3VCZA

1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
127
Chain Sequence
TKVLHTDSAPAAIGPYIQGVDLGNMVLTSGQIPVNPATGEVPADIAAQARQSLDNVKAVVEASGLTVGDIVKMTVFVKDLNDFGTVNEVYGNFFDEHNVAHYPARSCVEVARLPKDVGIEIEAIAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.80 Angstrom resolution crystal structure of a putative translation initiation inhibitor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Translation
molecule keywords Endoribonuclease L-PSP
total genus 37
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3vczA00
1QU9A 1X25A 1DBFA 2UYNB 2UYPA 3K0TA 1COMA 3ZOPA 2CW4A 2UYNA 5HP7A 1UI9A 3LYBA 1PF5A 2UYJA 3I3FA 2OTMA 2B33A 3QUWA 3M1XA 1J7HA 3VCZA 1XHOA 1QAHA 4NWOB 3R0PA 2CHTA 1ODEA 3L7QA 2DYYA 2UYKA 3D01A 3GTZA 3LMEA 1JD1A 3M4SA 2CVLA 2CHSA 1QD9A 3V4DA 3ZP7A 1NQ3A 3K12A 5HP8A 3ZO8A 3I7TA 1XRGA 2CSLA 3KJKA 2CWJA 3MQWA 1FNJA 1FNKA 3KJJA 1UFYA 2IG8A 3ZP4A 4ZK7A 1ONIA 2EWCA
chains in the Genus database with same CATH superfamily
5JVDA 1X25A 5G4VC 4TV9B 2ZAUA 1SZQA 3CB2A 2WALA 3V7QA 3RYIB 5HP7A 1TVKB 1UI9A 3N2GB 3N4ZA 2OTMA 4LNUB 3G4SF 2AMTA 5EZYB 3CCUF 4O4JA 3HKEB 3JAKB 3N2KA 3F0GA 2MQEA 4O4LA 2I6DA 3QHDA 3RA5A 3V4DA 2CHSA 3C9UA 3OBYA 3HTNA 3CCSF 2IAFA 3I7TA 3S02A 3RYCB 2ZVZA 1E7KA 3OBWA 5KX5B 3CMEF 1W5FA 1CN7A 3IR9A 1TUBB 3WGJA 1X7PA 1QVGF 1K9MH 3RYHA 5LP6B 1JN1A 5HXUA 5GIPC 1VQ5F 2KGWA 1VQ8F 3VCZA 5LA6B 5ITZB 3CCRF 3GTZA 3WXMB 4B5CA 5HY0A 4NQ3A 2HS4A 1YITF 3WJRA 4DRXB 5EAZA 5EB1B 1RA4A 3V3TA 5LP6C 3N2GA 3RYHB 2RHHA 1PF5A 5C8YA 2VXYA 5FLXM 3MDOA 4YJ3A 5EO3A 4I50A 1S72F 4C82A 1NQ3A 3K12A 3HWUA 3U0OA 1FNJA 3HKBA 5JQGB 3JVHA 5JCOC 4C81A 3LWOC 2R6R1 1VQMF 3VO8A 1R1MA 3CG6A 3RYIA 4BT5A 1ZWZA 3RYFA 1CLIA 2K1SA 2LBXA 4C8GA 1VQ4F 1Q8RA 2IQQA 2P6YA 2PMPA 3ESJA 4O2AA 5CB4B 1RLGA 3R0PA 1YI2F 3CCJF 3ELCA 2HP0A 1OFUA 2LBWA 3CCLF 4B46A 1VQKF 3GYQA 3C8LA 4O4HB 2Z01A 3MCAB 1YJNF 5HXZA 3VMFB 3C9TA 3E1YA 1VHAA 2UZHA 3M84A 1U3LA 2Z1EA 3N2KB 4X1IB 2H6LA 4R40B 3ZOPA 4ZOLB 1PXWA 3VI6A 4C8IA 4EB6B 4I50B 5B8FA 2R751 3UT5B 3D54A 2HRUA 5GAPK 4X3LA 4ZHVA 5EWRA 4HNAB 3E22B 2Q1YA 2Z1TA 2OHWA 3T80A 3KJJA 5EIBC 4ZK7A 4ERHA 2AIFA 1IV1A 1QVFF 4LCKA 3V7EA 5G4UC 