3NMUC

Crystal structure of substrate-bound halfmer box c/d rnp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/rna
total genus 29
structure length 121
sequence length 121
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nmuC00
1VQ7F 3CC4F 3CMAF 1CN7A 3CC7F 3LWOC 1YITF 3V7QA 1CK2A 5G4UC 1Q7YH 3CCQF 1KQSF 3J80M 1K73H 3AGKA 3HAXD 5G4VC 3CCLF 3CPQA 1VQOF 3RA6A 3JCMM 1KD1H 5GIOC 3CCJF 3GYQA 1GO0A 3N4ZA 1W41A 1YIJF 2KG4A 1YJNF 1QVFF 5GIPC 3J81M 3OBWA 1W2BF 3I56F 2QA4F 1W3EX 1KC8H 1VQMF 3E1YA 1VQKF 1VQ4F 3CCMF 1X52A 1GZ0A 3E20B 3I55F 2QI2A 4X3LA 1W42A 5IT9M 3WXMB 1GO1A 5FLXM 2ALEA 2OHWA 1M90H 2BO1A 3CD6F 1X7OA 5GINC 5GANK 2HVYD 1RA4A 3NK7A 1YJ9F 2KTVA 1M1KH 3V7EA 2QEXF 1E7KA 1VQNF 4LCKA 2WALA 3CCEF 3PLAC 1YHQF 2OTJF 4BW0B 3VMFB 1Q81H 1VQLF 2KTUA 5GAPK 3LWRC 3JAMM 5FJ4C 3O85A 3MCAB 3SIUA 3J7AR 3SIVA 3LWVC 3VI6A 3G6EF 2LBWA 1RLGA 3CCSF 2LBXA 3OW2F 3CCUF 1DT9A 3N4YA 5EO3A 3CC2F 1Q82H 1QVGF 3OBYA 1S72F 3IR9A 3CG6A 1K8AH 5DCVA 3HJWC 3LWQC 2OTLF 3CPWF 1ZWZA 2AIFA 1H7MA 2CZWA 3LWPC 3NVKE 1T0KB 3CCRF 1SDSA 1VQ6F 2I6DA 3PAFA 3G71F 2VGNA 1VQPF 1K9MH 1IPAA 3G4SF 1YI2F 3NVIB 3FFMA 4BY9D 1VQ5F 5A2QM 2VGMA 3NMUC 1YJWF 4NUTA 2OZBA 5EWRA 1N8RH 2JNBA 4TZZA 1NMUB 1X7PA 1PXWA 1XBIA 1Q86H 3RA5A 3CCVF 2FC3A 1VQ9F 3LFOA 4X3MA 1NJIH 1VQ8F 4C4WC 1JJ2F 3NK6A 3CXCF 3CMEF 1W40A 3ON1A
chains in the Genus database with same CATH superfamily
3ZP4A 1W5EA 5LOVA 3HKEA 3CC4F 3IKFA 5EZYA 2VAMA 2UZHA 2YYEA 4X1IB 4YJ2A 1GX1A 5EIBC 1U43A 4RHAA 5HXUA 5G4VC 4G4VA 3CPQA 4DXDA 5KX5B 1UFYA 2MQEA 3DC2A 4XCQA 1W41A 1NQ3A 3D54A 5JQGB 5J2TA 1QVFF 4I55A 2N48A 3RYHB 1W2BF 4U3JB 5BMVB 1JFFB 5CB4B 2HRYA 2QA4F 3JASB 2NMUA 3HTNA 2AIZP 5LOVB 3HKEB 3RYIA 5EZYB 3CCMF 1X52A 1GZ0A 5LP6C 4BT6A 3E20B 3I55F 4X3LA 2HRUA 4YJ2B 3QTYA 1PF5A 1X7OA 1W5AA 4TV9A 4YJ3A 2QTPA 5GANK 3WJPA 3S0HA 5EYPA 1YJ9F 2Q1XA 2UYNA 3V7EA 1E7KA 5HY4A 5IYZA 5J2TB 4I55B 3CCEF 5EIBD 4BW0B 3R0PA 3VMFB 3MCQA 1RQ2A 1VQLF 2EWCA 4NQ3A 3RYIB 4RQOA 3KJJA 3SIUA 3J7AR 3SIVA 3LWVC 4X1YA 2HS3A 1U3LA 2LBWA 4B45A 5LXTB 3CCSF 1RLGA 3K2XA 3V3TA 