3VCZA

1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
127
Chain Sequence
b'TKVLHTDSAPAAIGPYIQGVDLGNMVLTSGQIPVNPATGEVPADIAAQARQSLDNVKAVVEASGLTVGDIVKMTVFVKDLNDFGTVNEVYGNFFDEHNVAHYPARSCVEVARLPKDVGIEIEAIAVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease L-PSP
publication title 1.80 Angstrom resolution crystal structure of a putative translation initiation inhibitor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Translation
total genus 37
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3vczA00
3QUWA 1X25A 4NWOB 2UYJA 1FNJA 3KJKA 2IG8A 3M1XA 2CSLA 3R0PA 3ZP4A 2CHTA 1UFYA 1XHOA 2CVLA 3K12A 3ZP7A 1JD1A 3GTZA 1QAHA 3V4DA 3KJJA 5HP7A 1UI9A 2EWCA 3I3FA 3LYBA 2DYYA 5HP8A 1PF5A 2UYKA 2CHSA 2UYNA 2UYNB 1QU9A 3M4SA 1COMA 2CW4A 1J7HA 3I7TA 1QD9A 3ZOPA 1XRGA 3D01A 1ODEA 2B33A 1NQ3A 2CWJA 3LMEA 2UYPA 3ZO8A 1FNKA 1DBFA 4ZK7A 3K0TA 3L7QA 3VCZA 3MQWA 2OTMA 1ONIA
chains in the Genus database with same CATH superfamily
3F0FA 1GX1A 2VGMA 2Z01A 1FNJA 4TV8B 4DRXA 1XHOA 3JASA 3G71F 1OFUA 4ZOLB 3VMFB 2YYEA 2Z1EA 3IEQA 4X3LA 3LWOC 3N2GB 1W3EX 3I3FA 1TVKA 2ZF8A 2QTPA 4ZI7A 3HKDA 3S03A 3VTIC 2JNBA 5IJ0B 3P4EA 1ODEA 2RHHA 3ESJA 3HWUA 4I4TA 2I6RA 3N2KA 4BVTA 5G4UC 2ZAUA 3K0TA 4O4IA 4YJ2A 3RE3A 4X1IA 3NVKE 3M1XA 2Z1UA 1NJIH 1W57A 3K12A 4I55A 2VAWA 1H48A 1YHQF 4RQOA 2ZVYA 4FFBA 3MCAB 3CPWF 1JFFB 2DYYA 2KG4A 5A2QM 2QA4F 4BY9D 4LNUA 2PMPA 3NK6A 3JCMM 4O4JB 3LMEA 1U3PA 5LYJB 3QHDA 5LXTA 4ZK7A 2ZOVA 3WGJA 3HKEA 2ZODA 2IQQA 3JATB 5J2TB 4C4WC 2HP0B 5EZYA 3TD4A 1CLIA 3PLAC 1GO1A 3G6EF 1VQPF 3N4ZA 1H47A 5LP6B 1VQMF 5ITZA 2HP3A 1SA0B 5JCOA 1M90H 4X1KA 1OAPA 4EB6A 5FJ4C 5EYPA 5LA6A 3RYFB 4G4XA 1RQ7A 3E22A 1FSZA 3G4SF 4NWOB 5EWRA 2UYJA 2H8EA 2H8CA 3K2XA 3JAKB 2CVLA 5LOVA 1VQ6F 5G4VC 4TUYA 1JD1A 3CMAF 3RYIB 3HAXD 3V4DA 4G4YA 2HRUA 1U43A 1UI9A 3TD3A 1PF5A 3J7AR 1VHAA 4BT3A 5GIPC 4KWEA 1W2BF 3VI6A 3ZO8A 2RB9A 3N4YA 3UT5B 5GINC 1JY8A 1H7MA 1VQVA 3CYPB 3VCZA 4YJ2B 3VYTC 1CN7A 3BYQA 2PHNA 1X25A 1VQ8F 3WJQA 4HNAB 4ZHVA 3DDNA 3KHNA 2I6DA 2N48A 5GAPK 1NMUB 5C8YB 3RYCA 5CA0A 2CHSA 5EIBD 4BVRA 2Z1TA 1Q8RA 4O4HA 5GANK 3IKEA 1QD9A 1K8AH 3CG6A 5HY4A 1FNKA 1DBFA 