3NMUC

Crystal structure of substrate-bound halfmer box c/d rnp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords NOP5/NOP56 related protein
publication title Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 29
structure length 121
sequence length 121
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3nmuC00
3LWVC 1W41A 3RA5A 5GIOC 1YHQF 3CMAF 1VQMF 5FJ4C 2JNBA 1GZ0A 3N4YA 3CCLF 1SDSA 1YJNF 3G4SF 3WXMB 1NJIH 2I6DA 5A2QM 3PAFA 2QA4F 1W3EX 2VGMA 1K9MH 1VQOF 1YJWF 3E20B 2KG4A 1RLGA 3CMEF 1VQ9F 1PXWA 5FLXM 3CCRF 3HJWC 3J7AR 5G4UC 1DT9A 1VQLF 3GYQA 1CK2A 3CCEF 4BW0B 1YJ9F 3NK7A 3CCMF 1KD1H 2BO1A 1K8AH 1E7KA 1Q7YH 3I56F 3LWRC 3SIUA 2ALEA 3MCAB 3NVIB 3V7QA 3ON1A 1VQ4F 1VQ7F 4NUTA 1X7PA 2OTLF 5IT9M 3CCJF 1VQPF 1X52A 3CD6F 2OHWA 3AGKA 1JJ2F 3OBWA 3LWPC 3LFOA 3E1YA 4BY9D 5DCVA 3NVKE 3CC4F 2KTUA 3NK6A 2CZWA 2WALA 1QVFF 5GANK 5G4VC 1N8RH 1YI2F 3VI6A 4X3LA 2QI2A 3CG6A 3CC2F 2VGNA 3LWOC 3FFMA 2LBWA 1VQ6F 3VMFB 3J81M 2AIFA 1VQNF 1W40A 3CCUF 1Q81H 1YITF 1Q86H 3N4ZA 1NMUB 3CCVF 3JCMM 1Q82H 2HVYD 1YIJF 2OTJF 1S72F 3G71F 1H7MA 1QVGF 3JAMM 1GO1A 1M1KH 2LBXA 1KC8H 3CC7F 5GIPC 1M90H 3O85A 1K73H 3IR9A 1ZWZA 3OW2F 5EO3A 4LCKA 3G6EF 3HAXD 5GINC 4TZZA 2FC3A 3SIVA 1XBIA 2KTVA 1X7OA 3OBYA 3CCQF 3I55F 3CPQA 1RA4A 5GAPK 3J80M 3NMUC 3CXCF 4X3MA 1W2BF 1CN7A 2OZBA 1W42A 3V7EA 2QEXF 1VQKF 3RA6A 5EWRA 1KQSF 1T0KB 3PLAC 1IPAA 4C4WC 1GO0A 3CCSF 1VQ5F 1VQ8F 3CPWF 3LWQC
chains in the Genus database with same CATH superfamily
3CMAF 1IV2A 1W5BA 2HRYA 4HNAB 3N4YA 2VXYA 3CCLF 1SDSA 3FPIA 3GHZA 1NJIH 4F6RB 1IV3A 3HWUA 4TV8B 2QA4F 4YJ2B 2GZLA 4EI8A 3FBAA 1W3EX 3Q8HA 2IQQA 4EI7A 3E20B 3VTIC 4IIJB 3VOBA 1RLGA 2CHSA 2VAWA 4O4JA 3HKCB 4G4YA 4O4IB 1E7KA 1Q7YH 2Z1TA 4U3JA 2EWCA 3MQWA 3LWRC 3SIUA 1U3LA 5LYJA 5HXUA 4TUYA 2DYYA 3JARB 1VQ4F 4NUTA 4KWEA 2H8EA 2Z01A 3VIUA 3P0ZA 1COMA 2OTLF 1W57A 5IT9M 3K14A 5MN6A 3I3FA 3AGKA 3EORA 4F6RA 4TV8A 4EI9A 4YJ2A 1PF5A 3CC4F 4R40B 2CZWA 3IEQA 4BVTA 1RLUA 3VI6A 4IIJA 4X3LA 3WGKA 3C8LA 3N2GB 2Q1XA 5IYZB 5CA0B 5IJ9B 1ODEA 3JALB 3HKCA 1JD1A 3VCZA 5ITZB 4BT4A 3C9RA 