1Z5WA 1TUBA 3CC2F 1Q82H 3Q8HA 4YJ3B 2ZAUA 3WPWA 3CG6A 4ERHA 1VH8A 5EYPB 4C81A 2UYNB 2LCAA 3CPWF 2YXZA 1IV4A 3VYUC 3KE1A 4BVTA 5IYZB 2UYPA 3CCRF 3KJKA 2V9YA 1VQ6F 2PHNA 2LBTA 4WBNA 3I7TA 4R40B 5C8YA 4KWEA 1W5FA 3WGKA 3CB2A 3HKDA 3IEWA 3DDNA 1YJWF 2UYKA 1XHOA 1N8RH 2JNBA 4X1YB 1IV2A 1NMUB 1Q86H 1VQ9F 3CCVF 3C9RA 3LFOA 1JJ2F 1TUBB 5HY1A 1W57A 3V4DA 5LA6A 1VQ7F 3K14A 1YITF 5B8FA 4X1IA 3LDTA 2DT4A 4O4JB 4ZHYB 4WBNB 5C8YB 4O2BA 3CCQF 3HKDB 4B62A 4EI8A 3J80M 3JALA 5JVDA 3CCLF 3KIZA 3RA6A 3JCMM 1KD1H 1VHAA 4EI7A 3N4ZA 4X20A 3J81M 1J7HA 3HKCA 5EB0A 1QAHA 2AMTA 2DYYA 1JY8A 3E1YA 3JVHA 5LA6B 5AVMA 4C8IA 3S0WA 1JD1A 1GO1A 5FLXM 2ALEA 3VOBA 4O2BB 1KNKA 1M90H 3P0ZA 1X25A 5J2UA 3JALB 5JVDB 3P4EA 2HP0B 3TD5A 2VAPA 2QEXF 4B46A 3C8LA 3L7QA 4O2AA 4O4LA 4X1KA 4X20B 3C9TA 3QHDA 3HKCB 5HY0A 1YHQF 3ELCA 3PLAC 2OTJF 1ONIA 4EI9A 2W8BC 3UT5A 1VQVA 2RB9A 2KGWA 3JAMM 3O85A 3WPXA 3F0DA 3LMEA 5JCOA 1IV3A 3WGMA 5LXTA 5EB1B 2ZOVA 3VYTC 1OAPA 1T0AA 4O4HA 3OW2F 5EO3A 2Z1UA 3GHZA 3FBAA 5J2UB 5EAZA 2H6LA 4ZK7A 3HJWC 1XRGA 2OTLF 1W59A 2B33A 1ZWZA 3IMPA 1H7MA 2CZWA 3VOAA 3NVKE 4O2AB 4O4LB 4X1KB 2I6DA 3TD3A 2RHOA 3PAFA 4IIJA 3VO8A 3FD6A 4I50A 4IHJA 3UT5B 2HQSC 5MN5A 3I3FA 1VQ5F 2VGMA 4NUTA 4TV8A 4HNAA 4F6RA 3VYSC 5MN6A 1X7PA 3RA5A 4O4HB 1NJIH 4G4XA 2RHLA 3CMEF 5HP7A 5IJ9A 2R6R1 4BT7A 3N2KA 1RQ7A 1TVKA 1SZQA 4E6EA 2BTQB 4O4JA 3V7QA 3JATA 3M84A 3GTZA 4FFBA 4IIJB 4EB6A 4I50B 4IHJB 1KQSF 1K73H 3AGKA 3D00A 3HAXD 3K12A 4TV8B 4F6RB 4HNAB 1Z5VA 3E22B 3RYFA 2Z1EA 3F0GA 3LYBA 4BT3A 5GIOC 3HKBA 1YIJF 4ZI7A 3MQWA 2KG4A 2Q1YA 5ITZA 3F0FA 5HWEA 1QU9A 3I56F 5IJ9B 1W5BA 3D01A 1W3EX 1KC8H 3N2KB 1VK3A 2CWJA 2G9IA 1TVKB 4ZHVA 1VQMF 3JAWA 4ZOLA 3JATB 2QI2A 3OONA 3WXMB 4FFBB 4EB6B 2H8EA 5KMGA 4C8EA 2CHTA 5JH7B 2OHWA 2BO1A 5CA1A 2BTOA 1SA0A 2HP0A 3M4SA 2CSLA 3RYFB 3WJQA 2HVYD 1JN1A 5FNVA 3NK7A 2R751 3HKBB 2KTVA 3CYQA 2RHHA 1M1KH 4ZI7B 5ITZB 5GONA 2WALA 5LYJA 3ZOPA 1YGYA 5JCOC 2HX0A 4ZHQA 3JAKA 4LNUA 3LWRC 4G4YA 2IQQA 5FJ4C 1YQNA 3JAWB 4ZOLB 1QD9A 3G6EF 2LBXA 3IKEA 5KMGB 1DT9A 3CYPB 4ZHWA 2CVLA 3TD4A 2L26A 3OBYA 