2RHJA

Synthetic gene encoded bacillus subtilis ftsz with two sulfate ions and sodium ion in the nucleotide pocket
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
b'ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFLENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Cell cycle
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhjA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhjA01
5JH7A 5GONB 4U3JB 4O4LA 4E6EA 1SA0A 3HKEA 3R4VA 4LNUB 2Q1YA 4TUYB 4YJ2B 4O4JB 5MN6A 4ZHQA 3M89A 1TVKA 3VOBA 2XKAA 4O4HB 3JAKA 1RQ7A 4FFBB 5LA6B 5IJ0B 4X20B 4F6RB 3N2GA 4HNAB 3RYIA 5BMVA 3E22A 5IYZA 4YJ3B 5KMGA 3V3TA 1W5EA 4O2AB 5KX5B 4ZI7A 5LP6B 5CA0B 4I4TA 3WGMA 4EB6A 3ZBQA 4U39A 4O2BA 5J2UA 3VO9A 5JVDB 5EIBD 2RHHA 5CA1A 5EZYB 1TUBA 5FNVA 4B45A 5LXTB 1RQ2A 3JATA 2GVIA 3JASB 4IHJB 5IJ9A 5CB4A 3ZBPA 4TV9B 4X1IB 3JARB 1FFXA 1JFFA 1RLUA 3ZIDA 4WBNA 5JQGA 5MN5A 4KWEA 4I50B 5EYPA 5C8YA 4DRXB 3RYCA 4O4IB 3HKCB 3WGJA 2VAPA 4IIJB 4O4LB 3N2KA 3VO8A 4TUYA 3UT5A 3WGLA 1SA0B 3HKBA 3HKEB 2VAMA 3RYHA 2BTQA 4O4HA 4I55B 4X1YA 4ZHQB 5J2TA 4EI8A 1TVKB 5LYJA 5JCOC 4TV8A 5ITZA 5LP6C 5MN4A 3N2GB 3RYIB 5BMVB 5KX5A 3E22B 5IYZB 5KMGB 4XCQA 5LOVA 2RHLA 1Z5VA 3HKDA 4I4TB 3RYFA 5JVDA 4EB6B 1W59A 4O2BB 5J2UB 3JALB 4X1KA 3JAWA 1OFUA 4B46A 4ZOLA 1W5AA 5GONA 1TUBB 4U3JA 5FNVB 3JASA 5JH7B 3JATB 4LNUA 4X1IA 4YJ2A 3JARA 4O4JA 5M7EA 1W581 2VAWA 1Z5WA 1JFFB 1FFXB 2Q1XA 4WBNB 5JQGB 1W5FA 4FFBA 4O4IA 5LA6A 5IJ0A 3HKCA 5EYPB 5C8YB 1W5BA 4X20A 4F6RA 3RYCB 4HNAA 3JAKB 4IIJA 5JCOA 4YJ3A 4O2AA 3N2KB 4M8IA 5LP6A 3UT5B 5CA0A 3HKBB 3VPAA 2RHOA 4EI7A 1FSZA 2R751 2BTOA 3RYHB 4ZI7B 4I55A 5EIBC 3WGKA 2BTQB 5J2TB 4X1YB 5LYJB 3RB8A 4TV8B 5EZYA 5ITZB 5LXTA 5CA1B 4DXDA 3VOAA 3CB2A 4IHJA 3WGNA 5LOVB 3C8LA 2R6R1 3HKDB 4TV9A 5IJ9B 3JALA 3RYFB 5CB4B 2RHJA 2VXYA 4EI9A 4X1KB 3JAWB 2XKBA 3M8KA 4I50A 4DRXA 4ZOLB
chains in the Genus database with same CATH superfamily
