3VCZA

1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
127
Chain Sequence
TKVLHTDSAPAAIGPYIQGVDLGNMVLTSGQIPVNPATGEVPADIAAQARQSLDNVKAVVEASGLTVGDIVKMTVFVKDLNDFGTVNEVYGNFFDEHNVAHYPARSCVEVARLPKDVGIEIEAIAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.80 Angstrom resolution crystal structure of a putative translation initiation inhibitor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Translation
molecule keywords Endoribonuclease L-PSP
total genus 37
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3vczA00
3LYBA 2UYNA 1COMA 2UYNB 2UYKA 3M1XA 3GTZA 2CW4A 1DBFA 5HP7A 2EWCA 3QUWA 1QU9A 3ZO8A 4ZK7A 3K12A 3D01A 3I3FA 3K0TA 2IG8A 2CVLA 5HP8A 1JD1A 2UYPA 2CHSA 3MQWA 1FNKA 2UYJA 2OTMA 3VCZA 3KJJA 3I7TA 3L7QA 1QAHA 2DYYA 1X25A 2B33A 2CSLA 1QD9A 1XRGA 1FNJA 3LMEA 3R0PA 1PF5A 1ODEA 1ONIA 4NWOB 2CWJA 2CHTA 1NQ3A 3ZP7A 3V4DA 3ZP4A 1UI9A 1XHOA 1J7HA 1UFYA 3ZOPA 3KJKA 3M4SA
chains in the Genus database with same CATH superfamily
3J80M 4G4VA 5CA1B 1GO1A 1DBFA 3WJRA 4YJ2A 1VQ6F 1YGYA 2Z01A 3E20B 5JQGA 5JH7A 4EB6A 3HKCA 2BTOA 3TD3A 3G71F 4RHAA 5EYPA 3NVKE 1SDSA 1T0KB 3I56F 1RQ2A 2F9ZC 4E6EA 3LWPC 4LNUA 4TZZA 3JARB 4ZHYB 4FFBA 5EB0A 1K73H 1Z5WA 3RA6A 4IHJB 1JFFA 5LP6B 1YJ9F 1KD1H 4XCQA 2LCAA 5IJ9B 1X7PA 3HKDA 5FNVA 4ZOLB 3RYIB 2PHNA 1KNKA 1VK3A 3IKEA 4EI9A 3CCVF 2HRYA 1VQ5F 4ZI7B 3JAWB 3ELCA 3B6NA 3S0WA 3JAMM 2G9IA 4I55A 3K2XA 2OHWA 3V4DA 3SIVA 1Q8RA 3RYHB 3N2KA 3DDNA 1W581 4I50A 1COMA 4G4XA 3RA5A 4KWEA 1RLUA 2VAWA 2JNBA 4ZHVA 2RHOA 3QUWA 4YJ3A 2KTVA 3M84A 4G4ZA 2IAFA 1TVKA 4X1KB 1JY8A 5J2TA 1U3PA 2KG4A 2K1SA 4TUYA 3MQWA 4B45A 4TV8A 2P6YA 3OBWA 2HVYD 1VQPF 3FFMA 3LWRC 4C4WC 1XRGA 3P10A 3JASA 3EORA 3FD5A 4X3LA 4O4LA 3CB2A 1FFXB 3CCUF 3ZP4A 1W5BA 5GIPC 2QTPA 1SZQA 4TV9B 2ZAUA 2DT4A 2VAMA 2H6LA 2KGWA 3C9TA 2RHLA 3F0GA 1K8AH 5IYZA 5HY2A 5GONA 5EWRA 3D01A 3C9SA 3CCQF 1CLIA 5HP8A 2H8CA 4HNAB 4LCKA 5EB1B 1YQNA 4WBNA 3LWQC 1ZWZA 3HWUA 5G4UC 1PF5A 5HXUA 1UI9A 1VHAA 1KNJA 3I55F 3CYQA 5ITZA 1VH8A 2ZVZA 3WJPA 3SIUA 1YJWF 2AIFA 3OBYA 4ZHQB 3CMEF 3CC7F 4O4LB 1JD1A 5JVDB 1VQVA 2QI2A 5HY1A 1R1MA 4X1IB 1X52A 4I4TB 3K14A 3CCLF 2DYYA 2HQSC 5FJ4C 2VAPA 