2RHJA

Synthetic gene encoded bacillus subtilis ftsz with two sulfate ions and sodium ion in the nucleotide pocket
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFLENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhjA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhjA01
3RYCB 4I50B 4O4LA 3RB8A 2R751 3CB2A 3WGKA 4IHJB 3C8LA 3JAKB 3HKCB 1TUBA 3JASA 1TVKB 2XKBA 4LNUB 4DXDA 2VAPA 5IJ0A 3JAWB 4YJ2B 5M7EA 4U39A 2R6R1 3UT5A 5LOVA 5CA0B 4O4IB 4IIJA 4HNAB 4O2AB 3JATB 5JVDB 2RHJA 3RYFB 4WBNB 1RQ2A 4FFBB 3N2GB 4TV9A 5ITZA 4O4HB 1FFXB 2BTQB 5CA1A 4TV8A 1W581 4O2BB 5LXTB 4I4TB 5J2TA 4X1KB 5LYJB 4TUYA 3HKDA 4ZHQA 3HKEA 4ZOLA 1W5FA 3JALA 5JQGA 3HKBB 5GONB 4X1IB 4YJ3B 5LA6A 5BMVA 4I55B 4F6RA 3RYIB 4DRXB 3VOBA 1RQ7A 3WGLA 4U3JB 5J2UB 4ZI7A 3JARB 5JH7B 5CB4B 4EB6B 5KMGB 2VAMA 4EI7A 4X1YB 4EI9A 2Q1XA 4O4JA 5JCOA 4X20A 5FNVB 5LP6A 3E22A 5MN4A 5KX5B 4XCQA 3V3TA 5JCOC 2RHHA 3ZBQA 5LP6C 1FSZA 2RHLA 5EYPB 5EZYA 1W5AA 3N2KB 5MN5A 5EIBD 1JFFB 1SA0A 5C8YA 3M8KA 3WGNA 5IJ9B 3RYCA 5IYZB 4I50A 3RYHB 3VPAA 1W5EA 4O4LB 4IHJA 3JAKA 3HKCA 1TVKA 3ZBPA 4LNUA 1TUBB 3JASB 4EI8A 3JAWA 4YJ2A 4B45A 2Q1YA 5IJ0B 5CA0A 3UT5B 4O4IA 5LOVB 2RHOA 4HNAA 4O2AA 3JATA 5JVDA 3RYFA 4IIJB 4WBNA 4FFBA 3N2GA 4O4HA 1FFXA 5ITZB 4TV9B 4O2BA 4E6EA 5LXTA 4I4TA 5CA1B 4TV8B 2VXYA 4X1KA 3VO8A 5LYJA 1W59A 5J2TB 3M89A 5C8YB 4B46A 4TUYB 3HKDB 1Z5WA 1W5BA 3HKEB 4ZHQB 4ZOLB 5MN6A 3JALB 3HKBA 5GONA 4X1IA 1Z5VA 4YJ3A 5JQGB 4I55A 3WGMA 2VAWA 5LA6B 3RYIA 5BMVB 4DRXA 4F6RB 4U3JA 5J2UA 3R4VA 1RLUA 3JARA 4M8IA 5JH7A 5CB4A 4EB6A 5KMGA 4ZI7B 4X1YA 3ZIDA 2XKAA 5FNVA 4O4JB 4X20B 5LP6B 4KWEA 5KX5A 3E22B 3WGJA 2BTQA 5EIBC 5EYPA 2BTOA 3N2KA 3VO9A 1JFFA 5EZYB 2GVIA 1SA0B 1OFUA 5IJ9A 5IYZA 3RYHA 3VOAA
chains in the Genus database with same CATH superfamily
1B16A 2B35A 3H8JA 1MQSA 1YS6A 3M6MD 3NBYC 4F6LA 4G4ZA 1OX4B 2VT6A 3AUTA 2ZSKA 1SU8A 1U28C 5KVQA 2FX2A 2OZVA 1VQVA 3NM5A 1HLDA 1WQ4A 4X3CA 1BDIA 3DLAA 1SK8A 2PQ6A 3F3YA 1VJ0A 4QPPA 2Y2UA 1W9HA 3T9CA 3DDCA 4RZHA 5ES4B 3KDSE 2LBPA 2Z6AA 3I01M 1NTOA 1TGYA 1DKQA 5EWJB 3FDXA 1XHFA 1QO7A 1QGZA 1QYWA 1KZ9A 4O4HB 1LA2A 1X1SA 3DF7A 2IYTA 3NHMA 4RGQA 4YBZA 2VDQB 2Z2KA 4TPKA 3N0TA 1LPOA 3CZQA 3PXEA 4R8LA 1VK3A 4UTRA 2FUNB 3A3PA 1YDEA 4W5OA 1FSSA 4D4KA 1IOWA 2EX1A 4MARA 3PDJA 4QU0A 4FKZA 4E6PA 4I1PA 2V0GA 4QD3A 2PPVA 3PITA 4ZQHA 4DLLA 1L5LA 2DERA 3QPBA 4TTIA 3P0IA 4PAOA 5HNKA 1WDKA 2RK6A 2O19A 4B31A 3AVWA 3MGBA 4N76A 5B64A 1EAYA 4X1YB 4J0QA 2ET6A 3SJ7A 5CUQA 3ABQB 4FFSA 1G3RA 1QHSA 3AOGA 3N75A 5BR1A 4Q9DA 5KX5B 4QQFA 4XJSA 5BN5A 1PJ3A 1XDZA 5A7HA 1SIBE 5IHXA 3JQFC 4DM3A 1PZEA 2GM3A 2GZRA 3QX7A 5G0VA 1B74A 1TM1E 1YJAA 2RGDA 1KC3A 3V7EA 1FRQA 1T9HA 1UXJA 2RB9A 3NMUC 3ADOA 3KDPA 3QLTA 1NVDA 2R85A 1HYQA 1XVLA 2G40A 1RJGA 1ZVKA 1JEOA 3OIGA 4BLQA 1YH3A 2WIAA 2X9VA 3IEIA 3L0OA 2Z3ZA 3VPAA 3WV4A 1PHRA 3I9KA 1I13A 5B1IA 1E0AA 4E21A 3AK4A 1QKKA 5TV2A 4D3YA 2ADOA 2DG2A 4CEJB 1JGTA 2C58A 1FFEA 5LJLA 3N28A 1C0IA 4O2RA 1K9SA 1TM3E 3GA5A 1DV2A 3ESYA 2WZQA 1FC0A 5BRJA 3T1NA 3VSCA 4XAQA 2F64A 1GGFA 3MRTA 1RR6A 1VP3A 2IYNA 1JEDA 3OZEA 2H4XA 1KRWA 5CA1B 1N7IA 1X39A 3TD5A 3MGAA 3NIFB 4DEXA 1ZNYA 5FTLA 2C61A 4P2BA 3K35A 3V6MA 1JJ2F 5CVUA 4CEIA 4ZOLB 4TXLA 1K68A 1TUIA 4MO9A 5BSFA 4IGAA 3F3MA 1QTNA 1RABA 1VHQA 4B3FX 4EYKA 3F0DA 2YNMA 4FJ1A 5TVGA 1Y6FA 2UXCB 4L08A 3HYSA 3H6GA 1F8UA 1KZGB 1X70A 3PIIA 2DFKB 4QFBA 1SPXA 2A78A 2WOOA 2G0TA 4P4NA 3S1SA 3FTFA 5E7MA 3H18A 3K9NA 1SZQA 1KYWA 3PTAA 1FUEA 2VYFA 1YHNA 1MVNA 4PX9A 1X14A 3MCQA 3HVKA 4KQFA 4MWSA 4BDSA 4CU2A 2YWCA 4JT9A 4ZOQI 3HUFA 3I58A 1ODIA 2G25A 4AO7A 1W1UA 5K20A 4UUBA 2GN9A 4DM4A 1DBFA 4M60A 4U9IS 1FYEA 4MP8A 1KXJA 3D81A 3HDQA 4TYYA 1R1MA 4DUYB 3U16A 1L1RA 1WHSA 4Q9IA 3EUWA 3ZU5A 3EQ8A 4BFLA 4DIFA 3ZWVA 3SMVA 3ETEA 1R0BA 2ZJ0A 2W4QA 3AFMA 4K1XA 4JVMA 3TAUA 3FBAA 1ZH6A 4P33A 5KNDA 3U4MA 3OTQA 4BV2A 4L3VA 4DFDA 4HUTA 3R9XA 4C06A 3SIXA 4IGFA 4BMXA 3OOYA 3HVRA 4OV6B 1WP9A 3WWYA 5JQGF 1T0AA 3SC4A 5JOQA 2OZKA 4M8NE 3ZEAA 8LDHA 4NZNA 1S2GA 2QGFA 1M1YB 4ZYUA 2JASA 1AN9A 1HL3A 5AVOA 1QYXA 3T9AA 4QUDA 3FZEA 4IM7A 4IYRA 3AZOA 4QU9A 1XAJA 1KE1A 2NU7B 3LAWA 4G1FA 3KJFA 3AUFA 1U3DA 1QMGA 3N1UA 1LK0A 3DBLA 3A0RB 4GX5A 4IFIA 3DPSA 2OTCA 3AY7A 1LQUA 1FDRA 2QOEA 4ZU1X 2VPQA 4QQ8A 1QGUA 1J8YF 3KOWA 4MCHA 3WJAA 4N48A 1J20A 1WCYA 1S2IA 1MG5A 2WV9A 2SECE 3CE6A 2UYQA 3TRDA 3V7UA 1N2JA 1KJ9A 4AJ2A 4BNDA 4CM8B 3CZ4A 5CDYA 1MFZA 3K4PA 2FDRA 1T3SA 2N46A 3ASZA 4QX6A 2IHZA 2G17A 1ZO8A 4R05A 4UHHA 2C92A 4YJDA 5HK9A 1MC5A 1IG3A 3LSYA 4OU4A 1FLAA 3RTGA 2UXDB 2XRMA 4B6QA 3F0GA 4CGYA 3KYIB 4NDZA 3S8EA 2XE4A 1Z0JA 1SCJA 5DOZA 3EPHA 3W5HA 4GPBA 1A98A 1UBNA 2VAVA 3A37A 2IYPA 1K06A 3UTDA 4ZT5A 4Y1FA 3FHLA 3GAZA 1SIUA 3C6ZA 3DV0B 1C4WA 2BFFB 4PHGA 3UOGA 5A7FA 5C8YA 4KR9A 4P83A 1JIXA 2EFEB 3CXCF 5EE5B 5DBEX 3AVTA 3PRKE 2BH9A 3MS7A 2X5JO 4KGXA 5IYZB 2JFPA 3ZUPA 1XKQA 1CR1A 2YWHA 3IR7A 4YJFB 4HV4A 5CDFA 4FD3A 3W79A 3DNMA 1Z4MA 2JJMA 3PJGA 4YUYA 3K12A 3IAS6 3QPUA 4CTMA 4P98A 1GUAA 2O6LA 1WMSA 1G3MA 4WKOA 4A73A 1HM5A 5FHQA 2L82A 2C42A 