3OONA 1W5AA 1W2BF 1RLUA 1W57A 2RHLA 2ZODA 3LYBA 3ON1A 3WGLA 5GINC 3HKCB 2G9IA 1T0KB 2CHTA 4BW0B 3MCQA 5BMVA 5EYPB 2UYKA 3JASB 4ZI7A 5GIOC 2YXZA 3M4SA 2HP0B 5CA0A 1XRGA 5HY2A 3CCVF 3NMUC 1IV2A 4FFBA 4X3MA 1VH8A 3E20B 1Q82H 1T0AA 4G4ZA 4BVRA 3HJWC 2HQSC 4NUTA 1FFXB 4NWOB 3GHZA 2VAPA 2YYEA 3CXCF 2HP3A 2LBTA 3N4YA 2OZBA 5MN5A 4IIJA 4TV9A 3KJKA 5EYPA 2CWJA 4B45A 2HVYD 1UFYA 1VQOF 4EI9A 3JALA 4YJ2B 1NMUB 4X1KB 3RA6A 3HKDA 4BT3A 4E6EA 4BT6A 2HS0A 3SIUA 5LA6A 1M1KH 1GX1A 1DT9A 3PAFA 5FNVA 4X1YB 4DXDA 5LXTA 3HKCA 2FGYA 4EI8A 5JH7A 4XCQA 2QTPA 4G4WA 1KNKA 3G71F 2FC3A 1W41A 3JATA 4O2BA 1KD1H 4G88A 3JAMM 5CA1A 4X1YA 1IV3A 1KQSF 4IHJA 1DBFA 3J80M 1Q7YH 2NMUA 4X1KA 4F6RB 3S0HA 3E22A 2ALEA 3I3FA 3JALB 1Q81H 4YJ2A 1VQ6F 3JARB 1TUBA 2RHJA 1SDSA 2QA4F 1GO0A 3CC7F 3O85A 4ZHYB 3F0DA 3CPQA 5DCVA 5EB0A 3WGMA 4C4WC 2CSLA 5IT9M 1VK3A 3UT5A 4X20B 3I55F 5JCOA 1XV2A 3S03A 5IJ9B 1RQ2A 1QU9A 3K14A 5J2UB 4WBNA 2UYNA 1J7HA 1KC8H 1U43A 4I4TB 4BVQA 3JAWB 4ZHQB 2RB9A 5IYZB 4WBNB 5J2UA 2W8BC 3K2XA 1RQ7A 2CVLA 4M8IA 4O4IB 3ERNA 1NJIH 3KHNA 3RYFB 4RQOA 3F6MA 1XBIA 2VGNA 2V9YA 2ZF8A 3IKEA 3VYSC 4BVSA 5FJ4C 4G4VA 4BT7A 1W40A 5LXTB 2BTQB 2VGMA 2H8EA 5IJ9A 4I55B 3WJPA 1VQNF 3L7QA 3TD3A 5KMGA 5GANK 3G6EF 2F9ZC 1JD1A 4BVTA 3CC4F 5LYJB 1U3PA 3DDNA 4EI7A 3ZP7A 4B62A 1QD9A 1VQ9F 1JFFA 3WPWA 3S0WA 4RHAA 3P10A 5KX5A 3TD4A 2AIZP 3D00A 5FNVB 3LWVC 1KNJA 1OAPA 2HS3A 1SA0A 4O4IA 4DRXA 5GONB 5HY4A 1YGYA 4X1IA 2CW4A 1W581 1SA0B 3LFOA 2H8CA 1XHOA 3I56F 1ODEA 5ITZA 3D01A 3LMEA 1YHQF 1VQLF 3RYCA 5LYJA 3HKDB 3J7AR 1W42A 3LWRC 3B6NA 4F6RA 1X7OA 2DT4A 5AVMA 2L26A 4BY9D 3AGKA 5KMGB 3VYTC 1H48A 5CB4A 2IG8A 3F0FA 3KIZA 3Q8HA 5A2QM 5CA0B 3FFMA 5EIBD 5LP6A 2JNBA 2OTJF 3K0TA 1GO1A 3QTYA 3WPXA 1VQPF 4FFBB 1K73H 4I4TA 4U3JA 4G4YA 1FFXA 3F0EA 3M1XA 3MBMA 4ZHQA 2GZLA 3P4EA 5J2TB 4X20A 3SIVA 2GVIA 4C8EA 3CMAF 4G4XA 3TD5A 4ZHWA 1YQNA 5IJ0A 1JY8A 3HKBB 5JQGA 2VAMA 2Z1FA 1JJ2F 2EWCA 3HAXD 4BT4A 5IJ0B 2Z1UA 3CD6F 3FPIA 1COMA 2GLZA 5GONA 3WGNA 4TV8B 4YJ3B 2UYJA 3CCQF 2B33A 1W5EA 4O2AB 3LWPC 2QEXF 2ZOVA 4TUYB 1N8RH 3JARA 3NVKE 4U3JB 4O2BB 3CPWF 3BYQA 3FBAA 5HP8A 5BMVB 5JH7B 1GZ0A 3JASA 4ZI7B 3DC2A 3VOAA 2KTUA 