2RHJA

Synthetic gene encoded bacillus subtilis ftsz with two sulfate ions and sodium ion in the nucleotide pocket
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFLENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhjA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhjA01
4ZOLB 4O4LA 3WGNA 3M8KA 4B46A 3HKDB 4TUYA 5ITZB 3CB2A 2R751 1TVKA 2Q1XA 1RQ2A 5IJ9B 3JAKB 1W5FA 4O4JB 4YJ3A 5EZYA 3M89A 3ZIDA 5LA6A 1JFFB 3E22A 5LOVB 3WGJA 4I50B 1W59A 1W5AA 4ZI7B 3JALA 4O4LB 2XKAA 4HNAA 4U39A 5CB4B 3UT5A 4TUYB 5JCOA 3JAWA 5JH7A 4E6EA 1TVKB 3ZBQA 1OFUA 4YJ3B 5MN4A 5EZYB 4EI7A 3C8LA 5LA6B 1FFXA 3E22B 1Z5VA 3JALB 5LP6C 5MN5A 3JAWB 5JH7B 4F6RA 5LYJA 1W581 5IJ0A 1SA0A 5EYPA 5JVDA 1FFXB 4O2BB 3V3TA 4EB6A 3JARA 5KX5A 2XKBA 4TV9A 1RLUA 3VOBA 4YJ2A 4EI8A 3JASA 2BTQA 2GVIA 4O2AB 3VOAA 4FFBA 4F6RB 5LYJB 5CA0A 4O4IA 4X20A 5IJ0B 4EI9A 5GONA 5J2UA 1SA0B 5JVDB 4EB6B 3JARB 5KX5B 2VAWA 4YJ2B 3N2GA 5FNVA 3JASB 4XCQA 4X1KA 5C8YA 3VO9A 5CA0B 5LXTA 4X20B 1W5EA 5JCOC 4HNAB 5J2UB 3HKCA 3UT5B 3RYIA 5MN6A 4X1YA 5EIBC 2RHOA 5FNVB 4I4TA 5C8YB 4IIJA 1RQ7A 4O4HA 2Q1YA 4ZHQA 3RB8A 5LXTB 3RYHA 1FSZA 4DRXA 3HKCB 5IYZA 5JQGA 2BTOA 3WGKA 3HKBA 3RYIB 4WBNA 3ZBPA 4KWEA 4X1YB 4ZI7A 3RYFA 3N2KA 4I4TB 4IIJB 5EYPB 3HKDA 4O4HB 1TUBA 2R6R1 3VPAA 3RYHB 4TV9B 4DRXB 3JAKA 4LNUA 5JQGB 3HKEA 2BTQB 3HKBB 4WBNB 4FFBB 2RHHA 4I50A 4O4IB 3RYFB 2VXYA 4TV8A 3N2KB 5GONB 5CB4A 5J2TA 3VO8A 1Z5WA 5BMVA 1TUBB 4U3JA 5CA1A 5KMGA 2RHJA 4M8IA 3WGMA 4B45A 3N2GB 3RYCA 5M7EA 4LNUB 4X1KB 3HKEB 4IHJA 4I55A 3JATA 4X1IA 2RHLA 4TV8B 5J2TB 4DXDA 5BMVB 4U3JB 5CA1B 5LP6A 5KMGB 3RYCB 2VAMA 4ZOLA 3WGLA 5ITZA 4O2BA 4ZHQB 4IHJB 1W5BA 4I55B 3JATB 4X1IB 5IJ9A 5IYZB 5EIBD 4O4JA 4O2AA 1JFFA 5LOVA 5LP6B 2VAPA 3R4VA
chains in the Genus database with same CATH superfamily
5I8WA 1BDBA 4XVUA 5IC4A 4MRVA 2D3TA 3GLIA 3DF9A 4XB2A 4PNZA 2D2XA 5DSTA 3TM4A 1U31A 3ROKA 3WNBA 3EOZA 1YJWF 1TKCA 2A0WA 3KYCB 2CMKA 1XAGA 1QMPA 2PWYA 2OO5A 2WTAA 4CUJA 1UDWA 1XEFA 4ER3A 1HLDA 2FAXA 5BQFA 3QELA 2XGJA 2ZS9A 3WLNA 4OB7A 2V7QA 4HNAA 3JAWA 3DHEA 2Z43A 3DVSX 2QAGB 4NK5A 5IDVA 3RVSA 4BZZA 4B7CA 2BDUA 2VRCD 5DLPA 3TSCA 5MN4A 1NRXA 4BE7B 3CRZA 2AZ4A 3TL2A 3BL6A 3HR7A 4NCAA 2FNAA 4HGPA 2Y4NA 1F4VA 4JASB 1YJQA 2IPLA 5DNYB 1P7YA 3KJHA 3OCUA 3M6WA 3TPZA 1T9ZA 2VNAA 3FLEA 2W2QA 3ZBTA 3Q8MA 1KJIA 3I1JA 1YJNF 4YAEA 4C4ZA 2X7JA 1M0TA 3SXUA 1ZEJA 2BKEA 1FFXB 2WLSA 4WZ6A 4H16A 2X0RA 4BNUA 4CNBA 1PCXA 1WZCA 4FFVA 4D98A 1YZTA 1H2YA 5IT9A 2B3TA 5BRNA 3V8VA 5KNDH 4M89A 5BP7A 3AFIA 4ARSA 3KHTA 2XODA 4K9DA 2F9LA 3Q41A 3O7WA 1E0SA 4EI9A 3WYAA 3HUTA 3NHJA 2NU6A 2C31A 4H3KB 4CM3A 2OBXA 2O2DA 3I3OA 2ZTUA 1GPAA 3OWHA 1XMQB 2XMZA 13PKA 2EZ4A 4M1WA 4BTLA 4LYYA 1UPUA 1FMLA 1A9ZA 4DRZA 2VTVA 4RAOA 4JJGA 1FW8A 4E12A 5KTRA 5DEOA 1IPFA 1JSXA 3TD3A 4S3MA 3W8RA 1CJUC 2Q8PA 3FLMA 3UUGA 4ECAA 4Y2TA 2BI7A 1JU9A 1G8KA 2D1QA 2FRVA 4Z0PA 5KYYB 2UYQA 1GPLA 4PLTA 1KJ9A 5E9AA 3I9MA 4J29A 4QPPA 1ZL0A 2GJSA 4GQIA 2R1VA 2G70A 2ZETA 1OIVA 3OZVA 5LB4A 3SBDA 1MB2A 4RW0A 4U2GA 3ZO8A 2Y9PB 1X15A 3BTUA 4MIOA 1TJPB 3M6XA 4WHMA 3GT3A 1W57A 4UOZA 1H22A 2VJKA 4FM9A 1JR4A 1FQWA 3KJIA 1B14A 3ASVA 3LCCA 3BWEA 4D26A 1ZL2A 1L5KA 1LY1A 1GO0A 4EJSB 3ABRB 2P9JA 1J6UA 4RX1A 4PLCA 3G82C 1QB8A 1E9SA 2AS0A 3LUKA 4RM3A 1Q7RA 3OC0A 2WUVA 4YI3A 5I7OA 1WSWA 3L3BA 2EBWA 6LDHA 1B0PA 3MQWA 5ALVA 3GGPA 2YZ2A 3CFYA 4I4IA 5DVZA 1LBHA 1U2GC 4JD5A 3EWSA 4KKXB 1E6MA 4HQRA 1V8OA 2VP6A 4ZU1X 1Y4DE 3H4MA 5KWJA 1W0KD 4REQA 1GJRA 2QTPA 3GRCA 3I52A 1W93A 3I2KA 4FOPA 5H1YA 1K1EA 4YP7A 1I4OA 3S2YA 5KTTA 3ENQA 5FOTA 3EPJA 3SIUA 1GRRA 5LDHA 3PJDA 4KPYA 5ERXA 2GZ2A 4M4SA 3L0YA 1FRFS 2ISCA 2ZJ1A 3U1VA 4EUSA 1PAUA 2P6YA 1XL1A 4RA6B 1NVVQ 2IEZA 3PXDA 1JE1A 4Y6GB 4ASUA 4US2R 2BLLA 5LN1A 5TF0A 4GX1A 1SCKA 1IMJA 2C9YA 3F3YA 2ZIZA 3R5JA 4MS3B 2YIMA 4S24A 1KZYC 4AJOA 3R76A 4BVAA 2D2EA 2FZLA 3IE0A 4ENWA 5JJBA 4A23A 3E8SA 1KI9A 3AFOA 4HS4A 1C30B 2WU4A 2YC2C 3B5JA 1BWRA 3PPXA 5IAKA 2JLZA 4DE5A 4NCJA 1JBEA 3R5HA 5EMJA 1DL5A 2DC1A 2VRNA 1LBIA 1JSRA 5SYAA 1GPMA 2WD9A 4PC1A 3BN3A 5ER9A 4MJ7A 2MDTA 4WW0A 1Z38A 2CFIA 5GJBA 1WETA 1W49A 3QFCA 4NXNB 4AQ7A 1F7UA 4ZJZA 4LCBA 4N3GA 3MELA 3HBNA 2NZ8A 3U0BA 1QE3A 3A9RA 5CLFA 1H0KA 4DDKA 2Y1KA 3FWNA 3ZP4A 3DL7A 3QFRA 5IJWA 3S06A 3UUWA 4TLEA 3W5IA 1VCHA 3L05A 5ALJA 2ILTA 3ZZNA 1RPZA 4E5KA 2XKJE 4XD7D 1Q95A 4HDSA 3D8HA 1P4GA 3OCYA 4Z9BA 3RS8A 2QS9A 4EX6A 3TUZC 4JT8A 2FEPA 1HORA 5KWVA 1PZGA 1QCYA 5ALGA 1YIOA 3NNSA 3HACA 3WMFA 2IYZA 4GZMA 3M9WA 1WNFA 2ESRA 3KT8A 1QHHB 3PFCA 4O25A 4RABA 2V7PA 4XA8A 1Y1RA 4YWHA 1FNBA 3E8XA 1UBFA 1VJDA 2RHBA 3HJTA 2VHJA 5DHSA 2UYCA 4JBGA 4HH4A 3WNDA 2OQRA 5EIBC 1EBBA 2JGRA 2GXQA 1DSSG 1WCWA 2IUUA 5G1OA 2FZCA 1JD1A 1CWUA 5EG5A 1SVSA 2OBLA 3L06A 3G1TA 4QYIA 2F43B 1B26A 2AOXA 3W6UA 3IX7A 4JVSB 1OXKB 3IIJA 3LYUA 2C7GA 2I1WA 4MA4A 4Z0TA 1NVUQ 3WKDA 1HMYA 1QSGA 3WLHA 1TJ4A 1GA6A 1ZSVA 2FG7C 1XVLA 2CVZA 4PRLA 3SJAA 2GZSA 2O3UA 4DCUA 1CRZA 1RWOA 3S03A 5LQDA 1ZGGA 4JI7B 3QPAA 3U9SA 3VSDA 5DM1A 5JHHB 3QIAA 3HH8A 1JEYA 1P62B 1QLHA 1XLUA 2PUTA 4DQDA 