3GOHA 5D00A 1CWUA 1GZDA 1JT9A 2WR8A 3A9RA 5K3CA 3OVMA 5J2UF 4GLJA 3U4AA 4R98A 4DNOA 1YZVA 2YYZA 1PT5A 3DJFA 4Z9AA 3R7SA 4CKYA 3BJMA 1T8YA 2C5AA 3ECSA 3IYLW 3MTBA 3A9VA 3HKDB 4JL6A 3GELA 1ODCA 2D8MA 4GBGA 3DE7X 1P6QA 3RW9A 3TZEA 2ZUDA 4DADA 4DLXA 4LX8A 2I2DA 3IAM1 4XPIB 5EPEA 1JKJB 4UFPA 3ZVMA 1M6NA 4JLWA 4MEJA 3W2FA 2RI6A 1YQXA 4RZXA 3U3JA 2IUSA 3QEMA 1YT5A 2G1UA 3NBZC 2HZBA 3JZFA 2ASEA 3B1FA 2NYUA 4MVJF 4GO1A 3VYSC 1ZRSA 4OLHA 3UPDA 4FCCA 5D1HA 2LCIA 3EGXA 2XI4A 5LP6B 4G1VA 4WN9A 1R88A 3KWLA 4ENWA 1U5AA 2JFZA 3BTUA 3CX6A 5BVGB 5KYYB 5FADA 4EA6A 1Q86H 2NVUB 4BY9E 3VI4B 4PYJA 3KHUA 4DNPA 3FYTA 1QR2A 5EJ2A 2QA4F 1UM8A 4C8GA 1I36A 3IP9A 3A9TA 3OUZA 4KPUB 4GEGA 2JCVA 5JCJA 3UT6A 2OCPA 1YL7A 4RTSA 4S05A 1LX7A 1I24A 1OT5A 1KI8A 1W4CA 1GEEA 2Z83A 5GAPK 3O3OB 2CHGA 2CXNA 2GTHA 1X7HA 5HZKA 2AQ8A 3QFRA 5JAQA 5DM1A 4BGEA 4C7OA 2WT8A 4ND3A 3M3DA 3V8NA 3BD8A 3KE8A 1UBUS 3B9PA 3W5SA 3FFBA 4IBOA 4KXFB 3UFBA 1R2QA 1JLMA 2IDJA 3O2QB 2AOTA 1YJNF 1G1MA 2QGNA 3AFNA 1N6KA 2EW8A 1UP4A 3U3DA 3JTEA 4E15A 1IB0A 1VPLA 3NTQA 1OTHA 3QTYA 5K6AC 4CNBA 2W7TA 1J8QA 3HKBB 1ESEA 1I3KA 5I8ZA 1UIMA 5AM0A 3GFTA 3UCXA 3UXMA 4NCKA 2XQGA 4BLOA 4C7KA 5CEEA 2YFQA 1M8FA 3BIXA 4IIVA 1Z18A 2NZUG 3QELA 1BD4A 2DSTA 3M82A 4N8DA 2CNKA 5KMGB 4RHYA 4X7MA 3NXKA 4DWWA 3D59A 3RG2A 5J4VA 1CEYA 1NVGA 1XTUA 2C99A 2EZ4A 4RV4A 4WE3A 5G4KB 1GLNA 3VR4H 1XC7A 4MDHA 1R4MB 2HT6A 2WKWA 2FWPA 3Q12A 5JCZA 1JH9A 2BFAA 3BOSA 4TWZA 3FJ1A 3NTRA 3RT1A 2W6JD 3E9YA 1TCVA 5EYPB 5DLQC 2C31A 2Y6VA 3FUCA 5CCBA 4M9CA 3NWJA 2AB0A 3KQYA 2GTIA 4A8JA 2DE0X 4L5BA 5JHHB 2PQMA 1NUUA 1UH5A 4N8SA 4L4ZA 2C7PA 1TGVA 5CM2Z 2MSWA 3HJAA 4UU1A 1UEXC 5HKKA 4D99A 4IVRA 4GPZA 2RFLA 2P65A 3L8ZA 1XTQA 4BPBA 1P1CA 1NVFA 3DS8A 1GKUB 2GARA 4QDKA 5BY2A 3FFAA 1TD9A 1X7ZA 2B78A 3UXHA 16PKA 1TAUA 1F0NA 1O3YA 1Q21A 2IGTA 1AKEA 1NBAA 3O94A 4I36A 2HV8A 1ZWLA 5DV9A 3VH4A 1PQ4A 3NI2A 1E2HA 2AXQA 5BW6B 1FB5A 1FLNA 3C3XA 3RHTA 3U4GA 4FWTA 2IP1A 3GYGA 2O0HA 1I7NA 1M66A 4G2TA 4PLCA 1C2TA 4PIVA 1DL5A 2DHEA 4W9NA 3SBXA 4RQOA 1P2VA 4GF5A 4GWGA 4DAOA 3OZXA 1F6BA 3GFOA 1JA1A 1GV0A 1LPPA 1TJYA 5C8ZA 5I48A 2CC2A 4I55A 4IIBA 1JFTA 3O8OB 3CVOA 3LBAA 3QEJA 1A9QA 1GG8A 1VQ6F 1UK6A 1SCIA 4C87A 1BW9A 2DPXA 4G3XA 2X8LA 1YD7A 3BRWD 4N3CA 3R0IA 1SU7A 4REOA 4O4LF 1QZUA 1W3EX 4ZT4A 1BX0A 1TO1E 3LA8A 1E99A 1EA7A 4MVJD 4UKDA 1NONA 1TM4E 3OP4A 4WZBA 3C9UA 2C03A 4DUZB 3DPUA 1TXGA 1FP4B 4FDAA 4V0ME 4B3JA 2HD4A 4NY1A 5I7SA 1RC8A 1HRDA 4MPDA 3K1JA 1Y80A 1LQTA 2DT4A 2EJCA 2IU6A 1GZ0A 4H4DA 4DLRA 4P84A 3FB1A 4GI5A 2CWDA 3OMXA 3D7MA 4NH4A 2YV2A 1JUDA 5HZHA 5LU8A 1KI9A 4RACA 1CQJA 4HKTA 2WU3A 4AP6A 3C8UA 1CZUA 1DTWA 1G8AA 1T36A 1QQ6A 5H02A 2W2LA 3ENQA 1PT6A 3JQEA 4L8YA 4BMZA 5KNBA 2H9AA 1E9CA 2JL1A 3A7DA 3I28A 3PS9A 4Y6QA 1DIOB 4GI3A 3CVVA 2QRHA 5EMLA 5HMLA 3W3AH 1XMJA 1VJCA 1CQIB 1VP9A 2H2IA 3I39X 3K7EA 1VIDA 2D4HA 3L4SO 4HO1X 4N5IX 4TMFA 5TPWB 2F00A 3WFIA 4DCVA 1W581 1IATA 1VE1A 3OT5A 1G16A 3B1XA 4C0HA 1PZXA 1T6NA 2D54A 2HN9A 2SCUB 2QL9A 5SZKB 3MELA 1BE8A 3KK0A 1YCGA 3VYTC 1T0KB 2X2PA 2Y93A 3F5MA 3P27A 1VHLA 3WMFA 4OQLA 1E1CB 2FPLA 1ZCFA 1EZ1A 2SNIE 1UQUA 3EDYA 5EPOA 2PH3A 1XCOA 1J90A 1TT5B 3HR7A 1EM8B 5EXPA 1F2VA 1M74A 2I3DA 3ZY2A 5E9WA 2CV0A 2QM8A 3NEAA 1QOZA 4QQRA 2O3SA 5TT1A 3EVBA 4NABA 3TLBA 3UCFA 1XR3A 4NU6A 1RJFA 3GYBA 3UMFA 3ZCXA 4CKEB 3EXIB 1E2QA 4LMPA 3LC0A 2NVOA 4BO4A 2NUPA 3TW0A 2P62A 2QLFA 4E5SA 3A6JA 2P2YA 3AXSA 7MDHA 4BNHA 4F4UA 2AOXA 2HJWA 4EGAA 1ISHA 3OQJA 5F7OA 3ZQUA 3G9QA 1W85B 2XXAA 5ILQA 1F8YA 1OGYA 1ATZA 5KYWB 3DC2A 1DQPA 3G3EA 2W2QA 2HA4A 3EOAI 4KSBA 4JT4A 1V39A 1B41A 4TXMA 5CMLA 1TFUA 2B3TA 3AHFA 3JR3A 3TB4A 1OGJA 3D4OA 3Q3JB 2NXCA 4MQ6A 3QBVA 3EQ7A 3INGA 4KQHA 2JW5A 2QIPA 3SIRA 1KKLA 1UFOA 1YNSA 3THXB 3C8HA 4QYTA 1VKZA 2IZ5A 5DCVA 3TIIA 1IUNA 1P2DA 2A9RA 4HS9A 4KV7A 2EKPA 1GZ6A 3NM6B 1E2JA 1V7PC 3EA5A 4RZUA 2VH2A 5HIIA 1V1MB 4QJ4A 2OCXA 1GITA 2JJ2D 2P6PA 2NPFA 4BMDA 1EFVB 2O2DA 4KO4S 1Z8FA 1SRRA 3UJDA 4MIEA 3K94A 2FQYA 4HUQB 4PC1A 4QATA 2C4NA 5FTJA 3GHYA 4EBFA 2UZ3A 3MTGA 4UNNA 2GA8A 1JEYB 2RBGA 4MGYR 1T8UA 3GEGA 5K2OA 2WJ3A 4K3VA 3CA8A 4NENB 3AUSA 2UU9B 4R2IA 2HU7A 2KSQA 3IDZA 3L79A 4WVLA 2B37A 3PTLA 1YNOA 1CDOA 2CZQA 5FWXA 4B35A 4DIKA 5L51A 1G59A 3FUVA 1JSCA 3VPXA 1E0DA 5FUVA 3CX4A 1ORVA 1V9LA 1NUHA 5DWVA 1KBZA 4B83A 1GPAA 4CL3A 3OUTA 1KOJA 3LWNA 2GERA 3KXLA 3C1AA 2NW6A 2P2NA 3CCFA 3CSUA 4TRMA 5EQDA 3RSZA 4D97A 1A8IA 5LDHA 3O1HB 2A9FA 2AC4A 1SBQA 3TMYA 4OREX 2W48A 1ZH4A 4RPCA 5BN3A 2ZBDA 3WSTA 1RQXA 5L6LB 1T6BY 3BIWA 3KEFA 4QUKA 4B2LA 2YWEA 1T6ZA 1EFDN 4K9KA 2FN8A 2BCGY 5H5JA 3ZIAA 1H4QA 3D6JA 4LYYA 2PL5A 1A5TA 2R751 1XLTC 4YN3A 4YEDA 4CPDA 3S0HA 4GWLA 2EQ5A 2IDMA 3I6IA 4X54A 3D1VA 2BBWA 2PKCA 2PSJA 3D5QA 4KBYA 4M0DA 4ZANA 3W8DA 2FZEA 3BKWA 3JQGA 1TCCA 2QZSA 3NP9A 4KH1A 5FBWB 3WWPA 3KYJB 3Q8KA 2ZQ5A 3G9XA 2ZK7A 3C3CA 3QKTA 4FFRA 4MK4A 3FOBA 5CXXA 3DLBA 2CJWA 2IAFA 1F4LA 3JQDA 3F7NA 1O0BA 2FPXA 4HAIA 4FYIA 4I46A 1XCBA 4U4AA 3TDKA 3I55F 4DTCA 2G1KA 2RGAA 5L4NA 1U9ZA 2F48A 1PR6A 1X7PA 5F2EA 4L6AA 4ALMA 3E35A 1E94E 