3JAWA 3CCUF 4O4IA 3CCVF 3IMPA 2AIZP 4ZI7B 3F0GA 3VYTC 5LA6B 3RYIB 4TV9A 3ZP4A 3JARA 4I4TB 1FNJA 2ZVYA 1XRGA 3S0WA 3O85A 1ZWZA 3WGJA 3K12A 3G6EF 3HAXD 1H48A 1YQNA 2KTVA 3C9TA 1X7OA 2HRUA 4B46A 1W55A 5EB1B 2UYJA 1RA4A 3NMUC 3N2GA 2OZBA 3F6MA 3WPWA 4BVSA 5IYZA 5CA0A 1W5AA 1JY8A 3JALA 5ITZA 1GO0A 5EIBD 1T0KB 4C4WC 3CCSF 1VQ5F 3VOAA 1VQ8F 4ZHVA 3CPWF 2RHJA 1YHQF 4BT2A 1VQMF 5CA1B 4ZI7A 5J2UB 5JVDB 5HY0A 5LA6A 3RYIA 1U3PA 5C8YA 1YJNF 4O4LB 4I4TA 2I6RA 2CWJA 4G4WA 3WXMB 3LMEA 1T0AA 3PAFA 1U43A 4C82A 1JN1A 1J7HA 5EB0A 1FSZA 3CMEF 1VQ9F 1PXWA 3ESJA 3HJWC 1DT9A 1VQLF 1CK2A 4BW0B 1YJ9F 3NK7A 1W59A 4TUYB 4O4HB 4X1YB 1RQ2A 4BT7A 4X1IB 4ZHWA 3S03A 1KD1H 5B8FA 2AMTA 3N2KB 4ZK7A 4C81A 3I56F 2P6YA 3UT5A 2UYNA 4LNUB 2ZF8A 3B6NA 4RHAA 1VQ7F 2W8BC 4G88A 3S0YA 5CA1A 2CW4A 3RYHB 3R0PA 5CB4B 5JVDA 5J2UA 2ZODA 1VQPF 1X52A 4O4LA 3BYQA 1OAPA 3LFOA 3E1YA 4BY9D 5DCVA 3NVKE 4WBNB 1IV4A 3NK6A 3F0DA 1QVFF 5GANK 2VAMA 2UYKA 5GONB 3JAWB 5FNVB 3CC2F 2VGNA 3LWOC 3M1XA 4XCQA 3JAKB 3WGMA 3S02A 1KNKA 3RYCB 3QUWA 3U0OA 4TV9B 3I7TA 2UYPA 4X1YA 4O4HA 2PMPA 3CYQA 4X1IA 1W40A 1Q81H 1YGYA 2R6R1 3N2KA 3TD3A 4BT6A 4ZHQB 2LBTA 1NQ3A 1Q82H 3D01A 3M84A 1W5EA 4LNUA 2ZOVA 2UZHA 3C9SA 1KNJA 2LCAA 3RYHA 5CB4A 3CC7F 3KJJA 5GIPC 5JQGB 5HY2A 3ELCA 3OW2F 1UFYA 5GINC 1W581 1TUBB 4U39A 4DXDA 4WBNA 1TVKB 3OBYA 4YJ3B 3CPQA 4IHJB 2GVIA 5GONA 2CHTA 1XHOA 5FNVA 5MN5A 3JVHA 3JAKA 4DRXB 3RYCA 3FD5A 1KQSF 5C8YB 5JCOC 1IV1A 2KGWA 3KE1A 1FFXB 4PWTA 4ZHQA 5MN4A 3LWQC 3LWVC 1W41A 5GIOC 5FJ4C 3WPXA 3HKDB 3CB2A 3IKFA 1OFUA 3G4SF 2I6DA 3QTYA 3JASB 4NQ3A 2G9IA 4B45A 3LDTA 1SZQA 5JQGA 1VQOF 3T80A 1YJWF 3F0FA 2H6LA 2KG4A 2FGYA 3ERNA 1TUBA 5FLXM 4O2AB 3J7AR 1TVKA 3GYQA 3CCEF 3IEWA 4YJ3A 3KHNA 3UT5B 2UYNB 2HS3A 1VHAA 4IHJA 5EAZA 5JCOA 4C8GA 2BO1A 5AVMA 4G4XA 5EZYB 5LXTA 2RHOA 4DRXA 5BMVB 2ALEA 3MCAB 3VYUC 3MBMA 3ZO8A 1FFXA 4X1KB 3D54A 2H8CA 3HKDA 4I55B 1GX1A 3VO8A 2DT4A 3RE3A 1JJ2F 3JASA 5LOVB 1JFFB 3ZP7A 2KTUA 5G4VC 5HY4A 2HP3A 3E22B 3TD5A 1N8RH 4O2AA 3S0HA 2HS0A 4X20B 1H47A 3FFMA 2LBWA 2GLZA 4B5CA 1VH8A 2Q1YA 4BVRA 3VMFB 3J81M 5HXZA 