5K0EA 3MILA 4NR0A 1WUJS 4KLAA 4ZK6A 2Y1XA 4INAA 4PO3X 1QB7A 2J9ZB 4C5CA 3BRQA 4BNIA 1NMZA 2ZI3A 2H16A 5ICGA 3COPA 4QUHA 2PUDA 4G0UA 1Y3FE 3NEJA 1DDGA 3T3MB 1E1CB 1FDUA 4D80A 2PBRA 4LY6A 1ZCFA 2FPIB 2WD8A 3B6MA 1G7RA 4G67A 1KMMA 4GYYA 4OJQA 2I03A 5H16A 3UT6A 4B83A 1I7SB 1MC8A 2A1IA 5LWQA 5CFQA 1M2VA 2WF5A 3GEEA 4YDRA 1A27A 1SUBA 3R7AA 4BO4A 1SZCA 2GBGA 3J80A 1IVYA 1BRTA 2VDWB 4CU2A 4DCGA 1Y37A 5GOTA 3UYLA 4C6TA 3WKEA 2LCFA 1YKSA 3A6LA 4DAOA 4O4LA 4GQBA 3R41A 4PC6A 5C3MA 4YCLA 3ZNNA 4HX5A 4ZCLA 1NNSA 1D2HA 1H2ZA 3ERNA 1KDTA 4NCXA 3S3TA 5EIEA 2CHSA 1UODA 2XE4A 3RKSA 2WDPA 3I8SA 3BXXA 4W5WA 1BROA 1GGFA 2PMFA 2QUAA 3DB2A 4UNQA 4ZWNA 1JIUA 1UOPA 1ZQ1A 5LZ7A 1G63A 3RAJA 1E0KA 2WG0A 4NCBA 1ISMA 2PL9A 3MBKA 1I7LA 4CCYA 2VF2A 3FAZA 1BWQA 1DC3A 1P3Y1 4LJ9A 4G9BA 4DAEA 1YFJA 2A5FA 4UHJA 3AKZA 4IIGA 1XTIA 2G63A 2WD7A 3OTHA 4H35A 3N3AC 2A9QA 2JCSA 5J59A 1K68A 5UKDA 4E5NA 4DTCA 2ZIVB 4FYYA 2PUBA 5BQPA 1VPVA 4CUKA 1CUIA 4BFZA 4MQEA 3AUKA 1DNPA 1QMGA 4ZO7A 1TJ3A 4PC7A 4JI5B 4ZCRA 3B9QA 5HRAA 4FNMA 2WAXA 4LC0A 2BYTA 4DZTA 4JVMA 1G5FA 1H9CA 2SKDA 4MI9A 4F85A 2Y1OA 5D3ZA 5CX1A 5D85A 1GPH1 3DEJA 3T5BA 4L8LA 3N0VA 5JEDA 1YRYE 1J9ZA 3ANMA 4G86A 2HVYD 5FPPA 4AO8A 2I66A 4PAWA 4KE9A 4WXHA 2HQSA 2XSZA 5KOHB 1O0BA 3GLIE 1XR3A 3GDFA 2YFQA 3TXYA 1S72F 1VJ0A 4OF4A 4EB6B 4BO6A 2WTEA 3GDHA 4OI0A 3KL4A 5FF9A 1N75A 3MM4A 1FNMA 2D5AA 4BEVA 1YZNA 4UNIA 1L5NA 2PSHA 5CA0B 2YHIB 3KAQA 4MV7A 4JP3A 5J2UB 1I3LA 1UJBA 2M1ZA 2YWDA 4GHWA 1M1YA 3IO3A 4H9GA 5JSZB 5LP1A 3KKQA 4IOJA 4YLGA 1OGYA 3N6VA 3P32A 4M6WB 3ZYCA 5A4DA 1CQWA 2JD0A 5F4ZA 3REOA 2UZ1A 5KOIA 5HTOA 5J4VA 3FIUA 2FWAA 2PT5A 4LY9A 5F5XA 3VPSA 5IYZA 1SFRA 2HT1A 3PDUA 4HJXA 3SQLA 4ZAZA 3GP3A 4MVJF 4MP3A 2O9JA 3NYWA 4JL6A 3WIDA 1KI7A 2YRFA 3LVBA 1C9JA 7YASA 3GJ6A 3V7EA 4OHXA 3UY4A 2AJLI 2JGDA 1D6NA 5F1OA 1Q50A 1FLNA 2EX1A 3BHNA 3AIKA 2DUMA 1JALA 3BJEA 3HR8A 3KUCA 2R9VA 4IDAA 4UOQA 5AJWA 1U63A 2BH9A 1PZHA 3UAOA 5CNIA 1AQLA 3I1YA 3Q88A 4EB3A 3SXJA 3HM2A 2BAGA 2EVWX 4IJ5A 3T5GA 1L7DA 3H9JA 2QQFA 3GEHA 1NLUA 2QUJA 4XPIB 3W3AD 1MW8X 1O6BA 2FPSA 1VE6A 4ESHA 5LD2C 1G60A 3EA4A 5I3ZA 4D41A 1K06A 2NP7A 2C07A 2Q7XA 5TC4A 3HY4A 2UYGA 4RPCA 4IIFA 2NUAB 1P33A 2Z3ZA 2D1TA 5JD5A 4IXTA 4LJ5A 4N6GA 1MV5A 4OSEA 2GTHA 2VPPA 5AXAA 3U44A 1CXZA 2J0VA 5AI8A 2WWXA 5KVAA 1ESZA 4OYLA 1G3RA 1RC8A 3AM3A 2A0XA 3GEBA 1EHYA 4EVSA 1QIFA 1Y5MA 3CVUA 4G0NA 4YRZA 4LHVA 2CMFA 1SKAA 3DV0A 1XZDA 2C4WA 3ER6A 1VDZA 3QX8A 1F20A 2CE2X 3HY3A 1RBYA 3P1JA 4XSGA 5C4GB 4RFSB 1HKHA 1G66A 1J2JA 4JLWA 3F6YA 1C7JA 2EATA 3LP6A 3E0QA 1RXIA 3IUSA 4G5QA 5FPQA 1SVWA 3FB1A 4HPWA 4EITA 3RADC 2G8NA 1KS9A 2IBMA 5GV7A 2JL1A 2YXZA 1TVKB 3JQAA 4CU5A 3D43A 5EP4A 1WX1A 4TQUS 5T8KA 2PFKA 3ZHYA 5KVSA 1WTAA 1QDEA 3DLAA 3ND8A 5JDIC 4C7OB 3QXCA 3IGFA 4E30A 1ONBA 1PEYA 3NDIA 5KJ1A 3JYHA 2NTEA 4N3CA 4MV6A 2MWMA 2ZXEA 4NOMA 1FTGA 4MTCA 2ZCUA 4GM1A 1DDOA 3X44A 2BMJA 3FGOA 3V3TA 1K3FA 3KVOA 1W8DA 4IDBA 3JARA 2PJDA 4JQOA 4U7WA 2H8EA 5LMZA 2FWJA 3LIPA 2EQ5A 3V32A 3IUQA 1UDBA 3FMFA 1BMFA 2WPDD 4C78A 2P0AA 1TMYA 3E3AA 4FJ0A 4Q9LA 2PZMA 1E3LA 2BUBA 1WEKA 1A69A 2H00A 2O3RA 4XPZA 1FE8A 4EGFA 1S96A 4G25A 1Z0AA 3QVWA 4CETA 1NJ5A 1S9HA 1BOFA 1B6TA 1CQXA 2HFJA 2Z30A 4D9IA 4U7GA 1V3TA 3TFWA 2JK1A 2R6GA 3VMMA 1KEZA 1NJ8A 2OB1A 4OQ4A 5L4NA 3H2SA 3AI3A 4RWEA 5EVCA 1SU7A 5AKIA 3A1UA 4LYDA 2ODTX 2XJ4A 2XWQA 1A7KA 4RXTA 1NRIA 1PDVA 1ZXBA 1P75A 2ORED 2BFDA 1LV8A 1C0IA 3RIHA 4ZN6A 1N8RH 3WHKA 4MHSA 5B6IA 1UFRA 3AYXB 2XAUA 3B1YA 4K40A 4N18A 4BLVA 2FSFA 2H08A 1XKTA 4R98A 3WYNA 3HKCB 4QXAA 2RH4A 4LVNA 5EMNA 1JR3E 2FSUA 2GH1A 2EKDA 4NZZA 3M4NA 4GKKB 1C14A 1U7UA 3NHRA 3KV1A 3NVMB 3ZDFA 3ZNPA 2Z2KA 4UNRA 1OVMA 3KKOA 5B6JA 4HB4A 1WS6A 3SFVA 1TU4A 1HDGO 2A94A 2CLHB 5CDGA 2W98A 1EVIA 2J0QA 4QU9A 2FFQA 2IA5A 2QUKA 1U90A 2W6OA 3PR1A 4S2UA 3AVUA 4N8SA 2BT4A 2VATA 2P9QA 3G17A 2EFEB 2YJGA 5KNBD 3GGGA 2WJJA 1U6KA 3K2BA 2RB9A 2AZDA 4M0CA 3SQNA 2ZG6A 4KWCA 4JJAA 4TMVA 1QRSA 5BVGA 2QRLA 5DYGA 4B3GA 3DMPA 3T35A 4B5LA 1GQYA 2VDLB 3ITKA 2RIPA 5CIQA 1GDTA 2IBTA 5F2EA 5CA1B 2VYVA 3HJCA 4ZOQI 4P9NA 5KAPA 3TVYA 1OX4A 2AF4C 5L3VA 3MOGA 2IHYA 4JLNA 4DR3B 1QKKA 2QRZA 4J76A 1L5MA 4Y9RA 4TVSA 3VZDA 4ZCIA 2KTVA 1JDZA 2DR0A 1LRJA 2J7PD 5FJIA 4CMKA 2V97A 4TLAA 4ZOLB 3VU9A 3L8DA 4Q21A 2NZUG 3GO4A 4H6XA 4AJ9A 3HKDB 1GITA 3TSAA 3EPKA 4BY9E 1MC5A 4A8JB 3RUEA 5IDQA 4W5QA 1CFJA 1QTIA 1N9GA 4EARA 4MW2A 1Z6QA 3HXQA 3MCTA 4IIBA 2VF7A 2HX0A 3S0YA 3BOSA 1VE3A 3KEOA 3L07A 2BKVA 1IN8A 3KD2A 5TPWA 4DLWA 5DM0A 2YZGA 2P1RA 4K2HA 5CB4B 4I5FA 2BI4A 3KR1A 4CIXA 1E79D 2FWNA 2DMRA 3GU3A 4KODA 4EG4A 4KE8A 3G2HA 1A4XA 1VE9A 2W8BC 3SEFA 2Z4TA 4QL3A 2YFKA 3H2KA 3O95A 4ETMA 2F3PA 3TRJA 3ASZA 1OYVA 2NUPA 2PZ8A 1L4BA 4C08A 2FE4A 4ID3A 4YMSA 3JYNA 3NHMA 1DG9A 3MF4A 3UAZA 4C07A 1JG2A 5EJFA 5IPFA 1VL8A 2HLNA 2X6QA 3O90A 4K2AA 5HOEA 5ENVA 4CM4A 1LTHR 1I4TD 3BJIC 3DLIA 4Q02A 5CNKA 2CWDA 1L8QA 3C9SA 2VJYA 4UU8A 4EG1A 3E18A 3PIDA 1Q0PA 3BK1A 4LXIA 3BAFA 4Z49A 2XB6A 3CLSC 5ELXA 3GLRA 1KS2A 3FFBA 1E5XA 1TECE 1YUMA 1CNMA 4YJFB 5F76A 3RJMA 1PFQA 3RRJA 