4FW9A 1IQUA 4PTZA 4BKOA 3PNVA 3JAMA 3HXOA 4DNXA 3SIWA 3TLCA 3T80A 1Q44A 1US8A 2ZI7A 1EE9A 2EGHA 3Q7IA 5AO9A 5SYAA 3SJBA 3K15A 1GTVA 2LKDA 5L45A 1KEVA 2ONCA 3VPSA 3PQ8A 2W5UA 4MTCA 1SVWA 3H2GA 1UZUA 3FCSB 3CXUA 4YUXA 5FLKA 1PFKA 1QVAA 1N6HA 1INLA 4NNPA 3B9QA 3ZU3A 2J33A 2G6BA 2WA2A 3CISA 3IKEA 1GCUA 3FBWA 3EXAA 4HDMA 4RMHA 3EVDA 3P0ZA 2YIJA 2EDAA 1U7PA 3PXUA 1RAFA 3NH6A 2G4LA 2MSLA 2OXFA 3PJEA 3QV2A 1Y6RA 1OX4A 3HMKA 3COSA 2PUAA 2X76A 4KH0A 5BT8A 4XJXA 1E7WA 2OD7A 5G4LA 3DPIA 2C2YA 3N8NA 1GU1A 3EVNA 4WFIA 4NBWA 3OW2F 4LHYA 3ZZ1A 4DIMA 2CXHA 1EFLA 4IFEA 5ELLA 3DEYX 3WJ7A 4KXNA 5EWJA 1F4PA 4RIIA 5C4MA 1WXIA 1Z2NX 1GG5A 2ZRKA 3UJ3X 1XSEA 1Y5IA 4O4HA 1P4GA 3HGTA 4ZDWA 5CVTA 1EUCB 1OWPA 2C4HA 4WCVA 4BYGA 5HYVA 5LB4A 5KYXB 2SKDA 2WPDD 4IMJB 1VHJA 2ZRCA 2LBXA 1Z38A 3TFOA 4EHJA 2J46A 3AIMA 1Z0AA 2JI7A 2X9GA 3GJSA 1U3UA 4OM7A 2PYDA 4TXNA 2QTLA 5KJEA 3OY7A 3VMFB 3HCFA 4P7GA 5TRTA 1AZWA 4MH0R 1WIWA 3T5DA 2HDOA 1O5IA 3G6KA 3CBGA 2EKDA 1Q50A 1J9EA 3N8DA 2ZBRA 4KX5A 1ULZA 3JQAD 4N0QA 4NS4A 3W2TA 1IXRC 1HT2E 1IV3A 2ERXA 2NYVA 5IULC 2R5WA 4JYMA 5B57C 3CWZA 4X1YA 3MDOA 1C81A 2GRUA 3TTSA 5DHPA 1E59A 1H94A 3MWFA 4D4IA 2PSFA 3PUZA 4YPFA 1RI4A 5KX5A 2Q7XA 3KR1A 4RLFA 5IFKA 5ISMA 2QRUA 3GDGA 1K0UA 4AMYA 1IZYA 4C6HA 5CDFE 4L7VA 3R5FA 4Q9HA 2RAVA 4XFDA 4DBVO 3MLEA 1E9EA 3RC1A 3SR3A 1OUMA 4OGFA 1SVMA 1ML4A 2Q3LA 3L18A 4WK6A 3LWVC 1D0SA 2B61A 5GP1A 1HG0A 2AFIB 1DCFA 3DAYA 3KPWA 3PK0A 4ALKA 2HGZA 1HYHA 1GNVA 3F4LA 4L7QA 1WSBA 2KTUA 2ZITA 4IAOA 4CEJA 4Z9BA 2VJPA 2OO7A 3Q8HA 3WKAA 6ABPA 3QHDA 2VRCD 1FQOA 3B6KA 3P1JA 5CBKA 1V41E 3PXBA 2ZTLA 4G0PA 1J7HA 4MCAA 4BZPA 2I2AA 4R0MA 5K0JA 1ZH8A 1WPXA 3II6X 4E7PA 2QTVB 5FOSA 1BU8A 4EY6A 1TRHA 5CA1A 2W6IA 2ZVQX 4HB4A 3INNA 4MZXA 3CLRD 3NWEA 4TMTA 3M5CA 3A4TA 4JLNA 1U8UA 5CJPA 3CG6A 1RCTE 4X95A 1WUIS 2MYUA 3OQ1A 3M4ZA 3ZDQA 4ZOLA 2HPVA 4IS3A 4NBLA 3ESBA 4DJDC 3GLGB 3AF3A 5K45A 2I3GA 1DDIA 5I3CA 2PYZA 4LOJA 2EWWA 1A5BB 2FSVA 4WQMA 2JGKA 3VTZA 1AGYA 2UYYA 4UPEA 5TE9A 5JPCA 5EJAA 3M81A 1KI6B 4A1OA 1A82A 2XUJA 3OIUA 3LE8A 2FEOA 1W44A 4V0KA 3TAXA 2OOSA 1UAGA 2HBZA 1DRWA 3HBNA 3WP1B 3D4IA 3LKBA 3B82A 4Q3BA 4RSRA 3SJUA 3JAMM 2R60A 5A3JA 5KYKA 2EKZA 4GOKA 1UC4B 1U80A 2A5FA 3EGDB 1MO2A 3FWHA 3JQBA 5B6IA 4X97A 5LMZA 5B3AA 2X13A 2FFAA 3PWTA 4G97A 5B7GA 3KJEA 3THYB 1Z08A 2ZI6A 2BTUA 5IAGA 3H9GA 1TIBA 1QRAA 5DK4A 1VQ8F 2CDBA 3PPXA 2ESRA 1ZSVA 2YIDA 1IAVA 1C29B 2HDHA 5JNTA 3KTOA 3PHCA 2Q6IA 5F77A 1Z13A 3MBKA 4OFZA 4YV0A 3J81M 1LBSA 3C24A 3AWIA 2QMHA 3X3HA 5AIBA 5HJ7A 3F6MA 3LT0A 5JJBA 1IXSB 1ZWZA 3IESA 2DECA 3MAAC 1L5RA 3TBFA 2YRXA 3S5JA 1M1YA 3VPCA 4JXKA 4RTQA 3MJSA 2DAPA 2J3DA 2VCYA 1ID8A 2VAXA 2CBZA 3LZ6A 4FC6A 2P0EA 1DOHA 2NU7A 3QI7A 3PEYA 4MRAA 3MBIA 4ZYZA 2IYQA 4S24A 3BIOA 1CUDA 1W59A 1G60A 3S81A 2R8ZA 4X6YA 1E7SA 1TFRA 2PZAA 4ZHQB 1VE3A 1WCXA 3CF2A 1YE5A 2FW6A 4X7BA 3IKLA 2UVDA 1R0LA 3T4UA 4WXPA 1JEQB 4CM8A 3TLYA 1L3CA 3E7DA 5JSHA 3W5AA 4DMGA 2MMCA 2W2TA 4B6EA 2FUG6 1IFXA 1X3LA 5K0NA 4J75A 4RKRA 2D0IA 1AE1A 4YV2A 1HTWA 3BZBA 3UHAA 1U7UA 4IH1A 5BUZA 2JIQA 3CONA 4RUKA 2EXXA 3HACA 1P0QA 1FUUA 2AS0A 5I47A 1ODJA 1V2GA 2ZT6A 4I1VA 3AP1A 4O25A 5DZSA 2C98A 2C4MA 3DV0A 3ZPXA 2BFFA 2C7BA 1HSZA 2R7MA 3NDJA 4AROA 4H1HA 1B0UA 1EPUA 3QG1A 2HIAA 1D2EA 1HMYA 1V6CA 4TV9F 5IYZA 2BHTA 3OCUA 3RSQA 1TEHA 1VQ7F 4HFMA 1MD9A 4YJFA 1R64A 4J8PA 1RHUA 3MIZA 4Q3NA 3PFBA 3AIIA 4ENRA 3ZV6A 5KYXA 4PTLA 3MYYA 1MEJA 2C20A 4UUPA 1GNQA 1E1RA 4Y2PA 1BKDR 1SVIA 3L46A 3NALA 4PONA 5H0IA 4JKYA 2PAFA 3KPUA 4ALLA 2AW5A 1FFHA 2ODNA 4CMIB 4JITA 4HAZA 2AJLI 2N0SA 1R0RE 4L9RA 1TPYA 4F0JA 3E3LA 1XMQB 1CTQA 4UNQA 4D9GA 4BJHB 3PUIA 3G8YA 4UM5A 2G0AA 2CSLA 1SOAA 2OLEA 3JXEA 4FSHA 5LYJB 2O3TA 3HKDA 4Y67A 7ABPA 1WBDA 4A0FA 4AZ3B 4F9TA 4JSYA 2BM0A 1EZ4A 2GNOA 5C7LO 2A9KA 1ORWA 4XPIA 3OWOA 1JKJA 3AR7A 1BMFA 1QAOA 4KQCA 1N9ZA 3I0ZA 4M49A 4OSEA 4WZBE 4KQGA 3SDSA 1GLVA 4XGQA 2WFMA 5ILGA 2WAXA 4DKXA 1AGRA 2CUNA 3RC8A 1JB9A 1JN0A 2B4YA 2Z5FA 1UQRA 2J5RA 2QEQA 3GP5A 5LP6A 3C6BA 3GMDA 1C9EA 4D82A 4BN5A 5KYYA 3UNXA 3RU9A 4E12A 5BVGA 2NYAA 3RS5A 3TZKA 5DISB 1DAEA 2ZATA 2G9QA 4RHAA 1IZ0A 4G9EA 2Q4EA 3ZP4A 3F47A 3GD7A 4O4IF 1WXWA 2YHIB 3DDHA 2D7CA 5GIOE 2CDCA 3J80A 3R9WA 4ZI3A 4E2FA 5REQB 4KPUA 1EP2B 2JIMA 1JR3A 4G2NA 3S2GA 3LT5A 2JCSA 5FNZA 5JU6A 4BAZA 5AVUA 3CC8A 5I7HA 1ECBA 1Y9ZA 3DZCA 1ZCBA 1ZNZA 2LIVA 2Z08A 3JVIA 3R5JA 5CT5A 2X3UA 5ERYA 3H3JA 3ABZA 4CMBA 4ER0A 4EUHA 3ER9A 5IVHA 1FP6A 2QPTA 4CRWB 4P0QB 5B3JA 3TK1A 5DNUA 5DNYB 3PKJA 3BHJA 1SCDA 4TL9A 5GINE 1Y9JA 2BT4A 3ZX4A 2PCJA 3P7MA 4NDNE 5DHFA 3FVVA 1RHMA 3AVYA 3KQKA 2HPZA 1JEAA 3WBKA 2FPIB 1DIAA 1TEXA 4AB1A 1CUEA 3COPA 1KO5A 1A8HA 1CIPA 3VO8A 1II8B 2I6FA 3VTKA 3T54A 1SN7A 2X7JA 2PIDA 2JAWA 1MAHA 1NC3A 4LJAA 2QAJA 2ZSEA 5A2QM 3LFHA 1NNUA 5FWAA 4CIBA 3OM0A 4C4PA 1ZLXA 2FJPA 4MW1A 1Y9EA 3HKBA 1H93A 5PNTA 4H08A 1DAGA 5D87A 4F3YA 1UJ4A 2BMDA 2ACWA 3R44A 2XZDA 3AI1A 3IAEA 1I4WA 3PF8A 1VL8A 4GZ3A 4PG8A 2YIMA 4G8CA 2ZREA 3V4ZA 1EVKA 1U6IA 1OAOA 5KMGA 1WBBA 4ZI7B 3TOVA 5EOVA 1N5JA 1K8YB 5BWCA 1USGA 3NU1A 