3CYPB 1FNKA 1X52A 4IHJB 1YIJF 1U40A 1IV4A 1Z5WA 5HY1A 4I55A 3ZP4A 1YJWF 2RHOA 1H47A 2I6RA 5CA1B 2CZWA 2UYPA 3NVIB 2KTVA 1Q86H 3NK7A 3S06A 3C9SA 3VTIC 3IMPA 3S0YA 3CCMF 2HRYA 2PHNA 2OTLF 2N48A 3QUWA 1CK2A 4BT2A 1W55A 3FD6A 4EB6A 2BTOA 1W59A 3KE1A 1QAHA 1TVKA 1VQVA 1W5BA 4KWEA 3JATB 2QI2A 3CC2F 4U39A 4HNAA 3ZO8A 3NK6A 4O4JB 5IYZA 3LWQC 1YJ9F 3HKEA 3JAKA 1IPAA 1FSZA 4TUYA 3VOBA 3MQWA 2LCAA 3RE3A 3FD5A 4IIJB 4LNUA 2ZVYA 4TV8A 4ZOLA 1M90H 3OW2F 5LOVA 3IKFA 2UYNB 1K8AH 1JFFB 2KG4A 3CYQA 3LDTA 3P0ZA 5J2TA 4O4LB 5MN4A 3JCMM 3WJQA 5EZYA 2BTUA 4O4HA 5C8YB 2BO1A 2Q1XA 3CCEF 4TZZA 2DYYA 1VQ7F 3VYUC 1W3EX 5MN6A 5LOVB 4PWTA 2HX0A 3JAWA 1Z5VA 3IEQA 3IEWA 1H7MA 5JVDB 3J81M 3WGKA 5HWEA 2VAWA 3PLAC 3EORA 3VIUA 3C9RA 1ONIA
chains in the Genus database with same CATH topology
1QU9A 1X25A 1DBFA 2UYNB 2UYPA 3K0TA 1COMA 3ZOPA 2CW4A 2UYNA 5HP7A 1UI9A 3LYBA 1PF5A 2UYJA 3I3FA 2OTMA 2B33A 3QUWA 3M1XA 1J7HA 3VCZA 1XHOA 1QAHA 4NWOB 3R0PA 2CHTA 1ODEA 3L7QA 2DYYA 2UYKA 3D01A 3GTZA 3LMEA 1JD1A 3M4SA 2CVLA 2CHSA 1QD9A 3V4DA 3ZP7A 1NQ3A 3K12A 5HP8A 3ZO8A 3I7TA 1XRGA 2CSLA 3KJKA 2CWJA 3MQWA 1FNJA 1FNKA 3KJJA 1UFYA 2IG8A 3ZP4A 4ZK7A 1ONIA 2EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU9 A;  1X25 A;  1DBF A;  2UYN B;  2UYP A;  3K0T A;  1COM A;  3ZOP A;  2CW4 A;  2UYN A;  5HP7 A;  1UI9 A;  3LYB A;  1PF5 A;  2UYJ A;  3I3F A;  2OTM A;  2B33 A;  3QUW A;  3M1X A;  1J7H A;  3VCZ A;  1XHO A;  1QAH A;  4NWO B;  3R0P A;  2CHT A;  1ODE A;  3L7Q A;  2DYY A;  2UYK A;  3D01 A;  3GTZ A;  3LME A;  1JD1 A;  3M4S A;  2CVL A;  2CHS A;  1QD9 A;  3V4D A;  3ZP7 A;  1NQ3 A;  3K12 A;  5HP8 A;  3ZO8 A;  3I7T A;  1XRG A;  2CSL A;  3KJK A;  2CWJ A;  3MQW A;  1FNJ A;  1FNK A;  3KJJ A;  1UFY A;  2IG8 A;  3ZP4 A;  4ZK7 A;  1ONI A;  2EWC A; 
#chains in the Genus database with same CATH topology