5JVDA 3HKCA 3WGNA 4U3JB 1XV2A 3F0DA 2AIFA 5GONA 3WJRA 1CK2A 3QUWA 4WBNA 4O4LA 3HKBB 4R40B 4O2AA 1VQNF 3RYHB 3RA6A 3F0EA 2WALA 4TV9B 4G88A 2Q1YA 1YJWF 1E7KA 4IHJA 4XCQA 1FFXB 5J2UA 1YI2F 3FFMA 5CA1A 4F6RA 3CMEF 2VXYA 2UYNB 3JALB 3JARB 3JVHA 5IJ9A 4LCKA 5IYZB 1NQ3A 2F9ZC 4IIJA 3LWQC 5EYPB 2L26A 2OTMA 2HQSC 2LBTA 3CYQA 1KNJA 3CD6F 1VQ5F 3RA5A 3IEWA 4X20B 4B46A 1W5AA 4I50A 3O85A 3S02A 2P6YA 2EWCA 3LYBA 5HY2A 4BT7A 1YITF 1YGYA 2OZBA 1X52A 5FNVA 3FD5A 1W5BA 1SZQA 1XRGA 2RHLA 5HXUA 2B33A 3JAWA 1JN1A 3CCLF 1VQ7F 2NMUA 2KTUA 2UYPA 3ON1A 2R6R1 5MN5A 5IT9M 3MQWA 5FLXM 3NMUC 3V3TA 5MN6A 1Z5WA 3J81M 3C9RA 3P0ZA 4E6EA 5HY0A 4M8IA 5JQGA 1VK3A 1XBIA 5CB4B 1M1KH 1QVGF 2HS0A 1TUBB 4O2BA 4BVQA 3SIUA 5DCVA 5LP6C 5HP8A 1YJ9F 3K14A 4ZHQB 4G4ZA 5BMVB 5KMGB 1K9MH 3NVIB 1QVFF 3HJWC 3ZOPA 1VH8A 2FGYA 3U0OA 1VQ9F 4YJ3B 1W5FA 1KD1H 3CCJF 5KX5B 3DC2A 3D00A 4X1YB 4B45A 5JH7B 3F6MA 4TV8A 2CSLA 4ZHYB 1W42A 4DRXB 4ZOLA 3JASB 3Q8HA 4C81A 1IV2A 3GTZA 3JAMM 3N2GA 2BO1A 1GO0A 4BT4A 1TVKB 3S06A 2UYKA 2HS4A 2KTVA 1QU9A 3M4SA 1W59A 2CW4A 4ZI7B 3HKDB 3WGMA 5IJ0A 2HS3A 3S0WA 3SIVA 2Q1XA 4TZZA 5EB0A 4I4TB 1KC8H 4BVSA 3N2KB 1VQOF 3CC7F 4U39A 4C8EA 4O4IB 3I55F 4EI7A 4X1IB 2G9IA 3OBWA 2GVIA 1UFYA 1VQLF 1KQSF 2HVYD 1YIJF 1U3LA 4I55B 1SDSA 5EO3A 4G4WA 2QEXF 3QTYA 1JFFA 4FFBB 1Z5VA 1S72F 1J7HA 4LNUB 4ZHWA 3D01A 3C9UA 3OONA 4O4JA 1U40A 2BTUA 4NUTA 2CZWA 5JH7A 5LYJA 3V7QA 3EORA 2ALEA 2OTJF 5LXTB 3OBYA 3CCMF 5EB1B 3CCSF 3JATA 3HKEB 5J2TA 2HP0A 1W41A 3PAFA 2K1SA 5EZYB 3CXCF 3FBAA 2GZLA 1RLUA 2AIZP 3F0GA 4BW0B 5LP6A 3P10A 3IR9A 1YJNF 1IV4A 3CPQA 1ZWZA 3I7TA 2H6LA 3VOBA 1W5EA 1RLGA 1SA0A 5EIBC 5ITZB 5JCOC 2OTLF 2QI2A 3CCUF 1GZ0A 4X1KB 1T0AA 2BTQB 5HY1A 3GHZA 4B5CA 4EB6B 3RYFA 2W8BC 5LA6B 3E22B 4NQ3A 3CC4F 3ERNA 2YXZA 3JAKA 4RHAA 5LOVB 3WGLA 3RYIA 4BT6A 4TUYB 4EI9A 3M84A 3KJJA 5EAZA 3LWPC 4C82A 3OW2F 1W581 2DT4A 4C8IA 2Z1FA 4PWTA 3LWVC 3E20B 3UT5A 2FC3A 3LFOA 4BT5A 1KNKA 3LWRC 3R0PA 2BTOA 3KJKA 2CHTA 4HNAA 3NK7A 3CB2A 4BT2A 3HTNA 3AGKA 5C8YA 1Q86H 3WPWA 2LBWA 1VQ4F 3RYCB 5CA0B 4O4HB 1IV1A 2RHOA 3C9SA 5HXZA 2HRYA 3S0YA 4U3JA 4ERHA 5JVDB 3VOAA 1DT9A 3HKCB 1RA4A 2OHWA 3B6NA 5B8FA 1YQNA 5GONB 