1NWCA 2XKAA 5G4KA 2QGZA 5KEIA 4ZV9A 4KQMA 1R4MA 4ZCRA 1WZEA 2BRUA 4J0EA 4Z9XA 3HXQA 3FBGA 4MJ3A 2PX8A 3IBGA 3P4YA 4RHCA 5DLPA 3FZYA 3PQ6A 5EYPA 4NE2A 4NU8X 4OKSA 4BNJA 4WZ6A 2VPPA 1J2TA 1RXSA 2RKOA 4RGVA 5HG0A 1C3JA 5JTTA 3PC8A 3CCMF 1X9IA 2XV1A 1HBJA 4FCVA 1LF0A 2FPOA 3NKVA 1B93A 4EHAA 3M33A 3GFBA 4LXGA 5ALUA 1J9GA 3BIFA 2XOKD 3IODA 4GXNA 1Y98A 2XUAA 3VI3B 4DSOA 3GLIB 1E8MA 3TL2A 4EW2A 1EFAA 2XE7A 2PSSA 2KWIA 3ISTA 2V8OA 3CRQA 2VZ9A 4JQZA 4C7VA 2EBWA 3PNSA 2PKRA 3BTOA 2X6QA 4Z0NA 3B60A 5AYVA 3VRHA 3RA5A 1U7HA 1LBQA 1CY7A 2YWDA 3LDAA 3OC6A 4HAWA 1YB5A 1GLGA 3BJEA 3PP8A 1XVAA 3TEMA 1J2YA 1IJBA 1JHXA 3T1QA 3ZD7A 3TE7A 4KN9S 2WFAA 1GAEO 5CVCA 1QVFF 1B0ZA 1BA2A 1AKYA 2B8JA 2WF6A 2XVMA 3CIOA 3BHNA 3L5KA 4LRTB 3VSDA 1VHTA 3O4VA 4DDUA 5ICMA 2OCIA 2HZ7A 4YMUA 5KYGA 1XI2A 1O5TA 2YYSA 3O8OA 3R4CA 2XUZA 3CLTD 1P2FA 4JBHA 4MP6A 5NLLA 2XUPA 5GTDA 4V02A 4YAOA 2R48A 4NCIA 1CFZA 2DRIA 5CFLA 2H9IA 4FMCF 2B4TO 4EKEA 3ZO8A 4R1UA 3B1ZA 4GECA 4YAGA 3UUGA 4IEEA 3I2JA 1C1XB 3WOVA 5DN9A 3IOMA 1XUOA 3RVPA 4F7DA 3FNRA 1FP4A 3PEWA 4HX5A 3DNFA 1VDZA 3IV7A 4F6CA 2ZJ6A 1P60A 3RNLA 1L4HA 1CY0A 2UYPA 3ELWA 1FMCA 4KGVA 1VLMA 5CT4A 4D9MA 4B3SB 4E07A 3GPCA 4AJEA 1JW9B 2OGTA 5J40A 5F7JA 4EG5A 3WC4A 5FP0A 5CG1A 1OQAA 3S28A 5A6VA 4W5QA 1PSDA 4D3SA 3MC1A 4V0NA 1P5ZB 3J80M 1OBHA 1U9JA 1FBNA 3DTTA 4R9VA 4ZT6A 3T41A 3RUCA 5JZOA 3TD6A 3ZQKA 1MW9X 1LJLA 4ZOBA 2ADMA 4RVNA 3ZDYB 4IV8A 1CQIA 1RAIA 4B82A 5JRDS 5TPWA 4GPEA 1SWVA 3T7KA 3CPWF 4Y7DA 1AURA 2VK4A 2QQEA 2JHCA 4C4WC 1KU0A 3QF4B 1W88B 4BQPA 2NN3C 2VXYA 1HE8B 1S89A 3NM4A 2SCUA 4RDXA 3C8MA 3T61A 3BQNB 3C5EA 4G23A 3D8TA 1ZUD1 2HNBA 2GCNA 2Q45A 1OH7A 3LPCA 3NDPA 1L5SA 1E1CA 2QMQA 4FPXA 5JSUA 2A3RA 1D5WA 1D8AA 1TT5A 2BC9A 1EM8A 4WOKA 4H3SA 4JEHA 2AFRA 4Y7CA 2IWRA 4TZ6A 4B47A 2PL1A 2CKMA 2XCUA 1AVTA 3R3ZA 4MA4A 4EY3A 4C4AA 1D6JA 2ILVA 3E3MA 3G7NA 4FQ7A 4DA4A 1P2TA 2P8SA 2WWRA 1QIJA 5E2IA 3TZLA 4CKEA 3U39A 3EXIA 1M2HA 4IIGA 4D6XA 4YUAA 5HX7A 3Q3CA 2XIQA 5BWLA 2ATXA 3CCUF 2IW1A 2GHTA 1K3FA 1D6SA 1POXA 2QT9A 4JOCA 4CMKA 4G81A 1NJ8A 3O8QB 1MTZA 2ONYA 4BLRA 2D0OB 3ITDA 3DT6A 3PA8A 1Q1NA 2ZKLA 4N39A 4QEKA 5IT0A 1W85A 3H0CA 3IAFA 1VHWA 1U65A 2HDNB 1U28A 2WJIA 2I4RA 1QZTA 5KYWA 2BYTA 4YP1A 4XWWA 1M5TA 2J0EA 2VBCA 2OHGA 1U7OA 5F12A 4LYJA 1BZYA 1SHJA 3CG0A 2OXEA 5AW9A 1JTFA 1CXZA 3SSNA 1UXKA 1Z68A 3BCSA 4D44A 2LTAA 3FRJA 2ACKA 1JBEA 1GADO 3THXA 3GG9A 1JR2A 4H7FA 3QH4A 1UBSB 2MINB 4CIAA 3CH4B 2YOFA 1WOYA 1RKVA 1V1MA 3A26A 2V96A 3L8YA 2DY1A 1UDRA 2CSUA 2QNRA 1EFVA 2E4AA 2ZTMA 2DTXA 1WCWA 2ZRMA 1UJMA 1RYBA 4XCVA 1W75A 3TZQA 3BE6A 1N4DA 1Z15A 3EIEA 2P4HX 1N2CE 2B20A 4HUQA 4XIIA 1JYSA 5C7IO 3HB7A 5C37A 1SBZA 3UMMA 1JEYA 1LV7A 1SR8A 5I3ZA 4FOLA 3TE6A 4Q1EA 2Q07A 4NENA 2HYIC 2REQB 3K9QO 4N54A 3DKIA 3ET4A 1RYDA 3LZCA 2P2DA 2IG8A 1UAYA 4IVQA 2WWIA 4CT0A 3IULA 4G89A 1ZD1A 2Z9CA 2RKBA 4FKMA 2VQEB 1RADA 4I50F 2ZOSA 3KCQA 4L9WA 3C87A 4BB5A 3EFOB 1H85A 1KFCB 2YNMD 4L6CA 1MC4A 2Y8EA 1V5WA 2FW7A 1VJ1A 1P2SA 2GD1O 2PS9A 2ZFUA 3AEYA 3JQFA 3L6RA 2GBGA 4IHQA 4AMBA 1KQOA 4BNIA 4EFKA 1X52A 4QVIA 4L4UA 1X42A 3TQFA 5JCPA 3R41A 1Z4NA 2BZ0A 1SGWA 2RJ3A 1KVRA 2EZTA 3PNKA 4MMXB 4Y18A 4DMCA 1SIWA 4HQKA 3A1TA 1RYZA 3WGNA 1RLOA 2BJVA 2H8KA 5EHIA 1O95C 3JSAA 2DETA 5BYJA 5B6PA 1YZKA 2I62A 4M0PA 4AO6A 4ZI2A 3RLIA 2CZGA 2C0PA 2FR0A 1J4AA 4NOLA 1IXKA 3I8SA 3NR2A 1D9ZA 4Q7JB 4H7PA 4D3ZA 3WKEA 2QZJA 2YFKA 1S8AA 5SYNA 2MJLA 4IIEA 4DARA 1WS6A 4DBLC 5F2OA 3JYNA 4V1CB 3HEBA 2JLWA 4YRGA 1DKUA 2GYUA 1UAAA 1KJYA 4MUXA 4PIPA 1EX9A 1RI2A 4KLRA 3VCZA 1D6NA 5FPKA 1PV1A 1UR5A 1O0SA 3D7RA 1O8CA 3ON5A 4L85A 3L49A 3G02A 5IDXA 4MW9A 4POOA 1PJTA 2LKCA 4AG5A 1DFIA 2M6RA 2Z8YA 1M0EA 3K1ZA 2H1HA 4U8HA 6Q21A 4ZOCA 5A5EA 5LXTF 4MKHA 4B34A 1GGMA 2Q5EA 2G36A 3WAGA 1AK2A 4B79A 1J0BA 3UF0A 3MT7A 3FFXA 2YN2A 1FVOA 1FXWF 1R6DA 2OKGA 3F97A 1FJXA 2VUHB 3F8WA 2ZKIA 3BE4A 3FYDA 1NKSA 4PX5A 2OZBA 4YP9A 2DY0A 2DR0A 3HNRA 3IBTA 3IVMA 2MSEB 1FXUA 1XTVA 1LCIA 1IC6A 3KSDO 1FIUA 4GZMA 2QSUA 1R8XA 2GLXA 1TQHA 2Z1NA 3H5OA 3QVJA 4JVOA 1SKMA 1MZVA 1SH7A 3VC2A 1J56A 3BMOB 1CZHA 1GARA 4M1EA 2IYEA 2AVDA 3KVYA 3QQ5A 1JSLA 3R09A 1D2CA 2CFRA 4MLZA 2P11A 4ZAXA 1DJPA 4EF5A 3OC0A 4LJLA 1JU3A 4V0SA 3FPEA 4URWR 3STWA 1CDEA 4KODA 2UYGA 1I80A 1M34B 3EMBA 4ILKA 3MNFA 4K0RA 3TCXB 2JHPA 4ARBA 1VJTA 2I2CA 3CIFA 4CM4B 4CR8A 5DNCA 2R6JA 2FK8A 5JBIA 2FQ1A 2X9QA 1JKXA 2NZYA 1JX6A 3ED5A 1YBVA 3GLVA 3DVAB 3LGSA 4K6CA 2OHOA 3OPNA 4FLFA 4QA9A 2VPZA 4UAJA 4D9IA 1GTL1 4D96A 2XUKA 1AS2A 3QYAA 1EUCA 1MA3A 1ZNQO 2H8GA 1M1ZA 1XN1A 1YZFA 2IEBA 3AUUA 3DZ8A 2PX5A 3W6OA 2W98A 2AIRA 2OXTA 3ZVLA 4DT1B 1GP2A 3SHVA 1GA4A 3RQSA 4HPXB 1YE8A 4RX1A 2ODQA 2Q6LA 5KJ1A 4IDCA 3CEAA 4QO8A 4KVAA 3PUWA 3VMFA 3IQZA 4RM3A 1L3IA 5EKXA 2LWIA 1Y7PA 4ACAA 1YMVA 1WSDA 3R3YA 1RYMA 3FGOA 3LU1A 4H6PA 1KFJB 1GFIA 1YVPA 3N2LA 1ZGAA 1U3WA 2PRIA 4QASA 2FP3A 2YZGA 3CT6A 1E0KA 4FEAA 1E62A 5CDTA 3L4KA 3QENA 1GILA 2BZSA 2OTMA 1L7QA 1XROA 2J3KA 2I1QA 4X65B 4WESB 4N0PA 721PA 1ES9A 2RIPA 2MU1A 2HPAA 4PO3X 1W52X 1JIUA 3WTCA 4NBVA 3Q9SA 1D07A 4P4UA 