5CA1B 1S72F 3IR9A 1SA0B 3K0TA 1K8AH 5DCVA 5FNVB 3VIUA 2IAFA 3LWQC 1H47A 3JARA 2PMPA 5IJ0A 3FD5A 5GONB 5LYJB 2I6RA 5HP8A 3G71F 1VQPF 2VGNA 3FFMA 4TUYA 4BY9D 5A2QM 2ZODA 4ZHQB 3JAKB 4LNUB 3ZO8A 3NMUC 2HP3A 5EWRA 2RHJA 3MBMA 3KHNA 3MDOA 4U39A 1IV1A 2FC3A 3BYQA 4X3MA 4BVSA 1VQ8F 4C4WC 3NK6A 2Z01A 3CXCF 3B6NA 4NWOB 3EORA 2GZLA 4I4TA 3RYCA 3JARB 5MN4A 3S0YA 5IJ0B 3CMAF 1CN7A 3CC7F 1R1MA 1W581 3LWOC 2UYJA 2Z1TA 3U0OA 1CK2A 5G4UC 1FNJA 1Q7YH 4TUYB 1XV2A 3E22A 2GVIA 3S03A 1VQOF 1FNKA 3F6MA 2HS4A 3C9UA 3GYQA 1RLUA 3WJRA 4O4IA 3CCJF 1GO0A 4C8GA 1YJNF 5GIPC 2Z1FA 3OBWA 3N2GA 1KNJA 2ZF8A 2BTUA 2OTMA 4I4TB 5HXZA 3RYCB 3ESJA 3WGNA 1VQKF 1VQ4F 3ERNA 1COMA 5CA0A 4M8IA 2ZVZA 4PWTA 1W42A 2CHSA 5IT9M 2CW4A 2F9ZC 5JH7A 4G4ZA 3CD6F 4BT5A 3M1XA 4TV9B 5GINC 3VTIC 5LP6A 1RA4A 4O4IB 3P10A 1VQNF 2H8CA 4LCKA 3VCZA 1OFUA 2VXYA 4BT2A 1U3PA 3WGJA 3N2GB 1Q81H 1U40A 1ODEA 2KTUA 4DRXA 5GAPK 2ZVYA 1FSZA 3MCAB 3VI6A 5CA0B 3F0EA 5HY2A 3CCUF 3N4YA 4C82A 3T80A 1QVGF 2VAWA 3S06A 4BVQA 3HWUA 1FFXA 1W55A 4G4WA 3WGLA 4B5CA 4BVRA 5LP6B 1Q8RA 2AIFA 3S02A 3LWPC 1T0KB 1SDSA 3QUWA 2GLZA 1K9MH 1IPAA 3G4SF 1YI2F 3NVIB 2FGYA 3C9SA 4G88A 2K1SA 4DRXB 1UI9A 2OZBA 3IEQA 5KX5A 2P6YA 2HS0A 4TZZA 1XBIA 1PXWA 2IG8A 5JQGA 3ZP7A 4BT4A 3FPIA 3RYHA 1FFXB 4U3JA 3RE3A 1JFFA 5BMVA 5CB4A 1W40A 1CLIA 3JASA 3ON1A 1DBFA 1H48A
chains in the Genus database with same CATH topology
1VQ7F 3CC4F 3CMAF 1CN7A 3CC7F 3LWOC 1YITF 3V7QA 1CK2A 5G4UC 1Q7YH 3CCQF 1KQSF 4EI8A 3J80M 1K73H 3AGKA 3D00A 3HAXD 5G4VC 5HXUA 3CCLF 3CPQA 1VQOF 3RA6A 3JCMM 1KD1H 5GIOC 4EI7A 4XCQA 3GYQA 3N4ZA 1W41A 3CCJF 1YIJF 1GO0A 2KG4A 1YJNF 1QVFF 5GIPC 3J81M 5HWEA 3OBWA 1W2BF 3I56F 2QA4F 1W3EX 1KC8H 5HXZA 1VQMF 3E1YA 1VQKF 1VQ4F 3CCMF 1X52A 1GZ0A 3E20B 3I55F 2QI2A 4X3LA 1W42A 5IT9M 3WXMB 1GO1A 5FLXM 2ALEA 2F9ZC 2OHWA 1M90H 2BO1A 3CD6F 1X7OA 5GINC 5GANK 2HVYD 1RA4A 3NK7A 1YJ9F 2KTVA 1M1KH 3V7EA 2QEXF 1E7KA 1VQNF 5HY4A 4LCKA 2WALA 3CCEF 3PLAC 5HY0A 1YHQF 2OTJF 4BW0B 3VMFB 1Q81H 4EI9A 1VQLF 2KTUA 5GAPK 3LWRC 4NQ3A 3JAMM 5FJ4C 3O85A 3MCAB 3SIUA 3J7AR 3SIVA 