1X25A 3F0EA 1ONIA 1YITF 1Q86H 3HTNA 5EZYA 1U40A 2HVYD 5EIBC 5BMVA 1S72F 2OTJF 3P4EA 5IJ0B 3JAMM 1GO1A 4X1KA 1M1KH 3D00A 2LBXA 3MCQA 4I55A 3IKEA 1K73H 3K2XA 4LCKA 2IG8A 2FC3A 3SIVA 1FNKA 3S06A 5LOVA 3MDOA 1JFFA 2V9YA 3CCQF 3HKEB 4ZOLA 3E22A 2RHLA 3K0TA 3V4DA 3JATB 5KMGB 1CN7A 4X20A 3V7EA 3KJKA 5EWRA 3PLAC 2ZVZA 3CYPB 4EB6B 2BTQB 2YXZA 3ZOPA 3RA5A 4ZHYB 1VQVA 1QAHA 2JNBA 1GZ0A 4BT3A 5IJ0A 5KX5B 5A2QM 4FFBB 1QD9A 1W5FA 2Z1FA 2VGMA 2RHHA 4HNAA 2CVLA 2HP0B 1K9MH 5JH7B 4E6EA 4G4ZA 3CCRF 5G4UC 3QHDA 5LXTB 3C9UA 2QTPA 3HKEA 1SA0B 1RQ7A 3M4SA 3WJRA 3CCMF 4O2BB 3FD6A 3JATA 5KMGA 2PHNA 1K8AH 3RYFB 3OONA 5J2TB 3NVIB 5HY1A 3V7QA 4B62A 4EB6A 5LP6B 2HQSC 1R1MA 3WGNA 3ON1A 1Z5WA 3DC2A 2MQEA 1X7PA 3WJQA 3CCJF 5HP8A 2VAPA 5KX5A 3CD6F 5LP6C 3HKBB 1XV2A 2OHWA 2BTUA 3KIZA 3OBWA 4FFBA 4BVQA 3LWPC 1QU9A 3P10A 2NMUA 2WALA 2HP0A 3L7QA 4I50B 1YI2F 4M8IA 5JH7A 2QI2A 2ZAUA 3CG6A 3TD4A 1VK3A 2OTMA 2Z1UA 1SA0A 4ERHA 1VQ6F 2AIFA 4NWOB 1VQNF 4O2BA 1Z5VA 2R751 3N4ZA 1NMUB 5EYPB 3JCMM 4G4VA 3RYFA 5IJ9A 4C8IA 2Z1EA 1YIJF 3VYSC 2B33A 3G71F 5J2TA 1H7MA 1DBFA 2K1SA 5LP6A 1QVGF 3WGLA 2YYEA 1KC8H 1M90H 3LYBA 3GTZA 4ZOLB 1CLIA 3IR9A 3HKBA 5EO3A 4RQOA 4TZZA 1XBIA 1UI9A 2HX0A 4O4JB 4BT5A 4I50A 3I55F 3V3TA 2RB9A 2HS4A 5GAPK 3J80M 1Q8RA 3CXCF 4X3MA 1W2BF 5HP7A 2F9ZC 2N48A 1W42A 2CSLA 4C8EA 2QEXF 4U3JB 5HWEA 1VQKF 3RA6A 2IAFA 1IPAA 5LYJB 3DDNA 2L26A 3WJPA 2BTOA 5EYPA
chains in the Genus database with same CATH topology
3LWVC 1W41A 3RA5A 5GIOC 1YHQF 3CMAF 1VQMF 5FJ4C 5HY0A 2JNBA 1GZ0A 3N4YA 3CCLF 1SDSA 1YJNF 3G4SF 3WXMB 1NJIH 2I6DA 5A2QM 3PAFA 2QA4F 4NQ3A 4EI8A 1W3EX 2VGMA 4EI7A 1K9MH 1VQOF 1YJWF 3E20B 2KG4A 2FGYA 3CMEF 1VQ9F 1PXWA 5FLXM 3CCRF 1RLGA 3HJWC 3J7AR 5G4UC 1DT9A 1VQLF 3GYQA 1CK2A 3CCEF 4BW0B 1YJ9F 3NK7A 3CCMF 1KD1H 2BO1A 1K8AH 1E7KA 1Q7YH 3I56F 3LWRC 3SIUA 2ALEA 3MCAB 5HY1A 3NVIB 3V7QA 5HXUA 3ON1A 1VQ4F 1VQ7F 4NUTA 1X7PA 2OTLF 5IT9M 3CCJF 1VQPF 1X52A 3CD6F 2OHWA 3AGKA 1JJ2F 3OBWA 4BVQA 4EI9A 3LWPC 3LFOA 3E1YA 4BY9D 5DCVA 3NVKE 3CC4F 2KTUA 3NK6A 2CZWA 2WALA 1QVFF 5GANK 4BVTA 5G4VC 5HY4A 1N8RH 