3UXYA 4BKUA 3AU8A 3MWLA 1POXA 1KEEA 1TF5A 2XQGA 1EAYA 3I01M 1SUDA 3NT4A 1SKUA 5EGNA 1KMCA 4E11A 1RYMA 3H9EO 5BSRA 3C6XA 1M2OA 2TMKA 3QGMA 4O1MA 2IGBA 2XF8A 1BVUA 2CCGA 3Q8XB 4Q4HB 4WKBA 5EP1A 3EGXA 2NYVA 2WG2A 3PHIA 4EYGA 4LWQA 4BFYA 3DV9A 3C3XA 4ECEA 5HKKA 3UCEA 1N0IA 3RS0A 3A9CA 1NNLA 1T43A 2P6MA 3UGTA 1ZN7A 4YUXA 4AZWA 4I9NA 1KK1A 4Y0AA 1XVAA 3F46A 2VT2A 1GZ5A 2AR9A 3O3MB 4NE2A 5FTMA 4KWEA 3GP5A 4JA0A 3UK2A 5EPOA 1G8AA 3P9XA 2Y0CA 4QDXA 3IQIX 3T7CA 5B2EA 3VPAA 1X70A 2BZSA 1IZ8A 2AZTA 2DOKA 1S02A 2KBFA 4OEHA 1T3TA 2M98A 1S8AA 4Q1BA 1KNJA 1SG6A 3FWKA 5DBOA 2GN2A 1ZRHA 3ZWKA 121PA 2CJWB 3FGNA 3ITEA 3P0RA 1QV7A 1RJDA 1CUYA 3K73O 1KBQA 4RPHA 3KXKA 3T38A 4JC5A 2GILA 4RJTA 3ACDA 4UXIA 2R1UA 3ZC3A 3VSCA 1L1QA 4FFNA 3LKVA 3WGTA 4CEHA 3LVRE 3QYFA 2OFOA 2VZLA 4V0MA 4UU0A 2QW1A 4EG7A 4GEKA 4N01A 5J2TB 5KPDA 3U37A 2W6CX 4EJ0A 3R44A 3KYDA 1E58A 1H4SA 3R6GA 1IEQA 1PRYA 1C1XB 4P22A 4U0JA 3T7JA 4YONB 2RGBA 4OBXA 1RQRA 5I4BA 4GBMA 2DYYA 1TKAA 1V71A 2NO9A 3DJFA 3CWQA 3ILSA 5CB0A 1N3LA 4R81A 1EP2B 3B78A 4NU6A 4MLDA 5CB6A 1D3AA 3S4YA 2RMKA 1Q0TA 1RAAA 4AYTA 3OF2A 4ZI7B 1JT9A 4TRJA 5JNSA 3GMSA 1M83A 5L3ZA 5LU8A 5HTKA 4O8CA 1UZLA 3WQRA 2VP5A 3EWIA 3SKXA 2PX4A 2YVQA 2V03A 1JDVA 2P2CA 1RMTA 2OOSA 4QBTA 3B1FA 1ZINA 3LCMA 2OZEA 3F74A 5EJAA 4FMCB 5C81A 4LPKA 2J9FB 3IAS6 5DI3B 1USVA 2J6HA 1MH9A 2RHMA 4JB2A 1XNJA 2Q6TA 3UNXA 1S8NA 4RD4A 3MCUA 1E5TA 1Z4JA 4LC1A 4XDZA 3H9QA 4YAOA 3UIEA 4D2IA 1E2NA 5A04A 1MAHA 2BCJQ 2NTJA 2ZJOA 2ZITA 4G84A 5E3IA 3BB3A 3KBBA 4CYMA 3T4EA 2FSHA 2OM2A 3LDTA 2HCTA 2OMKA 4H60A 5AQEA 3WJ1A 1HDXA 2XOKA 3DD5A 1PTJA 4B6SA 2OEPA 3G88A 2DFNA 1TM2A 5DTQA 1RRCA 4J9UE 4HX9A 4JP5A 1R6XA 4WKNA 3IPYA 3ZHUA 2BGTA 2FXIA 1B15A 5ADVA 3MD0A 3GV0A 4D97A 4FZJA 4DCNA 4N5HX 2CHGA 2ZB8A 3MFYA 2XQIA 3Q7QA 5HWEA 4LHXA 2G7ZA 1NVEA 3CLTD 4MP6A 4F72A 2A3NA 4W9NC 3V4RA 1Y7IA 3G71F 2H1RA 5JZVA 5EXDA 1SHKA 5BNFA 3JQ8B 3RA6A 2ZE5A 4KPUB 4AZ0B 1DWQA 3VUEA 1QHIA 5SYNA 3L7MA 4QSMA 3FZYA 5I9IA 3UBTA 2A9RA 2ZYHA 4CWAA 4BBAA 4XCQA 1KDYA 5F77A 2P9CA 1TAUA 1FP2A 2G06A 2OGTA 1QFZA 3DQPA 4XVCA 4JC8A 2R85A 1V9LA 2JBAA 4NC9A 4OHCA 1QKIA 1U8UA 4RJ2A 1H1DA 1XCGB 3IKVA 3FCYA 4UASA 5CUQA 3ONDA 5DIZA 3BXEA 3S2GA 4M8SA 5IBCA 1VMIA 2DUNA 3ZWDA 1GZVA 4X84A 1R27A 3BWYA 3OQJA 1KZHA 3U3RA 1EX1A 3HTNA 1FDRA 3F1KA 2YQ5A 3WLMA 1NTRA 1U11A 3L7JA 4TL8A 1KXJA 3E35A 1BGXT 3CNLA 3UTDA 1L4YA 5IJXA 3WL6A 5I7HA 4FMDB 3T5CA 2G9IA 5ECGC 4RCYA 4IMIB 5TQ0B 2XB4A 1EJ2A 4DJAA 4HQOA 4OI4A 3PICA 3QHAA 2EWWA 1TDJA 3DKIA 3LBAA 1RS0A 2HC9A 1VE7A 5H9VA 1YOBA 2Z8YM 4N39A 4Y2RA 2RH5A 2WEKA 1WP4A 4ZHYB 1XTQA 3EJWA 1VJGA 5G0SA 6GPBA 1GPWB 1NNI1 2R7AA 3CNBA 3PFWO 5TV2A 1Y8ZA 2YIVX 3G2IA 3IEIA 1F8XA 4BWVA 3TECE 4AFNA 1TA4A 3MXOA 3SDSA 3TEJA 2E18A 4L8YA 4G37A 2IS6A 4WFKA 4NZ9A 4V0NA 1KSHA 5EP3A 1VBNA 4DCJA 5HCIA 1JDBC 3OLQA 1IYZA 3KLBA 4RKQA 3NATA 1GL9B 3IEPA 3K70B 3G8BA 3HGQA 3C3KA 4B6JA 1SOWA 3TLGA 5JCJD 1T0HB 4BJ3A 5JW6A 4BVQA 3Q10A 2HPAA 2GK7A 1LLDA 1GLVA 1JTEA 2GBLC 4PGMA 4UAUA 3MPUA 4L4XA 5ALLA 1EWQA 1SZDA 3VHXA 3NPMA 4O4JA 1LZLA 5D1HA 3W3ZB 2QSJA 2GGSA 4X6LA 1YNOA 3EZXA 2C3MA 1SAYA 2GEUA 3KHNA 1N3YA 5K6TA 3Q5EA 1G7SA 3CGGA 4H17A 5E2IA 2XGSA 2ZSKA 2ZRMA 4U2DA 3QU4A 3HDJA 4DNFA 4G5FA 4LJ7A 3CF6R 3OZFA 3BPSA 3O83A 4U0KA 1QPZA 1MPXA 3NK6A 1UM9B 2HA5A 4G4XA 4ZEXA 3TZQA 2DETA 5HR5A 1ZN8A 1MTOA 3K20A 4UAVA 2WR8A 2UZAA 1NVFA 2O50A 1E96A 2Q9BA 4OJMX 3ULKA 1N57A 2PT6A 4G6ZA 4B87A 3BKXA 2JAPA 3SHVA 3KVYA 3K3PA 4X8LA 4C3VA 1K5GA 4MV5A 3L46A 4RTQA 4N41A 4BVSA 4MWCA 1LLCA 2AV6A 5EHXA 5BW5A 3CH7A 3PENA 4FUTA 1NJGA 1LW6E 1MJGM 2YMLA 3CIOA 1VQLF 4KQIA 1L5SA 4RL6A 4S0ZA 3ZV6A 1CE8A 1SCDA 2VHUA 5AUPB 5GQSA 4CMAA 4KSCA 4IFIA 5FOXA 1R0ZA 1R15A 3INYA 3RVPA 3EWNA 2CZWA 1MNQA 2R47A 3C7DB 3CEHA 1G38A 4DUZB 1JPVA 1HFJA 1TYBE 2VO1A 3ZE2B 2W00A 4Z8XA 3ZZ0A 1XXHE 5JRZA 2R8BA 1T35A 2G67A 3AL3A 3LK6A 2FN4A 2GRUA 4JWTA 1A76A 5IBPA 3AY0A 5IYZF 3P0ZA 3UMSA 3WRYA 4I9FA 4B3IA 3AF5A 4KXUA 3Q0EA 3QW4B 4IIUA 2B4QA 3H0KA 1M0WA 2Q1WA 1Z2AA 4X91A 1DX4A 3O8BA 2OECA 3IUBA 2B34A 3GHHA 3AF3A 4TKUA 3RDPA 3W2FA 3AEQA 3G79A 1UBMS 5IZ4A 2CUTA 4F1JA 1QZZA 1B16A 1GQRA 2VWQA 2ZUUA 1S9DA 3KFVA 3AG5A 1WY5A 3VZRA 4G26A 4PO1A 4NMXB 1ABBA 1OY1A 1YUNA 2RB4A 3GFQA 2VSYA 3OM0A 3A25A 4PQFA 5FV7A 4D92A 1NZFA 4KWIA 4DIMA 1Y9ZA 2XKKA 1K88A 5E2BA 3WLRA 1GARA 3COWA 2IX9A 2O0JA 3GI1A 3ZQ6A 1Z2PX 1W6RA 4I2NA 3EGDA 5LBUA 5REQA 4EGAA 1Z4NA 2Q5FA 3QFSA 1C3EA 1NW7A 1W5SA 5CCBA 4JLPA 3V4FA 4ZO6A 3HLTA 1T8WA 3K2EA 3T1TA 3B1JA 3ESCA 3NIFB 1QC5A 1KAGA 1Y5NA 4Q3NA 3GJ4A 2D7CA 2P79A 1XEWY 4IO1A 3HA2A 5KREA 2RGGA 2BZGA 4E5MA 2BEJA 1DQYA 2Y8EA 2YDXA 4DFDA 4B73A 2H1CA 1DO0A 3QLTA 4J16A 4RV9A 2X14A 4GAEA 4UAJA 1I3MA 2ZJAA 4DKXA 1KQGA 3X3HA 3TLEA 2W2LA 4BYMA 3F8WA 3CY6A 4JT9A 3V4OA 3DBLB 3DBRB 4B5KA 3OZXA 1U9JA 3RS4A 4ZICA 3D6VA 1E6LA 5GY7A 1A5SB 3UV3A 4NIMA 5FNZA 4F8JA 3IMKA 3EODA 5L4SA 1GG5A 2CK3A 1ZC4A 4GQAA 3BB4A 2QAGA 3LFOA 3IDAA 4LGYA 3D2AA 5ESDA 4LZAA 5IKEA 4XFJA 1BD3A 1W5FA 1SVOA 3BGWA 1CCWA 4WN3A 1OSNA 4F45A 2GERA 1C0EA 5DCWA 1AQJA 5J63A 3T80A 