3LWVC 3VI6A 3G6EF 2LBWA 1RLGA 3CCSF 2LBXA 3V3TA 5HY2A 3OW2F 3CCUF 1DT9A 3N4YA 5EO3A 3CC2F 1Q82H 1QVGF 4BVQA 3OBYA 1S72F 3IR9A 3CG6A 1K8AH 5DCVA 4BVRA 3HJWC 3LWQC 2OTLF 3CPWF 1ZWZA 2AIFA 1H7MA 2CZWA 4BVTA 3LWPC 3NVKE 1T0KB 3CCRF 1SDSA 1VQ6F 2I6DA 3PAFA 2GLZA 2VGNA 3G71F 1VQPF 1K9MH 1IPAA 3G4SF 1YI2F 3NVIB 2FGYA 3FFMA 4BY9D 1VQ5F 5A2QM 2VGMA 3NMUC 1YJWF 4NUTA 2OZBA 5EWRA 1N8RH 2JNBA 4TZZA 1NMUB 1X7PA 1PXWA 1XBIA 1Q86H 3RA5A 3CCVF 2FC3A 1VQ9F 3LFOA 4X3MA 4BVSA 1NJIH 1VQ8F 4C4WC 1JJ2F 3NK6A 5HY1A 3CXCF 3CMEF 1W40A 3ON1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 F;  3CC4 F;  3CMA F;  1CN7 A;  3CC7 F;  3LWO C;  1YIT F;  3V7Q A;  1CK2 A;  5G4U C;  1Q7Y H;  3CCQ F;  1KQS F;  3J80 M;  1K73 H;  3AGK A;  3HAX D;  5G4V C;  3CCL F;  3CPQ A;  1VQO F;  3RA6 A;  3JCM M;  1KD1 H;  5GIO C;  3CCJ F;  3GYQ A;  1GO0 A;  3N4Z A;  1W41 A;  1YIJ F;  2KG4 A;  1YJN F;  1QVF F;  5GIP C;  3J81 M;  3OBW A;  1W2B F;  3I56 F;  2QA4 F;  1W3E X;  1KC8 H;  1VQM F;  3E1Y A;  1VQK F;  1VQ4 F;  3CCM F;  1X52 A;  1GZ0 A;  3E20 B;  3I55 F;  2QI2 A;  4X3L A;  1W42 A;  5IT9 M;  3WXM B;  1GO1 A;  5FLX M;  2ALE A;  2OHW A;  1M90 H;  2BO1 A;  3CD6 F;  1X7O A;  5GIN C;  5GAN K;  2HVY D;  1RA4 A;  3NK7 A;  1YJ9 F;  2KTV A;  1M1K H;  3V7E A;  2QEX F;  1E7K A;  1VQN F;  4LCK A;  2WAL A;  3CCE F;  3PLA C;  1YHQ F;  2OTJ F;  4BW0 B;  3VMF B;  1Q81 H;  1VQL F;  2KTU A;  5GAP K;  3LWR C;  3JAM M;  5FJ4 C;  3O85 A;  3MCA B;  3SIU A;  3J7A R;  3SIV A;  3LWV C;  3VI6 A;  3G6E F;  2LBW A;  1RLG A;  3CCS F;  2LBX A;  3OW2 F;  3CCU F;  1DT9 A;  3N4Y A;  5EO3 A;  3CC2 F;  1Q82 H;  1QVG F;  3OBY A;  1S72 F;  3IR9 A;  3CG6 A;  1K8A H;  5DCV A;  3HJW C;  3LWQ C;  2OTL F;  3CPW F;  1ZWZ A;  2AIF A;  1H7M A;  2CZW A;  3LWP C;  3NVK E;  1T0K B;  3CCR F;  1SDS A;  1VQ6 F;  2I6D A;  3PAF A;  3G71 F;  2VGN A;  1VQP F;  1K9M H;  1IPA A;  3G4S F;  1YI2 F;  3NVI B;  3FFM A;  4BY9 D;  1VQ5 F;  5A2Q M;  2VGM A;  3NMU C;  1YJW F;  4NUT A;  2OZB A;  5EWR A;  1N8R H;  2JNB A;  4TZZ A;  1NMU B;  1X7P A;  1PXW A;  1XBI A;  1Q86 H;  3RA5 A;  3CCV F;  2FC3 A;  1VQ9 F;  3LFO A;  4X3M A;  1NJI H;  1VQ8 F;  4C4W C;  1JJ2 F;  3NK6 A;  3CXC F;  3CME F;  1W40 A;  3ON1 A; 
