YJ9 F;  3V4D A;  5EIB D;  1COM A;  4I50 A;  4G4W A;  2KTU A;  2ZVY A;  4EB6 A;  1Q82 H;  4YJ2 A;  3N2K B;  4TUY A;  4BT2 A;  4M8I A;  2Z1E A;  2HS0 A;  5HY4 A;  4O2B B;  1SA0 A;  4PWT A;  4FFB B;  3ZP7 A;  1W5E A;  5MN5 A;  1CK2 A;  2EWC A;  3CC4 F;  5HY0 A;  2JNB A;  4I55 B;  1E7K A;  2BTQ B;  4BW0 B;  4BT3 A;  1QAH A;  3N2G A;  5A2Q M;  3JAW B;  3HKB A;  5EB1 B;  4X1I B;  4G4Y A;  5HP8 A;  2IG8 A;  4DRX A;  4ERH A;  4O4J A;  3LDT A;  3BYQ A;  2VAW A;  3RYH B;  4NUT A;  5J2U A;  5EAZ A;  5LP6 A;  5LYJ B;  3CC7 F;  2PMP A;  1Q7Y H;  3CD6 F;  2HS3 A;  5J2T A;  3N4Z A;  3VYS C;  1W5B A;  3M4S A;  3F0D A;  3G4S F;  4C8G A;  1UFY A;  4ZHQ B;  3VOB A;  5CA1 A;  1VQ4 F;  3WGJ A;  3FBA A;  5LOV A;  3IR9 A;  2L26 A;  4ZOL A;  3UT5 B;  4C82 A;  3GYQ A;  5LXT B;  2LCA A;  1IV2 A;  3KJJ A;  3LFO A;  5EYP A;  3G71 F;  2UZH A;  1RLG A;  3WJP A;  4LNU A;  1FNK A;  3ON1 A;  1YI2 F;  3S02 A;  1VQK F;  3E20 B;  2KTV A;  4X3M A;  1XHO A;  4ZHV A;  3LWV C;  3MCA B;  5IJ9 B;  2YXZ A;  4B62 A;  3FFM A;  2CZW A;  5LXT A;  4IIJ A;  1UI9 A;  3D00 A;  3JVH A;  3WPX A;  1VQL F;  2VAP A;  2DT4 A;  2DYY A;  1GX1 A;  4G4Z A;  4G4V A;  5JCO C;  3RE3 A;  2BO1 A;  2W8B C;  1VQN F;  3CCS F;  2UYP A;  4BVT A;  3CCJ F;  3CYP B;  3VMF B;  2ALE A;  3VI6 A;  5ITZ B;  1YIJ F;  5IT9 M;  4IHJ A;  4X3L A;  3VOA A;  2YYE A;  1S72 F;  3K0T A;  1FFX B;  3NK6 A;  3I55 F;  3ZP4 A;  4DRX B;  3HAX D;  3NVI B;  1U3P A;  2Q1X A;  1JJ2 F;  1K73 H;  3ZO8 A;  4BVR A;  1QU9 A;  2AMT A;  4U3J B;  1ZWZ A;  2CW4 A;  2HRY A;  5MN6 A;  3V7E A;  1SDS A;  1NQ3 A;  5EIB C;  5CB4 B;  5MN4 A;  3JAS B;  4BT6 A;  5G4V C;  2OTL F;  1RQ7 A;  3Q8H A;  3F0G A;  2GZL A;  5FJ4 C;  1VQ5 F;  3TD3 A;  3K12 A;  4I50 B;  5GAN K;  3LWP C;  4YJ3 A;  5LYJ A;  4ZHY B;  3DDN A;  2I6R A;  3OBY A;  4ZOL B;  2CHS A;  3CG6 A;  4O2A B;  2H8C A;  5GIN C;  3HKC A;  1NJI H;  3FD6 A;  1Z5W A;  3RYC B;  4TV9 A;  4WBN B;  3CCM F;  5EYP B;  1T0A A;  1VQP F;  3WGN A;  3KHN A;  3C9S A;  1W40 A;  2RHJ A;  4F6R B;  5KMG A;  2FC3 A;  3CPQ A;  5IJ0 B;  3M1X A;  3MDO A;  4TUY B;  1KNK A;  2RHO A;  1TVK A;  3CCL F;  1J7H A;  1W57 A;  3EOR A;  5B8F A;  5BMV A;  3JAW A;  3JAL A;  2QI2 A;  4O2B A;  3I7T A;  1W3E X;  3HKD B;  1X25 A;  3RYC A;  5EO3 A;  4I4T