 5JVD A;  1X25 A;  5G4V C;  4TV9 B;  2ZAU A;  1SZQ A;  3CB2 A;  2WAL A;  3V7Q A;  3RYI B;  5HP7 A;  1TVK B;  1UI9 A;  3N2G B;  3N4Z A;  2OTM A;  4LNU B;  3G4S F;  2AMT A;  5EZY B;  3CCU F;  4O4J A;  3HKE B;  3JAK B;  3N2K A;  3F0G A;  2MQE A;  4O4L A;  2I6D A;  3QHD A;  3RA5 A;  3V4D A;  2CHS A;  3C9U A;  3OBY A;  3HTN A;  3CCS F;  2IAF A;  3I7T A;  3S02 A;  3RYC B;  2ZVZ A;  1E7K A;  3OBW A;  5KX5 B;  3CME F;  1W5F A;  1CN7 A;  3IR9 A;  1TUB B;  3WGJ A;  1X7P A;  1QVG F;  1K9M H;  3RYH A;  5LP6 B;  1JN1 A;  5HXU A;  5GIP C;  1VQ5 F;  2KGW A;  1VQ8 F;  3VCZ A;  5LA6 B;  5ITZ B;  3CCR F;  3GTZ A;  3WXM B;  4B5C A;  5HY0 A;  4NQ3 A;  2HS4 A;  1YIT F;  3WJR A;  4DRX B;  5EAZ A;  5EB1 B;  1RA4 A;  3V3T A;  5LP6 C;  3N2G A;  3RYH B;  2RHH A;  1PF5 A;  5C8Y A;  2VXY A;  5FLX M;  3MDO A;  4YJ3 A;  5EO3 A;  4I50 A;  1S72 F;  4C82 A;  1NQ3 A;  3K12 A;  3HWU A;  3U0O A;  1FNJ A;  3HKB A;  5JQG B;  3JVH A;  5JCO C;  4C81 A;  3LWO C;  2R6R 1;  1VQM F;  3VO8 A;  1R1M A;  3CG6 A;  3RYI A;  4BT5 A;  1ZWZ A;  3RYF A;  1CLI A;  2K1S A;  2LBX A;  4C8G A;  1VQ4 F;  1Q8R A;  2IQQ A;  2P6Y A;  2PMP A;  3ESJ A;  4O2A A;  5CB4 B;  1RLG A;  3R0P A;  1YI2 F;  3CCJ F;  3ELC A;  2HP0 A;  1OFU A;  2LBW A;  3CCL F;  4B46 A;  1VQK F;  3GYQ A;  3C8L A;  4O4H B;  2Z01 A;  3MCA B;  1YJN F;  5HXZ A;  3VMF B;  3C9T A;  3E1Y A;  1VHA A;  2UZH A;  3M84 A;  1U3L A;  2Z1E A;  3N2K B;  4X1I B;  2H6L A;  4R40 B;  3ZOP A;  4ZOL B;  1PXW A;  3VI6 A;  4C8I A;  4EB6 B;  4I50 B;  5B8F A;  2R75 1;  3UT5 B;  3D54 A;  2HRU A;  5GAP K;  4X3L A;  4ZHV A;  5EWR A;  4HNA B;  3E22 B;  2Q1Y A;  2Z1T A;  2OHW A;  3T80 A;  3KJJ A;  5EIB C;  4ZK7 A;  4ERH A;  2AIF A;  1IV1 A;  1QVF F;  4LCK A;  3V7E A;  5G4U C;  3OON A;  1W5A A;  1W2B F;  1RLU A;  1W57 A;  2RHL A;  2ZOD A;  3LYB A;  3ON1 A;  3WGL A;  5GIN C;  3HKC B;  2G9I A;  1T0K B;  2CHT A;  4BW0 B;  3MCQ A;  5BMV A;  5EYP B;  2UYK A;  3JAS B;  4ZI7 A;  5GIO C;  2YXZ A;  3M4S A;  2HP0 B;  5CA0 A;  1XRG A;  5HY2 A;  3CCV F;  3NMU C;  1IV2 A;  4FFB A;  4X3M A;  1VH8 A;  3E20 B;  1Q82 H;  1T0A A;  4G4Z A;  4BVR A;  3HJW C;  2HQS C;  4NUT A;  1FFX B;  4NWO B;  3GHZ A;  2VAP A;  2YYE A;  3CXC F;  2HP3 A;  2LBT A;  3N4Y A;  2OZB A;  5MN5 A;  4IIJ A;  4TV9 A;  3KJK A;  5EYP A;  2CWJ A;  4B45 A;  2HVY D;  1UFY A;  1VQO F;  4EI9 A;  3JAL A;  4YJ2 B;  1NMU B;  4X1K B;  3RA6 A;  3HKD A;  4BT3 A;  4E6E A;  4BT6 A;  2HS0 A;  3SIU A;  5LA6 A;  