#chains in the Genus database with same CATH topology
 3ZP4 A;  1W5E A;  5LOV A;  3HKE A;  3CC4 F;  3IKF A;  5EZY A;  2VAM A;  2UZH A;  2YYE A;  4X1I B;  4YJ2 A;  1GX1 A;  5EIB C;  1U43 A;  4RHA A;  5HXU A;  5G4V C;  4G4V A;  3CPQ A;  4DXD A;  5KX5 B;  1UFY A;  2MQE A;  3DC2 A;  4XCQ A;  1W41 A;  1NQ3 A;  3D54 A;  5JQG B;  5J2T A;  1QVF F;  4I55 A;  2N48 A;  3RYH B;  1W2B F;  4U3J B;  5BMV B;  1JFF B;  5CB4 B;  2HRY A;  2QA4 F;  3JAS B;  2NMU A;  3HTN A;  2AIZ P;  5LOV B;  3HKE B;  3RYI A;  5EZY B;  3CCM F;  1X52 A;  1GZ0 A;  5LP6 C;  4BT6 A;  3E20 B;  3I55 F;  4X3L A;  2HRU A;  4YJ2 B;  3QTY A;  1PF5 A;  1X7O A;  1W5A A;  4TV9 A;  4YJ3 A;  2QTP A;  5GAN K;  3WJP A;  3S0H A;  5EYP A;  1YJ9 F;  2Q1X A;  2UYN A;  3V7E A;  1E7K A;  5HY4 A;  5IYZ A;  5J2T B;  4I55 B;  3CCE F;  5EIB D;  4BW0 B;  3R0P A;  3VMF B;  3MCQ A;  1RQ2 A;  1VQL F;  2EWC A;  4NQ3 A;  3RYI B;  4RQO A;  3KJJ A;  3SIU A;  3J7A R;  3SIV A;  3LWV C;  4X1Y A;  2HS3 A;  1U3L A;  2LBW A;  4B45 A;  5LXT B;  3CCS F;  1RLG A;  3K2X A;  3V3T A;  1Z5W A;  1TUB A;  3CC2 F;  1Q82 H;  3Q8H A;  4YJ3 B;  2ZAU A;  3WPW A;  3CG6 A;  4ERH A;  1VH8 A;  5EYP B;  4C81 A;  2UYN B;  2LCA A;  3CPW F;  2YXZ A;  1IV4 A;  3VYU C;  3KE1 A;  4BVT A;  5IYZ B;  2UYP A;  3CCR F;  3KJK A;  2V9Y A;  1VQ6 F;  2PHN A;  2LBT A;  4WBN A;  3I7T A;  4R40 B;  5C8Y A;  4KWE A;  1W5F A;  3WGK A;  3CB2 A;  3HKD A;  3IEW A;  3DDN A;  1YJW F;  2UYK A;  1XHO A;  1N8R H;  2JNB A;  4X1Y B;  1IV2 A;  1NMU B;  1Q86 H;  1VQ9 F;  3CCV F;  3C9R A;  3LFO A;  1JJ2 F;  1TUB B;  5HY1 A;  1W57 A;  3V4D A;  5LA6 A;  1VQ7 F;  3K14 A;  1YIT F;  5B8F A;  4X1I A;  3LDT A;  2DT4 A;  4O4J B;  4ZHY B;  4WBN B;  5C8Y B;  4O2B A;  3CCQ F;  3HKD B;  4B62 A;  4EI8 A;  3J80 M;  3JAL A;  5JVD A;  3CCL F;  3KIZ A;  3RA6 A;  3JCM M;  1KD1 H;  1VHA A;  4EI7 A;  3N4Z A;  4X20 A;  3J81 M;  1J7H A;  3HKC A;  