3C6YA 5TDHA 4KG7A 3W4JA 3WPXA 1S01A 2PTGA 5J43A 3SQWA 1Z6XA 4N40A 3PQCA 4C3UA 3OU6A 3IB3A 3WRVA 4FE3A 1A2BA 3R7WB 2JFUA 1F1BA 2QG6A 3IS3A 3M8KA 3R5TA 4M0EA 4UHEA 5DLYA 1WWKA 4YUVA 1PL8A 4JT2A 5FAXA 4W63A 2YHSA 1A8QA 2AFIA 1SY7A 3RTDA 3ZR4B 3E0XA 4IDDA 3G71F 2CUKA 3ZUGA 2C5HA 1QIHA 1Y0BA 3KKEA 3O3CA 1GPMA 2JEYA 3O4FA 5GV8A 2PGJA 3PQ3A 4LKRA 2X77A 2A0WA 4UM7A 2DM6A 2MMGA 4MB2A 5LQCA 5AVVA 2TMKA 2IHTA 4YRPA 1V96A 2BZGA 5CRIA 3RARA 5EHXA 4E5KA 3LOUA 3NH9A 4G0OA 1AF4A 1NVUQ 2R66A 4QGHA 4IPTA 5LUAA 1G38A 4MQMA 2O5RA 4JOSA 3BMQB 4Y2TA 3FUWA 3TOCA 4D8UA 4L8FA 4HVCA 2YXPX 1G64A 3EXFA 2QTFA 3AEZA 4WOJA 4PINA 1DCMA 1E1DA 3OF5A 2HSWA 1VBNA 4BLVA 4DG5A 4F2GA 2HT1A 5FFMA 2ERYA 1X77A 3GLGA 3PFWO 3Q3VA 2C5SA 2AXNA 3H9JA 5HUHA 1HTBA 3BAFA 4OHPA 1I33A 1N4AA 3SZMA 5LIRA 3TTWA 2Y1CA 4F6RB 1KI6A 1LNZA 3FOEC 2QENA 2GJ8A 3VU9A 1CY4A 1FLVA 3TTXA 1RVV1 3QNMA 1ZRNA 1JXAA 1N8RH 4HDRB 2Z8YM 3ENKA 4MEAA 3O6VA 3I76A 1Z2EA 4L2IB 5EHGA 2YC2C 5FULA 5G0UA 3H8WA 1IJKA 1TTQB 2ZG6A 3F7MA 5JSKA 1RT9A 1M8KA 2YXEA 2AJBA 2R44A 3O8DA 2VXBA 3EGDA 4ME6A 5BR8B 2VBIA 4N3NA 1GZ7A 1U0RA 3PC6A 2A94A 4C2AA 3VYRB 2JRCA 3OKAA 5IT9A 4E08A 1C8BA 1SXGA 2GFQA 1U3VA 2VPYA 4AS1A 1N2HA 1UOEA 1OXKB 1Z75A 2B0JA 2EBFX 2FAXA 4RMJA 5AM5A 5HVNA 2Q9BA 3THYA 5JPIA 4CFZA 2ZP1A 2PUDA 2D2IA 4BB0A 1I2DA 2X4LA 3K0EA 1ZOOA 5EXDA 1O58A 2YZMA 3MK31 3P97A 3FCUB 1TLFA 5KHAA 5K3AA 2ZQYA 3F2IA 4OTZA 1X74A 3KT3A 4OQYA 1C7QA 3P2EA 1RHRA 2D1QA 3Q6NA 2JJYA 4IF4A 4P3OA 2XMPA 4R9RA 3PFFA 4ZTBA 3JPWA 1X1QA 3ZNNA 3UAVA 2BUAA 1E6UA 1M8JA 1U7XA 1XJWA 1FNNA 1GPWB 2GLUA 3BYZA 3V7QA 4HNAB 1EXWA 1F7VA 4EVSA 1YQTA 4XWTA 3M6VA 2HK8A 3QE9Y 4LXTA 1A8UA 2KI5A 4AJPA 2Z5LA 2QTMA 1A9YA 1OFUX 4MHOA 2B0CA 5DH9A 3PXXA 3U9TA 5EIFA 1RFLA 1ZU5A 2OMEA 3R5XA 1WXEA 4ZHQA 3R9IA 3VR6H 1RW4A 1BA3A 4F21A 4YRMA 4JA0A 4IZHA 4URVR 1XMVA 1I6WA 2I6UA 2VTDA 4Y9SA 4EAAA 1JEQA 1HOXA 4KI0A 3ITKA 1ZOSA 3DE6X 4WACA 3WQSB 2ONJA 1ZY2A 5B58T 4RU1A 4CT4B 3IHWA 1LPAB 4HAXA 2A9PA 2DKFA 4DDMA 1Q57A 3K8ZA 4MS4B 5EKSA 2GJ4A 3QOXA 3ZWNA 2VJAA 1KAEA 3CY6A 3FDZB 1FPQA 5JO0A 4KQJA 4MV6A 1QRUA 1K66A 2J41A 3WL3A 4PN7A 2YVKA 3AZQA 1Z6GA 2G80A 4Y6SA 3L7JA 2CFOA 3E9RA 3RK0A 2E4VA 2P9YA 4HNRA 3URMA 2ANBA 1UBOS 3H0KA 1AUVA 1YKFA 2Q21A 5B3KA 2W6ZA 4LJ9A 4DDWA 2CHQA 1OXMA 4MSUA 4I9HA 4I4CA 4RF5A 3DOJA 3BSWA 4FU0A 4P58A 3SMQA 2QAIA 4O5AA 3NK7A 3C6KA 4LV8B 3WQRA 3JWIA 1WL8A 1Y7LA 2VHVA 5C1IA 2HRCA 1NT2A 1ZD4A 2QX4A 3C85A 3LHFA 3OTIA 4WXYB 2VBGA 4QSHA 3VPDA 1LC0A 2QE7D 4JVSB 5K0ZA 4I8XA 1UDCA 3H7IA 4FJ2A 3BZUA 2IV7A 4QG7A 4BRSA 3F73A 3TG2A 1XGKA 4R2JA 1YB1A 1SUDA 4K8OA 3SSAA 4CMIA 1JE1A 1DU4A 2XDQB 4I8IA 4EG7A 3TS1A 1G291 4PXYA 4Q4AB 3UW1A 1GUFA 2AOVA 2W2LD 3QBEA 2QP3A 1SD2A 5KNBD 2QQ0A 4ZRDA 1NXWA 3V42A 5F9FA 5LYJA 4FYVA 1E0SA 3KQHA 3MJTA 1KAOA 5KOHB 1CVRA 4AZ3A 2NOAA 4YCMA 3PT9A 3DYBA 4OO3A 3DWFA 2X0FA 4DG8A 4DM7A 4LSMA 2GBIA 2QZPA 1T2DA 4J91A 1M7HA 2J4CA 2EL7A 3LV8A 3QM1A 4PO9A 1ORDA 1U8TA 2RBKA 2WPNA 1EJ6A 4HPJB 3QMWA 3O7MA 1L4MA 1ZA2A 5FTMA 3JQRA 2GDJA 5BP7A 3KKZA 3RRNA 3OY2A 1YJCA 2QX8A 1ZJWA 1PNRA 1RZUA 3JZDA 2R6CA 1QFMA 2WIKA 4LWOA 1U3GA 2P1ZA 3AKEA 2Q5OA 1Z2CA 2ZDGA 4RKQA 3NDBB 4US0R 2NACA 4HQRA 3TGPA 2GZAA 2CDAA 5KBYA 4MB6A 3RV4A 2YHIA 4D80A 5B4VA 3RVLA 5JC1A 2ODAA 2ZQZA 1SZCA 3FNHA 2V9CA 4I6GA 1TA4A 4N0MA 5REQA 4KPGA 1T9KA 4D5EA 5CDUA 4LIPD 1L7XA 3QHPA 2IYUA 2IY9A 4X7RA 4B75A 4M1TA 3LCJA 4P7BA 4J2OA 4G5FA 3CURA 5IT9M 1QDUA 2EIHA 3UKJA 2HB6A 3GARA 1ONOA 2A2ZA 3L7CA 1KP3A 4NZMA 5M04A 1KKUA 3MUNA 2O1WA 1H5QA 4GP6A 4NI5A 5JAPA 3MB5A 5EHNA 1ZSNA 4ND4A 5JXJA 3BG5A 1MOZA 4RPJA 3QVMA 5CA0B 5AD1A 4UEKA 2A4MA 4NL4H 1NZDA 2X86A 4BVJA 2FPIA 3ELYA 1XRPA 5I9IA 2I3AA 1ADCA 1II8A 5EHQA 1KNJA 1V9SA 5FCDA 5IANA 1NG1A 3NYWA 1VZ3A 2VNSA 1REQB 2JLZA 2MR5A 3C48A 4EY5A 5IFLA 3BPSA 5IZ4A 4A5SA 1A7KA 2Q49A 3TBHA 3WWCA 2IZ0A 2QVLA 4FOPA 1OR8A 4TGLA 2PSEA 2ETVA 3ZE7A 5KDOA 2JVKA 3Q5EA 1RXEA 2F9LA 4K88A 1BG6A 4PGFA 1G7CA 1PV4A 4F92B 1FEZA 3D5TA 2HW8A 1N25A 4TKZA 1WXGA 4ZI7A 1JYFA 1U8EA 2H31A 5JH7B 2NADA 1U3PA 2O05A 4LYAA 1PX0A 3TLXA 3RUDA 1IPHA 3ISJA 3PI7A 5A9RA 5KU7A 5TMBA 2WSLA 4L5YA 2AF3C 4DLSA 1ZGCA 1Z4KA 2H1LA 3FDFA 4YMLA 3SP1A 2J67A 4Y2VA 3WL5A 4ZHYB 3ZH2A 5SY4A 3VO2A 2ZPAA 3AP3A 5KC8A 1KEZA 4OUDB 1PD1A 4RS4A 1U4OA 4R5MA 4TRNA 2GPNA 3HV2A 1E6MA 1KP2A 1O7JA 1YRBA 1VXOA 2WY2D 4AS2A 4Q39A 3SJCA 1M6YA 1PL6A 2FW1A 2JK1A 1Q7YH 3DJYA 2BBSA 3GLIA 1UMDB 1WEHA 4GXRA 1SVKA 5AVQA 2IH2A 1IJEA 2FYTA 5JPDA 1PR0A 2HRYA 3F9IA 2XVAA 2LRHA 1IUPA 1H9CA 1JHQA 3O92A 1H48A 2BGMA 3G85A 2KBEA 3TSZA 3ZIAD 4EKNB 5AW8A 2NXJA 3P0FA 3FFMA 4MGKR 1Q81H 2HO4A 2I4NA 3F6CA 4DLWA 5I8PA 3I62A 3TUJC 2Z58A 4FK8A 2Z57A 1TW2A 2QW0X 3QU9A 4HN9A 4W82A 4H35A 3V1MA 1UJBA 4HNSA 3JU3A 2ZUCA 1KHHA 1E9AA 1D5CA 2VUTA 5ICSA 1J49A 3QLJA 3KSAC 3CCSF 2YVUA 4HN2A 4RFVA 2H29A 2AZDA 4QDUA 2Y71A 3TKLA 1DIHA 3NUGA 3IUMA 2EC5A 3TZCA 2DR3A 5LYYA 4KLNA 3DAFA 3NVMB 5LUBA 1I51A 1UT6A 1EK6A 4Y9DA 2HHLA 3T4EA 4AG6A 4AMZA 4RJKA 3TQOA 4TTQA 1E32A 1XZCA 3K0KA 4YJHB 2PEZA 2RGBA 4M8SA 5I7EA 3NETA 3PC2A 3LLVA 4F1KA 3KYDB 7GPBA 