4QOEA 4Q24A 1O6FA 1ZK0A 1W5AA 2R6AA 3D7SA 4A8TA 1HUQA 3LY8A 4NG5A 4DLLA 2CHFA 3HHPA 3QXSA 1M6VB 2HV8A 3NHZA 3QXJA 1MX9A 1UJ6A 2VH2A 3TR0A 2R4QA 4DLRA 1E1RD 1FFXA 1RRMA 2VDNB 1WTCA 4LZWA 3FYCA 4QQRA 4D9BA 4YV2A 5HJ5A 3WGUA 2RKBA 4B40A 1PUXA 4GNKA 4C3UA 2A84A 4G9EA 1QH9A 2O3TA 2E1RA 4HDKB 3D0RA 1SD5A 3I6ZA 4PHCA 4BVJA 4JSYA 1C0KA 1MXFA 4KMSA 1CQIB 4MAMA 3UA4A 3CUKA 3P9RA 3RWBA 1DBRA 2ZJ2A 5I7VA 2AN4A 3TEMA 1X39A 2BBSA 1V7CA 3E1KA 3E7PA 4IUCS 1ISGA 4P54A 3J81A 4IZ6A 3JD2A 4RFVA 2HS4A 4OXNA 2XQJA 4DPMA 5C51B 5D3MB 3GF4A 2PYDA 1C7QA 1PZXA 2A9FA 3GEMA 4OAOA 3MQFA 3CG6A 1PUJA 3E27A 2AWNA 5I7AA 1ENOA 3USES 2JIZD 1YDMA 1KK2A 2LGJA 2QVLA 4YHHB 4PINA 1U28A 2VSOA 4FS3A 5BWLA 1YB5A 2F55A 1H66A 5KKCA 3SC2B 5KYYA 3EIXA 4F5DA 3LOUA 4AU1A 1DQZA 3ZDQA 4OBBA 5I4KA 4QG7A 2ZWAA 1IQRA 2JGJA 3FOWA 4U63A 3FIJA 2ID8A 3TLCA 5WRFA 3C3EA 3IAFA 3SZ3A 1X3LA 4TGLA 4DYHA 2C59A 5ARBA 3NDBB 1KRXA 1LDMA 4R84A 4OGLA 2H51A 3VYRB 3I2JA 3NXSA 1QCCA 4QYMA 1NULA 2AOVA 4QSHA 4IQ8A 5CXXA 5HP7A 4IJKA 4MYDA 3NBXX 3BXHA 4RTKA 3MRXA 3WGKA 4ZXFA 3C3JA 1IZ7A 3L41A 4LHWA 4Q00A 4X3CA 5KHLB 3M4SA 4LDZA 1Z7GA 4AKTA 5AICA 1NKTA 4B44A 4FTWA 2DLNA 2YWJA 1A8SA 1C2TA 4WGFA 2CHQA 4OXXA 3SFTA 2E4VA 4BLUA 3CC4F 3OZTA 4FN5A 1XU7A 2VDUE 3RTGA 2CL7X 4CKBB 4MHTA 4OLJA 2AK2A 3MFQA 3VKWA 1PEAA 10MHA 2OV3A 2P4HX 3FMIA 5I7RA 4UBMA 1ETHA 4I1IA 3DE6X 4DL9A 3GA0A 4C21A 2P2LA 3G9UA 2VK1A 4BHTA 4G4WA 2NV0A 4JJIA 3D3NA 4WQMA 1Q84A 2C29D 2H4FA 1M1NB 1JSZA 3LCJA 2PXCA 4R0NA 5DLDA 5LYJF 1TAQA 1L4EA 3KZ1E 3TLJA 4PSAA 5BMVB 1BKSB 3VYUC 4XJSA 2LPMA 2JNWA 4WXYB 1W85A 2NIPA 2BEVB 2JD1A 4RA6A 5TNXA 3EZNA 2ID9A 4DS3A 3IL2A 1ONNA 3HXLA 1JS1X 2RGRA 4PZDA 4BT5A 4MS3A 3FNQA 4H1VA 2QQ0A 4GR9A 1SM4A 1C30A 2COKA 1O77A 3IVMA 4WBXC 3ZDZB 2HBZA 4EGCB 2ZSUA 4M36A 4JLAA 5EQDA 5H5JA 3ZDCA 3AHFA 3RROA 4ZVSA 2PNJA 2VQSA 3TN7A 3IAUA 4NARA 3B9PA 4JI1B 5IAOA 5K5EA 1K7YA 3A1VA 3CLVA 3ND7A 5JCZA 3B3GA 4A2WA 4R7ZA 4JWKA 3PITA 5AIBA 4E7OA 2CNWA 3L5OA 2COEA 5CYFA 1R88A 3P2KA 3G9ZA 4M9QA 4UD6A 2IXBA 1P73A 2H2DA 3OI7A 2ZT7A 2IHNA 2VBIA 5AJYA 4FDMA 1CETA 3ZD6A 1YIJF 1J0XO 1UXJA 2BKUA 4FGLA 2NYRA 3EAFA 1DTSA 2QPOA 1I36A 4R2HA 4JYMA 4IS3A 4FONA 4K7JA 1PK7A 3HC7A 5EZ6B 4CF5A 1DEKA 1J2UA 3H2HA 5DYWA 4ZAYA 5I5GA 3P9ZA 1V8PA 3KPYA 2CT8A 1TI7A 1RCFA 3CZQA 3GLGE 5GPBA 4QVGA 4RK5A 4V2UA 4Q9NA 1X8KA 1H4VB 1QHHA 1RFGE 3DZFA 3UMBA 3PQ2A 2B30A 3ZCRA 3BCHA 1BYIA 1GTRA 3E8MA 1IN1A 3N7UA 1MAAA 3E9MA 2F67A 821PA 2JLVA 1CJMA 2WJIA 1EE9A 4RLFA 1LFDB 5AVWA 2F43A 3UV6A 3KEFA 2H4HA 1RP1A 4RTOA 1BH2A 3TQSA 1P2SA 3TQQA 4F91B 1YI1A 2AXPA 2DLCX 4IPTA 3ZUPA 1EQAA 2JGFA 2QM0A 5C8YB 3AR7A 1VL1A 1EE1A 3I2FA 1PG0A 5DZSA 5DYIA 2CCJA 5E9WA 2K4MA 2QLMA 3EX7C 1SU8A 1UFQA 2WSSD 4XTCS 3VQTA 2YVUA 3PNMA 4W8GA 1CEYA 3LQ4A 3CH5A 4M22A 4HFMA 1F4PA 1JJBA 3J7AC 4LMPA 2YXNA 3AM4A 3SJCA 4Y2UA 1FVFA 4B7ZA 1ZGJA 1ECGA 3OWOA 1YJ8A 1ORWA 4CTOA 1D0VA 1DTEA 1ZI8A 3DOFA 2O57A 1ZN9A 4Y0NA 3DJYA 3SZLA 1B6SA 5I9TA 3V1MA 4R7GA 1AE1A 2ID4A 1BE8A 3IIIA 2F8MA 4LN1A 1E1CA 5K09A 4A2QA 1D2GA 2CN1A 3BD6A 1OGIA 1C50A 4QLBA 2FPIA 1ZOPA 4A27A 5IT5A 3RFFA 3N28A 4S05A 3SC6A 3UJNA 1OV4A 1P4SA 3A2KA 2QMZA 3KLMX 1AHHA 1JNXX 2PMKA 4ND4A 4X62B 1YNSA 1EDZA 2HPVA 4PYOA 4XYBA 5CB8A 4KJZA 1IUNA 1KNKA 1WQ4A 2VDWA 1YA6A 1UBNA 2DFPA 3L1HA 2BP7A 5HJEA 5KMGB 4AECA 1E98A 3U4DA 5CLQA 4Y6LA 3C6MA 3SGLA 3ZKAA 2ZYWX 2ZYRA 5LQMA 5HFAA 4ZHQB 1MOQA 2RJNA 2FDCA 1E6KA 1UZAA 3NEPX 4E5SA 3VAZA 1X7GA 4MVJH 3PJRA 4BLOA 4DBVO 1VZ3A 1XZNA 4RMNA 3HYSA 3UUFA 4FQ7A 2QD1A 5JFTA 1LC0A 1K8RA 3HV0A 1X1BA 2DQZA 1DAMA 5A9SA 1IUOA 1KKLA 2YVAA 3QVKA 4MPDA 2GHIA 5FOQA 3EVCA 3JAKB 1J25A 4ETIA 1YRHA 3PNQA 2NP6A 4X8OA 4YPVA 1EK5A 3HVJA 4PZAA 4QG3A 8ADHA 4RSGA 5TMPA 2DUJA 5KC9A 3K09C 3SBEA 1BMQA 3CN7A 2ZWOA 3SYLA 5JCOA 1GPUA 2V9ZA 2V7GA 3P10A 2WU3A 4XTRA 3HJBA 4BIIA 4HOYA 3ZWNA 1DKOA 3QMPA 2CLLB 5JLJA 4RY8A 1ACLA 1O08A 3N58A 5TT0A 5ALWA 1H1LB 1P81A 3ENKA 1NE7A 3GJXC 1JLKA 2ORIA 4LI0A 1AN9A 1G42A 2J3KA 4ZVNA 1U2PA 1UXIA 4DMLA 2DU8A 3RHTA 1ICIA 3U4MA 4M3NA 4OKIA 4XB1A 3W2HA 2GBPA 3EQ8A 4UBLA 4EB6A 3WLQA 4PBTA 3C7KA 1YKGA 4TV9A 1Y3CE 3MPOA 5H82A 2P68A 3WYCA 5C18A 2XRZA 4EYOA 1G9XA 3GLQA 4ZOEA 1TPYA 4XDGA 5CA0A 2YHIA 1C29B 2OGWA 5D6OA 2CSLA 5IMBA 5J2UA 4XSVA 2XOEA 4TYQA 2F8LA 3BTSA 5JSZA 3PUHA 2YTZA 3OTOB 4M6WA 1PJ8A 4PGGA 3T7EA 4AD8A 4Z1OA 5B7NA 5LFAA 3U4QB 5TDHA 3T9EA 4N3NA 3U4GA 4EGQA 5HIJA 4RHYA 1JILA 1E2BA 5EJ8A 2HA7A 4B3SB 2FPXA 3D31A 4LJLA 4TTPA 2A5LA 3C8UA 5EESA 1Z9BA 3AHCA 5JXJA 3W5BA 3NVDA 1JAYA 3ZHXA 4LGCA 4TWAA 1QHEA 1D2AA 2QGZA 3T5DA 3NT5A 521PA 1KYQA 5D3QA 3S2UA 2H0QA 1CHDA 1YC2A 3OKPA 1Z33A 3KZMA 4KQCA 5DV9A 2ZSFA 5DCYA 3MD9A 3Q9NA 4A0RA 4MS1B 1U02A 4H0FA 1VKOA 1NR7A 1QH1B 3TQTA 2Y68A 4LDRA 4AN0A 3G7UA 1PJBA 3ELUA 1QZUA 2WF6A 1YONA 2FFJA 4FFSA 3DOJA 3S2EA 3W06A 3WP0A 4U02A 1NW4A 1WNTA 2Q5OA 1G18A 3NI2A 3F4BA 4KXVA 2FLKA 3R20A 4GR4A 4RVDA 1GTL1 3BBPA 4X41A 4HDNB 3CPSA 1J90A 2R6HA 4MV3A 2IH5A 4WECA 4Q9HA 2V7VA 2V55B 3D8RA 3Q3VA 4KBYA 2VJOA 4REOA 2NUAA 4BNNA 1J8FA 2UKDA 5B3JC 3I73A 3FMVA 3JQ9C 4M7PA 5AK6A 