3WJPA 3HKBA 4WBNB 4O4LB 3ZP4A 4EI8A 3RYHA 4O2AB 3J80M 3ZP7A 3MCQA 4TV9A 2R751 3WXMB 2V9YA 1QAHA 3C8LA 3T80A 1FFXA 5HP7A 4IHJB 1RQ2A 5J2UB 5AVMA 3CCRF 3TD5A 5CA1B 2UYNA 3JALA 4F6RB 3IKFA 3JARA 1PXWA 3KIZA 4B62A 3V7EA 3VO8A 3IMPA 3VYSC 5IYZA 5MN4A 5IJ9B 3FPIA 3MBMA 4IIJB 3VYUC 3VIUA 1K73H 1T0KB 1R1MA 2IG8A 3C9TA 4X20A 2MQEA 4X3MA 3FD6A 2VAMA 2GLZA 4I50B 3CCVF 2LCAA 1Q82H 1IV3A 1COMA 3WGKA 2ZVZA 5FNVB 3CC2F 3I56F 2HX0A 3LDTA 3JAWB 2KGWA 3MDOA 1X7PA 1W40A 5HWEA 3CCQF 3E1YA 5JQGB 5CB4A 1X7OA 1TUBA 1IPAA 4O2BB 4ZHQA 1W55A 2VGNA 4C8GA 5BMVA 5KMGA 4DXDA 2AMTA 2UZHA 2IAFA 2LBXA 1Q7YH 3KE1A 4YJ3A 2VAPA 3D54A 3GYQA 1VQKF 2CWJA 3CCEF 1N8RH 5GIOC 2RHJA 4G4VA 3ELCA 3WPXA 1Q81H 5KX5A 3L7QA 1JJ2F 3S0HA 4X1YA 1ONIA
chains in the Genus database with same CATH topology
3QUWA 1X25A 4NWOB 2UYJA 1FNJA 3KJKA 2IG8A 3M1XA 2CSLA 3R0PA 3ZP4A 2CHTA 1UFYA 1XHOA 2CVLA 3K12A 3ZP7A 1JD1A 3GTZA 1QAHA 3V4DA 3KJJA 5HP7A 1UI9A 2EWCA 3I3FA 3LYBA 2DYYA 5HP8A 1PF5A 2UYKA 2CHSA 2UYNA 2UYNB 1QU9A 3M4SA 1COMA 2CW4A 1J7HA 3I7TA 1QD9A 3ZOPA 1XRGA 3D01A 1ODEA 2B33A 1NQ3A 2CWJA 3LMEA 2UYPA 3ZO8A 1FNKA 1DBFA 4ZK7A 3K0TA 3L7QA 3VCZA 3MQWA 2OTMA 1ONIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUW A;  1X25 A;  4NWO B;  2UYJ A;  1FNJ A;  3KJK A;  2IG8 A;  3M1X A;  2CSL A;  3R0P A;  3ZP4 A;  2CHT A;  1UFY A;  1XHO A;  2CVL A;  3K12 A;  3ZP7 A;  1JD1 A;  3GTZ A;  1QAH A;  3V4D A;  3KJJ A;  5HP7 A;  1UI9 A;  2EWC A;  3I3F A;  3LYB A;  2DYY A;  5HP8 A;  1PF5 A;  2UYK A;  2CHS A;  2UYN A;  2UYN B;  1QU9 A;  3M4S A;  1COM A;  2CW4 A;  1J7H A;  3I7T A;  1QD9 A;  3ZOP A;  1XRG A;  3D01 A;  1ODE A;  2B33 A;  1NQ3 A;  2CWJ A;  3LME A;  2UYP A;  3ZO8 A;  1FNK A;  1DBF A;  4ZK7 A;  3K0T A;  3L7Q A;  3VCZ A;  3MQW A;  2OTM A;  1ONI A; 
#chains in the Genus database with same CATH topology