2WKSA 3M0EA 5CNJA 5EIWA 3QXJA 1CRLA 1FW8A 1Z5UA 2L17A 3O74A 3VVLA 4ECEA 3FUUA 1C1XA 2RG7A 3HB1A 2EJUA 2JCGA 4IICA 1ZLYA 3RVSA 5K0EA 5JJIA 1N0HA 5A9SB 221PA 1BOOA 1I32A 2AMLA 4P34A 5EEHA 3TQCA 4AJOA 4DMMA 2DHQA 2FV8A 1ND5A 2UYHA 1TLLA 3RJ5A 3G68A 5F2KA 4EOGA 2VTBB 3DLCA 1GGVA 4E2XA 3K0AA 1ZCZA 1XLTA 3M6UA 4TX1A 1VYVA 2O7RA 2GPTA 5TMDA 4AIRA 3KU4A 5JSZB 5L3ZA 3RF6A 2MTBA 2JHAA 2J4FA 1C9JA 1G20B 3TEJA 4ITUA 4G4VA 2PANA 2ZIGA 5TMEA 3KT0A 1PK7A 2V74B 1XDBA 3KPYA 5AQ1A 3W1VA 1X1CA 1MFPA 3GMTA 1JSRA 3JAWB 3PLAC 3KIZA 1K75A 3V7FA 3DZDA 3LUBA 1O6BA 2JFWA 4Z2YA 2FEPA 4V39A 3VR5A 3P94A 2OK7A 3GCWA 5EJ4A 3KUDA 4KE7A 2GN6A 2RDMA 3EPJA 2J0SA 5DLEA 4F3TA 3QF4A 5EESA 1W88A 1PNVA 1IBRA 3TDMA 5IJXA 1V5IA 1W19A 1Z8DA 2QNIA 4L16A 4LDAA 2H2WA 3LWZA 1JHAA 3CUUA 3UYKA 4FB5A 3FDJA 3T7TA 3RIGA 2AR7A 1M72A 1ISFA 1ELOA 1SUFA 3GQBB 4LFBB 1OPRA 1R9JA 3G88A 2IF0A 4JYAB 2OBLA 3T94A 1IOLA 1O9GA 4FFPA 2PZ8A 1VQLF 3MMXA 3SU8A 3M84A 3M1LA 4BLPA 2AE2A 1AN0A 1Z28A 2PFKA 4IDQA 3WDLA 4QOJA 3IEWA 2FHSA 7REQB 2PGLA 1WABA 4I99A 2LR0A 1Z4IA 1R5OA 1ISPA 3SKVA 5F64A 1SBHA 2BONA 2X19A 3VDRA 1E5LA 3Q88A 2A14A 4R2KA 5AXAA 1KBOA 2LBTA 1BHO1 3O8QA 4JSTA 4Y9RA 3UHFA 2XTZA 3N2KB 1ORHA 2O3JA 1RXWA 1GQQA 2CCGA 4OB8A 1K7EB 1CEQA 2EJVA 5C5DA 1NQ3A 2BKUA 4EGQA 4AN4A 1YRWA 1PBNA 3G2HA 2EFCB 2ZT5A 4C20A 4MPRA 5C5IA 3WE7A 1U1CA 2PKXA 2XE8A 4FHCA 2OGZA 2E2WA 3DEFA 4N01A 5FXMA 4EF6A 4Z51A 2W6OA 2R6AA 1ACMA 4J3NA 5MGNA 2Q1YA 2CD7A 1F12A 2FPWA 4B33A 1XZFA 3P4UA 4GYJA 5KQLA 2MINA 2OP1A 4PX3A 4ENVA 1NXSA 1U11A 1QRDA 2B36A 2AN9A 7ADHA 1CUXA 5DBHX 3ZY4A 4PBSA 1YK1A 1A5SB 2OLKA 3AT1A 2B30A 3IVCA 5KJFA 1NURA 2D4AA 2V8BA 3AINA 2JFHA 2HQBA 3B3FA 1ZMBA 2C7OA 1KEWA 2PT6A 1Z22A 1TZJA 1P3Y1 4MKRA 1QHFA 4RXMA 3JALB 4XCXA 2REQA 2W6ID 3AYXB 1LSUA 4ER6A 4ZCIA 2H00A 4C4RA 2DUMA 1EI9A 3IRVA 3ZU2A 3GH3A 1IY9A 1UBJS 1YUNA 4LXHA 3SJAA 2CMDA 4U63A 1CY6A 3CLUC 4AX4A 3RRJA 3OBWA 1M2FA 2HEGA 3HADA 1Q1GA 4PQEA 2R87A 3EFOA 2F1RA 3V1KA 4Q00A 3ZG6A 5KPJA 1PO7A 3ZWDA 3VVCA 4O0LA 1ANKA 3ONDA 3RK4A 2AFIE 5JY6A 2IDZA 3SOPA 2GVNA 3BAZA 1XZPA 5A5FA 3C9SA 4PHTA 3LZDA 3GJZA 4ZVQA 3VSBA 3KQPA 3OTGA 4AJ4A 5LN1A 3GVCA 1YJXA 2Q2QA 5C1OA 2NAFA 4ARUA 4CKCA 3RSLA 2YR0A 3UMSA 4TZ0A 5GWXA 5CGZA 3HU5A 4YIHA 3VOAA 2ZF8A 1X7XB 1A0OA 1I4DD 5DSZA 2J8ZA 4OHZA 4AZVA 2Q0HA 4K2HA 1QVRA 2AJ8A 4IHJB 1W30A 2FEKA 2NO0A 4V1CA 3LM8A 3NZEA 4UUMA 4NRDA 3MTDA 1LF5A 1I7LA 1DBPA 1NVKA 1Z73A 1GKLA 2WRZA 5D6NA 3K5IA 5HDQA 3ZNOA 3UGJA 3TD2A 3O85A 3RFCA 1NE7A 4S1TA 3GLGE 1LLQA 1Q8RA 3RJ9A 1DAFA 5G1NA 1CK2A 2GPWA 1F17A 1U0EA 5KTKA 1L8AA 3I42A 2FUG1 4I4TB 3QVGB 3E9ZA 1BE1A 3ESXA 4MGEA 5AXCA 4S1PA 1BMTA 2FX5A 2NSJA 5MFZA 2H4WA 1KVTA 4KZKA 1UPTA 4MYTA 3OJ0A 3K9FC 2GN4A 1W47A 1DC5A 4ED9A 4PSUA 4E51A 5JDIC 5JAIA 2Z5GA 2Z2YA 1ND6A 2OQ2A 1GM5A 2X1MA 4RIFA 4XQCA 3B8EA 2XF8A 5WRFA 2VLIA 5LZ5A 4MI3A 1D09A 2NP6A 2VWHA 2RB4A 1PLKA 3L7YA 4D02A 2CJXA 2IDKA 1OGIA 2CXUA 2WD9A 2Q7OE 3DCJA 5AVYA 3EVZA 1Y63A 3PCRB 3QNWA 4MMYB 5E2AA 4BTLA 5D7BA 4X00A 2W22A 4ZAVA 3H8SA 4H16A 1P1KA 2QPOA 3A31A 1UODA 3FWKA 4H4CA 3MS4A 4J29A 4L51A 2RHHA 1EUZA 1V3UA 1W57A 2A9VA 3NIGB 3I3FA 5KYVA 3VZPA 2H1OA 5G0SA 1NE2A 1E1LA 1R8YA 4B4WA 4NQZA 4B9AA 5J58A 5MN5A 3ANNA 3BMOA 3MT0A 1P0CA 1PWEA 1SOVA 3L6OO 3ZV7A 4L8VA 3BXOA 4E09A 1JAZA 2JAOA 1OH5A 1RBQA 3HCBA 4R5HA 3WKDA 2JCXA 2CEAA 1M34A 3C6MA 4X8HA 4CM4A 2R62A 4Q34A 1MNAA 1ULBA 1XTTA 3MFQA 4TS3A 5D85A 1T1SA 1JH8A 4P4GA 4BVFA 2WEKA 4ZK6A 3SR0A 3R0ZA 2ZI9A 3UUEA 3KL2A 3DVAA 5JAUA 2LXNA 5FRDA 3UT5B 1GO0A 4AO8A 1QUEA 4HCJA 4UHJA 1K98A 2G5CA 2VYNA 3WFJA 2QBYB 1G2IA 1E1RD 3DC7A 4DT1A 4HNQA 2REOA 1QCZA 3E9CA 1HURA 4PNZA 4TUYB 3NT2A 3DVQX 1C7FA 4C1BA 4F45A 3NXSA 1QFJA 4DNQA 1R4ZA 4FVTA 3F8SA 3FWZA 3LECA 4OLBA 4YAFA 5K3SA 1JLSA 1FNDA 2BVNA 3OIVA 5LA6B 2Q9AA 4S1OA 1SCQA 1DIBA 1U99A 1EHYA 1S3SA 2P2GA 2X0JA 1W0JA 3ID6C 1GTZA 1GRQA 3OE4A 4F86A 2A5DA 2M1XA 1E66A 1FL9A 2AR0A 3FHJA 3I23A 1XZHA 2WIJA 1BMFD 1PZFA 4WESA 1DJQA 1S1CA 4O4JB 1M1XB 2VCHA 2HA0A 5I7AA 2ZSBA 4AMUA 2JB9A 3NX4A 3O2SB 4YCNA 5HGXA 5HE9A 3ZCUA 1F48A 4Q6BA 2YQ4A 5K8VA 5HTOA 4Q16A 1CUUA 1Q14A 4POAA 5JNRA 1KQNA 1P5HA 2ZI5A 1OTXA 5AICA 4FGWA 4DSTA 4BNVA 2PT7A 4IH9A 1YDMA 5GQSA 4YS6A 2X6RA 4DA0A 4ZAGA 4TTVA 4DCMA 3FGNA 3CX3A 1P4HA 2WD8A 3TKAA 4AULA 4BQIA 4CF7A 1R7RA 5EO3A 2ASVA 2EP5A 1CZKA 3DM5A 3E0QA 3L1KA 5J1SB 1W2BF 1T5SA 4X5OA 1GTMA 5CVJA 2R4UA 1T8SA 1J0EA 2I6RA 1JR3D 4N6NA 4URYR 5FIUA 4P3XA 1JNXX 5IUJC 2B1QA 3SX0A 4GKBA 4DILA 1DVRA 3NV7A 1E2LA 5CLQA 5JVDB 3DBIA 4ROSA 3CH6A 3F78A 1RWPA 2YC4C 3W04A 4DR2B 4ARCA 1OX5A 4TLCA 3BMQA 4R81A 3ER8A 3HUEA 1YA4A 1G6HA 2G4VA 3IAAA 1Z29A 1YZYA 1GNRA 3P2KA 4EUFA 2PYIA 5LVAA 2MYPA 4DJFC 2DCMA 3U26A 2UYCA 5FUXA 2WF7A 2XSZD 1P81A 3PE4A 3QJGA 4QUGA 4RVFA 5ARBA 1UK7A 4MWEA 4ARAA 2R9VA 3L5OA 4NE9A 1LU9A 4CIXA 4A16A 4ZXFA 5KNDH 1NWHA 3ABSB 3L1IA 3KFLA 1Q0QA 3WK5A 4F6RA 1RFGE 2QVXX 4R2LA 2C95A 3KE1A 2Z95A 3ND8A 3ZTWA 5BUQA 1OZGA 3ZBUA 5E8RA 3MILA 2Q6TA 4HDRA 3ZY6A 1C7IA 1YQNA 3LT1A 1YZ3A 1J9ZA 1NM5A 1VG9B 4L2IA 1T4BA 1N0IA 1WDTA 1Y8QB 1OU4A 