3VCZA

1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
127
Chain Sequence
TKVLHTDSAPAAIGPYIQGVDLGNMVLTSGQIPVNPATGEVPADIAAQARQSLDNVKAVVEASGLTVGDIVKMTVFVKDLNDFGTVNEVYGNFFDEHNVAHYPARSCVEVARLPKDVGIEIEAIAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease L-PSP
publication title 1.80 Angstrom resolution crystal structure of a putative translation initiation inhibitor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Translation
total genus 37
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3vczA00
2UYNB 3ZO8A 3I7TA 4ZK7A 3K12A 3QUWA 4NWOB 3V4DA 1XHOA 3GTZA 3ZOPA 1UFYA 2CHTA 2IG8A 2CHSA 1JD1A 2OTMA 2B33A 1QD9A 2UYKA 1ONIA 1PF5A 1XRGA 2CWJA 3D01A 3M4SA 1DBFA 3M1XA 2EWCA 3LYBA 3VCZA 1FNJA 2UYPA 2CW4A 1COMA 3LMEA 1X25A 1FNKA 2DYYA 3I3FA 1QAHA 2CVLA 1UI9A 5HP8A 3ZP7A 1ODEA 1NQ3A 3KJJA 3L7QA 3R0PA 2UYNA 5HP7A 1J7HA 3ZP4A 3K0TA 3KJKA 2UYJA 3MQWA 1QU9A 2CSLA
chains in the Genus database with same CATH superfamily
5HY1A 3NK6A 3HKEB 5C8YA 1JFFA 3IEWA 3RA5A 5GIOC 4HNAA 5HXUA 1JD1A 2OTMA 4C8GA 4WBNA 5LYJA 3LYBA 1VQOF 5C8YB 2CW4A 1JFFB 4B62A 1X25A 3JAWA 3LWQC 4HNAB 3F6MA 2GVIA 4WBNB 2CVLA 3KE1A 2KTVA 3WJQA 5LYJB 5IJ9A 3CYPB 4O4HA 2P6YA 1VQ7F 5HP7A 3LWPC 5EWRA 3JAWB 3CPQA 1W41A 2RHOA 3CC7F 1W55A 4DXDA 5JQGA 5KX5A 3WGNA 3PLAC 4I50A 5IJ9B 3BYQA 2HQSC 4O4HB 1SZQA 3JASA 3D00A 1YJ9F 4NWOB 3QUWA 1YI2F 4O2BA 5JQGB 5KX5B 3GTZA 4I50B 2QA4F 1M1KH 3VO8A 3JASB 3T80A 3RYHA 2OTLF 1S72F 3TD4A 1H47A 3HKDA 5JH7A 1FNKA 3WJPA 2PMPA 5MN4A 2FGYA 5IJ0A 4ZHQB 1CN7A 3RYHB 3CMAF 3HKDB 3OONA 4X1KA 1IV1A 2ALEA 2V9YA 3JAKA 5IJ0B 1T0AA 4G4YA 1U43A 2WALA 4X1KB 3JAKB 1W57A 2R6R1 3WJRA 1XRGA 2LBTA 2LBXA 2Z1UA 3P10A 1FNJA 3S0YA 2VAWA 2DYYA 3B6NA 4TUYA 5BMVA 2RHHA 3E20B 5A2QM 5GANK 4U3JA 2H6LA 3MCAB 2W8BC 4TUYB 3RYIB 2L26A 3IKEA 3N2GA 4O4LA 4G88A 5BMVB 3ZP4A 1VQMF 3RYFA 3JATA 4NQ3A 4BVTA 2DT4A 2CZWA 2Q1XA 4O4IA 1W3EX 3IR9A 3N2GB 4O4LB 5EIBD 3S06A 3VOBA 5LXTA 1K8AH 1RQ7A 3MBMA 3S0WA 3RYFB 3JATB 1R1MA 2OHWA 4LNUA 2CWJA 3D01A 5LOVA 3M84A 4I55A 5LXTB 1QAHA 3AGKA 5LOVB 1H7MA 2BO1A 4LNUB 2R751 3KJJA 4I55B 3P0ZA 1VQNF 3CC2F 3LDTA 2ZVZA 1CLIA 1W5BA 3C8LA 4BVSA 3CCJF 4IIJB 