 3F0F A;  1GX1 A;  2VGM A;  2Z01 A;  1FNJ A;  4TV8 B;  4DRX A;  1XHO A;  3JAS A;  3G71 F;  1OFU A;  4ZOL B;  3VMF B;  2YYE A;  2Z1E A;  3IEQ A;  4X3L A;  3LWO C;  3N2G B;  1W3E X;  3I3F A;  1TVK A;  2ZF8 A;  2QTP A;  4ZI7 A;  3HKD A;  3S03 A;  3VTI C;  2JNB A;  5IJ0 B;  3P4E A;  1ODE A;  2RHH A;  3ESJ A;  3HWU A;  4I4T A;  2I6R A;  3N2K A;  4BVT A;  5G4U C;  2ZAU A;  3K0T A;  4O4I A;  4YJ2 A;  3RE3 A;  4X1I A;  3NVK E;  3M1X A;  2Z1U A;  1NJI H;  1W57 A;  3K12 A;  4I55 A;  2VAW A;  1H48 A;  1YHQ F;  4RQO A;  2ZVY A;  4FFB A;  3MCA B;  3CPW F;  1JFF B;  2DYY A;  2KG4 A;  5A2Q M;  2QA4 F;  4BY9 D;  4LNU A;  2PMP A;  3NK6 A;  3JCM M;  4O4J B;  3LME A;  1U3P A;  5LYJ B;  3QHD A;  5LXT A;  4ZK7 A;  2ZOV A;  3WGJ A;  3HKE A;  2ZOD A;  2IQQ A;  3JAT B;  5J2T B;  4C4W C;  2HP0 B;  5EZY A;  3TD4 A;  1CLI A;  3PLA C;  1GO1 A;  3G6E F;  1VQP F;  3N4Z A;  1H47 A;  5LP6 B;  1VQM F;  5ITZ A;  2HP3 A;  1SA0 B;  5JCO A;  1M90 H;  4X1K A;  1OAP A;  4EB6 A;  5FJ4 C;  5EYP A;  5LA6 A;  3RYF B;  4G4X A;  1RQ7 A;  3E22 A;  1FSZ A;  3G4S F;  4NWO B;  5EWR A;  2UYJ A;  2H8E A;  2H8C A;  3K2X A;  3JAK B;  2CVL A;  5LOV A;  1VQ6 F;  5G4V C;  4TUY A;  1JD1 A;  3CMA F;  3RYI B;  3HAX D;  3V4D A;  4G4Y A;  2HRU A;  1U43 A;  1UI9 A;  3TD3 A;  1PF5 A;  3J7A R;  1VHA A;  4BT3 A;  5GIP C;  4KWE A;  1W2B F;  3VI6 A;  3ZO8 A;  2RB9 A;  3N4Y A;  3UT5 B;  5GIN C;  1JY8 A;  1H7M A;  1VQV A;  3CYP B;  3VCZ A;  4YJ2 B;  3VYT C;  1CN7 A;  3BYQ A;  2PHN A;  1X25 A;  1VQ8 F;  3WJQ A;  4HNA B;  4ZHV A;  3DDN A;  3KHN A;  2I6D A;  2N48 A;  5GAP K;  1NMU B;  5C8Y B;  3RYC A;  5CA0 A;  2CHS A;  5EIB D;  4BVR A;  2Z1T A;  1Q8R A;  4O4H A;  5GAN K;  3IKE A;  1QD9 A;  1K8A H;  3CG6 A;  5HY4 A;  1FNK A;  1DBF A;  5JVD A;  3HKC A;  3WGN A;  4U3J B;  1XV2 A;  3F0D A;  2AIF A;  5GON A;  3WJR A;  1CK2 A;  3QUW A;  4WBN A;  4O4L A;  3HKB B;  4R40 B;  4O2A A;  1VQN F;  3RYH B;  3RA6 A;  3F0E A;  2WAL A;  4TV9 B;  4G88 A;  2Q1Y A;  1YJW F;  1E7K A;  4IHJ A;  4XCQ A;  1FFX B;  5J2U A;  1YI2 F;  3FFM A;  5CA1 A;  4F6R A;  3CME F;  2VXY A;  2UYN B;  3JAL B;  3JAR B;  3JVH A;  5IJ9 A;  4LCK A;  5IYZ B;  1NQ3 A;  2F9Z C;  4IIJ A;  3LWQ C;  5EYP B;  2L26 A;  2OTM A;  2HQS C;  2LBT A;  3CYQ A;  1KNJ A;  3CD6 F;  1VQ5 F;  3RA5 A;  3IEW A;  4X20 B;  4B46 A;  1W5A A;  4I50 A;  3O85 A;  3S02 A;  2P6Y A;  2EWC A;  3LYB A;  5HY2 A;  4BT7 A;  1YIT F;  1YGY A;  2OZB A;  1X52 A;  5FNV A;  3FD5 A;  1W5B