3ZUGA 4HC4A 4RZIA 3SLGA 4C76A 3ZJTA 4YI5A 3TNLA 3ID6C 1TD9A 5D5PA 2FJ0A 1SBIA 1L5KA 5LQMA 1QQ5A 1OIVA 2X2OA 2B78A 1B4DA 4DLNA 1J2JA 3KYDA 4PXAA 3CRNA 1VBKA 1U0NA 2PZAA 3AF3A 4IKOA 4BFYA 2ZB4A 3WQRA 1VHAA 3UGQA 3WWPA 3FOZA 4L7QA 3AGQA 4GR4A 5B1YA 5HKKA 1OVGA 1ZG3A 3BERA 3O2NA 10MHA 1R3UA 1JHDA 1UXOA 2IIBA 4PANA 1PGPA 2CNKA 2GAAA 4JYPA 4D3YA 2OCLA 1EDDA 1I2DA 5KQRA 2OORA 1VC2A 3ELWA 4UM7A 2BI8A 3E2MA 3WSVA 4PLGA 3URMA 1UC8A 1R9JA 1JSCA 5KYXB 3NOXA 2PS3A 1D09A 2OD2A 2WMYA 2QUZA 3BK7A 3SF8B 2ZCJA 5KVQA 1BE6A 1Y33E 2JA1A 2QEXF 1EE2A 3SBXA 1HGXA 1DRWA 3DMGA 3SIXA 2C20A 4J0DA 3IE1A 1ML4A 1OBVA 2QUIA 3WL5A 2ZIGA 1LQ2A 2R00A 4EHBA 1HG0A 1QKJA 3RYCA 1P5ZB 2OXRA 4PFKA 4TLAA 3VZRA 1B0PA 1O94D 2OWDA 3EWSA 5LZ9A 1Z6QA 2VT2A 1BXGB 4NZNA 1U3UA 1GQ2A 3KE8A 5E1MA 1C1DA 2OKGA 3CLSC 1LRJA 1YD7A 2FWJA 5HILA 2Y1DA 1W9HA 1GU1A 3FYCA 3I1FA 2GCEA 3N4ZA 2P9JA 3A6FA 3P1JA 1BE8A 1R5NA 5KKAA 1IZZA 4ZHSA 1U8FO 3TO5A 4ENTA 3JCMM 3VAZA 1FNKA 1M34E 5LOVA 1KAEA 4E5PA 2BR4A 4Z7NB 4W5TA 1H2HA 4LOAA 3F2VA 1C2YA 4WMLA 1NW9B 3KM0A 4KYUA 2L0XA 4Q9HA 2OEPA 2D1RA 3NC0C 4QASA 3FPFA 2I3AA 3VU0A 2G07A 4GR9A 1PUJA 3NM6B 3O31A 3WLNA 3QJGA 1MLDA 1U65A 1FFHA 2DRIA 1X3SA 2VDQB 2H07A 3KNZA 2QWXA 4I6EA 2H92A 1OUMA 4JJ4A 4AUMA 4DUZB 1JH8A 4BNXA 2C5LA 3LRPA 4XWGA 2J09A 4AG3A 1TF2A 4BNDB 2IH5A 4QD3A 2XZLA 1G8MA 1N6NA 4MGEA 2PQ2A 4KH1A 1CUIA 4HLNA 2ZBFA 3TKYA 1EFPA 1E9BA 1U31A 4G4VA 1N9ZA 4KXYA 1DAOA 4G4ZA 2GAJA 2P69A 4MVJI 4LMAA 4M1OA 2P41A 3TBHA 5K3EA 2QP9X 1QE3A 2XUKA 2XOEA 1A72A 2G0TA 5MFPA 5KQMA 1DMRA 5DRTA 2DLNA 2BAGA 3K0CC 3NTOA 2C9ZA 2BMEA 1RWBA 2HLPA 3TGLA 2OUKA 4O59O 3OEYA 4EX7A 1EM8B 2CVOA 1DTWB 1FYVA 2O3SA 3N3AC 1X74A 1R64A 1U0LA 4JYBA 4NMWA 3VI3B 3RUAA 1CSEE 1ELOA 2J9XB 3AG6A 1UBHS 3DT9A 1A7AA 2G77B 1EVLA 4TXNA 2Y6VA 1PWYE 2YV5A 5IM5A 1KO5A 2OVFA 4I3HA 1YUNA 3QUBA 2O19A 3INGA 3ZV7A 5DHAA 5G1PA 2WF8A 