2VGNA 5HXZA 2ZODA 3C9UA 1FFXA 1NMUB 2I6DA 3KHNA 2QEXF 1K9MH 2LCAA 4X1IA 2HS3A 1Z5WA 5IYZA 4BVQA 3OW2F 1VQKF 3WGMA 1FFXB 3HKCA 3S0HA 3CCLF 3V7EA 4ZI7A 3HTNA 4X1IB 5GINC 2QI2A 3C9TA 5KMGB 3CCSF 3IMPA 1Q82H 2PHNA 4E6EA 1QU9A 3K0TA 3M4SA 3S03A 3HKCB 4ZI7B 1OAPA 3K12A 2N48A 5EIBC 3VI6A 5G4VC 5DCVA 2AIZP 4C8IA 5EB0A 3LWVC 3M1XA 2EWCA 2G9IA 3CC4F 5J2UA 5LA6A 5MN6A 3E22A 1JN1A 1ODEA 3SIUA 3OBYA 1Q8RA 5J2UB 5LA6B 3FBAA 3E22B 1YHQF 3V3TA 3F0DA 3G71F 4G4XA 5EO3A 2BTOA 4I4TB 5EYPA 3MDOA 1FSZA 4KWEA 2BTQB 2Z1FA 4PWTA 3V7QA 2OTJF 4ZHQA 2AMTA 1GO1A 2ZOVA 1JJ2F 4BY9D 4B45A 5EYPB 2HRUA 2GLZA 3CD6F 2Z1TA 5FNVB 5HY0A 4ZOLA 3EORA 1T0KB 1Z5VA 3UT5A 5HY2A 3P4EA 4ZOLB 5AVMA 4ZK7A 4LCKA 1VQ6F 3UT5B 5J2TA 4BW0B 4C8EA 2VAPA 5GONA 1GZ0A 1VK3A 3CMEF 2OZBA 5J2TB 2HVYD 5FLXM 3F0GA 1QVGF 3RYIA 1UI9A 2VGMA 5GONB 3ZP7A 3NVIB 3L7QA 3DC2A 1IV2A 1W2BF 2GZLA 2MQEA 3ERNA 3RYCA 1U40A 2BTUA 1X7OA 1VH8A 1IV4A 3NK7A 3I56F 1RQ2A 2K1SA 2KG4A 3RYCB 3J80M 1M90H 3ZOPA 2IG8A 1RA4A 5B8FA 3ON1A 3S02A 1PF5A 2Z1EA 1U3LA 1ZWZA 4R40B 1VHAA 2HRYA 1N8RH 1GO0A 1Q86H 3LMEA 4BT6A 1K73H 3IKFA 2H8EA 1Q7YH 4C81A 4YJ2A 1J7HA 3RE3A 3CCEF 4TZZA 1SDSA 1KNKA 3G6EF 3KJKA 3O85A 4IIJA 1OFUA 3CG6A 3HKBB 4YJ2B 5MN5A 4YJ3A 3J7AR 1KQSF 4B46A 3WGLA 3QHDA 4ERHA 5JCOC 3LWRC 1QD9A 1ONIA 3JVHA 3JCMM 3KIZA 1YJWF 3NMUC 1PXWA 4YJ3B 2UYPA 5JCOA 4DRXA 2ZF8A 4ZHWA 3I3FA 3VYTC 5HP8A 5KMGA 5G4UC 3F0EA 1TUBA 2ZAUA 4M8IA 1GX1A 4DRXB 4EI9A 3CCQF 1VQ8F 4G4ZA 3JARA 1TUBB 2JNBA 2QTPA 4X1YA 1RLUA 2Z01A 3CYQA 1RLGA 1XV2A 2LBWA 1KC8H 4G4WA 3JARB 3TD5A 3K14A 4X3MA 3G4SF 4X1YB 2FC3A 1COMA 1X7PA 3HWUA 2ZVYA 3JALA 2HP0B 3CCMF 3VYSC 2NMUA 3LFOA 4BT2A 3VOAA 3JALB 1TVKA 3VYUC 4BT5A 4EB6A 3F0FA 3C9SA 4I4TA 5ITZB 3ZO8A 2HX0A 4FFBA 5CA0A 4O2AA 3CCRF 1TVKB 1VQ9F 3FD5A 3CCUF 4EB6B 4ZHYB 3HAXD 3SIVA 1VQ4F 4FFBB 1DBFA 5CA0B 5FNVA 5GAPK 4O2AB 2F9ZC 5EZYA 4BT4A 1Q81H 3FD6A 4XCQA 4F6RA 3NVKE 3LWOC 2RHJA 4C82A 2YYEA 3C9RA 5EZYB 4F6RB 3U0OA 3MQWA 3V4DA 3N2KA 1VQPF 1SA0A 3CPWF 5HY4A 1XHOA 3JAMM 2CHTA 2HP3A 3N2KB 2B33A 1SA0B 1YGYA 3I55F 1YJNF 1W40A 4O2BB 3HJWC 1W5EA 1W42A 3VTIC 1CK2A 2VAMA 5EB1B 4X3LA 3GYQA 5JH7B 3MCQA 2VXYA 5CA1A 2UYJA 5JVDA 