1Q8RA 1J07A 2R2GA 1GU1A 2VQ6A 1GO1A 3K2QA 5EQTA 5L8VA 3I62A 2ZSHA 2FMUA 1U8XX 2BDEA 3AVTA 4PAOA 4MUAA 2Q5HA 3TGPA 2B82A 4RZQA 4PQYA 1I1HA 4B7XA 3AT1A 2ZVYA 5E1DA 3WYGA 5EHQA 4PO9A 2Y92A 4MDYA 4MPTA 5EJGA 4B8WA 3VI3B 1QVFF 1AUPA 2EV9A 3IIEA 2COUA 4OLHA 1W30A 2P7HA 1VBFA 3C3AA 1OAAA 5IU6A 4RFSA 3WWEA 5A6SB 2BZ1A 3O9ZA 4DABA 2CNNA 3HAXD 4QOIA 4HGRA 2Z2XA 4PRYA 5ISMA 5B37A 3ADCA 2WKQA 2Z08A 2NW6A 2R60A 4IJMA 1U1IA 1RKUA 3AG6A 3HMQA 3KP1A 1TVKA 4BEJA 1KAQA 5EKSA 4YX9A 3JZMA 1KH1A 4HNRA 1OMOA 4ZQCB 1P44A 5DULA 4BO1A 1P7CA 4K6MA 3IMFA 1NVXQ 2O7NA 2P27A 3F49S 4I50B 1QX3A 1U0RA 3TSOA 2WJWA 4D0RA 5HF6A 2XLBA 5JAOA 4N7MA 3E2MA 4P7FA 1VK3A 2HU2A 3MIIA 4IIJF 1ODIA 2H9IA 3TQOA 4AWAA 2C78A 2PH3A 4L08A 1P91A 5HG0A 1Z5VA 3FROA 3KT0A 1EWYA 1QHSA 1HI9A 1U1FA 2WJPA 4LOAA 3UENA 4JI2B 1TUIA 2P6OA 1ESMA 3CO5A 3EQ6A 1SXJD 4IIEA 2IZ7A 3TO5A 3AV3A 1XHFA 3JQ7B 1I6MA 4ABYA 3B1KA 2QYOA 2IK8A 4FU0A 4G81A 2ZZNA 2W2NA 1SELA 4WRRA 3AF4A 2I6XA 2EG5A 1M67A 3KKMA 4PGAA 4RY0A 4A2CA 3DLTA 2HQ1A 1OFGA 5LQNA 1VPDA 1KEUA 3L6OO 1QP4A 1LSSA 4OUDB 3K0SA 1RXVA 4N76A 1LU9A 4EVIA 3KJKA 4PLVA 3MJ4A 4HUTA 2E85A 5M5BA 4ENQA 3BUSA 3W0LB 4J0QA 1V35A 1QVWA 2ADFA 2LNDA 3F6EX 3AIIA 2VAWA 2CYBA 2JZOA 3IMPA 2OYCA 1GEEA 1X8XA 1BS2A 1H2BA 3CURA 3S6JA 1XD9A 3D4PA 4B47A 1AN0A 4MLCA 3ETHA 3RG2A 3PHLA 1H4TA 1TF7A 4OD0A 4PYKA 3ZGZA 1EB8A 3HKCA 4ISBA 3AINA 2QLBA 1CZHA 5TB5A 2QGFA 1SWVA 3EXHB 4N5MA 3DL2A 1N33B 4D4HA 3LX6A 4AO6A 3I1IA 2J3IA 5CFPA 1RQ7A 1M5RA 3IOYA 1OIXA 4DV3B 1ENYA 2IP1A 4EH1A 1PL0A 5AHRA 3R7BA 2ZOSA 4C6SA 3S81A 2HKIA 1EWRA 2HH9A 5IZCC 5A2QM 1XTPA 3FKSD 3ZBPA 3EW9A 4G0QA 2LTAA 3M4XA 2BSXA 2SICE 1TD9A 1ULSA 1ZGBA 3OSUA 4R41A 5TGDA 4EEXA 3N2EA 1BSVA 3L8MA 1RAHA 1HWYA 2EC5A 1BE0A 2DECA 3CBQA 2JLAA 2DLDA 5TS3A 1Z74A 4KQ6A 1DKUA 1VMDA 1AKMA 1F2UB 3K12A 2WYHA 4IIXA 3MNFA 3WMWA 3QU2A 5CA1A 2B9EA 1H8HA 4QAQA 1ELOA 4P83A 2Q6OA 1V8BA 1YRAA 3UJCA 3IB3A 4ZEVA 1B00A 1GD1O 3KIZA 1PW7A 1JHYA 4OLFA 3FHCB 4D8YA 2PL1A 2F3QA 4NVRA 1ORDA 4JFRA 4GZLA 3ZD7A 3RQIA 5IM4F 1EUCB 4D79A 4ZOLA 1VIVA 3I04M 2RHCA 1T0UA 1OBVA 3LUPA 5DTJA 2NU9B 4RQOA 2AWOA 2FPPB 2Z56A 3GXOA 3H84A 2I6RA 4R2KA 1YE5A 3DM9B 4A8JA 1S5PA 1QP7A 2PSDA 5HK8A 5CRIA 2RGDA 1MPTA 3AFNA 2A7XA 4HGNA 3NO4A 2FJUA 1W9MA 1YBMA 1WPXA 4HMOA 3OAAD 1GRVA 4NJMA 1HE4A 8ABPA 4ZT3A 1EFTA 1I33A 3GYQA 2QNBA 2XZPA 4PZYA 1AUOA 3ZGVA 1M8FA 2ZEJA 5A3RA 5LXTF 1VMEA 3F5DA 4CFSA 1SKYE 2ZRBA 2Q8NA 4MR9B 4RQAA 4ZAWA 1CJCA 5DOZA 1NQXA 2ZB2A 1MN6A 5F7XA 1E32A 4IICA 3ICWA 2X5JO 1N34B 1AGPA 3DWGA 1NIPA 1JKJB 2RHRA 5DSXA 1SBHA 3LQKA 1U40A 1AURA 2IYFA 4G09A 4HRVA 4BO5A 3QVXA 2AA3A 4DSUA 2XEDA 4KREA 1JVBA 1JQKA 2MU1A 4CN9A 4CQMB 2YMMA 2CFRA 4ESVA 3HN7A 3M4YA 1T3HA 4TSRA 3KV3O 1K63A 3PC3A 3FD6A 5KIAA 5ECWA 4YUAA 3RFCA 2IEGA 4ZCPA 3O8DA 1ZYUA 1CUJA 5IUJC 5K20A 5CXQA 3CNEA 1GR0A 2B0CA 1HE8B 4XYMA 2QU8A 2W6NA 4V0QA 5PGMA 2AQKA 2VDKB 1FDTA 5LLTA 4TYMA 3GLFA 4QIHA 3WMEA 4NWOB 1MAVA 4U6QA 2XNDA 4YRCA 1LFAA 2FWRA 3RARA 4Q4HA 4IHAA 3MMPA 4UW9A 1FCJA 1XXLA 1CUWA 4URHA 1QRTA 3Q0TA 3PTZA 1DJNA 2HU5A 3L6BA 3O8LA 2PUWA 4HQLA 3WNVA 6REQB 1YUBA 4ZQIA 1AHNA 2BGIA 1H69A 1GZ4A 5K7SA 3WICA 4R83A 5CT9A 2QV0A 3NM6B 2OGZA 1PHRA 2D0IA 1E6EA 1DIRA 3OFJA 5EE3A 3LF1A 4TWRA 1ZXXA 4XR9A 4YCBA 2AOUB 5DTRA 4A03A 2ZM5A 1RWNA 2P9YA 2PGIA 2ZIEA 3SEAA 5IX8A 2FV8A 2CJWA 3HA5A 1LVUA 2HSEA 3G2QA 4Z5XA 3RTDA 1FUUA 1LXCA 1U0BB 2CBXA 4XX0B 2PA3A 4BMYA 4I1VA 3O9VA 4L57A 4CM9D 3U19A 4Q7MB 3QLVA 2GJ8A 3VO2A 3BSYA 2Q29A 3U31A 1SCNE 3BB1A 1X86B 2N75A 1HKUA 3EXIB 2BFWA 2AGVA 4HNSA 3UJ9A 5B12A 1YTUA 3QTLA 2IV2X 1T8RA 1J49A 2NVBA 5J2TA 4KRYA 1O97D 1HM5A 2FE1A 2VZ9A 1N1EA 2WIKA 3W9BA 1XQVA 4B82A 1N4DA 1C1XA 5F12A 4EY7A 2IFTA 3GH3A 1IOWA 1E5DA 2B8EA 2BFPA 2B69A 1TYDE 2JGNA 3FCAA 3JZFA 1HSZA 1SHZA 2HAEA 3QVGB 3IR6A 1L5LA 5C4IA 3VPBA 2CUKA 3QKRB 1FK8A 2ZAMA 1QGYA 1RPTA 3SHWA 1IHPA 4C0BA 2RBEA 3NV9A 4H7IA 4L0QA 3F0GA 1R3DA 2ZQZA 3ZU6A 2XE7A 1UFVA 4PLPA 4Q7LA 1XHLA 3B6NA 3WK5A 1L4LA 1WUKS 3OOJA 1UBGA 4YJ2F 2JJ1D 2E5FA 1NPYA 1U7DA 2XQKA 1FDWA 4F4IA 1Y8RB 1D7OA 1J2RA 1H2AS 2KPOA 2QTNA 2ZJZA 2FOLA 2RGEA 1Q1BA 1KEPA 3O8QB 4H27A 4LSWA 5JPCA 2Q5QA 1C80A 2E3JA 3G0BA 3QHPA 1WKVA 2H06A 1ZI6A 2W0MA 3KZCA 7ADHA 1RHQA 1SBNE 1OZHA 1Q21A 2J9FA 1BJKA 1HLFA 1ZS9A 4DG8A 1DCFA 4BQEA 3NJ8A 3I5YA 2LE0A 3MEQA 4G85A 2FR8A 3BHMA 4BT2A 3FN4A 3K5PA 3M1AA 4HN4B 2UZ0A 2O14A 2QY6A 2XUKA 2QI9F 3H16A 4XIYA 5TQ2B 5CITA 1BQEA 1LDYA 1CY6A 4P4TA 1K9MH 1BCSA 1G5HA 2VRCA 1NFFA 2ECPA 2H7CA 5E6UB 3ZE7A 3OEHD 4WK0B 1IRXA 5BWBA 4ZK7A 2BMVA 2I6DA 3LQ1A 1PR1A 4HZIA 2ZXUA 4LG1A 4YJ3B 4ESOA 1D8AA 3RG8A 4PXSA 4M53A 5K3AA 1I3OA 3UT0A 4IWXA 2WB4A 3DBHB 1IHOA 1VTKA 1ULAA 2Q2WA 3BCRA 3D3JA 3LYAA 1I32A 1G21B 4J03A 4HD8A 4QREA 4HLDA 3THWA 5DHPA 3HBLA 4X6XA 4BGUA 1I6KA 1P8AA 4WV3A 2R8XA 1ODSA 1KSJA 1VLHA 3WXMB 1Z3IX 1PL6A 3G0OA 2QNRA 2D0DA 4FOTA 4J1QA 1ULHA 2D5BA 1RAGA 4P0QB 2JJYA 1F2VA 3FCUB 4KIGA 1X1SA 2HRZA 4FYHA 4HNHA 4KPUA 4AZ0A 3G5TA 1B74A 3OTWA 1KETA 5FJJA 5EIAA 2Y6UA 4XW2A 4CEIB 2JH8A 5FBHA 4BECA 5BW4A 1RI4A 4IGKA 1N2HA 1NXVA 1Z12A 5DOVA 