4YLGA 1GZ5A 3MILA 4O2AF 3EEBA 3OKCA 4ZAYA 4BQOA 5IDQA 2NACA 3A1EA 1LBEA 3WAGA 1ORHA 1T6BY 2D06A 4FI3F 3UN1A 3QZUA 1V35A 2VXBA 4C78A 1OYWA 5JANA 2HLDA 2A3RA 3FG9A 3HB0A 4KNVA 4Y7CA 4CKWA 3BEDA 5K6AC 5KYUB 1RC8A 1KAMA 1B16A 1L5WA 3EIOA 3GVPA 4PSDA 2ATEA 3KCNA 4HB4A 1UODA 2JFUA 5FUYA 3S44A 3HJBA 5DNWA 1YHNA 1JPNA 1H2XA 3KELA 4ZZ1A 3EVCA 4NPHA 3KZMA 4KREA 1TO2E 4YJ3B 3JRXA 1E79D 2MU1A 3JZMA 4OYYA 3PD7A 3PJDA 5E0KB 4YT8A 5C37A 1Y3IA 3QUQA 3IELA 4TTTS 4ZO4A 2IGTA 3HDGA 5KC9A 4HTFB 3QX7A 1JEJA 4LYDA 1FRFS 2Y0BA 2BMFA 2WTEA 3LGXA 2Q99A 4UJ5A 1USUA 1Z75A 3KQVA 4WBSA 5IN4A 5BQPA 2FKNA 2YJ4A 1ZSNA 2HCTA 3B7WA 3ESQA 1PXWA 4KDRA 4UCXA 4B45A 3U7QA 1G3IA 4GI3A 1NXVA 3AM5A 3K9LA 1VHLA 2O5VA 3NBKA 3R3WA 5AI6A 5THKA 3U9TA 2O59A 2P2YA 3MRSA 4FYIA 1OGJA 4TTQA 3RSLA 1WF6A 4ZT5A 3RT1A 2JD1A 2FWPA 1K0FA 4J07A 1E3WB 5KWJA 3AIKA 3N8NA 1GGEA 4QUDA 2I4OA 1O9BA 4MRAA 2OMKA 4LCEA 1I94B 2HC9A 4Q01A 3ITDA 3HWRA 4I4TF 2VGNA 1Z6TA 3RNOA 4TX1A 3SC3A 3KWFA 4YN3A 1J09A 4QKQA 4IKPA 4Q15A 3WZLA 1AK2A 2NYRA 3F4KA 1CRQA 1XMSA 1MX5A 1NBIA 4Q82A 5C1DA 2JLCA 3PXDA 1XLWA 2W6NA 4PNEA 4G4IA 4OQFA 1TW3A 4N40A 4RE5A 4XEUA 1CJKC 4Y2YA 3DOCA 3UPTA 1JXAA 1OFGA 5DBHX 4UUMA 4ENRA 1G5FA 3E1KA 2WZBA 3FB4A 3JQBA 5A9RA 4IUDS 3OW2F 1KY5A 2AOTB 3W5VA 3ZIAA 4UM9B 4JSTA 1BD3A 2WFAA 3P0EA 4MCJA 2O7QA 3DW3X 2MINA 2VLBA 1H8EA 3PI6A 5KWIA 5JJBA 1DEHA 1UF9A 2G8LA 1DAIA 2A88A 2HUNA 1M72A 2FSVC 1UJCA 4JWTA 3A0RB 4W99A 5F52A 3WB0A 4PZCA 3UBMA 1GNVA 4JVOA 3NRBA 3ASUA 3GHZA 3GROA 3DKVA 4FYHA 5AVSA 1GPAA 3I9LA 5H3HA 1XQ1A 3M82A 4JH0A 1P2SA 5EYPB 5KX5F 2OQIA 5EJFA 2NU9A 3ZHOA 3EZFA 3KEFA 2ZUFA 1N7JA 1Y6JA 3CWQA 2C7GA 2VH5R 2IL1A 3GJ8A 3I6ZA 4M9ZA 1V48A 1ZD8A 4UU0A 5LQJA 1TT5B 3BWCA 4G09A 4QM7A 4PLFA 2YJ3A 4TSKA 4S04A 3K31A 1TM5E 1WM1A 2ZU6A 3NKLA 1VQ6F 2WMOB 4WNCA 4C81A 2YMPA 4R9VA 4X64B 5JDIA 1Z08A 1F0KA 2D5LA 1VHJA 2X0KA 2XMGA 3BH6A 4JBNA 1VKOA 2QMOA 