3CYPB 3U0OA 3WGNA 1JJ2F 3VYUC 3ZP7A 3WGMA 4PWTA 4X20A 1VQNF 1W5AA 5GINC 3VIUA 4NUTA 2OTLF 1GO0A 3S02A 4C8GA 3WGJA 3E1YA 1W2BF 3RYHA 3MCQA 5BMVB 2CVLA 1W59A 3KHNA 1W42A 2W8BC 1FSZA 3JAWA 1IV4A 3VCZA 3WPWA 4BVSA 3N2GB 2FGYA 2VXYA 1FNJA 2LBTA 5LYJA 3IMPA 5EIBD 4ZOLA 3RYIA 1H47A 3NK7A 1NQ3A 3LFOA 5FNVB 4DRXB 3HKDB 1Q7YH 3D54A 5IJ9A 3KJKA 5KMGA 3LYBA 3RE3A 4IHJA 4O4IA 3M1XA 3GTZA 2CW4A 5KX5B 4FFBB 2Q1YA 2VGNA 3VO8A 2BO1A 3HKBB 3JARA 2LBWA 2LBXA 4RQOA 3ERNA 3WPXA 2R6R1 4BVQA 1VQKF 5IT9M 1SA0B 2Z1TA 1DT9A 2UZHA 3KE1A 4EB6B 5JH7B 1N8RH 1VQ8F 1XV2A 3UT5B 3DC2A 4BT4A 1NJIH 3MBMA 1Q82H 1W5EA 3CPWF 1VQ9F 4ZHWA 5CA1A 3CXCF 3CCRF 1VQMF 2UYKA 4IIJB 3CG6A 2OZBA 4O4JB 3RYCB 5LXTA 2AMTA 4G4WA 4O2BA 5MN6A 3QTYA 2UYJA 4B5CA 3KJJA 3UT5A 4EI8A 1S72F 1QAHA 2ZF8A 2GVIA 2BTUA 1SA0A 3GYQA 3ZOPA 2Z1UA 2I6RA 1Z5VA 3NMUC 3HKBA 2AIZP 2R751 3IR9A 4M8IA 2HS3A 3FBAA 5KX5A 3CC2F 4ZK7A 4X1YB 3QHDA 2KTUA 4O4IB 4BW0B 5HY0A 1VQ4F 3PLAC 3VYSC 1YJNF 3F0DA 5KMGB 2GZLA 4F6RA 1QVFF 3HKEA 4DRXA 2YYEA 1GX1A 5LYJB 2HRUA 1W41A 1X25A 2B33A 3Q8HA 5CA0A 3V3TA 3S03A 3N2GA 3JCMM 1Q81H 2L26A 5MN4A 1KQSF 2RHHA 5IJ0B 2OTJF 1YIJF 5J2UB 5EO3A 5LA6A 3N4YA 2QA4F 2H8EA 2UYNA 5BMVA 5C8YA 4C8EA 2PMPA 4BT2A 3CCJF 3LDTA 3CC4F 3V7QA 4X20B 2HS4A 1U3LA 2N48A 1W40A 5JCOA 3T80A 1X7OA 3S0HA 1H48A 3F6MA 3C8LA 1W55A 1RA4A 3LMEA 3R0PA 4I4TA 3VI6A 1ODEA 4X1IA 5GIOC 2I6DA 4BT6A 5GAPK 2NMUA 1QVGF 5JVDA 4ZHQA 2HP3A 4BVTA 5B8FA 5MN5A 3VMFB 5ITZB 3CMAF 3K12A 3VYTC 1IV3A 5EZYB 1E7KA 4BY9D 3FPIA 4G4YA 3HJWC 4U39A 2IQQA 1U40A 3AGKA 4O2AA 5EAZA 3RYFB 2VGMA 4WBNB 4BT7A 1OAPA 3ESJA 4HNAA 3HTNA 1UFYA 5HY4A 1H7MA 3KIZA 1M90H 5GONB 4U3JA 4O4HA 2HP0B 3JAKA 3E22A 4BT5A 5IYZB 3D00A 2YXZA 2IG8A 5LP6C 1JN1A 3O85A 4TV9A 3CD6F 3JATA 1FFXA 2ZODA 5CB4B 5CB4A 5EIBC 3L7QA 3OW2F 3JASB 3VOAA 4B62A 3JATB 1CK2A 1W3EX 3VOBA 4TV8B 2CHTA 3ON1A 2GLZA 4TUYB 3E22B 2HP0A 3JAKB 1J7HA 2Z1EA 4O4HB 4U3JB 3JVHA 4BT3A 5J2TB 1TVKB 4X1KA 5G4VC 4YJ3B 1GZ0A 1M1KH 3C9UA 3J7AR 5A2QM 3CCMF 3MDOA 3I3FA 4I50B 3IEWA 3IEQA 4C81A 3RYFA 3N2KB 5HWEA 4NQ3A 4O2AB 3NK6A 1FNKA 3V7EA 1VQ7F 4I55B 1VQLF 3N4ZA 4ZI7A 3WGLA 2FC3A 5EZYA 4NWOB 3S06A 3TD5A 2ZVYA 3C9RA 5FLXM 