5FJ4C 1U3PA 3WPWA 5CA1B 4EI7A 4BT7A 5JVDB 1UFYA 4B5CA 1IV3A 2CHSA 2UYKA 2KGWA 3FFMA 4BT3A 1KD1H 4EI8A 1W5AA 3ESJA 3VCZA 3WPXA 4X20A 5EAZA 2HS4A 4C4WC 4O4JA 1NQ3A 1X52A 2UYNA 4G4VA 1YIJF 4X20B 1XBIA 2IAFA 3FPIA 3HKBA 4U3JB 3N4YA 4O4JB 3R0PA 2UYNB 1JY8A 3N4ZA 1VQLF 1NJIH 3RA6A 4RHAA 3ELCA 4ZHVA 5IT9M 4TV9A 3J81M 1YITF 1KNJA 2Q1YA 2KTUA 4O4IB 1DT9A 5HWEA 4NUTA 3WGKA 5LP6C 2IQQA 3D54A 4TV9B 1H48A 1E7KA 5CB4A 5LP6A 2UZHA 3IEQA 3Q8HA 4U39A 4TV8A 2RHLA 4BVRA 2AIFA 3WXMB 1W581 5CB4B 2CSLA 5LP6B 3K2XA 5GIPC 3I7TA 4TV8B 3CCVF 3CB2A 3VIUA 3OBWA 1W59A 3TD3A 2HP0A 1VQ5F 3WGJA 3GHZA 3PAFA 3VMFB 1QVFF 1W5FA 3CXCF 2RB9A 4IHJA 1VQVA 3DDNA 1YQNA 1IPAA 5ITZA 4RQOA 2I6RA 3E1YA 2YXZA 3HKEA 3QTYA 5IYZB 4IHJB 2H8CA 2HS0A
chains in the Genus database with same CATH topology
2UYNB 3ZO8A 3I7TA 4ZK7A 3K12A 3QUWA 4NWOB 3V4DA 1XHOA 3GTZA 3ZOPA 1UFYA 2CHTA 2IG8A 2CHSA 1JD1A 2OTMA 2B33A 1QD9A 2UYKA 1ONIA 1PF5A 1XRGA 2CWJA 3D01A 3M4SA 1DBFA 3M1XA 2EWCA 3LYBA 3VCZA 1FNJA 2UYPA 2CW4A 1COMA 3LMEA 1X25A 1FNKA 2DYYA 3I3FA 1QAHA 2CVLA 1UI9A 5HP8A 3ZP7A 1ODEA 1NQ3A 3KJJA 3L7QA 3R0PA 2UYNA 5HP7A 1J7HA 3ZP4A 3K0TA 3KJKA 2UYJA 3MQWA 1QU9A 2CSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYN B;  3ZO8 A;  3I7T A;  4ZK7 A;  3K12 A;  3QUW A;  4NWO B;  3V4D A;  1XHO A;  3GTZ A;  3ZOP A;  1UFY A;  2CHT A;  2IG8 A;  2CHS A;  1JD1 A;  2OTM A;  2B33 A;  1QD9 A;  2UYK A;  1ONI A;  1PF5 A;  1XRG A;  2CWJ A;  3D01 A;  3M4S A;  1DBF A;  3M1X A;  2EWC A;  3LYB A;  3VCZ A;  1FNJ A;  2UYP A;  2CW4 A;  1COM A;  3LME A;  1X25 A;  1FNK A;  2DYY A;  3I3F A;  1QAH A;  2CVL A;  1UI9 A;  5HP8 A;  3ZP7 A;  1ODE A;  1NQ3 A;  3KJJ A;  3L7Q A;  3R0P A;  2UYN A;  5HP7 A;  1J7H A;  3ZP4 A;  3K0T A;  3KJK A;  2UYJ A;  3MQW A;  1QU9 A;  2CSL A; 
#chains in the Genus database with same CATH topology