1WF6A 4IIYA 3IKTA 4QM7A 1RHQA 1U2TA 4R2HA 1W29A 4LKOA 1BJRE 5ARDA 2Q5JA 2W2OA 4I6JA 3A2NA 4EZEA 4LHWA 5IC5A 1E6LA 2I6DA 1TVMA 2XTMA 3B52X 1P72A 2C0CA 3B12A 3DFMA 3O9VA 4G84A 1MO6A 4EPYA 3H5VA 1IY2A 1YV9A 3FVQA 3GRFA 4D9CA 1KIFA 5J4HA 1TYZA 4JJEA 1U4NA 1NV9A 2GZSA 3IPLA 1E1QA 1GR1A 4H6VA 4J1NA 1UPBA 3SIVA 1EWKA 4TL7A 1FYVA 4C0JA 4HWPA 4EDFA 2OT3B 3P2IA 3R6TA 4Z7JA 3IDFA 3PRJA 3G5MA 3IA2A 3LHKA 4HNAA 4Q1BA 2P68A 3DKRA 3Q9UA 5HJEA 3O8RA 4HMOA 2V4MA 4D46A 5L7YA 4EO4A 2IITA 5E6UB 4MWCA 1T8PA 4XARA 1HQDA 1G8PA 5K4HA 5DYYA 3I52A 2J1LA 5CIQA 2IA5A 1CJBA 4JBWA 4ARZB 3S0WA 1YI8A 1SJ9A 2UYKA 4EMSA 5JASA 3SBOA 1OA1A 3M1YA 4DLZA 1XRLA 1Q2UA 1SCNE 3D7LA 3VR2A 4NYMR 1P0PA 1QHIA 1UDWA 1UK9A 1IZZA 1LLDA 3D3KA 3CVXA 5TS2A 1T6XA 4UHDA 3LBYA 2QRJA 4QUAA 2IOFA 3VX4A 1FSFA 1SXQA 1G3UA 4MS4A 3DVLA 2VJMB 1JDPA 1E3LA 1FSGA 3QLUC 3FDZA 3A0UA 5JRZA 4CUKA 4HXFB 2DBZA 3QGMA 1C3EA 1L7OA 3WJ1A 3DHEA 2I1LA 2PSDA 2F67A 5CTJA 5AVZA 2YN4A 2IOFK 2AJDA 2CVHA 3BE5A 3NO4A 3QE3A 4AAYA 1AQNA 1CERA 3FE2A 2SICE 4L0CA 1KE2A 3TF5A 3FNBA 4CXMA 1GPJA 2W2PA 1G5TA 1NFQA 1U0NA 3VH1A 1T4GA 4BNGA 1IBLB 1ISIA 4GOOD 2NT4A 2GVIA 1EB8A 1P17A 1EX7A 1U2GC 2D0DA 2JVJA 4QARA 3FMIA 4FFWA 1JAIA 4NVRA 3NMUF 2O3QA 3IPCA 4URFA 4D42A 1M2KA 4LOAA 5EQFA 3D64A 4DWOA 1NJ6A 2YZKA 4WRRA 1DQRA 4L27A 1U8YA 1M6WA 1XMXA 3VPBA 3LQ1A 5KS2A 3PHLA 4JB3A 4GIBA 1NA5A 2XDQA 1H7MA 1PS0A 3G0DA 4LDNA 4WCFB 5CH8A 4Q4AA 5L3QB 5IX8A 1CHNA 3ZQ4A 4QT4A 4PNHA 4RK7A 4B87A 3VJRA 4YGYA 4YNBA 4C89A 4MWDA 1VECA 2XECA 3GL9A 4P4TA 4KVZA 3KELA 5KOHA 1ZR4A 1Y7TA 4OCZA 5DNWA 5FUWA 4ASUA 1I4TD 1EFPB 4QFMA 2O2EA 4OB6A 5FBKA 3ZJTA 4X6LA 1H8EA 3X0DA 3F5FA 1TI7A 2WUDA 4KPYA 3KKNA 4GGMX 1GPLA 1NR7A 3UH1A 2LGJA 2ZGVA 2Y0PA 3VVBA 4YCSA 4NMWA 4RPIA 3GH1A 3MCTA 2VHQA 2XYPA 3RUFA 1Q7TA 3BCRA 2IYLD 3JSXA 3OPYB 4QBKA 4D26A 3K4QA 3JX9A 3O21A 2H54A 4IEIA 1RQPA 2QP4A 4P1ZA 4AS3A 2X1LA 4N4AA 1U2EA 3VDMA 1QNFA 2G5GX 1IDN1 1ZGHA 1BN7A 3HG7A 2AL7A 3N2EA 1F5NA 1XF1A 4MP3A 4MJ7A 4W9RA 4ZA2A 2FZGA 1V5GA 1Z3CA 1KPGA 3KZCA 4YRCA 2IYXA 4UTPA 2GD2A 2IE0A 5BORA 4FFLA 1T5HX 2A58A 4WBNF 2PZLA 4RYDA 1R0SA 1N3YA 2A0FA 2BFNA 2HC9A 2OGUA 2G8LA 4RQBA 4YCBA 4AG3A 4GPD1 3NANA 4KFSA 4PCLA 5CX4A 1Z6TA 4I1SA 2QTHA 2IY7A 1XNRB 4QGGA 1X1EA 1X7YB 4KRYA 2N75A 3W8RA 3FLMA 4IIDA 1ZJZA 3KEMA 4O0MA 4YJ3F 2IXFA 4L0DA 1BHJA 2A59A 5CA0A 4E1AA 4QRDA 1CBUA 4U2GA 3LGXA 4G5RA 3BXXA 1EWVA 1LPMA 2ZWPA 2VDVE 4TSFA 4OAOA 3NVDA 4L78A 1OXSC 2MIIA 3BHIA 1ZRMA 4LXYA 1TQ2A 3VA7A 1O6GA 2XH8A 3AR8A 4L0QA 1REQA 1S7GA 4GM4A 1XTSA 1JQDA 3T06B 1W5BA 2C5LA 3TNFA 4NCAA 4YDRA 2HX0A 2OV1A 4V1CI 2Y1DA 5EUMA 4PIMA 3HJFA 3U4DA 3VJLA 1L7VC 3HXLA 4PRKA 4TYNA 1P0MA 3LUHA 4KRFA 1FTGA 2FC3A 2E55A 1N2SA 1QVZA 2GRJA 4X8MA 3IE1A 5JH7A 4JYBA 1V8OA 2HAEA 2PVSA 4A0SA 5BR4A 1E6WA 2DXIA 3UMRA 3WLIA 2MQEA 3MQWA 5MHTA 4NV1A 3CPJB 1RZRA 2PMCA 3AW9A 3HJWC 2VWQA 3FB4A 4YC7A 3AIKA 3ZZTA 2HCBA 2I8AA 3LX8A 3IQGX 1L5QA 1DC3A 4OGWA 3WGJA 2C7RA 2ZJ3A 3ICPA 4N5HX 3N0WA 3NHZA 3KL4A 3NIBA 4OUDA 4BATA 5A62A 4XX1A 5KTMA 3P2OA 3AM5A 3HMQA 5DTRA 1ZMRA 5IH3A 1ZL2A 3H16A 1J00A 3G9UA 1KFEB 2QS9A 2VXOA 1TF2A 2FEAA 1YA6A 5K4AA 3ZD8A 1UMDA 2QUJA 3OQ6A 3JD1A 2OSVA 4G9BA 1FA9A 3ETDA 3QKIA 4RNCA 4AJ9A 4DLAA 4YCLA 4HAVA 5ALWA 4Z4IA 3DQPA 1KMMA 2O23A 2R5FA 3JW8A 2JAUA 4G0ZA 3JR7A 5EJFA 2GBFA 3I5XA 2RK4A 4Z7QB 3QXSA 2XGOA 3EYWA 3HUUA 3N8GA 1XQXA 2FKAA 4FIZA 4L4RA 5CB6A 2OWDA 3UA4A 1IK4A 2C1EA 1VQ5F 1I3MA 3MXOA 5FA5A 5BQOA 2GB4A 4ID9A 4B43A 2RHJA 4BDTA 2Z8XA 3ESQA 5BOSB 4LF5B 3LUKA 1FU8A 3RSOA 4U0KA 1CY8A 4YQYA 4TTAA 4WNCA 2K7FA 1QQTA 3CNNA 2XGGA 3V1TC 2VUIB 4Z4FA 2O57A 4M99A 4WHMA 1YMUA 1TYBE 3IDAA 4KO8A 4YPVA 3HO6A 2FN4A 1LFDB 3ENZA 4ZC1A 1JF8A 3RS4A 1EVQA 1T2UA 5BURA 4YJHA 4AP5A 3PNLA 2J3LA 3NORA 4NFHA 2EP7A 2P5UA 4JBGA 3R77A 2O50A 4MUFA 4OH7A 3I6QA 3N07A 4XLZA 2XPCA 4XZ3A 3B6IA 3COZA 3KYDA 2NZWA 2RH8A 4HDKB 4ICIA 3K2QA 4AT1A 4BBZA 1P2UA 2GXUA 4M0FA 4ZVMA 4IQFA 1RWXA 2PZFA 3BL8A 4NP6A 3LDTA 3FYSA 1ODEA 2B94A 3LS2A 5A9SA 5LPNA 4H18A 1HZJA 4OXRA 3RF7A 3IEUA 3TIVA 5CFZA 2FG7C 2CBXA 2RKWA 1GO1A 2QUIA 2F6RA 2PU7A 3SXPA 5IT5A 2VTBA 3G1UA 1JQEA 2VJNA 3FPCA 4WTOA 4DR1B 4XVQA 4M1KA 1AF7A 1MCZA 3M83A 4J49A 1CRZA 1V1JA 3E5RA 4IKPA 3NHRA 4W4TA 5JSZA 1KEPA 1LNSA 1ZA1A 2EQAA 4IUDS 5K3DA 1G20A 4YAWA 4AJIA 3GGSA 3GUHA 2PUCA 4YJKA 4MZDA 1ULUA 4REQB 3SZLA 4WIAA 5A4KA 2Q29A 3NRJA 2P9CA 1I2CA 4PICA 4RTOA 1XQ1A 1QX4A 5F1PA 3JAWA 2R79A 2R7NA 3TQSA 4ND5A 3ZHQA 1PW5A 3IGFA 1ZJ4A 1C4OA 3GGJA 1T2EA 4H3VA 4US2R 3U1BA 2XB4A 4ER5A 1D4FA 2R2GA 2O0KA 4BY9D 3AERB 4GRIA 5EP1A 2PTHA 5FH9A 2W6CX 3ZNPA 1LBTA 2BE7A 5KHOC 2XXBA 2ZR0A 4ZTZB 1T8RA 4GL2A 5ILOA 5ESWA 5BYKA 5FLXM 2QM3A 1QVVA 2SHKA 2CLHB 1THGA 3EEQA 4MUYA 2FPSA 4F5ZA 4FSXA 2XA9A 3U44B 4DR4B 5JR3A 3GQBA 4RK6A 1KWKA 2GZ3A 3PEVA 5JQGB 2ZAGA 1P19A 5HXZA 1CK4A 2EWCA 3OF2A 4JODA 4CJXA 3MWEB 5TF4A 2AZMA 2DT5A 1V7ZA 1P5RA 2VO1A 4DDKA 1GQRA 2GASA 3AY6A 3WGUA 3EFHA 2FOLA 3A4MA 4OP1A 4ENPA 1X0XA 3DM9B 1NBME 3E81A 1IV4A 3KQTA 3PR3A 3QA3E 1JIJA 1U7ZA 3KIPA 4KXQA 4MTLA 1G8MA 1QQBA 2I9KA 3DGEC 3KQSA 1QTQA 