B;  4O4I B;  2H6L A;  1XBI A;  4B46 A;  3NMU C;  3WXM B;  2H8E A;  4BT5 A;  3F6M A;  1NMU B;  3M84 A;  1N8R H;  1GO0 A;  1TVK B;  4ZHW A;  3JAK B;  4O4H A;  1YGY A;  3S0Y A;  3T80 A;  3LYB A;  3HTN A;  3U0O A;  3D01 A;  1Q8R A;  3WGL A;  4RQO A;  3V3T A;  4C4W C;  1W59 A;  5AVM A;  1JFF B;  1TUB B;  2HRU A;  2GLZ A;  5LOV B; 
#chains in the Genus database with same CATH homology
 4TZZ A;  5G4U C;  3OBW A;  5HXZ A;  3SIU A;  3LWV C;  3MCA B;  3PLA C;  3PAF A;  1YJN F;  2OHW A;  3CCR F;  3FFM A;  4BVQ A;  3LWO C;  1IPA A;  2CZW A;  1W42 A;  3OW2 F;  2VGM A;  5GAP K;  3D00 A;  1VQL F;  3E1Y A;  1GO1 A;  3SIV A;  4NQ3 A;  3CCE F;  2BO1 A;  3JAM M;  1RA4 A;  1VQN F;  3CCS F;  1GZ0 A;  1K8A H;  3J7A R;  1PXW A;  4BVT A;  3CCJ F;  1W2B F;  3LWR C;  4EI8 A;  3VMF B;  5HY2 A;  2ALE A;  2FGY A;  3VI6 A;  1YIJ F;  4EI7 A;  1QVF F;  5IT9 M;  4X3L A;  4XCQ A;  1Q86 H;  3CME F;  2HVY D;  1YJ9 F;  1X52 A;  3JCM M;  1S72 F;  3NK6 A;  3I55 F;  5FLX M;  3CMA F;  3HAX D;  3NVI B;  1VQM F;  1JJ2 F;  1K73 H;  2I6D A;  2WAL A;  2KTU A;  4BVR A;  2VGN A;  1Q82 H;  1ZWZ A;  1K9M H;  3V7E A;  1SDS A;  2OTL F;  2KG4 A;  5G4V C;  5HY4 A;  2OTJ F;  5FJ4 C;  1VQ5 F;  1CK2 A;  3CC4 F;  5HY0 A;  5GAN K;  2JNB A;  3NVK E;  3LWP C;  3LWQ C;  1E7K A;  2QA4 F;  4BW0 B;  3O85 A;  3OBY A;  3CG6 A;  2OZB A;  5A2Q M;  5GIP C;  1VQ7 F;  2AIF A;  3J81 M;  5GIN C;  1YIT F;  1X7O A;  1W41 A;  1NJI H;  1YJW F;  1M90 H;  1VQ6 F;  2F9Z C;  5DCV A;  3CCM F;  2GLZ A;  3CC2 F;  1VQP F;  1KC8 H;  2QEX F;  1W40 A;  1M1K H;  2FC3 A;  3CPQ A;  5HXU A;  1H7M A;  3I56 F;  4NUT A;  3CC7 F;  4BY9 D;  3CCL F;  3G6E F;  1Q7Y H;  3CD6 F;  2QI2 A;  3V7Q A;  3AGK A;  5HY1 A;  3N4Z A;  2LBW A;  2LBX A;  3HJW C;  3CCQ F;  1W3E X;  3G4S F;  5GIO C;  1YHQ F;  1DT9 A;  5EO3 A;  3RA6 A;  1KD1 H;  1XBI A;  1VQ4 F;  3J80 M;  3NMU C;  3WXM B;  3CCU F;  5EWR A;  3IR9 A;  1Q81 H;  1N8R H;  1NMU B;  3GYQ A;  3CCV F;  1VQ9 F;  1GO0 A;  4LCK A;  3LFO A;  3G71 F;  1KQS F;  3NK7 A;  3N4Y A;  3CPW F;  1RLG A;  1QVG F;  4EI9 A;  1CN7 A;  3ON1 A;  3RA5 A;  1X7P A;  3V3T A;  1VQO F;  5HWE A;  4C4W C;  1YI2 F;  1VQ8 F;  4BVS A;  3CXC F;  1VQK F;  1T0K B;  3E20 B;  2KTV A;  4X3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...