4PYLA 1QF9A 2PYIA 3W2EA 3FOCA 1HE2A 5BT9A 3WJAA 4WOJA 2PKQP 3VH3A 4CI9A 4AY5A 3T4PA 2CD9A 3B1VA 4P5DA 4G88A 4PLWA 4G0XA 3AEYA 1G16A 1T9HA 2O8FA 2WSIA 4BT3A 2EZ9A 1PJ2A 3JRXA 4XQCA 3IQZA 1CYEA 1X1TA 5HFJA 1X1EA 3OH8A 2C83A 4TSFA 4DCOA 4I9GA 4G4ZA 1CZUA 3ACCA 1VFPA 4IJWA 4MUGA 4JNKA 4M76B 1U2DA 5HOQA 1M8PA 1OH5A 2BONA 3MVEA 1IHYA 3FNGA 5LDGA 3BFXA 3CPQA 3CKLA 3PPVA 3VR3A 3HV2A 1VBMA 5EGSA 2H48A 3NFYA 5TQ0A 3WQHA 5P21A 2B36A 2EQBA 2J85A 1XTRA 1XQ9A 4EQ6B 5SZKB 1YVPA 4K05A 3WPWA 2B1RA 2P4UA 1CUDA 3JQPA 1EDBA 4IXMA 2R00A 4ZPJA 3UMVA 5E4FA 3F0EA 2JAUA 1QIEA 4A7PA 2NLOA 2C4KA 3EULA 4I8IA 4LQCA 3W5CA 2FQWA 4DWOA 2HQBA 5IC6A 3EBOA 3LP8A 1BZYA 1PZFA 4Q48A 1RJ9B 3K0CC 1NLYA 4OKSA 2VKTA 3V7WA 1USKA 4WZBB 1PV1A 4DV5B 4X24A 4UHFA 4DA8A 4DM4A 5I7UA 3RC7A 3V7UA 4I9HA 2JCVA 4TT3A 3FVRA 5CLIA 5FPHA 5ECDA 4KVAA 4HDCA 1JJ7A 1YHZA 4HB2A 4IH1A 2UUOA 5I45A 2GYWA 1F3LA 1ZP6A 4KK4A 2E4WA 2EFGA 1H4QA 4BT4A 4ZAFA 2AMVA 3AEUB 4GFDA 3U9TA 9LDBA 1FOEB 1QOPB 5CHYA 1B8OA 2GHRA 4XH9B 2FVYA 1MJ5A 3KHSA 3T54A 1U0SY 4FX5A 3RO7A 5BW8A 1Z63A 1R9MA 1AZSC 3UGKA 4O29A 3AETB 4UNNA 4AYWA 2R66A 4D57A 1RHKA 3DNFA 1UM9A 3R3YA 2YJ6A 3NTQA 4XDHA 3ZDDA 3QJYA 1Q0UA 1DC4A 3D6NB 3DNPA 2QW8A 3PD0A 1N6HA 2Q4RA 2R6JA 4E32A 4EPYA 3IE2A 3GJQA 4URZR 2JEOA 4C0JA 4ZDJA 4L02A 2G1JA 1DEOA 4TS9A 5GV8A 3TYXA 4CMBA 4OXYA 3AONB 2RK3A 4UQLA 2BGRA 1SQ0A 3ZHOA 4E2FA 2EFHB 4M9UA 3FSJX 4J1NA 4XUCA 4I3FA 3U7QB 2QTAA 2QD3A 2DPGA 3TJZA 3Q11A 1RSZA 4OFZA 1PYGA 3SYKA 5IVHA 1PQWA 4KAJA 2QMYA 4ZYWA 4XJTA 3G5LA 3RRNA 2JAWA 3S27A 2PSJA 4TV9F 4A6PA 1E2GA 1PK8A 3DZHA 4OQNA 4RVFA 5FWDA 1P6XA 1DCMA 4F06A 4BE9A 2QHXA 2V6MA 3IOEA 5JH7B 1YQTA 2OK7A 3NDJA 3GRYA 5L3RA 3CZ5A 3ETDA 2JIQA 5J2UF 1M6HA 4TLCA 4A6XA 3CVXA 4R40A 1XTJA 1DXYA 3ESQA 3F47A 4B6FA 4H1UA 4I6JA 1LZKA 1EZ4A 4B09A 3FOEC 3KEGA 3NHAA 1ZITA 1P1FA 2OZBA 1J22A 4YLYA 2IL1A 4Q4LA 5GONA 4Y9UA 1QBGA 4HNGA 2IEYA 3RLIA 3VOTA 2VPIA 3WGOA 4AMVA 1JJ2F 3K0FB 3QKUA 3AXTA 2FKAA 1UMKA 4X3PA 2HSJA 3NWJA 1FQJA 1CUXA 1A9XB 4KUHA 3WZLA 3ER9A 2GLUA 4ZDIA 1XRLA 1LX7A 2G82A 1OXMA 2JASA 3GCZA 1SHUX 3PI7A 4ZOCA 3VH2A 1X0XA 1I7QB 2ZAUA 4OHFA 1HDIA 1QFSA 3KJXA 3QVOA 2FPMA 3EE6A 1C0LA 4IYRA 3Q3CA 2ACVA 1KJNA 3EDCA 4JLUA 4BLWA 3AERB 1C1HA 2FEKA 3L0ZA 1JHDA 1NMSA 5A62A 3H3XA 4C30A 1SUPA 2PS1A 3GJ0A 5CT6A 4B4VA 1A3CA 2FSSA 5HK9A 1L5FA 1C9NA 2Z98A 3EAGA 4XXHA 5B36A 4HAYA 3IMGA 6ADHA 5KPJA 3UOGA 3JAMM 2JLBA 2Q0QA 4CQNA 1ZG3A 1RXUA 3OIGA 2BPOA 3GDWA 4YUYA 5DBGA 1ZJZA 1C3JA 1JTFA 5LU9A 2ENUA 2QN9A 3GLHB 4XASA 1QHNA 4JI6B 4ARBA 1CSEE 1DIOB 5ICMA 1RQNA 2DPHA 3HS3A 1FFAA 2ETVA 1IV3A 2YS6A 3BXZA 3I58A 1RABA 5E6SB 1E9AA 3VNRA 5A1JA 2BF7A 2KI5A 3CH6A 3DPUA 4LDJA 5B1YA 2CLMB 2FSPA 5T8KC 4XUEA 2SECE 3DFFA 1OTXA 4YT5A 1ORTA 2NU7B 1GM5A 3HFGA 3UJ8A 4D0GA 3EK2A 2DBVO 3MXTA 3EG5A 1UC4B 3O21A 4RKRA 4C0HA 3UVEA 3GG2A 4KR9A 3DBLA 3DBRA 1FPQA 5EQFA 2OFXA 4MI3A 1P4AA 2VTEA 3T3NA 1TCAA 4C8GA 1N5MA 1POWA 1N2CE 1NW9B 2JGIA 3IAAA 1D2MA 1SOMA 3K71B 3CRNA 3MJDA 3WL3A 1GCGA 4BRZA 1A72A 5ALNA 4WKGA 1PI3A 3H83A 3SS9X 3VZPA 3M82A 3BXGA 1VP3A 1OQAA 2P78A 1S0UA 5EQJB 1JG3A 3UK1A 4WK4B 1W3EX 1E99A 3ZGLA 1OLUA 1M0SA 2JFZA 3G5UA 5BUCA 3DW3X 5JROA 2FR1A 1I51A 1M6VA 1J8VA 3C5VA 3F97A 4P7BA 3ZJYA 1E3IA 1U6JA 4Z4CA 5ADUS 4QE3A 1QGZA 2Y76A 3C6QA 3GOHA 1MEJA 1NA5A 1T8TA 1FBTA 1UBLS 4PHFA 3Q3JB 4RXMA 5E7JA 4CM5A 5EI5A 1DOZA 2G1UA 3GMIA 4MWEA 4R3NA 3DAFA 4YRLA 3WBJA 2DXIA 3CCRF 4HDKA 1V48A 1I3NA 2O7SA 4HRYA 3K5WA 4A6DA 4EW2A 5BSVA 4QDJA 4Q34A 4HWPA 3VR5H 2AOWA 4MICA 4TN1A 2AXQA 3AZOA 2E1PA 2WV7A 3S7TA 1CQIA 3G2PA 3FKQA 4QDZA 2PA0A 1O0SA 3GUYA 3OPVA 5AVKA 2V4ZA 3T7KA 5CVTA 2BGKA 4MKFA 2GZ1A 3O47A 4JMPA 1Y98A 4EGJA 1U99A 5D3MA 5FYDA 4QLAA 1PJLA 4FB4A 2E6UX 4ZYVA 3Q1KA 1VPWA 1AV6A 2FK8A 2KHZA 3CZ9A 4F4CA 3TI7A 1E4OA 2MSEB 3TVDA 1UJ5A 1US8B 2XW6A 3KNZA 3ZCXA 5DN6D 1G8HA 1C3VA 4TZ6A 4NYJR 2AJTA 4YUZA 2R62A 3NIDB 3K6JA 1VGVA 3SC2A 2ZJ8A 1ZCBA 2JLSA 3EYWA 4F4JA 1GFZA 2YN0A 2HF8A 2V0CA 5F98A 3RS5A 3L6UA 2NPOA 1XZMA 3JQDA 4AIIA 3AM1A 2FEOA 1JXOA 3JX9A 3DVRX 3PGVA 2FPGB 3WTCA 2WT4A 5JJCA 1W2GA 3IT0A 1JI3A 4QPJC 2BM0A 2NVOA 3E9CA 3ENNA 1YL7A 4YLEA 1GLNA 1LH0A 3KK0A 1JL3A 2AC7A 5DT9A 3IDZA 5E8RA 3PFBA 3UHPA 4WZAE 1XZGA 5J3JA 4YI5A 4DDUA 3MSCA 3KQHA 3RTCA 3FFMA 3VYSB 1GCOA 4WA8A 4IDCA 3LC1O 5CDHA 2R6CA 3ZGOA 2C0QA 3MJTA 4FI3F 3ESDA 1LS1A 1L4HA 1NXTA 2W2MA 2WE8A 3M1XA 2I2XB 4PWZA 2DHEA 4CKBA 5CFLA 5JAPA 3I2HA 1Z18A 1X25A 4FZ5A 3A6JA 4I4TB 5CA1F 1FTNA 4UM9B 1T0JB 3FVQA 1Q5PA 4JUIA 4RKWA 1KSFX 3WBBA 4JDPA 3GK3A 3MWEB 2C9DA 5T4FA 2BUCA 3PPWA 1QF6A 1ZRMA 4FJ2A 2BLNA 3H75A 4ZYZA 4OM7A 4W4TA 2RHHA 1M1NA 3B48A 3P52A 3AGPA 4GSKA 5FPTA 3ER8A 1U2SA 3AB3A 2FN7A 3FA2A 3OCJA 4UTZA 3TCKA 4R54A 4GI3A 5DWVA 5BMVA 2V7WA 4IVNA 5CJPA 4CE6A 1VQ6F 3WHLA 1N1MA 5IVIA 2Z6AA 2BEVA 1NXPA 2C00A 3L9WA 3U60B 1YQQA 3KL2A 5IKPA 1CHNA 2JFGA 2QNIA 2D7DA 1R4AA 1C3OB 4DV4B 1FDOA 2YZKA 4MXDA 1EX6A 5K2MA 1E77A 2EARA 1COMA 1BVRA 1EK6A 2EQAA 4U3JB 1KI3A 1P2UA 4ILKA 4PLHA 4FXPA 3JVVA 4UD2A 1G4UR 3TD6A 1YCHA 1O58A 1K9VF 4U9UA 2Q5JA 3RQSA 1V1RB 