1YI2F 3VI6A 4X3LA 2QI2A 3CG6A 3CC2F 2VGNA 3LWOC 3FFMA 4XCQA 2GLZA 2LBWA 4BVRA 3VMFB 3J81M 1VQ6F 2AIFA 1VQNF 5HXZA 1W40A 3CCUF 1Q81H 1YITF 1Q86H 3N4ZA 1NMUB 3CCVF 3JCMM 1Q82H 2HVYD 1YIJF 2OTJF 1S72F 3G71F 1H7MA 1QVGF 3JAMM 1GO1A 1M1KH 3D00A 2LBXA 1KC8H 3CC7F 5GIPC 1M90H 3O85A 1K73H 3IR9A 1ZWZA 5HY2A 3OW2F 5EO3A 4LCKA 3G6EF 3HAXD 5GINC 4TZZA 2FC3A 3SIVA 1XBIA 2KTVA 1X7OA 3OBYA 3CCQF 3I55F 3CPQA 1RA4A 3V3TA 5GAPK 3J80M 3NMUC 3CXCF 4X3MA 1W2BF 1CN7A 2OZBA 4BVSA 2F9ZC 1W42A 3V7EA 2QEXF 5HWEA 1VQKF 3RA6A 5EWRA 1KQSF 1T0KB 3PLAC 1IPAA 4C4WC 1GO0A 3CCSF 1VQ5F 1VQ8F 3CPWF 3LWQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV C;  1W41 A;  3RA5 A;  5GIO C;  1YHQ F;  3CMA F;  1VQM F;  5FJ4 C;  2JNB A;  1GZ0 A;  3N4Y A;  3CCL F;  1SDS A;  1YJN F;  3G4S F;  3WXM B;  1NJI H;  2I6D A;  5A2Q M;  3PAF A;  2QA4 F;  1W3E X;  2VGM A;  1K9M H;  1VQO F;  1YJW F;  3E20 B;  2KG4 A;  1RLG A;  3CME F;  1VQ9 F;  1PXW A;  5FLX M;  3CCR F;  3HJW C;  3J7A R;  5G4U C;  1DT9 A;  1VQL F;  3GYQ A;  1CK2 A;  3CCE F;  4BW0 B;  1YJ9 F;  3NK7 A;  3CCM F;  1KD1 H;  2BO1 A;  1K8A H;  1E7K A;  1Q7Y H;  3I56 F;  3LWR C;  3SIU A;  2ALE A;  3MCA B;  3NVI B;  3V7Q A;  3ON1 A;  1VQ4 F;  1VQ7 F;  4NUT A;  1X7P A;  2OTL F;  5IT9 M;  3CCJ F;  1VQP F;  1X52 A;  3CD6 F;  2OHW A;  3AGK A;  1JJ2 F;  3OBW A;  3LWP C;  3LFO A;  3E1Y A;  4BY9 D;  5DCV A;  3NVK E;  3CC4 F;  2KTU A;  3NK6 A;  2CZW A;  2WAL A;  1QVF F;  5GAN K;  5G4V C;  1N8R H;  1YI2 F;  3VI6 A;  4X3L A;  2QI2 A;  3CG6 A;  3CC2 F;  2VGN A;  3LWO C;  3FFM A;  2LBW A;  1VQ6 F;  3VMF B;  3J81 M;  2AIF A;  1VQN F;  1W40 A;  3CCU F;  1Q81 H;  1YIT F;  1Q86 H;  3N4Z A;  1NMU B;  3CCV F;  3JCM M;  1Q82 H;  2HVY D;  1YIJ F;  2OTJ F;  1S72 F;  3G71 F;  1H7M A;  1QVG F;  3JAM M;  1GO1 A;  1M1K H;  2LBX A;  1KC8 H;  3CC7 F;  5GIP C;  1M90 H;  3O85 A;  1K73 H;  3IR9 A;  1ZWZ A;  3OW2 F;  5EO3 A;  4LCK A;  3G6E F;  3HAX D;  5GIN C;  4TZZ A;  2FC3 A;  3SIV A;  1XBI A;  2KTV A;  1X7O A;  3OBY A;  3CCQ F;  3I55 F;  3CPQ A;  1RA4 A;  5GAP K;  3J80 M;  3NMU C;  3CXC F;  4X3M A;  1W2B F;  1CN7 A;  2OZB A;  1W42 A;  3V7E A;  2QEX F;  1VQK F;  3RA6 A;  5EWR A;  1KQS F;  1T0K B;  3PLA C;  1IPA A;  4C4W C;  1GO0 A;  3CCS F;  1VQ5 F;  1VQ8 F;  3CPW F;  3LWQ C; 