5JCOC 3M4SA 3GHZA 2MQEA 3PAFA 1RLGA 2EWCA 3P0ZA 2BTQB 3VTIC 2ALEA 3K0TA 1JFFB 5LP6A 5GANK 2UYPA 1NMUB 3S0YA 1RQ7A 5HXZA 2OTMA 3CCEF 1K9MH 4LNUB 1QD9A 2CZWA 3LWOC 3CCSF 5EYPB 1YI2F 4EI7A 3HKCB 1PXWA 1XHOA 5C8YB 3OONA 1XBIA 5JQGB 2UYNB 3G4SF 5LA6B 1YHQF 4X3MA 5J2UA 4YJ2B 5HP7A 3WXMB 5IJ0A 1T0AA 5DCVA 2V9YA 3LWVC 2Z1FA 1TUBA 1VQOF 1U43A 5CA0B 5AVMA 3TD4A 1W57A 1IV2A 3HAXD 3WGKA 2CHSA 2QEXF 3MCAB 3IKFA 3I7TA 4G88A 2RB9A 3HKEB 4F6RB 3F0EA 3WJQA 1Q86H 2CWJA 4X1YA 1CN7A 2Q1XA 3JALA 2ZOVA 4ERHA 4R40B 2RHJA 1OFUA 5LOVA 1QU9A 3ZO8A 5LOVB 3CPQA 3J81M 4BVRA 1IPAA 3G6EF 1YITF 3JALB 3BYQA 4O2BB 4C82A 2WALA 2CSLA 1W5FA 2HX0A 2HS0A 5LXTB 3P4EA 3RYCA 1KC8H 4C8IA 1ONIA 3F0FA 3FD6A 4O4JA 4B46A 4IIJA 1IV1A 3NVIB 4DXDA 1TUBB
chains in the Genus database with same CATH topology
3LYBA 2UYNA 1COMA 2UYNB 2UYKA 3M1XA 3GTZA 2CW4A 1DBFA 5HP7A 2EWCA 3QUWA 1QU9A 3ZO8A 4ZK7A 3K12A 3D01A 3I3FA 3K0TA 2IG8A 2CVLA 5HP8A 1JD1A 2UYPA 2CHSA 3MQWA 1FNKA 2UYJA 2OTMA 3VCZA 3KJJA 3I7TA 3L7QA 1QAHA 2DYYA 1X25A 2B33A 2CSLA 1QD9A 1XRGA 1FNJA 3LMEA 3R0PA 1PF5A 1ODEA 1ONIA 4NWOB 2CWJA 2CHTA 1NQ3A 3ZP7A 3V4DA 3ZP4A 1UI9A 1XHOA 1J7HA 1UFYA 3ZOPA 3KJKA 3M4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYB A;  2UYN A;  1COM A;  2UYN B;  2UYK A;  3M1X A;  3GTZ A;  2CW4 A;  1DBF A;  5HP7 A;  2EWC A;  3QUW A;  1QU9 A;  3ZO8 A;  4ZK7 A;  3K12 A;  3D01 A;  3I3F A;  3K0T A;  2IG8 A;  2CVL A;  5HP8 A;  1JD1 A;  2UYP A;  2CHS A;  3MQW A;  1FNK A;  2UYJ A;  2OTM A;  3VCZ A;  3KJJ A;  3I7T A;  3L7Q A;  1QAH A;  2DYY A;  1X25 A;  2B33 A;  2CSL A;  1QD9 A;  1XRG A;  1FNJ A;  3LME A;  3R0P A;  1PF5 A;  1ODE A;  1ONI A;  4NWO B;  2CWJ A;  2CHT A;  1NQ3 A;  3ZP7 A;  3V4D A;  3ZP4 A;  1UI9 A;  1XHO A;  1J7H A;  1UFY A;  3ZOP A;  3KJK A;  3M4S A; 
#chains in the Genus database with same CATH topology