4HVAA 1TZKA 4U7FA 2WSYB 1XLTA 4XKJA 2XMCA 4MQLA 4MCIA 2ZB4A 1Y80A 2VPWA 3OZSA 2CEAA 3DBOB 1QIIA 4YHBA 2GBIA 3KR0A 4PBSA 2WSLA 3UN1A 1WXFA 1D7AA 4IDFA 3ROEA 1K08A 3C6KA 5KYTA 5A05A 4YS6A 4DIOA 4YTEA 5BV2P 5HKBA 5LMUB 2FEXA 2ZRFA 2FEMA 3D6FA 2AKAB 4X7RA 3LC0A 4N40A 5HPYB 1V6AA 3DD1A 5LVAA 1VL5A 3B9BA 3RE3A 3LW8A 3TW8B 1CEXA 3R0QA 2VI5A 2HWWA 3UC5A 4AM8A 4KJXA 2PRYA 3C8LA 3COZA 3OLVA 2IV3A 1VHQA 2GN0A 1M73E 5DMHA 4KL8S 2C5LA 3GXBA 3QFFA 5IDWA 4G0WA 2YMPA 3AGQA 4F04A 1SNYA 3PYMA 4PE5B 4Z54A 1QQ5A 1NMEA 1Y33E 1C0PA 3E84A 4AK9A 2ZRDA 2OAEA 4K9SA 2VUHB 4YBRA 1ZISA 2I4NA 2JGEA 1IB0A 1WW2A 3ENVA 2WPDA 3TLBA 1SXJB 4CTKA 1XJQA 4G4JA 4Q9JA 1K75A 3ODPA 4S0XA 4YXWA 3QKSB 4FN4A 1ZZGA 2D54A 1LK0A 1T0PA 3VPFA 2QRKA 5EKXA 2IS2A 2OFFA 1JDPA 4D0NA 2ZSEA 3AR3A 1U0FA 5L9AA 2YOGA 2XMRA 4GW3A 1SXIA 4NBNA 4FUQA 3TDNA 2ETXA 1UL1X 3HJHA 3PEEA 2OLKA 1Z7EA 3RH0A 2XIQA 4NQZA 3A05A 5C8YA 3DCJA 5DBEX 1QIKA 2GA8A 5TMEA 1HNNA 1ZCAA 2HMUA 2C3OA 2QPTA 3KDPA 1Q7EA 3PVZA 2VF4X 2ZRNA 4BKOA 4ZQHA 4LFCB 4TRNA 1JHOA 1W36B 4RTSA 3CCFA 3HFRA 4NPAA 4OQFA 4BV8A 4CV2A 4UTVA 4PHGA 1DU4A 3SIRA 3QW2A 2D1RA 5BSKA 1WE2A 3FZQA 3ZIAA 4PCUA 1LTQA 5K6AA 1ZH4A 5H0IA 3P7MA 3M1YA 1WA5A 2GXUA 2IHUA 2RFLA 4YRNA 4BRSA 2QL5A 1WXXA 5JJLA 3DHNA 3HJAA 4X1YB 1J06A 4UFNA 1HEYA 4QFCA 4FHZA 2M6SA 5EYPB 3CMCO 2OD2A 4Z7OB 4R3WA 2X0EA 1QOQB 3HDGA 4IEIA 1ZOSA 2BKXA 3NGLA 3I01A 4RAQA 1GTJ1 1GZDA 3D5EA 3ESXA 3VJMA 4Y6RA 1KGSA 3UMMA 3U1TA 2QDXA 4H59A 4MW4A 3R9XB 2X2FA 3W1WA 1G20E 3EQZA 4RZ2A 4XQ0A 1HXHA 4DJ5X 2YY6A 2WU1A 1V1MA 4B4KA 1T9KA 1YDHA 1O1YA 1TGYA 2C95A 1AA9A 3RS9A 4AVYA 1UFYA 5KMGA 2IF0A 4C7VA 1TZMA 4WJZA 3T9AA 4LOLA 1KZ1A 2V54A 3AR2A 4IWYA 3CLHA 4P08A 4JUCA 5FI5A 3TDKA 3V8BA 2C9MA 2AMJA 4KQJA 5FTJA 2P4SA 4AMUA 4E4RA 4QZVA 5ALTA 5I9NA 2HA6A 1VSQA 2JAOA 3A0RB 1U0OC 2RHLA 2FWMX 3ECSA 3U7JA 1DXHA 2XB8A 2QY9A 3LPCA 4DR4B 1CU1A 2HBYA 5K9ZA 2AFHE 4BQPA 3LWQC 2ODBA 1KE2A 2I8AA 5A3QA 1GZHB 5CDSA 5KTYA 5JI2E 2EYQA 3WGLA 2Q2VA 1P9OA 3TKYA 1S2IA 4JR0A 3GGSA 3EIEA 2ZBPA 3D8UA 1OX6A 4E2XA 4GI1A 1Z25A 4I6EA 3CWCA 4OTZA 3DHYA 3HY6A 4QEKA 1A5ZA 1RR6A 3QOYA 2YR0A 4OAQA 1EFAA 3OPYI 3RIMA 5HA5A 4OGFA 2O2ZA 1T4BA 3BH7A 3PFHA 5NLLA 5C31A 4EENA 1E79A 3KQOA 3O3NB 1H1LA 4QPDA 4UQOA 1M74A 5CU7A 4BNHA 5H70A 2O2HA 2Q62A 1PX2A 1JIIA 1TX4B 1IBSA 2RD2A 4MNTA 1DT5A 1ZNWA 1N6RA 2YWCA 3AJAA 3GZNA 5DHUA 3AP2A 4HAWA 4LKRA 4JT2A 5I48A 1NVMB 3IXQA 2GVDC 3BICA 4PLZA 4L5YA 1JHXA 2AQ8A 1CB7A 4UQPA 2AIRA 4AYXA 4F86A 2K7FA 3NTOA 2QUIA 1DJMA 2YMQA 2Q6IA 3L7DA 1XCLA 1GAWA 3ICEA 1WQ3A 2JFXA 2PIDA 3F6RA 3IUMA 4XZ3A 3U13A 1JH9A 4MUYA 1K6IA 1P2FA 1H85A 1OAPA 1WWKA 2PWPA 3PG5A 4YFYA 2DT8A 3CGWA 1XQ1A 4EI8A 1UDCA 1FRVA 2P4QA 1IM8A 1TCBA 3CB4A 3PLAC 2V3WA 4K9RA 1E66A 1P6UA 5CLLA 2CBZA 2B4AA 1BQ4A 1XVUA 5IP5A 2ZWIA 2D7JA 3RJ5A 4DV6B 3GBSA 4UHKA 2X9GA 1JIKA 3B13B 3FHJA 4GMKA 1KJZA 1RE1A 3IT3A 5LLSA 1ZH6A 5C0OE 4MW0A 4OI2A 2O23A 1RTTA 2ZT5A 5EE1A 1EXDA 2CLSA 1QR2A 3NBYC 3DDNA 4MV8A 2OB2A 4HKTA 1OAOC 3HR4A 4HYTA 2W43A 4MS1A 3IYLW 2VNKA 3SHQA 3SY8A 4XRGA 3ZXSA 1QH1A 2Q28A 2NNLD 4WCVA 4C89A 5JQWA 1PD0A 1OX5A 1RP7A 4OJNA 2IXEA 4JN6B 1ISJA 1UCFA 2IEDA 4HVCA 5ALRA 2XUAA 5BNWA 1TYAE 1PNRA 2UYHA 3FYSA 3NTLA 4WNCA 2OQ2A 2Z95A 3C74A 4QTTB 5JO9A 1G6HA 4HDNA 4OYHA 4AUMA 3TJMA 1KR5A 2RI0A 2ZATA 3KTAB 3KQNA 4NQRA 3NAGA 5KNLA 3QEMB 5HF5A 3U6KA 5FFNA 3RPEA 6AT1A 3ZWQA 5JDCA 3A26A 1FYFA 2Z57A 4FYMA 2V7XA 3UPUA 4G1CA 1W5TA 2D74A 4WVFA 2FUEA 3IURA 2CKDA 4O4IB 1XRSB 2AI3A 1TZCA 4V0SA 1LLQA 3MJRA 3MJFA 4RIGA 5ARDA 1HTWA 2HZBA 4Q37A 3K31A 4K1LA 5J1SB 3V8NA 3VISA 1JT2A 4U4AA 3KJJA 2YYZA 1WZIA 1DCKA 1ZHFA 4KGXA 2IW3A 3VAYA 2UYOA 1SR8A 1ARZA 1E2PA 1Z68A 2X0DA 3S40A 1ECFA 3G8AA 1NZJA 1JHPA 1YR3A 4U7DA 4WH0A 1UP7A 2PH7A 1ZJWA 1HEIA 3SF0A 1YR6A 2F90A 2H2IA 7MHTA 4EPVA 2JBHA 4Z4IA 4XQEA 3ZWWA 4OYRA 3IAM6 4RE5A 3U80A 2O5EA 4QASA 3V8PA 2BMEA 5MF6A 2VL7A 4BZWA 5JXGA 1O5TA 3UAGA 5M04A 1Z5GA 2Z8YA 4IH9A 5E1MA 2OLEA 4GSYA 1G8SA 1IK4A 2HOQA 3I8XA 4RPJA 3ROZA 4PR0A 1IXYA 4Q7KA 3N8GA 3E0XA 4D3YA 5MGBA 2HDNB 3JZIA 2HMSA 4WOBA 1KY4A 1VG9B 2OYSA 1X80B 2PMBA 3DULA 3H6HA 1OBCA 4LJSA 3BJZA 3FDZB 8GPBA 1OH6A 3ELCA 1GX1A 1W2HA 4OGKA 2M6RA 3DZDA 3BYZA 3B89A 3K1AB 2QLNA 3N8HA 5FV4A 3S1LA 1JFSA 2BC9A 1YI8A 1WMAA 3L4JA 2XSZD 5FTNA 1TIPA 4H7HA 2PVPA 1QZTA 1CJTC 5EIFA 3GRVA 3W6PA 2O20A 1P77A 4F6CA 3GG9A 5AVTA 2GPNA 2WP8J 4M1EA 1A77A 3W7BA 3TMAA 4OUDA 5EWJB 4F3YA 3QHDA 3G6EF 3HDQA 3I5UA 4GI2A 5GONF 3ZGYA 5E7MA 3DFZA 4YRAA 4Z9XA 1TGVA 3STTA 1JG4A 2BTEA 1D4ZA 2WB2A 5GINC 4IDHA 1P6QA 3NTUA 2Q1SA 2JVJA 1T2CA 4LXHA 4IVQA 4ARCA 1YH3A 1QPBA 5IABA 3BRSA 3SIXA 3MHTA 4QU5A 5JI3E 5KJEA 5JVDB 2HJ9A 1QHGA 3P9SA 2EEPA 4LX8A 3EXHA 2YDYA 2A78A 3QOFA 4ZAVA 4OI1A 3W2IA 4FWTA 3AVVA 1VSTA 2C7OA 1F3OA 4IHJF 3C6BA 4I55F 2OCXA 3HPRA 4KAFA 4R01A 1VXOA 2J41A 5AOBA 4CT5A 4AQYB 2DSTA 2DBZA 3E5MA 4YV0A 5BV0A 1MJGA 1LNZA 3F4LA 3P9QA 2QL9A 2ZI7A 1H0RA 2JGLA 4GPBA 3IJEB 4G4SP 3ZE6A 1PSDA 1Q57A 2FMTA 1N1DA 4M0DA 4OBWA 3I64A 1FX0B 1NUHA 1WSBA 3I3FA 1SK9A 1HYHA 3QU9A 1NF2A 4ITVA 4N54A 3R3VA 4WLUA 2CWWA 