5EB0 A;  1QAH A;  2AMT A;  2DYY A;  1JY8 A;  3E1Y A;  3JVH A;  5LA6 B;  5AVM A;  4C8I A;  3S0W A;  1JD1 A;  1GO1 A;  5FLX M;  2ALE A;  3VOB A;  4O2B B;  1KNK A;  1M90 H;  3P0Z A;  1X25 A;  5J2U A;  3JAL B;  5JVD B;  3P4E A;  2HP0 B;  3TD5 A;  2VAP A;  2QEX F;  4B46 A;  3C8L A;  3L7Q A;  4O2A A;  4O4L A;  4X1K A;  4X20 B;  3C9T A;  3QHD A;  3HKC B;  5HY0 A;  1YHQ F;  3ELC A;  3PLA C;  2OTJ F;  1ONI A;  4EI9 A;  2W8B C;  3UT5 A;  1VQV A;  2RB9 A;  2KGW A;  3JAM M;  3O85 A;  3WPX A;  3F0D A;  3LME A;  5JCO A;  1IV3 A;  3WGM A;  5LXT A;  5EB1 B;  2ZOV A;  3VYT C;  1OAP A;  1T0A A;  4O4H A;  3OW2 F;  5EO3 A;  2Z1U A;  3GHZ A;  3FBA A;  5J2U B;  5EAZ A;  2H6L A;  4ZK7 A;  3HJW C;  1XRG A;  2OTL F;  1W59 A;  2B33 A;  1ZWZ A;  3IMP A;  1H7M A;  2CZW A;  3VOA A;  3NVK E;  4O2A B;  4O4L B;  4X1K B;  2I6D A;  3TD3 A;  2RHO A;  3PAF A;  4IIJ A;  3VO8 A;  3FD6 A;  4I50 A;  4IHJ A;  3UT5 B;  2HQS C;  5MN5 A;  3I3F A;  1VQ5 F;  2VGM A;  4NUT A;  4TV8 A;  4HNA A;  4F6R A;  3VYS C;  5MN6 A;  1X7P A;  3RA5 A;  4O4H B;  1NJI H;  4G4X A;  2RHL A;  3CME F;  5HP7 A;  5IJ9 A;  2R6R 1;  4BT7 A;  3N2K A;  1RQ7 A;  1TVK A;  1SZQ A;  4E6E A;  2BTQ B;  4O4J A;  3V7Q A;  3JAT A;  3M84 A;  3GTZ A;  4FFB A;  4IIJ B;  4EB6 A;  4I50 B;  4IHJ B;  1KQS F;  1K73 H;  3AGK A;  3D00 A;  3HAX D;  3K12 A;  4TV8 B;  4F6R B;  4HNA B;  1Z5V A;  3E22 B;  3RYF A;  2Z1E A;  3F0G A;  3LYB A;  4BT3 A;  5GIO C;  3HKB A;  1YIJ F;  4ZI7 A;  3MQW A;  2KG4 A;  2Q1Y A;  5ITZ A;  3F0F A;  5HWE A;  1QU9 A;  3I56 F;  5IJ9 B;  1W5B A;  3D01 A;  1W3E X;  1KC8 H;  3N2K B;  1VK3 A;  2CWJ A;  2G9I A;  1TVK B;  4ZHV A;  1VQM F;  3JAW A;  4ZOL A;  3JAT B;  2QI2 A;  3OON A;  3WXM B;  4FFB B;  4EB6 B;  2H8E A;  5KMG A;  4C8E A;  2CHT A;  5JH7 B;  2OHW A;  2BO1 A;  5CA1 A;  2BTO A;  1SA0 A;  2HP0 A;  3M4S A;  2CSL A;  3RYF B;  3WJQ A;  2HVY D;  1JN1 A;  5FNV A;  3NK7 A;  2R75 1;  3HKB B;  2KTV A;  3CYQ A;  2RHH A;  1M1K H;  4ZI7 B;  5ITZ B;  5GON A;  2WAL A;  5LYJ A;  3ZOP A;  1YGY A;  5JCO C;  2HX0 A;  4ZHQ A;  3JAK