 3J80 M;  4G4V A;  5CA1 B;  1GO1 A;  1DBF A;  3WJR A;  4YJ2 A;  1VQ6 F;  1YGY A;  2Z01 A;  3E20 B;  5JQG A;  5JH7 A;  4EB6 A;  3HKC A;  2BTO A;  3TD3 A;  3G71 F;  4RHA A;  5EYP A;  3NVK E;  1SDS A;  1T0K B;  3I56 F;  1RQ2 A;  2F9Z C;  4E6E A;  3LWP C;  4LNU A;  4TZZ A;  3JAR B;  4ZHY B;  4FFB A;  5EB0 A;  1K73 H;  1Z5W A;  3RA6 A;  4IHJ B;  1JFF A;  5LP6 B;  1YJ9 F;  1KD1 H;  4XCQ A;  2LCA A;  5IJ9 B;  1X7P A;  3HKD A;  5FNV A;  4ZOL B;  3RYI B;  2PHN A;  1KNK A;  1VK3 A;  3IKE A;  4EI9 A;  3CCV F;  2HRY A;  1VQ5 F;  4ZI7 B;  3JAW B;  3ELC A;  3B6N A;  3S0W A;  3JAM M;  2G9I A;  4I55 A;  3K2X A;  2OHW A;  3V4D A;  3SIV A;  1Q8R A;  3RYH B;  3N2K A;  3DDN A;  1W58 1;  4I50 A;  1COM A;  4G4X A;  3RA5 A;  4KWE A;  1RLU A;  2VAW A;  2JNB A;  4ZHV A;  2RHO A;  3QUW A;  4YJ3 A;  2KTV A;  3M84 A;  4G4Z A;  2IAF A;  1TVK A;  4X1K B;  1JY8 A;  5J2T A;  1U3P A;  2KG4 A;  2K1S A;  4TUY A;  3MQW A;  4B45 A;  4TV8 A;  2P6Y A;  3OBW A;  2HVY D;  1VQP F;  3FFM A;  3LWR C;  4C4W C;  1XRG A;  3P10 A;  3JAS A;  3EOR A;  3FD5 A;  4X3L A;  4O4L A;  3CB2 A;  1FFX B;  3CCU F;  3ZP4 A;  1W5B A;  5GIP C;  2QTP A;  1SZQ A;  4TV9 B;  2ZAU A;  2DT4 A;  2VAM A;  2H6L A;  2KGW A;  3C9T A;  2RHL A;  3F0G A;  1K8A H;  5IYZ A;  5HY2 A;  5GON A;  5EWR A;  3D01 A;  3C9S A;  3CCQ F;  1CLI A;  5HP8 A;  2H8C A;  4HNA B;  4LCK A;  5EB1 B;  1YQN A;  4WBN A;  3LWQ C;  1ZWZ A;  3HWU A;  5G4U C;  1PF5 A;  5HXU A;  1UI9 A;  1VHA A;  1KNJ A;  3I55 F;  3CYQ A;  5ITZ A;  1VH8 A;  2ZVZ A;  3WJP A;  3SIU A;  1YJW F;  2AIF A;  3OBY A;  4ZHQ B;  3CME F;  3CC7 F;  4O4L B;  1JD1 A;  5JVD B;  1VQV A;  2QI2 A;  5HY1 A;  1R1M A;  4X1I B;  1X52 A;  4I4T B;  3K14 A;  3CCL F;  2DYY A;  2HQS C;  5FJ4 C;  2VAP A;  3CYP B;  3U0O A;  3WGN A;  1JJ2 F;  3VYU C;  3ZP7 A;  3WGM A;  4PWT A;  4X20 A;  1VQN F;  1W5A A;  5GIN C;  3VIU A;  4NUT A;  2OTL F;  1GO0 A;  3S02 A;  4C8G A;  3WGJ A;  3E1Y A;  1W2B F;  3RYH A;  3MCQ A;  5BMV B;  2CVL A;  1W59 A;  3KHN A;  1W42 A;  2W8B C;  1FSZ A;  3JAW A;  1IV4 A;  3VCZ A;  3WPW A;  4BVS A;  3N2G B;  2FGY A;  2VXY A;  1FNJ A;  2LBT A;  5LYJ A;  3IMP A;  5EIB D;  4ZOL A;  3RYI A;  1H47 A;  3NK7 A;  1NQ3 A;  3LFO A;  5FNV B;  4DRX B;  3HKD B;  1Q7Y H;  3D54 A;  5IJ9 A;  3KJK A;  5KMG A;  3LYB A;  3RE3 A;  4IHJ A;  4O4I A;  3M1X A;  3GTZ A;  2CW4 A;  5KX5 B;  4FFB B;  2Q1Y A;  2VGN A;  3VO8 A;  2BO1 A;  3HKB B;  3JAR A;  2LBW A;  2LBX A;  4RQO A;  3ERN A;  