#chains in the Genus database with same CATH topology
 3CMA F;  1IV2 A;  1W5B A;  2HRY A;  4HNA B;  3N4Y A;  2VXY A;  3CCL F;  1SDS A;  3FPI A;  3GHZ A;  1NJI H;  4F6R B;  1IV3 A;  3HWU A;  4TV8 B;  2QA4 F;  4YJ2 B;  2GZL A;  4EI8 A;  3FBA A;  1W3E X;  3Q8H A;  2IQQ A;  4EI7 A;  3E20 B;  3VTI C;  4IIJ B;  3VOB A;  1RLG A;  2CHS A;  2VAW A;  4O4J A;  3HKC B;  4G4Y A;  4O4I B;  1E7K A;  1Q7Y H;  2Z1T A;  4U3J A;  2EWC A;  3MQW A;  3LWR C;  3SIU A;  1U3L A;  5LYJ A;  5HXU A;  4TUY A;  2DYY A;  3JAR B;  1VQ4 F;  4NUT A;  4KWE A;  2H8E A;  2Z01 A;  3VIU A;  3P0Z A;  1COM A;  2OTL F;  1W57 A;  5IT9 M;  3K14 A;  5MN6 A;  3I3F A;  3AGK A;  3EOR A;  4F6R A;  4TV8 A;  4EI9 A;  4YJ2 A;  1PF5 A;  3CC4 F;  4R40 B;  2CZW A;  3IEQ A;  4BVT A;  1RLU A;  3VI6 A;  4IIJ A;  4X3L A;  3WGK A;  3C8L A;  3N2G B;  2Q1X A;  5IYZ B;  5CA0 B;  5IJ9 B;  1ODE A;  3JAL B;  3HKC A;  1JD1 A;  3VCZ A;  5ITZ B;  4BT4 A;  3C9R A;  3JAW A;  3CCU F;  4O4I A;  3CCV F;  3IMP A;  2AIZ P;  4ZI7 B;  3F0G A;  3VYT C;  5LA6 B;  3RYI B;  4TV9 A;  3ZP4 A;  3JAR A;  4I4T B;  1FNJ A;  2ZVY A;  1XRG A;  3S0W A;  3O85 A;  1ZWZ A;  3WGJ A;  3K12 A;  3G6E F;  3HAX D;  1H48 A;  1YQN A;  2KTV A;  3C9T A;  1X7O A;  2HRU A;  4B46 A;  1W55 A;  5EB1 B;  2UYJ A;  1RA4 A;  3NMU C;  3N2G A;  2OZB A;  3F6M A;  3WPW A;  4BVS A;  5IYZ A;  5CA0 A;  1W5A A;  1JY8 A;  3JAL A;  5ITZ A;  1GO0 A;  5EIB D;  1T0K B;  4C4W C;  3CCS F;  1VQ5 F;  3VOA A;  1VQ8 F;  4ZHV A;  3CPW F;  2RHJ A;  1YHQ F;  4BT2 A;  1VQM F;  5CA1 B;  4ZI7 A;  5J2U B;  5JVD B;  5HY0 A;  5LA6 A;  3RYI A;  1U3P A;  5C8Y A;  1YJN F;  4O4L B;  4I4T A;  2I6R A;  2CWJ A;  4G4W A;  3WXM B;  3LME A;  1T0A A;  3PAF A;  1U43 A;  4C82 A;  1JN1 A;  1J7H A;  5EB0 A;  1FSZ A;  3CME F;  1VQ9 F;  1PXW A;  3ESJ A;  3HJW C;  1DT9 A;  1VQL F;  1CK2 A;  4BW0 B;  1YJ9 F;  3NK7 A;  1W59 