2ZUTA 1GPBA 1UJNA 4TWRA 2XYHA 1T2AA 3ORSA 3WHIA 1M34E 3SEQA 5FPHA 3N2KA 1TB4A 2YJ3A 4HRVA 3OCJA 2R7LA 2M6KA 4HJXA 3AB8A 3PZRA 4MW4A 4Q5IA 1YR2A 1JKFA 4DSNA 3RPEA 2FRXA 1WF3A 4QNNA 3I9FA 4JAVC 2CNOA 2KG4A 1LH0A 1A2QA 4ML3A 4F12A 3E23A 3HVUA 1E63A 2YWJA 5G2OA 2FMTA 4ZGGA 3WHPA 2OORC 1RXCA 3ISVA 1QO9A 4CGZA 4J7UA 1VRCA 4A2QA 4DDTA 2C5EA 2ZM6B 2B69A 2RONA 4ZEOA 1SU6A 2TS1A 1B8VA 1TEZA 3W7AA 1V4VA 2QVCA 1J97A 5KOIA 5DTJA 4HAUA 3W4KA 2JLCA 4JUBA 4JOBA 4EA7A 2QLJA 2CWWA 4JFRA 3JALA 3WK8A 4L28A 4E0BA 4HRAA 1CUWA 4G5QA 2ZE6A 2WBLC 4AY5A 3OA2A 2ZIUB 4ZDIA 3L7LA 1R27A 2OHVA 4Y2UA 4WLVA 2NU9B 1PG2A 5JLJA 2XE6A 5JZMA 2PFSA 5J2UB 2CNWA 3PNQA 1HFKA 3T7SA 4UOZA 1GRRA 2ZVDA 4MKFA 5AHRA 4D41A 2CKDA 3P9NA 4EI9A 4JK3A 2OHFA 4PPQA 4OJTA 4LZLA 1LK7A 3R8XA 2BEWB 2AMVA 3BXPA 5HEKA 2ZTVA 1DC6A 2CVOA 5AFSA 4HQFA 4NBTA 1XTKA 2FOXA 1E7QA 1O77A 3PUJA 4JLDA 4MUAA 3LSTA 4CL2A 1XHEA 2JNBA 2BF7A 2X22A 2PLAA 3WA6A 5EB0A 3EIOA 4ALJA 4U7DA 4BNWA 3HFGA 4ZZ2A 4F04A 4F60A 1X7XA 4Y0NA 3ZE6A 4EY8A 2ZU0C 5KWIA 1MMFB 2EKQA 3CUWA 3TXYA 1WTAA 4NPAA 4IHJA 4BNLA 1ZHOA 4O1MA 5IKEA 2D7JA 4AMVA 2V65A 5L4LA 3F1KA 4MJLA 2WM8A 4AD8A 2PKWA 4GI1A 5H3HA 4AXXA 5JTUA 1GYQA 3SQNA 4YONB 3IVAA 4NZOA 4RH1A 4M21A 4QGBA 4MRNA 2AHRA 3HJCA 2GILA 4RWZA 5JZBA 1BVUA 3QJ5A 5FB3A 4YPOA 2WYWA 1E3EA 5C1DA 3L9XA 4I4TA 2NP7A 3QVGA 4CETA 3E7PA 5IK2D 2X40A 3L6CA 4OXXA 3LUJA 1JSZA 3H4IA 4RD2A 3L1VA 2B5WA 4HQLA 1VL2A 1R12A 1XD9A 2GEBA 4FYHA 4QDZA 3D2AA 2WIFA 5ITVA 1R0WA 1N6LA 1D9XA 4TLDA 2KM1A 4R1LA 4Q7KA 4FGLA 4IDOA 1EGVB 1Y3FE 1YACA 4ZO8A 2E4UA 3T5CA 4EEXA 4TYWA 5BW5A 1XXHB 4Q1AA 1LRJA 3V97A 1PTJC 4P3YA 4MI1A 2AX3A 1NYTA 3PX2A 1AGPA 4FI3F 4FN5A 3ZGXA 1O94C 3CW9A 4KWEA 3QXHA 3ITEA 2YCLA 3ICCA 1QH8B 5COBA 3TFWA 4B74A 4YCCA 2VGMA 4XUCA 3QA9A 3WIOA 5F5LA 3T99A 1IY8A 4BVGA 1QIIA 1IUOA 1XJQA 5DEIA 2BI7A 4B7ZA 1FXSA 3T5GA 4F91B 4IIJF 2VHTA 3LA6A 2PE5A 3NTVA 5KNLA 1ADYA 2NX2A 5B1SA 4AU1A 2BFCB 1MAWA 4AWBA 4P54A 5LR6A 3VOTA 3P45A 1KYVA 4NBUA 2WAYA 5GIPE 1UZMA 2G1JA 3CPQA 5C51B 3N58A 5LD2C 1I6LA 2J7KA 4JI7B 4N65A 4YDSA 2VUSA 5DGDA 1PJSA 3L8DA 4IGEA 4Y6LA 3OZRA 1OYWA 1YVEI 3WK4A 4BCCA 3CC4F 3KBBA 3UT5A 1OJ7A 1NW3A 3DCIA 4KK4A 5IEBA 5AOCA 3L1JA 4EB0A 4XVCA 3FTQA 1KY5A 3CF6R 4WY2A 2AKAB 3C45A 5EAZA 4XFJA 2UZ1B 5FJJA 1GQOA 2VT2A 2QBYA 5JYBA 3B85A 1KF0A 1CIJA 3P32A 1T9GS 3L0CA 1U04A 2BGJA 3AJEA 4TUYA 3GJRA 3H2JA 4QJBA 4EYQA 3RNOA 4G0QA 2IS2A 4KQWA 4PEVA 1JN1A 4C03A 5LA6A 1H2WA 3W6NA 2GN1A 2ORWA 4LV5B 4NBRA 5TF0A 4RAQA 2RC6A 3CLHA 3L0SA 2NMUA 3QEOA 4CBVA 5B7PA 4DSUA 1FP7A 5ELXA 4XASA 4NPCA 4Q7QA 2RGRA 4KTVE 4MOWA 1J5XA 4TLMB 1S3GA 1TMOA 4E5VA 1O87A 1XV5A 2GWRA 4O4JA 3T5PA 1RPZA 2IQQA 2AD1A 1P39A 5KJCA 3R6DA 3D8NA 4FFNA 1NPDA 4RDIA 3D6UA 5D1NA 3CCCA 1AG9A 1CVIA 3GC6A 2O1XA 2FI1A 1BKYA 2WJGA 1WVMA 3VGPA 4Z4GA 1GA1A 1U7WA 1XRQA 3DMNA 4EEKA 2E5LB 1N8SA 1MJ5A 2OESA 2O2CA 3RJTA 2WP0A 5DBGA 3N8KA 1JY8A 3GX1A 2I7XA 3L7DA 2WWVD 4AMGA 4O4LB 4L76A 5M2QA 2YMPA 4QYXA 2BO1A 4WL0A 3KOXA 4D79A 3W6PA 4LE0A 2EWVA 4N7RA 4M0LA 4PSAA 4BPRA 1E3MA 5L7WA 5AI4A 1L4YA 3LFUA 4G5GA 4K87A 5D8DA 3EVTA 3QWIA 4D9EA 2AX4A 4QDXA 5JVDA 3PYMA 5ENVA 4CIYA 1ONSA 4RKFA 3EPPA 3A06A 4R8MA 3C4QA 2HMAA 3L7NA 3SNKA 3I4CA 3ZTYA 2GVDC 5ALHA 3VDQA 1CRWG 2PV7A 5K3OA 1Z83A 2Q9CA 5IN4A 3GB9A 2NU8B 1G8JA 1B1CA 1RPJA 4PS1A 4AKSA 1SXIA 2Q41A 3Q87B 3ZWAA 5HIKA 4QICA 5TLSA 4CIWA 4C0KA 3FOFC 3B5JA 1FS4A 5E1DA 3T9FA 4R8SA 1QHHB 4GLOA 4M8IA 1C8LA 4ZMBA 1W1WA 3OONA 2MHCA 4CDMA 4CMCA 1Y8QA 5BT9A 2VQDA 3A6DA 3CMMA 3WL6A 3ZXYA 5C18A 3J7AC 1WPGA 3O8LA 4DB4A 2HBYA 1CQWA 1L4GA 4MPTA 2QYOA 4Y2HA 1G2PA 3N2ZB 4BO5A 1XCLA 2X2OA 1A1VA 2AH5A 1S8NA 2A9OA 1TX4B 5CFOA 3C1OA 1B3BA 3TD4A 3OT1B 4LDRA 4F4DA 1F0YA 3F67A 4LXQA 1DEOA 1XBTA 2QT0A 3ILSA 4N0DA 2XODA 1RACA 4H77A 4JJAA 4CQLB 1WKVA 3H97A 4K9LA 4HXEB 1AK9A 3KOYA 3FHOA 4NHEA 3RYCB 1OVGA 4GVLA 5GOZA 1V71A 2F17A 4RD6A 2RGCA 3VI6A 1LWOA 3WL4A 4EECA 3WGOA 2AKYA 2A1IA 4G37A 4LDJA 1WZ2A 3JQ7B 3SQOA 1I2BA 1ICEA 1X1AA 4AKHA 3NVIB 2VAPA 2XA1A 4WY5A 2ZAYA 2Z4SA 1DFGA 3KJGA 1EFHA 1SB9A 1QAMA 2E7ZA 2GESA 5JS8A 4C4TA 2QJTA 5E6UA 1XQWA 4EW6A 3EEFA 5CYPA 2EF1A 1YCHA 3BICA 1RQNA 3DE4X 4IV0A 1OFGA 4R83A 2ZBVA 4ZAWA 5F52A 1JB1A 5TR9A 2J0UB 4N6OA 4FFMA 5AW5A 3ZU6A 2GD0A 5KU1A 5FF9A 2DH5A 2J87A 2EV9A 3H1FA 5JDCC 3NP7A 1MBZA 4OHKA 1JXMA 3V1NA 3EIWA 3T1TA 3U9LA 2QV0A 3JD2A 3R3UA 4YCJA 2WM9B 5CCXA 5ER9A 3FKQA 1ZJYA 1K8ZB 4F3CA 1Y1LA 5AJHA 2AK3A 2VNAA 5JC8A 3C6QA 4S1NA 5BPHA 2WZBA 1BWQA 5KINB 4EI7A 3LI2A 4KMSA 3IR5A 4RZQA 2FDXA 5LBIA 3KEQA 3RAGA 4N6GA 3QE2A 2OCBA 3CGWA 3WNDA 5AW7A 1OH6A 3H2ZA 1SG9A 4LPKA 1UBMS 1BWRA 2IP4A 3WB2A 3ZHCA 1TCUA 2H2AA 4R1QA 1PL7A 4YJGB 4C01A 2WU1A 2X8JB 3CZ9A 3A2MA 1BXRB 1JG2A 1IH8A 2COUA 2G82A 2OD9A 2KYRA 2WIGA 3FPSA 3HJBA 2JHGA 5FI5A 5B1EA 1J5EB 2FPUA 4LI3X 5CH5A 2XUQA 1XA4A 4Y1EA 3GUZA 1SC9A 1XXLA 3JVUA 4NYJR 3FBTA 4J0GA 3SG0A 3ZW7A 3DE3X 1DTEA 1X9GA 4L5JA 5TT0A 4HLDA 1NRXA 1SURA 4WJKB 1KI4A 2OV3A 2OHWA 5HKOA 2YX1A 5IBRA 1VI6A 5T57A 4BBJA 4MROA 4GBJA 1M2OB 1JI0A 1UBFA 2H1CA 2I65A 3RE1A 5JECA 1JDZA <