1DADA 1KEZA 4JLAA 4NIMA 1VCIA 5K3CA 4RGVA 3ZE9A 3D6VA 4WNAB 1GFIA 3KZNA 3TLAA 5L3SA 1KO8A 1RYYA 4B5CA 1NYQA 5TVKA 3C8LA 3L1KA 1OH6A 2OHFA 3R1IA 4RY9A 2YMQA 3DZGA 5AICA 3FJYA 1F4VA 1GGKA 3H5OA 3F8TA 2SCUB 4KQ1A 5K8VA 4ND5A 2CZWA 1UMCB 2DM6A 2JFVA 3S2IA 5KKNB 1F8XA 1JDBB 2ZUEA 2JI9A 4JU9A 3HRKA 3HVJA 1JFVA 4W1QA 2HW8A 4JSYA 3CC7F 4HXGA 3UHJA 2Q4BA 1Q3HA 3E35A 4H7PA 4TGLA 1IPAA 3KR9A 3O9VA 2JH3A 2Q1YA 4TUYB 1ZAKA 2C4NA 4OUDA 1AKRA 3ZWBA 1T2AA 2P9CA 4J76A 3O47A 3AHEA 1ZXBA 3FYSA 1LRKA 3TX2A 5JBIA 2YRWA 1AQYA 3B3AA 4R40B 5L95A 1MV8A 1CUEA 4IJ6A 4EVRA 1JRLA 4R0MA 5KEIA 1E5TA 1YL6A 1MTOA 4NK5A 3D1VA 4TWJA 4WJKB 4KRFA 4HUTA 3BAZA 5YASA 4XXHA 3EUAA 1Y6ZA 3OQHA 3ZWNA 3I52A 1V5WA 5C4IA 3VM6A 1UINA 4RYDA 3THSA 2HQOA 1SBZA 3L8ZA 5BO5A 1SBYA 3QFTA 4EG4A 3PPIA 2J3KA 4DLZA 3WK6A 1U8YA 3GDWA 4HO1X 2ZIXB 3QPVA 5JAOA 2YY5A 5CYGA 3T41A 1RXWA 4EB3A 3V8BA 4JHLA 1U2SA 1FU7A 2PGNA 2E49A 2J33A 3U56A 1K7XB 2VYQA 3HM9A 4TQUS 1LLCA 1GYPA 3LVBA 3KAJA 3BBLA 2ZUVA 4PSVA 4DIBA 4P08A 5IEJA 3E4CA 4V1CI 4J7XA 1W88B 1SUPA 1VL1A 4QVIA 2V6GA 1BU5A 1Y5NA 4IDHA 3EY4A 4ARUA 1UADA 1VP3A 1KDOA 1QGUA 2CJFA 1OYOA 4YFVA 5C3UA 4NE9A 5CD9A 2E4UA 4NDNE 3IAS1 3EZLA 3IR9A 3P0HA 5IDVA 4B4WA 3SEZA 3ZVMA 4MW1A 2OBNA 3Q3GE 3FIJA 3EMKA 3U2QA 2Q07A 3AUJB 3DVLA 5JD5A 5IKPA 2EWWA 2OYRA 3RNLA 3FUXA 1ZM9A 5ELXA 5EHQA 1FIUA 2H18A 2W6MA 3ZXUB 5CYPA 4D98A 1W36B 3GGPA 1KK0A 3TSYA 1W4CA 2ZUTA 1DTEA 1E58A 2WOJA 5DN6D 1ZRSA 4YX9A 7YASA 4ZRMA 3JCZA 4QBGB 1ENOA 2PKCA 3ROTA 3WNDA 4EFKA 1AQLA 5HIAA 2QIOA 4FFBA 4P7FA 3C1AA 4D7AA 4ZYLA 4B44A 4EHNA 3C9TA 2Z8YM 2GFHA 2GWRA 3BXFA 3RC9A 2JC3A 3C3KA 1J8MF 3O03A 4ME6A 4CEHB 2YIJA 3CLSD 3BE6A 4XSGA 2BZGA 5TPWB 3IUBA 3VYTC 3WK4A 3E18A 3IHTA 3NVMB 5I45A 1RWKA 3L1JA 1QANA 3RM3A 2FV8A 2P7IA 2E4WA 3NKFA 3RVPA 2NVOA 2K87A 3ES9A 2AFHE 1DCMA 4ZQIA 4CMCA 5JNLA 4BMSA 2A86A 3BX1A 4QU8A 4AUKA 4CLOB 5CXQA 1IM2A 1RZRD 3PT5A 