A;  4TUY B;  4O4H B;  4X1Y B;  1RQ2 A;  4BT7 A;  4X1I B;  4ZHW A;  3S03 A;  1KD1 H;  5B8F A;  2AMT A;  3N2K B;  4ZK7 A;  4C81 A;  3I56 F;  2P6Y A;  3UT5 A;  2UYN A;  4LNU B;  2ZF8 A;  3B6N A;  4RHA A;  1VQ7 F;  2W8B C;  4G88 A;  3S0Y A;  5CA1 A;  2CW4 A;  3RYH B;  3R0P A;  5CB4 B;  5JVD A;  5J2U A;  2ZOD A;  1VQP F;  1X52 A;  4O4L A;  3BYQ A;  1OAP A;  3LFO A;  3E1Y A;  4BY9 D;  5DCV A;  3NVK E;  4WBN B;  1IV4 A;  3NK6 A;  3F0D A;  1QVF F;  5GAN K;  2VAM A;  2UYK A;  5GON B;  3JAW B;  5FNV B;  3CC2 F;  2VGN A;  3LWO C;  3M1X A;  4XCQ A;  3JAK B;  3WGM A;  3S02 A;  1KNK A;  3RYC B;  3QUW A;  3U0O A;  4TV9 B;  3I7T A;  2UYP A;  4X1Y A;  4O4H A;  2PMP A;  3CYQ A;  4X1I A;  1W40 A;  1Q81 H;  1YGY A;  2R6R 1;  3N2K A;  3TD3 A;  4BT6 A;  4ZHQ B;  2LBT A;  1NQ3 A;  1Q82 H;  3D01 A;  3M84 A;  1W5E A;  4LNU A;  2ZOV A;  2UZH A;  3C9S A;  1KNJ A;  2LCA A;  3RYH A;  5CB4 A;  3CC7 F;  3KJJ A;  5GIP C;  5JQG B;  5HY2 A;  3ELC A;  3OW2 F;  1UFY A;  5GIN C;  1W58 1;  1TUB B;  4U39 A;  4DXD A;  4WBN A;  1TVK B;  3OBY A;  4YJ3 B;  3CPQ A;  4IHJ B;  2GVI A;  5GON A;  2CHT A;  1XHO A;  5FNV A;  5MN5 A;  3JVH A;  3JAK A;  4DRX B;  3RYC A;  3FD5 A;  1KQS F;  5C8Y B;  5JCO C;  1IV1 A;  2KGW A;  3KE1 A;  1FFX B;  4PWT A;  4ZHQ A;  5MN4 A;  3LWQ C;  3LWV C;  1W41 A;  5GIO C;  5FJ4 C;  3WPX A;  3HKD B;  3CB2 A;  3IKF A;  1OFU A;  3G4S F;  2I6D A;  3QTY A;  3JAS B;  4NQ3 A;  2G9I A;  4B45 A;  3LDT A;  1SZQ A;  5JQG A;  1VQO F;  3T80 A;  1YJW F;  3F0F A;  2H6L A;  2KG4 A;  2FGY A;  3ERN A;  1TUB A;  5FLX M;  4O2A B;  3J7A R;  1TVK A;  3GYQ A;  3CCE F;  3IEW A;  4YJ3 A;  3KHN A;  3UT5 B;  2UYN B;  2HS3 A;  1VHA A;  4IHJ A;  5EAZ A;  5JCO A;  4C8G A;  2BO1 A;  5AVM A;  4G4X A;  5EZY B;  5LXT A;  2RHO A;  4DRX A;  5BMV B;  2ALE A;  3MCA B;  3VYU C;  3MBM A;  3ZO8 A;  1FFX A;  4X1K B;  3D54 A;  2H8C A;  3HKD A;  4I55 B;  1GX1 A;  3VO8 A;  2DT4 A;  3RE3 A;  1JJ2 F;  3JAS A;  5LOV B;  1JFF B;  3ZP7 A;  2KTU A;  5G4V C;  5HY4 A;  2HP3 A;  3E22 B;  3TD5 A;  1N8R H;  4O2A A;  3S0H A;  2HS0 A;  