A;  4LNU A;  3LWR C;  4G4Y A;  2IQQ A;  5FJ4 C;  1YQN A;  3JAW B;  4ZOL B;  1QD9 A;  3G6E F;  2LBX A;  3IKE A;  5KMG B;  1DT9 A;  3CYP B;  4ZHW A;  2CVL A;  3TD4 A;  2L26 A;  3OBY A;  5CA1 B;  1S72 F;  3IR9 A;  1SA0 B;  3K0T A;  1K8A H;  5DCV A;  5FNV B;  3VIU A;  2IAF A;  3LWQ C;  1H47 A;  3JAR A;  2PMP A;  5IJ0 A;  3FD5 A;  5GON B;  5LYJ B;  2I6R A;  5HP8 A;  3G71 F;  1VQP F;  2VGN A;  3FFM A;  4TUY A;  4BY9 D;  5A2Q M;  2ZOD A;  4ZHQ B;  3JAK B;  4LNU B;  3ZO8 A;  3NMU C;  2HP3 A;  5EWR A;  2RHJ A;  3MBM A;  3KHN A;  3MDO A;  4U39 A;  1IV1 A;  2FC3 A;  3BYQ A;  4X3M A;  4BVS A;  1VQ8 F;  4C4W C;  3NK6 A;  2Z01 A;  3CXC F;  3B6N A;  4NWO B;  3EOR A;  2GZL A;  4I4T A;  3RYC A;  3JAR B;  5MN4 A;  3S0Y A;  5IJ0 B;  3CMA F;  1CN7 A;  3CC7 F;  1R1M A;  1W58 1;  3LWO C;  2UYJ A;  2Z1T A;  3U0O A;  1CK2 A;  5G4U C;  1FNJ A;  1Q7Y H;  4TUY B;  1XV2 A;  3E22 A;  2GVI A;  3S03 A;  1VQO F;  1FNK A;  3F6M A;  2HS4 A;  3C9U A;  3GYQ A;  1RLU A;  3WJR A;  4O4I A;  3CCJ F;  1GO0 A;  4C8G A;  1YJN F;  5GIP C;  2Z1F A;  3OBW A;  3N2G A;  1KNJ A;  2ZF8 A;  2BTU A;  2OTM A;  4I4T B;  5HXZ A;  3RYC B;  3ESJ A;  3WGN A;  1VQK F;  1VQ4 F;  3ERN A;  1COM A;  5CA0 A;  4M8I A;  2ZVZ A;  4PWT A;  1W42 A;  2CHS A;  5IT9 M;  2CW4 A;  2F9Z C;  5JH7 A;  4G4Z A;  3CD6 F;  4BT5 A;  3M1X A;  4TV9 B;  5GIN C;  3VTI C;  5LP6 A;  1RA4 A;  4O4I B;  3P10 A;  1VQN F;  2H8C A;  4LCK A;  3VCZ A;  1OFU A;  2VXY A;  4BT2 A;  1U3P A;  3WGJ A;  3N2G B;  1Q81 H;  1U40 A;  1ODE A;  2KTU A;  4DRX A;  5GAP K;  2ZVY A;  1FSZ A;  3MCA B;  3VI6 A;  5CA0 B;  3F0E A;  5HY2 A;  3CCU F;  3N4Y A;  4C82 A;  3T80 A;  1QVG F;  2VAW A;  3S06 A;  4BVQ A;  3HWU A;  1FFX A;  1W55 A;  4G4W A;  3WGL A;  4B5C A;  4BVR A;  5LP6 B;  1Q8R A;  2AIF A;  3S02 A;  3LWP C;  1T0K B;  1SDS A;  3QUW A;  2GLZ A;  1K9M H;  1IPA A;  3G4S F;  1YI2 F;  3NVI B;  2FGY A;  3C9S A;  4G88 A;  2K1S A;  4DRX B;  1UI9 A;  2OZB A;  3IEQ A;  5KX5 A;  2P6Y A;  2HS0 A;  4TZZ A;  1XBI A;  1PXW A;  2IG8 A;  5JQG A;  3ZP7 A;  4BT4 A;  3FPI A;  3RYH A;  1FFX B;  4U3J A;  3RE3 A;  1JFF A;  5BMV A;  5CB4 A;  1W40 A;  1CLI A;  3JAS A;  3ON1 A;  1DBF A;  1H48 A; 