1M1K H;  1GX1 A;  1DT9 A;  3PAF A;  5FNV A;  4X1Y B;  4DXD A;  5LXT A;  3HKC A;  2FGY A;  4EI8 A;  5JH7 A;  4XCQ A;  2QTP A;  4G4W A;  1KNK A;  3G71 F;  2FC3 A;  1W41 A;  3JAT A;  4O2B A;  1KD1 H;  4G88 A;  3JAM M;  5CA1 A;  4X1Y A;  1IV3 A;  1KQS F;  4IHJ A;  1DBF A;  3J80 M;  1Q7Y H;  2NMU A;  4X1K A;  4F6R B;  3S0H A;  3E22 A;  2ALE A;  3I3F A;  3JAL B;  1Q81 H;  4YJ2 A;  1VQ6 F;  3JAR B;  1TUB A;  2RHJ A;  1SDS A;  2QA4 F;  1GO0 A;  3CC7 F;  3O85 A;  4ZHY B;  3F0D A;  3CPQ A;  5DCV A;  5EB0 A;  3WGM A;  4C4W C;  2CSL A;  5IT9 M;  1VK3 A;  3UT5 A;  4X20 B;  3I55 F;  5JCO A;  1XV2 A;  3S03 A;  5IJ9 B;  1RQ2 A;  1QU9 A;  3K14 A;  5J2U B;  4WBN A;  2UYN A;  1J7H A;  1KC8 H;  1U43 A;  4I4T B;  4BVQ A;  3JAW B;  4ZHQ B;  2RB9 A;  5IYZ B;  4WBN B;  5J2U A;  2W8B C;  3K2X A;  1RQ7 A;  2CVL A;  4M8I A;  4O4I B;  3ERN A;  1NJI H;  3KHN A;  3RYF B;  4RQO A;  3F6M A;  1XBI A;  2VGN A;  2V9Y A;  2ZF8 A;  3IKE A;  3VYS C;  4BVS A;  5FJ4 C;  4G4V A;  4BT7 A;  1W40 A;  5LXT B;  2BTQ B;  2VGM A;  2H8E A;  5IJ9 A;  4I55 B;  3WJP A;  1VQN F;  3L7Q A;  3TD3 A;  5KMG A;  5GAN K;  3G6E F;  2F9Z C;  1JD1 A;  4BVT A;  3CC4 F;  5LYJ B;  1U3P A;  3DDN A;  4EI7 A;  3ZP7 A;  4B62 A;  1QD9 A;  1VQ9 F;  1JFF A;  3WPW A;  3S0W A;  4RHA A;  3P10 A;  5KX5 A;  3TD4 A;  2AIZ P;  3D00 A;  5FNV B;  3LWV C;  1KNJ A;  1OAP A;  2HS3 A;  1SA0 A;  4O4I A;  4DRX A;  5GON B;  5HY4 A;  1YGY A;  4X1I A;  2CW4 A;  1W58 1;  1SA0 B;  3LFO A;  2H8C A;  1XHO A;  3I56 F;  1ODE A;  5ITZ A;  3D01 A;  3LME A;  1YHQ F;  1VQL F;  3RYC A;  5LYJ A;  3HKD B;  3J7A R;  1W42 A;  3LWR C;  3B6N A;  4F6R A;  1X7O A;  2DT4 A;  5AVM A;  2L26 A;  4BY9 D;  3AGK A;  5KMG B;  3VYT C;  1H48 A;  5CB4 A;  2IG8 A;  3F0F A;  3KIZ A;  3Q8H A;  5A2Q M;  5CA0 B;  3FFM A;  5EIB D;  5LP6 A;  2JNB A;  2OTJ F;  3K0T A;  1GO1 A;  3QTY A;  3WPX A;  1VQP F;  4FFB B;  1K73 H;  4I4T A;  4U3J A;  4G4Y A;  1FFX A;  3F0E A;  3M1X A;  3MBM A;  4ZHQ A;  2GZL A;  3P4E A;  5J2T B;  4X20 A;  3SIV A;  2GVI A;  4C8E A;  3CMA F;  4G4X A;  3TD5 A;  4ZHW A;  1YQN A;  5IJ0 A;  1JY8 A;  3HKB B;  5JQG A;  2VAM A;  2Z1F A;  1JJ2 