 5HY1 A;  3NK6 A;  3HKE B;  5C8Y A;  1JFF A;  3IEW A;  3RA5 A;  5GIO C;  4HNA A;  5HXU A;  1JD1 A;  2OTM A;  4C8G A;  4WBN A;  5LYJ A;  3LYB A;  1VQO F;  5C8Y B;  2CW4 A;  1JFF B;  4B62 A;  1X25 A;  3JAW A;  3LWQ C;  4HNA B;  3F6M A;  2GVI A;  4WBN B;  2CVL A;  3KE1 A;  2KTV A;  3WJQ A;  5LYJ B;  5IJ9 A;  3CYP B;  4O4H A;  2P6Y A;  1VQ7 F;  5HP7 A;  3LWP C;  5EWR A;  3JAW B;  3CPQ A;  1W41 A;  2RHO A;  3CC7 F;  1W55 A;  4DXD A;  5JQG A;  5KX5 A;  3WGN A;  3PLA C;  4I50 A;  5IJ9 B;  3BYQ A;  2HQS C;  4O4H B;  1SZQ A;  3JAS A;  3D00 A;  1YJ9 F;  4NWO B;  3QUW A;  1YI2 F;  4O2B A;  5JQG B;  5KX5 B;  3GTZ A;  4I50 B;  2QA4 F;  1M1K H;  3VO8 A;  3JAS B;  3T80 A;  3RYH A;  2OTL F;  1S72 F;  3TD4 A;  1H47 A;  3HKD A;  5JH7 A;  1FNK A;  3WJP A;  2PMP A;  5MN4 A;  2FGY A;  5IJ0 A;  4ZHQ B;  1CN7 A;  3RYH B;  3CMA F;  3HKD B;  3OON A;  4X1K A;  1IV1 A;  2ALE A;  2V9Y A;  3JAK A;  5IJ0 B;  1T0A A;  4G4Y A;  1U43 A;  2WAL A;  4X1K B;  3JAK B;  1W57 A;  2R6R 1;  3WJR A;  1XRG A;  2LBT A;  2LBX A;  2Z1U A;  3P10 A;  1FNJ A;  3S0Y A;  2VAW A;  2DYY A;  3B6N A;  4TUY A;  5BMV A;  2RHH A;  3E20 B;  5A2Q M;  5GAN K;  4U3J A;  2H6L A;  3MCA B;  2W8B C;  4TUY B;  3RYI B;  2L26 A;  3IKE A;  3N2G A;  4O4L A;  4G88 A;  5BMV B;  3ZP4 A;  1VQM F;  3RYF A;  3JAT A;  4NQ3 A;  4BVT A;  2DT4 A;  2CZW A;  2Q1X A;  4O4I A;  1W3E X;  3IR9 A;  3N2G B;  4O4L B;  5EIB D;  3S06 A;  3VOB A;  5LXT A;  1K8A H;  1RQ7 A;  3MBM A;  3S0W A;  3RYF B;  3JAT B;  1R1M A;  2OHW A;  4LNU A;  2CWJ A;  3D01 A;  5LOV A;  3M84 A;  4I55 A;  5LXT B;  1QAH A;  3AGK A;  5LOV B;  1H7M A;  2BO1 A;  4LNU B;  2R75 1;  3KJJ A;  4I55 B;  3P0Z A;  1VQN F;  3CC2 F;  3LDT A;  2ZVZ A;  1CLI A;  1W5B A;  3C8L A;  4BVS A;  3CCJ F;  4IIJ B;  2VGN A;  5HXZ A;  2ZOD A;  3C9U A;  1FFX A;  1NMU B;  2I6D A;  3KHN A;  2QEX F;  1K9M H;  2LCA A;  4X1I A;  2HS3 A;  1Z5W A;  5IYZ A;  4BVQ A;  3OW2 F;  1VQK F;  3WGM A;  1FFX B;  3HKC A;  3S0H A;  3CCL F;  3V7E A;  4ZI7 A;  3HTN A;  4X1I B;  5GIN C;  2QI2 A;  3C9T A;  5KMG B;  3CCS F;  3IMP A;  1Q82 H;  2PHN A;  4E6E A;  1QU9 A;  3K0T A;  3M4S A;  3S03 A;  3HKC B;  4ZI7 B;  1OAP A;  3K12 A;  2N48 A;  5EIB C;  3VI6 A;  5G4V C;  5DCV A;  2AIZ P;  4C8I A;  5EB0 A;  3LWV C;  3M1X A;  2EWC A;  2G9I A;  3CC4 F;  5J2U A;  5LA6 A;  5MN6 A;  3E22 A;  1JN1 A;  1ODE A;  3SIU A;  3OBY A;  1Q8R A;  5J2U B;  5LA6 B;  3FBA A;  3E22 B;  1YHQ F;  3V3T A;  3F0D A;  3G71 F;  4G4X