A;  1SZQ A;  1XRG A;  2RHL A;  5HXU A;  2B33 A;  3JAW A;  1JN1 A;  3CCL F;  1VQ7 F;  2NMU A;  2KTU A;  2UYP A;  3ON1 A;  2R6R 1;  5MN5 A;  5IT9 M;  3MQW A;  5FLX M;  3NMU C;  3V3T A;  5MN6 A;  1Z5W A;  3J81 M;  3C9R A;  3P0Z A;  4E6E A;  5HY0 A;  4M8I A;  5JQG A;  1VK3 A;  1XBI A;  5CB4 B;  1M1K H;  1QVG F;  2HS0 A;  1TUB B;  4O2B A;  4BVQ A;  3SIU A;  5DCV A;  5LP6 C;  5HP8 A;  1YJ9 F;  3K14 A;  4ZHQ B;  4G4Z A;  5BMV B;  5KMG B;  1K9M H;  3NVI B;  1QVF F;  3HJW C;  3ZOP A;  1VH8 A;  2FGY A;  3U0O A;  1VQ9 F;  4YJ3 B;  1W5F A;  1KD1 H;  3CCJ F;  5KX5 B;  3DC2 A;  3D00 A;  4X1Y B;  4B45 A;  5JH7 B;  3F6M A;  4TV8 A;  2CSL A;  4ZHY B;  1W42 A;  4DRX B;  4ZOL A;  3JAS B;  3Q8H A;  4C81 A;  1IV2 A;  3GTZ A;  3JAM M;  3N2G A;  2BO1 A;  1GO0 A;  4BT4 A;  1TVK B;  3S06 A;  2UYK A;  2HS4 A;  2KTV A;  1QU9 A;  3M4S A;  1W59 A;  2CW4 A;  4ZI7 B;  3HKD B;  3WGM A;  5IJ0 A;  2HS3 A;  3S0W A;  3SIV A;  2Q1X A;  4TZZ A;  5EB0 A;  4I4T B;  1KC8 H;  4BVS A;  3N2K B;  1VQO F;  3CC7 F;  4U39 A;  4C8E A;  4O4I B;  3I55 F;  4EI7 A;  4X1I B;  2G9I A;  3OBW A;  2GVI A;  1UFY A;  1VQL F;  1KQS F;  2HVY D;  1YIJ F;  1U3L A;  4I55 B;  1SDS A;  5EO3 A;  4G4W A;  2QEX F;  3QTY A;  1JFF A;  4FFB B;  1Z5V A;  1S72 F;  1J7H A;  4LNU B;  4ZHW A;  3D01 A;  3C9U A;  3OON A;  4O4J A;  1U40 A;  2BTU A;  4NUT A;  2CZW A;  5JH7 A;  5LYJ A;  3V7Q A;  3EOR A;  2ALE A;  2OTJ F;  5LXT B;  3OBY A;  3CCM F;  5EB1 B;  3CCS F;  3JAT A;  3HKE B;  5J2T A;  2HP0 A;  1W41 A;  3PAF A;  2K1S A;  5EZY B;  3CXC F;  3FBA A;  2GZL A;  1RLU A;  2AIZ P;  3F0G A;  4BW0 B;  5LP6 A;  3P10 A;  3IR9 A;  1YJN F;  1IV4 A;  3CPQ A;  1ZWZ A;  3I7T A;  2H6L A;  3VOB A;  1W5E A;  1RLG A;  1SA0 A;  5EIB C;  5ITZ B;  5JCO C;  2OTL F;  2QI2 A;  3CCU F;  1GZ0 A;  4X1K B;  1T0A A;  2BTQ B;  5HY1 A;  3GHZ A;  4B5C A;  4EB6 B;  3RYF A;  2W8B C;  5LA6 B;  3E22 B;  4NQ3 A;  3CC4 F;  3ERN A;  2YXZ A;  3JAK A;  4RHA A;  5LOV B;  3WGL A;  3RYI A;  4BT6 A;  4TUY B;  4EI9 A;  3M84 A;  3KJJ A;  5EAZ A;  3LWP C;  4C82 A;  3OW2 F;  1W58 1;  2DT4 A;  4C8I A;  2Z1F A;  4PWT A;  3LWV C;  3E20 B;  3UT5 A;  2FC3 A;  