4X20 B;  1H47 A;  3FFM A;  2LBW A;  2GLZ A;  4B5C A;  1VH8 A;  2Q1Y A;  4BVR A;  3VMF B;  3J81 M;  5HXZ A;  1X25 A;  3F0E A;  1ONI A;  1YIT F;  1Q86 H;  3HTN A;  5EZY A;  1U40 A;  2HVY D;  5EIB C;  5BMV A;  1S72 F;  2OTJ F;  3P4E A;  5IJ0 B;  3JAM M;  1GO1 A;  4X1K A;  1M1K H;  3D00 A;  2LBX A;  3MCQ A;  4I55 A;  3IKE A;  1K73 H;  3K2X A;  4LCK A;  2IG8 A;  2FC3 A;  3SIV A;  1FNK A;  3S06 A;  5LOV A;  3MDO A;  1JFF A;  2V9Y A;  3CCQ F;  3HKE B;  4ZOL A;  3E22 A;  2RHL A;  3K0T A;  3V4D A;  3JAT B;  5KMG B;  1CN7 A;  4X20 A;  3V7E A;  3KJK A;  5EWR A;  3PLA C;  2ZVZ A;  3CYP B;  4EB6 B;  2BTQ B;  2YXZ A;  3ZOP A;  3RA5 A;  4ZHY B;  1VQV A;  1QAH A;  2JNB A;  1GZ0 A;  4BT3 A;  5IJ0 A;  5KX5 B;  5A2Q M;  4FFB B;  1QD9 A;  1W5F A;  2Z1F A;  2VGM A;  2RHH A;  4HNA A;  2CVL A;  2HP0 B;  1K9M H;  5JH7 B;  4E6E A;  4G4Z A;  3CCR F;  5G4U C;  3QHD A;  5LXT B;  3C9U A;  2QTP A;  3HKE A;  1SA0 B;  1RQ7 A;  3M4S A;  3WJR A;  3CCM F;  4O2B B;  3FD6 A;  3JAT A;  5KMG A;  2PHN A;  1K8A H;  3RYF B;  3OON A;  5J2T B;  3NVI B;  5HY1 A;  3V7Q A;  4B62 A;  4EB6 A;  5LP6 B;  2HQS C;  1R1M A;  3WGN A;  3ON1 A;  1Z5W A;  3DC2 A;  2MQE A;  1X7P A;  3WJQ A;  3CCJ F;  5HP8 A;  2VAP A;  5KX5 A;  3CD6 F;  5LP6 C;  3HKB B;  1XV2 A;  2OHW A;  2BTU A;  3KIZ A;  3OBW A;  4FFB A;  4BVQ A;  3LWP C;  1QU9 A;  3P10 A;  2NMU A;  2WAL A;  2HP0 A;  3L7Q A;  4I50 B;  1YI2 F;  4M8I A;  5JH7 A;  2QI2 A;  2ZAU A;  3CG6 A;  3TD4 A;  1VK3 A;  2OTM A;  2Z1U A;  1SA0 A;  4ERH A;  1VQ6 F;  2AIF A;  4NWO B;  1VQN F;  4O2B A;  1Z5V A;  2R75 1;  3N4Z A;  1NMU B;  5EYP B;  3JCM M;  4G4V A;  3RYF A;  5IJ9 A;  4C8I A;  2Z1E A;  1YIJ F;  3VYS C;  2B33 A;  3G71 F;  5J2T A;  1H7M A;  1DBF A;  2K1S A;  5LP6 A;  1QVG F;  3WGL A;  2YYE A;  1KC8 H;  1M90 H;  3LYB A;  3GTZ A;  4ZOL B;  1CLI A;  3IR9 A;  3HKB A;  5EO3 A;  4RQO A;  4TZZ A;  1XBI A;  1UI9 A;  2HX0 A;  4O4J B;  4BT5 A;  4I50 A;  3I55 F;  3V3T A;  2RB9 A;  2HS4 A;  5GAP K;  3J80 M;  1Q8R A;  3CXC F;  4X3M A;  1W2B F;  5HP7 A;  2F9Z C;  2N48 A;  1W42 A;  2CSL A;  4C8E A;  2QEX F;  4U3J B;  5HWE A;  1VQK F;  3RA6 A;  2IAF A;  1IPA A;  5LYJ B;  3DDN A;  2L26 A;  3WJP A;  2BTO A;  5EYP A; 