A;  5EO3 A;  2BTO A;  4I4T B;  5EYP A;  3MDO A;  1FSZ A;  4KWE A;  2BTQ B;  2Z1F A;  4PWT A;  3V7Q A;  2OTJ F;  4ZHQ A;  2AMT A;  1GO1 A;  2ZOV A;  1JJ2 F;  4BY9 D;  4B45 A;  5EYP B;  2HRU A;  2GLZ A;  3CD6 F;  2Z1T A;  5FNV B;  5HY0 A;  4ZOL A;  3EOR A;  1T0K B;  1Z5V A;  3UT5 A;  5HY2 A;  3P4E A;  4ZOL B;  5AVM A;  4ZK7 A;  4LCK A;  1VQ6 F;  3UT5 B;  5J2T A;  4BW0 B;  4C8E A;  2VAP A;  5GON A;  1GZ0 A;  1VK3 A;  3CME F;  2OZB A;  5J2T B;  2HVY D;  5FLX M;  3F0G A;  1QVG F;  3RYI A;  1UI9 A;  2VGM A;  5GON B;  3ZP7 A;  3NVI B;  3L7Q A;  3DC2 A;  1IV2 A;  1W2B F;  2GZL A;  2MQE A;  3ERN A;  3RYC A;  1U40 A;  2BTU A;  1X7O A;  1VH8 A;  1IV4 A;  3NK7 A;  3I56 F;  1RQ2 A;  2K1S A;  2KG4 A;  3RYC B;  3J80 M;  1M90 H;  3ZOP A;  2IG8 A;  1RA4 A;  5B8F A;  3ON1 A;  3S02 A;  1PF5 A;  2Z1E A;  1U3L A;  1ZWZ A;  4R40 B;  1VHA A;  2HRY A;  1N8R H;  1GO0 A;  1Q86 H;  3LME A;  4BT6 A;  1K73 H;  3IKF A;  2H8E A;  1Q7Y H;  4C81 A;  4YJ2 A;  1J7H A;  3RE3 A;  3CCE F;  4TZZ A;  1SDS A;  1KNK A;  3G6E F;  3KJK A;  3O85 A;  4IIJ A;  1OFU A;  3CG6 A;  3HKB B;  4YJ2 B;  5MN5 A;  4YJ3 A;  3J7A R;  1KQS F;  4B46 A;  3WGL A;  3QHD A;  4ERH A;  5JCO C;  3LWR C;  1QD9 A;  1ONI A;  3JVH A;  3JCM M;  3KIZ A;  1YJW F;  3NMU C;  1PXW A;  4YJ3 B;  2UYP A;  5JCO A;  4DRX A;  2ZF8 A;  4ZHW A;  3I3F A;  3VYT C;  5HP8 A;  5KMG A;  5G4U C;  3F0E A;  1TUB A;  2ZAU A;  4M8I A;  1GX1 A;  4DRX B;  4EI9 A;  3CCQ F;  1VQ8 F;  4G4Z A;  3JAR A;  1TUB B;  2JNB A;  2QTP A;  4X1Y A;  1RLU A;  2Z01 A;  3CYQ A;  1RLG A;  1XV2 A;  2LBW A;  1KC8 H;  4G4W A;  3JAR B;  3TD5 A;  3K14 A;  4X3M A;  3G4S F;  4X1Y B;  2FC3 A;  1COM A;  1X7P A;  3HWU A;  2ZVY A;  3JAL A;  2HP0 B;  3CCM F;  3VYS C;  2NMU A;  3LFO A;  4BT2 A;  3VOA A;  3JAL B;  1TVK A;  3VYU C;  4BT5 A;  4EB6 A;  3F0F A;  3C9S A;  4I4T A;  5ITZ B;  3ZO8 A;  2HX0 A;  4FFB A;  5CA0 A;  4O2A A;  3CCR F;  1TVK B;  1VQ9 F;  3FD5 A;  3CCU F;  4EB6 B;  4ZHY B;  3HAX D;  3SIV A;  1VQ4 F;  4FFB B;  1DBF A;  5CA0 B;  5FNV A;  5GAP K;  4O2A B;  2F9Z C;  5EZY A;  4BT4 A;  1Q81 H;  3FD6 A;  4XCQ A;  4F6R A;  3NVK E;  3LWO C;  2RHJ A;  