3LFO A;  4BT5 A;  1KNK A;  3LWR C;  3R0P A;  2BTO A;  3KJK A;  2CHT A;  4HNA A;  3NK7 A;  3CB2 A;  4BT2 A;  3HTN A;  3AGK A;  5C8Y A;  1Q86 H;  3WPW A;  2LBW A;  1VQ4 F;  3RYC B;  5CA0 B;  4O4H B;  1IV1 A;  2RHO A;  3C9S A;  5HXZ A;  2HRY A;  3S0Y A;  4U3J A;  4ERH A;  5JVD B;  3VOA A;  1DT9 A;  3HKC B;  1RA4 A;  2OHW A;  3B6N A;  5B8F A;  1YQN A;  5GON B;  3WJP A;  3HKB A;  4WBN B;  4O4L B;  3ZP4 A;  4EI8 A;  3RYH A;  4O2A B;  3J80 M;  3ZP7 A;  3MCQ A;  4TV9 A;  2R75 1;  3WXM B;  2V9Y A;  1QAH A;  3C8L A;  3T80 A;  1FFX A;  5HP7 A;  4IHJ B;  1RQ2 A;  5J2U B;  5AVM A;  3CCR F;  3TD5 A;  5CA1 B;  2UYN A;  3JAL A;  4F6R B;  3IKF A;  3JAR A;  1PXW A;  3KIZ A;  4B62 A;  3V7E A;  3VO8 A;  3IMP A;  3VYS C;  5IYZ A;  5MN4 A;  5IJ9 B;  3FPI A;  3MBM A;  4IIJ B;  3VYU C;  3VIU A;  1K73 H;  1T0K B;  1R1M A;  2IG8 A;  3C9T A;  4X20 A;  2MQE A;  4X3M A;  3FD6 A;  2VAM A;  2GLZ A;  4I50 B;  3CCV F;  2LCA A;  1Q82 H;  1IV3 A;  1COM A;  3WGK A;  2ZVZ A;  5FNV B;  3CC2 F;  3I56 F;  2HX0 A;  3LDT A;  3JAW B;  2KGW A;  3MDO A;  1X7P A;  1W40 A;  5HWE A;  3CCQ F;  3E1Y A;  5JQG B;  5CB4 A;  1X7O A;  1TUB A;  1IPA A;  4O2B B;  4ZHQ A;  1W55 A;  2VGN A;  4C8G A;  5BMV A;  5KMG A;  4DXD A;  2AMT A;  2UZH A;  2IAF A;  2LBX A;  1Q7Y H;  3KE1 A;  4YJ3 A;  2VAP A;  3D54 A;  3GYQ A;  1VQK F;  2CWJ A;  3CCE F;  1N8R H;  5GIO C;  2RHJ A;  4G4V A;  3ELC A;  3WPX A;  1Q81 H;  5KX5 A;  3L7Q A;  1JJ2 F;  3S0H A;  4X1Y A;  1ONI A; 
#chains in the Genus database with same CATH homology
 3QUW A;  1X25 A;  4NWO B;  2UYJ A;  1FNJ A;  3KJK A;  2IG8 A;  3M1X A;  2CSL A;  3R0P A;  3ZP4 A;  2CHT A;  1UFY A;  1XHO A;  2CVL A;  3K12 A;  3ZP7 A;  1JD1 A;  3GTZ A;  1QAH A;  3V4D A;  3KJJ A;  5HP7 A;  1UI9 A;  2EWC A;  3I3F A;  3LYB A;  2DYY A;  5HP8 A;  1PF5 A;  2UYK A;  2CHS A;  2UYN A;  2UYN B;  1QU9 A;  3M4S A;  1COM A;  2CW4 A;  1J7H A;  3I7T A;  1QD9 A;  3ZOP A;  1XRG A;  3D01 A;  1ODE A;  2B33 A;  1NQ3 A;  2CWJ A;  3LME A;  2UYP A;  3ZO8 A;  1FNK A;  1DBF A;  4ZK7 A;  3K0T A;  3L7Q A;  3VCZ A;  3MQW A;  2OTM A;  1ONI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...