#chains in the Genus database with same CATH homology
 1VQ7 F;  3CC4 F;  3CMA F;  1CN7 A;  3CC7 F;  3LWO C;  1YIT F;  3V7Q A;  1CK2 A;  5G4U C;  1Q7Y H;  3CCQ F;  1KQS F;  4EI8 A;  3J80 M;  1K73 H;  3AGK A;  3D00 A;  3HAX D;  5G4V C;  5HXU A;  3CCL F;  3CPQ A;  1VQO F;  3RA6 A;  3JCM M;  1KD1 H;  5GIO C;  4EI7 A;  4XCQ A;  3GYQ A;  3N4Z A;  1W41 A;  3CCJ F;  1YIJ F;  1GO0 A;  2KG4 A;  1YJN F;  1QVF F;  5GIP C;  3J81 M;  5HWE A;  3OBW A;  1W2B F;  3I56 F;  2QA4 F;  1W3E X;  1KC8 H;  5HXZ A;  1VQM F;  3E1Y A;  1VQK F;  1VQ4 F;  3CCM F;  1X52 A;  1GZ0 A;  3E20 B;  3I55 F;  2QI2 A;  4X3L A;  1W42 A;  5IT9 M;  3WXM B;  1GO1 A;  5FLX M;  2ALE A;  2F9Z C;  2OHW A;  1M90 H;  2BO1 A;  3CD6 F;  1X7O A;  5GIN C;  5GAN K;  2HVY D;  1RA4 A;  3NK7 A;  1YJ9 F;  2KTV A;  1M1K H;  3V7E A;  2QEX F;  1E7K A;  1VQN F;  5HY4 A;  4LCK A;  2WAL A;  3CCE F;  3PLA C;  5HY0 A;  1YHQ F;  2OTJ F;  4BW0 B;  3VMF B;  1Q81 H;  4EI9 A;  1VQL F;  2KTU A;  5GAP K;  3LWR C;  4NQ3 A;  3JAM M;  5FJ4 C;  3O85 A;  3MCA B;  3SIU A;  3J7A R;  3SIV A;  3LWV C;  3VI6 A;  3G6E F;  2LBW A;  1RLG A;  3CCS F;  2LBX A;  3V3T A;  5HY2 A;  3OW2 F;  3CCU F;  1DT9 A;  3N4Y A;  5EO3 A;  3CC2 F;  1Q82 H;  1QVG F;  4BVQ A;  3OBY A;  1S72 F;  3IR9 A;  3CG6 A;  1K8A H;  5DCV A;  4BVR A;  3HJW C;  3LWQ C;  2OTL F;  3CPW F;  1ZWZ A;  2AIF A;  1H7M A;  2CZW A;  4BVT A;  3LWP C;  3NVK E;  1T0K B;  3CCR F;  1SDS A;  1VQ6 F;  2I6D A;  3PAF A;  2GLZ A;  2VGN A;  3G71 F;  1VQP F;  1K9M H;  1IPA A;  3G4S F;  1YI2 F;  3NVI B;  2FGY A;  3FFM A;  4BY9 D;  1VQ5 F;  5A2Q M;  2VGM A;  3NMU C;  1YJW F;  4NUT A;  2OZB A;  5EWR A;  1N8R H;  2JNB A;  4TZZ A;  1NMU B;  1X7P A;  1PXW A;  1XBI A;  1Q86 H;  3RA5 A;  3CCV F;  2FC3 A;  1VQ9 F;  3LFO A;  4X3M A;  4BVS A;  1NJI H;  1VQ8 F;  4C4W C;  1JJ2 F;  3NK6 A;  5HY1 A;  3CXC F;  3CME F;  1W40 A;  3ON1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...