4C82 A;  2YYE A;  3C9R A;  5EZY B;  4F6R B;  3U0O A;  3MQW A;  3V4D A;  3N2K A;  1VQP F;  1SA0 A;  3CPW F;  5HY4 A;  1XHO A;  3JAM M;  2CHT A;  2HP3 A;  3N2K B;  2B33 A;  1SA0 B;  1YGY A;  3I55 F;  1YJN F;  1W40 A;  4O2B B;  3HJW C;  1W5E A;  1W42 A;  3VTI C;  1CK2 A;  2VAM A;  5EB1 B;  4X3L A;  3GYQ A;  5JH7 B;  3MCQ A;  2VXY A;  5CA1 A;  2UYJ A;  5JVD A;  5FJ4 C;  1U3P A;  3WPW A;  5CA1 B;  4EI7 A;  4BT7 A;  5JVD B;  1UFY A;  4B5C A;  1IV3 A;  2CHS A;  2UYK A;  2KGW A;  3FFM A;  4BT3 A;  1KD1 H;  4EI8 A;  1W5A A;  3ESJ A;  3VCZ A;  3WPX A;  4X20 A;  5EAZ A;  2HS4 A;  4C4W C;  4O4J A;  1NQ3 A;  1X52 A;  2UYN A;  4G4V A;  1YIJ F;  4X20 B;  1XBI A;  2IAF A;  3FPI A;  3HKB A;  4U3J B;  3N4Y A;  4O4J B;  3R0P A;  2UYN B;  1JY8 A;  3N4Z A;  1VQL F;  1NJI H;  3RA6 A;  4RHA A;  3ELC A;  4ZHV A;  5IT9 M;  4TV9 A;  3J81 M;  1YIT F;  1KNJ A;  2Q1Y A;  2KTU A;  4O4I B;  1DT9 A;  5HWE A;  4NUT A;  3WGK A;  5LP6 C;  2IQQ A;  3D54 A;  4TV9 B;  1H48 A;  1E7K A;  5CB4 A;  5LP6 A;  2UZH A;  3IEQ A;  3Q8H A;  4U39 A;  4TV8 A;  2RHL A;  4BVR A;  2AIF A;  3WXM B;  1W58 1;  5CB4 B;  2CSL A;  5LP6 B;  3K2X A;  5GIP C;  3I7T A;  4TV8 B;  3CCV F;  3CB2 A;  3VIU A;  3OBW A;  1W59 A;  3TD3 A;  2HP0 A;  1VQ5 F;  3WGJ A;  3GHZ A;  3PAF A;  3VMF B;  1QVF F;  1W5F A;  3CXC F;  2RB9 A;  4IHJ A;  1VQV A;  3DDN A;  1YQN A;  1IPA A;  5ITZ A;  4RQO A;  2I6R A;  3E1Y A;  2YXZ A;  3HKE A;  3QTY A;  5IYZ B;  4IHJ B;  2H8C A;  2HS0 A; 
#chains in the Genus database with same CATH homology
 2UYN B;  3ZO8 A;  3I7T A;  4ZK7 A;  3K12 A;  3QUW A;  4NWO B;  3V4D A;  1XHO A;  3GTZ A;  3ZOP A;  1UFY A;  2CHT A;  2IG8 A;  2CHS A;  1JD1 A;  2OTM A;  2B33 A;  1QD9 A;  2UYK A;  1ONI A;  1PF5 A;  1XRG A;  2CWJ A;  3D01 A;  3M4S A;  1DBF A;  3M1X A;  2EWC A;  3LYB A;  3VCZ A;  1FNJ A;  2UYP A;  2CW4 A;  1COM A;  3LME A;  1X25 A;  1FNK A;  2DYY A;  3I3F A;  1QAH A;  2CVL A;  1UI9 A;  5HP8 A;  3ZP7 A;  1ODE A;  1NQ3 A;  3KJJ A;  3L7Q A;  3R0P A;  2UYN A;  5HP7 A;  1J7H A;  3ZP4 A;  3K0T A;  3KJK A;  2UYJ A;  3MQW A;  1QU9 A;  2CSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...