#chains in the Genus database with same CATH homology
 3LWV C;  1W41 A;  3RA5 A;  5GIO C;  1YHQ F;  3CMA F;  1VQM F;  5FJ4 C;  5HY0 A;  2JNB A;  1GZ0 A;  3N4Y A;  3CCL F;  1SDS A;  1YJN F;  3G4S F;  3WXM B;  1NJI H;  2I6D A;  5A2Q M;  3PAF A;  2QA4 F;  4NQ3 A;  4EI8 A;  1W3E X;  2VGM A;  4EI7 A;  1K9M H;  1VQO F;  1YJW F;  3E20 B;  2KG4 A;  2FGY A;  3CME F;  1VQ9 F;  1PXW A;  5FLX M;  3CCR F;  1RLG A;  3HJW C;  3J7A R;  5G4U C;  1DT9 A;  1VQL F;  3GYQ A;  1CK2 A;  3CCE F;  4BW0 B;  1YJ9 F;  3NK7 A;  3CCM F;  1KD1 H;  2BO1 A;  1K8A H;  1E7K A;  1Q7Y H;  3I56 F;  3LWR C;  3SIU A;  2ALE A;  3MCA B;  5HY1 A;  3NVI B;  3V7Q A;  5HXU A;  3ON1 A;  1VQ4 F;  1VQ7 F;  4NUT A;  1X7P A;  2OTL F;  5IT9 M;  3CCJ F;  1VQP F;  1X52 A;  3CD6 F;  2OHW A;  3AGK A;  1JJ2 F;  3OBW A;  4BVQ A;  4EI9 A;  3LWP C;  3LFO A;  3E1Y A;  4BY9 D;  5DCV A;  3NVK E;  3CC4 F;  2KTU A;  3NK6 A;  2CZW A;  2WAL A;  1QVF F;  5GAN K;  4BVT A;  5G4V C;  5HY4 A;  1N8R H;  1YI2 F;  3VI6 A;  4X3L A;  2QI2 A;  3CG6 A;  3CC2 F;  2VGN A;  3LWO C;  3FFM A;  4XCQ A;  2GLZ A;  2LBW A;  4BVR A;  3VMF B;  3J81 M;  1VQ6 F;  2AIF A;  1VQN F;  5HXZ A;  1W40 A;  3CCU F;  1Q81 H;  1YIT F;  1Q86 H;  3N4Z A;  1NMU B;  3CCV F;  3JCM M;  1Q82 H;  2HVY D;  1YIJ F;  2OTJ F;  1S72 F;  3G71 F;  1H7M A;  1QVG F;  3JAM M;  1GO1 A;  1M1K H;  3D00 A;  2LBX A;  1KC8 H;  3CC7 F;  5GIP C;  1M90 H;  3O85 A;  1K73 H;  3IR9 A;  1ZWZ A;  5HY2 A;  3OW2 F;  5EO3 A;  4LCK A;  3G6E F;  3HAX D;  5GIN C;  4TZZ A;  2FC3 A;  3SIV A;  1XBI A;  2KTV A;  1X7O A;  3OBY A;  3CCQ F;  3I55 F;  3CPQ A;  1RA4 A;  3V3T A;  5GAP K;  3J80 M;  3NMU C;  3CXC F;  4X3M A;  1W2B F;  1CN7 A;  2OZB A;  4BVS A;  2F9Z C;  1W42 A;  3V7E A;  2QEX F;  5HWE A;  1VQK F;  3RA6 A;  5EWR A;  1KQS F;  1T0K B;  3PLA C;  1IPA A;  4C4W C;  1GO0 A;  3CCS F;  1VQ5 F;  1VQ8 F;  3CPW F;  3LWQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...