4UDYX 1VQOF 4M37A 1DIBA 1P0PA 3SX0A 4BO1A 4NYIQ 2A9VA 2I1WA 1VA5A 1QXSA 3M8KA 4PZUA 2C03A 4KHZA 4YP6A 5K03A 1AKYA 2ZYTX 3JZAA 4YMTA 2H17A 2Y05A 2GDJA 5EIAA 4RJJA 1GADO 4RTSA 5GJCA 3JD2A 5I47A 2P2ZA 3ESZA 3ESYA 3OLWA 2PGLA 4TSRA 5ENZA 2JLXA 4ZK7A 3MBMA 2ZUWA 3F4LA 1JKJB 3G2OA 5KDDA 1XDBA 4ZVPA 3O5AA 5AMXA 1ML3A 2W70A 5L3ZA 3FW1A 1NNI1 5H4GA 3SOPA 4UZSA 1YS6A 2CW4A 1Y3DE 3ZQKA 1FTYA 5B3AA 3QEBZ 2R8RA 4CI0B 1LFAA 1U8TA 4LRTB 1EGQA 1WNFA 3M6VA 3K2QA 9GPBA 3NHPA 4XIGS 4DIKA 1N2CB 1PZMA 3AUYA 4EYQA 1U43A 4LHWA 2V7BA 4KR3A 3AQIA 1YOBA 1AGYA 1ZCFA 2NO7A 2FHPA 2SECE 2VDLB 5FA6A 4MVYA 4DZZA 1PL0A 3OX1A 4NRDA 3DDNA 1P7WA 3JQGA 3T99A 3RPEA 1ZMOA 5LZ7A 1A4UA 1SVMA 5IMSA 2ZODA 2FOXA 5F1PA 3E5RA 5C5CA 2NG1A 4QELA 5F64A 5G3YA 3V1KA 1UMBA 1RLUA 1CUSA 3WNVA 3WYDA 4EZIA 4R2XA 4OQ4A 1I33A 1FYDA 4C04A 3I92A 4LZPA 1PSZA 2VVTA 4FD3A 4DBLE 4X3PA 2UZ4A 3ZQUA 1D2EA 1EGAA 1MRNA 1UFKA 2BGNA 2VDJA 4UTZA 3HXLA 3U4QA 2AE2A 4FNAA 1SIWA 2F90A 2G9IA 2ZPUA 3FDZB 5AI4A 5M2QA 3UAVA 2WHEA 4J0QA 7MHTA 4EL0A 3NBYC 2H1VA 3VFDA 1KEPA 1FRVA 2OMEA 4ABYA 4UMVA 4TXHA 5FLXM 1D2CA 4FU0A 4QOIA 5H16A 4C2UA 2XR1A 2V5UA 2C88A 5K4HA 4J0CA 1T29A 1II0A 1EUDA 2B3DA 4KCGA 4DLTA 5JNUA 2PRKA 4QXMA 1KH3A 4R1NA 1VQVA 1TK9A 2ZTSA 2YS7A 5IJZA 4U00A 5EMNA 1R8QA 3LE8A 1YSCA 2Y1LA 3H11A 1DBVO 3FUCA 4EVSA 4U3JA 1CQZA 3BFKA 2Q50A 1B74A 5T6MA 3D6HA 5HJ7A 3RR2A 2XUIA 1TU0A 1V25A 2W48A 3IBFA 4G24A 4U8GA 5C32A 4B87A 5JNVA 3W9SA 4CF3A 1KMQA 3T15A 1VSBA 821PA 1AQUA 1W36C 1HE5A 2O7SA 1KRWA 2OO7A 5KQPA 3ADBA 3SQLA 1SKUA 3OPYB 3ELYA 3Q7QA 4XM1A 4UU7A 4DM7A 5EXDA 3UB4A 2PY6A 2RHGB 1CUWA 1Y9EA 1IRXA 2YX1A 3DXFA 5GWXA 3FR8A 4LY6A 4NCJA 1V37A 1PTKA 3H8JA 2R751 2ZBEA 1DJOA 3LYAA 1EGVB 3M6IA 3LLUA 1JSXA 4P98A 2GZLA 1CG6A 1E99A 3DG9A 1O03A 3LQ4A 3AEKB 4MRVA 3QHDA 1EX9A 2EOAA 4QULA 4YP5A 2VDWA 5AYVA 4FMPA 1L7XA 4C1BA 4AYWA 1YQ9A 5LXTA 1SD1A 3ZZ1A 3TLGA 2BFEB 1YGPA 