1QAHA 1M7BA 3OBBA 4Z0NA 1GPKA 2JK0A 4C4XA 3NRJA 2UYYA 4DCSA 4LXGA 1F2UA 4WY8A 3LWBA 1D6MA 1B0UA 3C9TA 1E3DA 2GF9A 3L6EA 4V0LA 3MAJA 3EPLA 4DRXB 1PT6A 4MMZB 1E2EA 1L5OA 2BTQB 2YN4A 4EZIA 4DV2B 1GN9A 1XVTA 4OQEA 3LKDA 4YIKA 4LYAA 1X9IA 2WM9B 3QH4A 3C14C 1SPXA 1YO6A 2PR7A 3AUYA 4N7JA 4YNBA 1JFLA 1E4VA 2W6JA 1SBCA 4FOSA 1OBOA 1RU3A 1NP7A 3N2GB 3AL2A 2QG9A 2NU9A 2FPPA 4X60A 3H5TA 3RBAA 1AUVA 4NQ3A 2PUEA 1U2RA 3KLPX 4JGBA 4GRAA 1TVEA 3HJWC 5E2AA 2H7VA 3OLYA 5K0CA 4C2AA 1LD3A 2TMGA 1JV2B 2H2FA 2ZIXB 4HDAA 1H65A 1JR3D 3QXGA 4DR7B 3FHTA 3ONVA 1PR4A 1W2WB 1YZFA 3JQAD 4Y2GA 4AJ4A 1EGAA 5FORA 4PQEA 4G36A 1MDBA 2E6KA 2I78A 3OOEA 2YIJA 2JZNA 4R2JA 2DULA 3VR4A 3PYLA 5C37A 3OIYA 4MR9A 1N8SA 1ZUIA 2GFIA 3PGMA 4ZU6X 4L76A 1Z4KA 1SQGA 4FE4A 1T4CA 1R4NB 2RG7A 3ITDA 4OFXA 3FY4A 4LRXA 2P2YA 3TTYA 1JKJA 1F8UA 4BGEA 3DAHA 5DNWA 4LZJA 4F56A 3AZPA 4BAZA 2IYNA 3S2SA 2Z58A 4UU1A 1RRPA 2PMEA 4DMFA 1FYEA 3ASYA 2YASA 3QF4B 4LZOA 4CQMA 4WFJA 1BMFD 1W42A 2WNSA 5KJCA 1A97A 4EF5A 1ECCA 3H86A 1X8JA 5DX1A 3AK4A 3C7AA 5AVUA 1O8BA 4EI7A 2UZHA 4FNAA 2PGJA 1PR3A 4H18A 3V2HA 4J94A 4QNRA 4BNTA 4W5TA 1K7FB 2C4UA 2QJRA 2RK6A 2C3YA 3PTLA 2HFKA 3H2BA 5DASA 5J5VA 3RSLA 3ERCA 3EPHA 1XDBA 2WAOA 1E3WB 3LUAA 4GUDA 5HEKA 1I10A 3A7DA 1QQAA 1ADGA 1PNQA 3ZYZA 4UU7A 3UV7A 2ZFUA 1RYNA 1GG2A 2P3SA 1VYHA 3N6RA 3WQBA 4MR8B 3E3OA 4CG2A 4EECA 5HP4A 4P1ZA 2ZUDA 3HP4A 2I99A 2YXLA 4FHEA 5U4XA 1J09A 1ZQ9A 3QYAA 4M2LA 4N0MA 4N47A 4AZSA 6REQA 1FMFA 1NBAA 2X5KO 5EP2A 4MAAA 3NPAA 4X7BA 1U9ZA 2E48A 2C5SA 3FYUB 5B7QA 3JASB 1RWPA 2O8BB 5C1OA 4FBGA 3BWBA 3F9RA 2JAHA 4FGSA 4MYSA 4IMJB 5HCNA 5FX2A 1J9EA 1YQWA 3H0CA 4ZALA 3L7BA 3A3YA 1I4WA 3FGPA 3LRTA 5CR9A 4JP2A 1XX6A 2ADMA 5FI3A 1E6WA 5EKTA 4MW6A 3V7YA 3ZE9A 2YWFA 2PQ0A 3IJ5A 5IAEA 1S8FA 1CUSA 1Y48E 2B5OA 2UDPA 3GN2A 2FQQA 2JFQA 4PS1A 3EOBI 4XX0A 4BQQA 3DYIA 5CLHA 2YFYA 4ENVA 2CHTA 5HQTA 2VGMA 5JD3A 5LOVF 4XIFA 4KE7A 3LWRC 5AJUA 3U5TA 1LPAB 2X7HA 3CNHA 1DKMA 2B7LA 1BW9A 1OTYA 4AWBA 2V6FA 5ALHA 3V1NA 3HA7A 2OV1A 2PLWA 3LDAA 4EBFA 1CRWG 2PFGA 3NAQA 4GT1A 4M9ZA 1IY0A 4O4HB 4QBFA 1L5VA 2VYVD 3IH5A 2R6R1 1UOQA 1IL0A 1SKQA 5KZMB 1NBIA 2BEKA 2BVNA 1WDTA 3I9LA 4GP7A 2Q0SA 4N5IX 1W1IA 3TMYA 4K81B 3IPXA 4BL5A 3QVGA 4L75A 4O3FA 3NUQA 4WLVA 1XFAA 1YCFA 2CVHA 1L4KA 1G17A 3GGJA 3VR2A 4ADSG 1LWOA 5JYDA 1HE3A 3H65A 3H5LA 3QKRA 1EUYA 2XV1A 1W0CA 3H1GA 1H48A 1Y0BA 3W5UA 2B3DA 3TRKA 1WHTB 4A8HA 2EJBA 3G6WA 2Q4EA 5L6MB 2E5LB 1C7RA 4DA0A 2PT9A 4LF5B 1RACA 4IR7A 1KORA 4CMIB 1YFKA 2I6QA 5ALPA 4EG8A 2GD6A 3SBOA 3WRVA 3TSZA 1Y8RA 3EEQA 3LT0A 5GTDA 5AH0A 3O8QA 1N25A 3D2BA 3KPVA 2GJ9A 3H9UA 3JQFC 3BBLA 3I53A 2ZTSA 2J3QA 3GFVA 4GMDA 3BSSA 5C52B 4MVXA 1G64A 3RIYA 1Y3BE 2NSDA 1Y34E 3RT1A 3KTDA 1P0FA 1WXWA 1XQWA 2HLHA 1MC4A 1UDAA 3RF6A 1WF6A 4YV1A 3A1EA 5TQ2A 1PP4A 5LP6B 4D4KA 4OU5A 2YW9A 3C9RA 3FTNA 5HXUA 2O1XA 3G8CA 2O06A 1UF9A 1DHTA 1H0SA 4LY3A 5E6UA 3KYJB 4R68A 1K66A 4CG3A 1EM6A 1XD8A 3T7IA 1QIHA 2PLNA 4MULA 1GQFA 4YJ3A 2CSUA 3AKYA 3DPSA 1CNFA 1PTKA 4FGWA 3IBFA 4NENB 5TSDA 3DBHA 2KLHA 3SHTA 3HYNA 5FBLB 2OC4A 1G21A 3EA0A 5HMLA 3U3OA 1R8YA 1W48A 3GZ4A 3IXLA 5BSTA 1ZVVA 1KQPA 2G9ZA 1IN5A 3ZW7A 1XTZA 4JGGA 4L4ZA 4IOKA 3WXMA 4AJNA 2HR1A 5EZYB 1UXHA 4F3TA 4AF8A 4D4LA 5DCUA 3LUJA 3E22B 2JLWA 4WJLA 2BJVA 4RSMA 2QN3A 2J5BA 1CY2A 1N2GA 4DC1A 1OUMA 2Q07A 3CISA 3M6FA 3NT2A 2VJBA 4CEIA 3VFDA 1Q77A 1GRQA 4WKPA 3E81A 1W581 4R9UC 3UKDA 1ZU4A 3CM0A 1Y1TA 3B52X 1N5OX 4BO8A 3FJYA 4UTOA 4C4OA 3DKVA 4KNWA 1J5XA 4PXYA 3OWXA 1AGXA 4RPGA 5DM2A 1FP4A 4BZXA 1E2FA 3TWOA 4K8OA 1AF4A 5A03A 1FS5A 5CCDA 2JIZA 1DTWB 3O94A 1EUQA 3S0WA 1JA0A 1QG2A 2C8KA 3JWGA 2FUG6 3OTIA 5AJTA 3WR5A 5J58A 1QFJA 2NXEA 1R16A 2XUQA 3TZCA 2JJ2A 1UMDB 2I3DA 2WM8A 1PYDA 3D2CA 3E58A 3SJZA 3OMLA 4CQJA 4D9NA 5BN5B 4D3FA 1MO5A 3L4EA 4CODB 1VHDA 2C54A 3N8KA 4RPKA 3C87A 3V1YA 4EQ6A 1JKIA 3HNOA 5K3CA 5DNAA 1Z56C 1Y1SA 1OLOA 4LVUA 4AKEA 4QJ3A 1UZMA 3W05A 3SQWA 2Z6UA 2B9VA 1JTVA 3HWRA 2J31A 1C7IA 4EA8A 1YDWA 4BFWA 1XC7A 1G21E 1W7AA 4GVPA 1TXGA 3BHJA 3H19A 5AVXA 2CW4A 2G4LA 3RRBA 1RJ9A 1PFUA 4XCXA 5JD6A 4B6QA 4EFLA 4US0R 1EX7A 1D2RA 3TQHA 1Z6XA 4WZBA 1XDWA 4E1VA 3WHIA 5KI6A 1RWVA 1O96B 4BN4A 1IVNA 1EBFA 2PWZA 3RT7A 2FDRA 1VG0B 3RNOA 5JQGB 3E9NA 3M1LA 4F11A 1OFVA 1WMFA 3BXPA 4FFBB 3QVUA 3VIUA 3SIPA 4CMCA 1UK9A 2V6JA 1T2AA 4UVGA 5A3SA 5SZHB 1YB2A 3W79A 1K8YB 1OVGA 1TUBB 2CNBA 2G5PA 4WT7A 3B1WA 1IG0A 3AEUA 4BBPA 4GWGA 3TZKA 4YUWA 3FOZA 3IKJA 4KXWA 3TLAA 2C1XA 4M0PA 4V03A 3ROQA 3H8JA 2VUUA 4HX2A 4JKYA 4KZPA 1HDRA 5LL6P 2O0LA 2QTWB 2ZR9A 3GEGA 4MWZA 5JNRA 2WJ6A 1IIRA 1KDPA 3E53A 4HFJA 4R5MA 3REQB 3UAXA 4D9GA 1T5DX 2YZMA 2YV2A 1MOZA 2QJFA 2ZSIA 3GX1A 4IGAA 4OJTA 2IYRA 4RDCA 5ALQA 3TX6A 1KU0A 3OPXA 3V7FA 3CWZA 3V8EA 3ZWBA 2XIJA 4R9SA 2FF7A 1IEVA 3IPAA 3THRA 3MUFA 4BO3A 3P71T 3D64A 4HPJB 3QY0A 2OM6A 1L7VC 4GOOD 4TKMA 3U7QA 4CW7A 1IY2A 2RGAA 4XFDA 1J8MF 1HFKA 1PFYA 2IYLD 2WZDA 2XOKD 4HMQA 4MKZA 4W5JA 5B3AA 5BN3B 3C43A 3DLBA 3LT4A 1DAOA 1XRGA 3QITA 3OP1A 3QBEA 3DEKA 2NT3A 5EPUA 4DIFA 5FI0B 4LF6B 1E5QA 2JA1A 2PKCA 2AE2A <