F;  2EWC A;  3HAX D;  4BT4 A;  5IJ0 B;  2Z1U A;  3CD6 F;  3FPI A;  1COM A;  2GLZ A;  5GON A;  3WGN A;  4TV8 B;  4YJ3 B;  2UYJ A;  3CCQ F;  2B33 A;  1W5E A;  4O2A B;  3LWP C;  2QEX F;  2ZOV A;  4TUY B;  1N8R H;  3JAR A;  3NVK E;  4U3J B;  4O2B B;  3CPW F;  3BYQ A;  3FBA A;  5HP8 A;  5BMV B;  5JH7 B;  1GZ0 A;  3JAS A;  4ZI7 B;  3DC2 A;  3VOA A;  2KTU A;  3CYP B;  1FNK A;  1X52 A;  4IHJ B;  1YIJ F;  1U40 A;  1IV4 A;  1Z5W A;  5HY1 A;  4I55 A;  3ZP4 A;  1YJW F;  2RHO A;  1H47 A;  2I6R A;  5CA1 B;  2CZW A;  2UYP A;  3NVI B;  2KTV A;  1Q86 H;  3NK7 A;  3S06 A;  3C9S A;  3VTI C;  3IMP A;  3S0Y A;  3CCM F;  2HRY A;  2PHN A;  2OTL F;  2N48 A;  3QUW A;  1CK2 A;  4BT2 A;  1W55 A;  3FD6 A;  4EB6 A;  2BTO A;  1W59 A;  3KE1 A;  1QAH A;  1TVK A;  1VQV A;  1W5B A;  4KWE A;  3JAT B;  2QI2 A;  3CC2 F;  4U39 A;  4HNA A;  3ZO8 A;  3NK6 A;  4O4J B;  5IYZ A;  3LWQ C;  1YJ9 F;  3HKE A;  3JAK A;  1IPA A;  1FSZ A;  4TUY A;  3VOB A;  3MQW A;  2LCA A;  3RE3 A;  3FD5 A;  4IIJ B;  4LNU A;  2ZVY A;  4TV8 A;  4ZOL A;  1M90 H;  3OW2 F;  5LOV A;  3IKF A;  2UYN B;  1K8A H;  1JFF B;  2KG4 A;  3CYQ A;  3LDT A;  3P0Z A;  5J2T A;  4O4L B;  5MN4 A;  3JCM M;  3WJQ A;  5EZY A;  2BTU A;  4O4H A;  5C8Y B;  2BO1 A;  2Q1X A;  3CCE F;  4TZZ A;  2DYY A;  1VQ7 F;  3VYU C;  1W3E X;  5MN6 A;  5LOV B;  4PWT A;  2HX0 A;  3JAW A;  1Z5V A;  3IEQ A;  3IEW A;  1H7M A;  5JVD B;  3J81 M;  3WGK A;  5HWE A;  2VAW A;  3PLA C;  3EOR A;  3VIU A;  3C9R A;  1ONI A; 
#chains in the Genus database with same CATH homology
 1QU9 A;  1X25 A;  1DBF A;  2UYN B;  2UYP A;  3K0T A;  1COM A;  3ZOP A;  2CW4 A;  2UYN A;  5HP7 A;  1UI9 A;  3LYB A;  1PF5 A;  2UYJ A;  3I3F A;  2OTM A;  2B33 A;  3QUW A;  3M1X A;  1J7H A;  3VCZ A;  1XHO A;  1QAH A;  4NWO B;  3R0P A;  2CHT A;  1ODE A;  3L7Q A;  2DYY A;  2UYK A;  3D01 A;  3GTZ A;  3LME A;  1JD1 A;  3M4S A;  2CVL A;  2CHS A;  1QD9 A;  3V4D A;  3ZP7 A;  1NQ3 A;  3K12 A;  5HP8 A;  3ZO8 A;  3I7T A;  1XRG A;  2CSL A;  3KJK A;  2CWJ A;  3MQW A;  1FNJ A;  1FNK A;  3KJJ A;  1UFY A;  2IG8 A;  3ZP4 A;  4ZK7 A;  1ONI A;  2EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...