2PUCA 3B8HA 1JFLA 3HB4X 4HB0A 3WGNA 4P36A 2IT1A 3FPIA 2BM8A 1RYMA 3CPQA 4FYJA 3GFFA 3VHRA 1Q12A 1RAGA 1M8GA 4LKOA 4X45A 4GEKA 5A05A 2DFLA 1M5RA 4I50A 1JA1A 3A7EA 4G86A 5LUAA 1YZHA 2YWCA 5E8JA 3PZRA 5BUSA 1Y7TA 2O50A 3LCMA 2CBGA 2HTEA 2Q3FA 3DB2A 2WU3A 3G85A 3A9CA 4U7GA 1U3LA 3VNQA 3NAQA 1Q0SA 1VPWA 2V6BA 4ZVVA 5C4GB 1OROA 3E9NA 5AKLA 4UEOA 3CJQA 1J0BA 4N3BA 3JAKA 1AK9A 1UOEA 3IBYA 3QF4B 2JASA 5IXYA 3AFHA 2WJAA 3SHOA 4ED9A 1R4ZA 3FE2A 4GFDA 4HNRA 5IYZA 1E3IA 2XCIA 3KL2A 3QUCA 4KXNA 4QODA 3LU1A 4DKXA 1JQKA 4U39A 4BMNA 3GFSA 1XCBA 2F17A 2QRLA 1DTSA 2IHNA 1RSZA 5FPQA 2D2IA 2ZUUA 4OJMX 3ETJA 2H2AA 4M9XA 1E1YA 4HDSB 3I8XA 2GM3A 2OXTA 3BWDD 3TRJA 1GLVA 1D4OA 1NOKA 3BJMA 3LRTA 4ASUA 5AW5A 2BI4A 1QVZA 3UJAA 3DMTC 1T9ZA 1ZOIA 2Z9CA 3I72A 1M1YA 1PJ3A 3T7EA 1XQ9A 1J49A 3UC9A 3CKYA 1QDEA 1IUPA 3GLGE 1ECBA 4MS1A 3D64A 1DARA 1AV6A 2NUTB 4K46A 4BWGA 4QXPA 3WKDA 3HKBA 3DUFB 4MYTA 2ZJ2A 1D6JA 3W5JA 2EP7A 4NCKA 2LCQA 2H7CA 4DIFA 4F4JA 1KKUA 3D9QX 4C05A 3UFXB 3CVVA 4MQMA 3ZK7A 4A8JA 4GG1A 2NTVA 4UTVA 5LDGA 3GLTA 1SOAA 4XLZA 3HBMA 1Z4PX 5FAXA 4D4GA 1L4NA 1FP7A 1Z5VA 2OO5C 4HH1A 5LCXA 1CS0A 2VRCA 3O7MA 2XSZA 3PQFA 3MINB 3HUUA 4K9SA 5DWQA 2ON6A 1S02A 3KOZA 3NQ41 4NWIA 4BBAA 1HI9A 1BHJA 2FP4B 1QCDA 3OQOA 2XAUA 2WTXA 2P9HA 1J4AA 1YK0A 3T5DA 2KG4A 3T1OA 2R5FA 1Z34A 1FPQA 2AKEA 2JD2A 1G0OA 1M2EA 1OXUA 3COYA 3F0GA 3F5SA 2DKFA 3RODA 3RRFA 3ERNA 5HY1A 2PTGA 3B3FA 1NXTA 3KQTA 4C1NA 3QBDA 4LJKA 3I5XA 1OI2A 3JQ8B 2V3VA 1YA6A 1VH8A 3MGAA 1WXGA 2OB2A 5HY4A 5LA6A 3GL9A 1RAEA 4IIGA 4Y30A 4A82A 4BWVA 4QATA 3WIOA 5IDXA 4HNAA 5EZQA 2HIAA 3JWJA 3CGWA 3QMPA 3PAFA 2FPUA 4QX6A 3SJ7A 5I8WA 5JSZA 2PKRA 1YE5A 3QQ5A 1OWMA 4PGAA 1T4BA 5CP8A 5LPNA 1W41A 1AZLA 5DH9A 1CB0A 4X84A 3E5MA 1YFZA 3C3DA 3L7YA 2I91A 4GSKA 4K9PA 2WIJA 1N8NA 1TA4A 2G09A 4LCBA 5E95A 5EPEA 5LZ5A 4BX9A 2A9PA 3W8EA 3KLOA 2QVLA 3EXG2 1EVQA 1V16B 2CXTA 1W55A 1KMHB 