3WPX A;  2R6R 1;  4BVQ A;  1VQK F;  5IT9 M;  1SA0 B;  2Z1T A;  1DT9 A;  2UZH A;  3KE1 A;  4EB6 B;  5JH7 B;  1N8R H;  1VQ8 F;  1XV2 A;  3UT5 B;  3DC2 A;  4BT4 A;  1NJI H;  3MBM A;  1Q82 H;  1W5E A;  3CPW F;  1VQ9 F;  4ZHW A;  5CA1 A;  3CXC F;  3CCR F;  1VQM F;  2UYK A;  4IIJ B;  3CG6 A;  2OZB A;  4O4J B;  3RYC B;  5LXT A;  2AMT A;  4G4W A;  4O2B A;  5MN6 A;  3QTY A;  2UYJ A;  4B5C A;  3KJJ A;  3UT5 A;  4EI8 A;  1S72 F;  1QAH A;  2ZF8 A;  2GVI A;  2BTU A;  1SA0 A;  3GYQ A;  3ZOP A;  2Z1U A;  2I6R A;  1Z5V A;  3NMU C;  3HKB A;  2AIZ P;  2R75 1;  3IR9 A;  4M8I A;  2HS3 A;  3FBA A;  5KX5 A;  3CC2 F;  4ZK7 A;  4X1Y B;  3QHD A;  2KTU A;  4O4I B;  4BW0 B;  5HY0 A;  1VQ4 F;  3PLA C;  3VYS C;  1YJN F;  3F0D A;  5KMG B;  2GZL A;  4F6R A;  1QVF F;  3HKE A;  4DRX A;  2YYE A;  1GX1 A;  5LYJ B;  2HRU A;  1W41 A;  1X25 A;  2B33 A;  3Q8H A;  5CA0 A;  3V3T A;  3S03 A;  3N2G A;  3JCM M;  1Q81 H;  2L26 A;  5MN4 A;  1KQS F;  2RHH A;  5IJ0 B;  2OTJ F;  1YIJ F;  5J2U B;  5EO3 A;  5LA6 A;  3N4Y A;  2QA4 F;  2H8E A;  2UYN A;  5BMV A;  5C8Y A;  4C8E A;  2PMP A;  4BT2 A;  3CCJ F;  3LDT A;  3CC4 F;  3V7Q A;  4X20 B;  2HS4 A;  1U3L A;  2N48 A;  1W40 A;  5JCO A;  3T80 A;  1X7O A;  3S0H A;  1H48 A;  3F6M A;  3C8L A;  1W55 A;  1RA4 A;  3LME A;  3R0P A;  4I4T A;  3VI6 A;  1ODE A;  4X1I A;  5GIO C;  2I6D A;  4BT6 A;  5GAP K;  2NMU A;  1QVG F;  5JVD A;  4ZHQ A;  2HP3 A;  4BVT A;  5B8F A;  5MN5 A;  3VMF B;  5ITZ B;  3CMA F;  3K12 A;  3VYT C;  1IV3 A;  5EZY B;  1E7K A;  4BY9 D;  3FPI A;  4G4Y A;  3HJW C;  4U39 A;  2IQQ A;  1U40 A;  3AGK A;  4O2A A;  5EAZ A;  3RYF B;  2VGM A;  4WBN B;  4BT7 A;  1OAP A;  3ESJ A;  4HNA A;  3HTN A;  1UFY A;  5HY4 A;  1H7M A;  3KIZ A;  1M90 H;  5GON B;  4U3J A;  4O4H A;  2HP0 B;  3JAK A;  3E22 A;  4BT5 A;  5IYZ B;  3D00 A;  2YXZ A;  2IG8 A;  5LP6 C;  1JN1 A;  3O85 A;  4TV9 A;  3CD6 F;  3JAT A;  1FFX A;  2ZOD A;  5CB4 B;  5CB4 A;  5EIB C;  3L7Q A;  3OW2 F;  3JAS B;  3VOA A;  4B62 A;  3JAT B;  1CK2 A;  1W3E X;  3VOB A;  4TV8 B;  2CHT A;  3ON1 A;  2GLZ A;  4TUY B;  3E22 B;  2HP0 A;  3JAK B;  1J7H A;  2Z1E A;  4O4H B;  4U3J B;  3JVH A;  4BT3 A;  