1LV7A 3J80A 4FQ7A 2VYVA 1A50B 3DS8A 2BEJA 1S1MA 4N3AA 2JAPA 4LPSA 2PRSA 5E9AA 1D6MA 2XF8A 2GLZA 1DAEA 1KJJA 3H4IA 2O2SA 2ZTVA 3KCQA 4HWKA 4P3OA 5DULA 4ZV7A 4FB4A 1YVEI 2AEFA 3QLVA 4TT8A 4YECA 1QONA 1SG6A 1KVTA 2GFQA 3VR0A 4Z9XA 3TH5A 1NURA 3MCUA 3ZGXA 4ZYXA 1NC1A 2WJ4A 1SBQA 2NAPA 3EGEA 4JT8A 3VYUB 4MYDA 4I3GA 3KPVA 4JI6B 4UM9D 2C3YA 3M5CA 4INAA 1PD0A 3OPNA 5AJHA 4LEIA 1FOEB 3TXYA 1H2ZA 1P5HA 1R0KA 3GFPA 5WRFA 3F73A 3KYIB 3E2IA 1SOMA 5D7BA 3SZLA 5I7RA 3M4YA 1K73H 2QTZA 3PWSA 1OFIA 1YQQA 4X9XA 3TOSA 1NMSA 1N8TA 4X6YA 1TXGA 3O8QB 1RP7A 4I1SA 4C0AC 4RDXA 4YRFA 2PSSA 1H05A 5EQFA 1R6TA 4WKCA 1IFXA 1I7QB 2RGUA 3DO5A 3PQ5A 1A8IA 3KJFA 1AD2A 3KEOA 5JZOA 2IS4A 1JU9A 4KLZA 4EMTA 1YQEA 3MBKA 3HA3A 2J9FA 5FCDA 4P0QB 5EGSA 1BVUA 4LX8A 2RIPA 1HT0A 3IJPA 3LWBA 3BXZA 4TMXA 4YAOA 3NT5A 5B1SA 4AJOA 1VHQA 4DYVA 1B0AA 4P5DA 4B8YA 4XARA 5H02A 5EMMA 1ISIA 1R66A 2OBFA 3TR6A 1WDMA 3VU3A 2QRVA 3MLEA 2DU8A 1LCIA 3D3NA 1ZHFA 3LK7A 4YRNA 4G8BA 4IMRA 3QEMA 3VYSB 3EIFA 2BRUA 3IUMA 3JYLA 3T4XA 3W5DA 1IRIA 4RQAA 1VGQA 4QXOA 1NUTA 4MYCA 3MQ4A 1NRJB 2IOFK 3DULA 3DE3X 5DBGA 4CDGA 3L7BA 4Q4CA 1IHPA 4UARA 5J2TA 5EWLB 1V6AA 3LSTA 221PA 1TVKB 1G21E 2ZVQX 3B82A 3IP8A 2B34A 1G55A 3QVOA 4KLNA 3H2KA 4XEHA 1CETA 1D8TA 4XFKA 3VZPA 5JSHA 4AY5A 1UJNA 4E30A 1P0QA 3EZYA 3GMDA 1ZVVA 4KVZA 4DDKA 1DIGA 4OKIA 4RF4A 3VZCA 1V7CA 1PWEA 2EG9A 1E1CA 1PJCA 3JAWA 4UQOA 3RS5A 1CZUA 1W76A 1A69A 2CXNA 2ZIZA 4WJLA 5CDSA 1LSOA 1SQGA 1K1EA 2D1TA 4PGGA 2ZTLA 1QRUA 2J0SA 3S55A 4J49A 1NNSA 4D8WA 1CEEA 1XAGA 4Q9IA 3HCBA 1HZZA 1N5IA 2YYSA 4OQYA 3NXSA 3B7PA 4FZRA 5F51A 1NBWB 4FFNA 3ZH2A 1YC5A 2WJJA 2O1XA 5JG7A 5B7PA 3L43A 1OVMA 2QMHA 4IILA 1RVV1 4UMEA 5JBQA 5C8YB 5H3LA 4ZAZA 2ZSJA 4L76A 1TQHA 3W6UA 4RF3A 1Q2XA 2WHPB 5JS2A 3QI2A 3NVDA 5DM60 4QUKA 3RF7A 3ICWA 2J7PA 1JDTA 1JHMA 1H94A 2IV3A 1T34A 2NADA 1ZC3A 1GZ4A 4E11A 1D2GA 1D1SA 5A4FS 3DLBA 3A6GA 1EJ0A 