5J2T B;  1TVK B;  4X1K A;  5G4V C;  4YJ3 B;  1GZ0 A;  1M1K H;  3C9U A;  3J7A R;  5A2Q M;  3CCM F;  3MDO A;  3I3F A;  4I50 B;  3IEW A;  3IEQ A;  4C81 A;  3RYF A;  3N2K B;  5HWE A;  4NQ3 A;  4O2A B;  3NK6 A;  1FNK A;  3V7E A;  1VQ7 F;  4I55 B;  1VQL F;  3N4Z A;  4ZI7 A;  3WGL A;  2FC3 A;  5EZY A;  4NWO B;  3S06 A;  3TD5 A;  2ZVY A;  3C9R A;  5FLX M;  5JCO C;  3M4S A;  3GHZ A;  2MQE A;  3PAF A;  1RLG A;  2EWC A;  3P0Z A;  2BTQ B;  3VTI C;  2ALE A;  3K0T A;  1JFF B;  5LP6 A;  5GAN K;  2UYP A;  1NMU B;  3S0Y A;  1RQ7 A;  5HXZ A;  2OTM A;  3CCE F;  1K9M H;  4LNU B;  1QD9 A;  2CZW A;  3LWO C;  3CCS F;  5EYP B;  1YI2 F;  4EI7 A;  3HKC B;  1PXW A;  1XHO A;  5C8Y B;  3OON A;  1XBI A;  5JQG B;  2UYN B;  3G4S F;  5LA6 B;  1YHQ F;  4X3M A;  5J2U A;  4YJ2 B;  5HP7 A;  3WXM B;  5IJ0 A;  1T0A A;  5DCV A;  2V9Y A;  3LWV C;  2Z1F A;  1TUB A;  1VQO F;  1U43 A;  5CA0 B;  5AVM A;  3TD4 A;  1W57 A;  1IV2 A;  3HAX D;  3WGK A;  2CHS A;  2QEX F;  3MCA B;  3IKF A;  3I7T A;  4G88 A;  2RB9 A;  3HKE B;  4F6R B;  3F0E A;  3WJQ A;  1Q86 H;  2CWJ A;  4X1Y A;  1CN7 A;  2Q1X A;  3JAL A;  2ZOV A;  4ERH A;  4R40 B;  2RHJ A;  1OFU A;  5LOV A;  1QU9 A;  3ZO8 A;  5LOV B;  3CPQ A;  3J81 M;  4BVR A;  1IPA A;  3G6E F;  1YIT F;  3JAL B;  3BYQ A;  4O2B B;  4C82 A;  2WAL A;  2CSL A;  1W5F A;  2HX0 A;  2HS0 A;  5LXT B;  3P4E A;  3RYC A;  1KC8 H;  4C8I A;  1ONI A;  3F0F A;  3FD6 A;  4O4J A;  4B46 A;  4IIJ A;  1IV1 A;  3NVI B;  4DXD A;  1TUB B; 
#chains in the Genus database with same CATH homology
 3LYB A;  2UYN A;  1COM A;  2UYN B;  2UYK A;  3M1X A;  3GTZ A;  2CW4 A;  1DBF A;  5HP7 A;  2EWC A;  3QUW A;  1QU9 A;  3ZO8 A;  4ZK7 A;  3K12 A;  3D01 A;  3I3F A;  3K0T A;  2IG8 A;  2CVL A;  5HP8 A;  1JD1 A;  2UYP A;  2CHS A;  3MQW A;  1FNK A;  2UYJ A;  2OTM A;  3VCZ A;  3KJJ A;  3I7T A;  3L7Q A;  1QAH A;  2DYY A;  1X25 A;  2B33 A;  2CSL A;  1QD9 A;  1XRG A;  1FNJ A;  3LME A;  3R0P A;  1PF5 A;  1ODE A;  1ONI A;  4NWO B;  2CWJ A;  2CHT A;  1NQ3 A;  3ZP7 A;  3V4D A;  3ZP4 A;  1UI9 A;  1XHO A;  1J7H A;  1UFY A;  3ZOP A;  3KJK A;  3M4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...