3V8RA 3K8OE 3ENKA 3PHLA 4IDNA 4R9RA 1PJQA 1E1MA 3WE7A 3U44A 1BA2A 1J00A 2FUG6 5JZSA 1ZD4A 1KQGA 1AC5A 1GZVA 2OCBA 4IQ8A 1A9PA 3GFTA 1B00A 2FA9A 1Q0TA 4EQ6B 4F9FA 5FA5A 3UK6A 4FYYA 1HO3A 5FTMA 3SXPA 1P4JA 4DANA 3IHLA 1QYWA 3Q88A 3UMRA 1SCJA 4CIBA 4BQPA 3I7TA 4L0MA 5BWNA 1Z16A 1KDYA 2NPFA 1X8JA 2DXIA 4M6WA 2AD1A 5GONB 2FSIA 2ONCA 5K2OA 2BGGA 3GA5A 1M0SA 1Z82A 2WIBA 2AJCA 2C58A 2ZSDA 3G1UA 3MGKA 4HWTA 5AW0A 3S0YA 1P4AA 2VJLA 3TR5A 1UXJA 4NCAA 5B7GA 4FSDA 4TL9A 1DAPA 3ZOPA 5KTKA 2G17A 4OMFG 2V1UA 1J1ZA 2QRNA 1C30A 2IEAA 4JV5B 1CQJB 5HP8A 2P7HA 1U6IA 3BB4A 1W36D 5I7SA 3OEWA 4ZT7A 1DAGA 1KD1H 2VS1A 1G17A 2C5HA 3C7DB 3F7NA 3R76A 3LUBA 4B84A 2QM3A 1G60A 5EEHA 5LP6B 1FFBA 1G63A 4HGOA 3SM9A 2IV7A 3SN6A 3OT1B 4CI9A 4O2BA 1LWNA 4EJ6A 9ATCA 2C3OA 4HRVA 5T4BA 2QTVA 4Y2HA 3CYPB 1KJZA 3LC7O 2IXDA 2MJLA 2Q2OA 2QTNA 3B3QA 1Z4QA 2AJDA 3DOJA 4BBJA 4R7TA 4EH1A 2YICA 3IV6A 3IJRA 2ZQZA 2LTAA 1PFUA 1EFUA 4LYYA 4ZT3A 1NV9A 1GAQA 1OD6A 4AYTA 3GEPA 1FVHA 1DAMA 5AW8A 3S3TA 4YT5A 1AB6A 4YTEA 1TZJA 5KREA 2FF7A 4A03A 1FUEA 2EDAA 2WF5A 3VZSA 4UD6A 3L3BA 2RONA 4AS2A 3T9DA 1K4MA 4BU0A 4PV7A 3EMBA 1VI5A 1YJ9F 3ESXA 2DKOA 1Y6RA 2BOVA 3GJ6A 1JILA 2OGZA 2ES4A 2OCKA 1P9WA 2CLKB 3KTDA 2OYCA 4DLPA 4LF8B 3K9NA 3BEOA 1YKGA 2P3QA 1EQUA 4JR2A 5TNXA 1WXIA 4TKUB 1LU9A 2HS4A 3TB6A 2ISSD 4IH1A 5EQJB 2LWIA 4ZQGA 1Y7IA 3LD9A 3M3PA 4XWKA 5DASA 1YJBA 1JUDA 1ZN2A 1WUYA 3BM5A 3LT1A 3MS4A 4XASA 2QMUA 3HB9A 2V7QD 2B5VA 4E1AA 3OJWA 4ZEVA 1G59A 4W6QA 1E63A 3UG6A 4F56A 2EFEB 3TF5A 4FHEA 2WVGA 1U80A 3D2LA 4ZEXA 1ZGHA 1U98A 1CY1A 1UBKS 2QENA 3QE4A 3C39A 4D4MA 3F3KA 1HY3A 3L46A 1UBFA 2YWFA 1T2CA 2AOUB 2NVWA 3O8LA 2O0MA 4KGDA 3W6OA 2GF9A 4TTAA 4BVJA 1NVVR 4B34A 2A9KA 4KGZA 2GARA 4OYLA 4RD4A 1Q20A 1VFNA 3MGBA 4FGLA 5ECYA 3KKEA 3QPWA 4GPIB 1UQRA 4OHRA 1TA9A 1GARA 1UT8A 5F7OA 2QKYA 1F5SA 1L1RA 1TJPB 1L0BA 1ZJYA 2H59A 4MW6A 3D8NA 3V1NA 2DFPA 4YRMA 3MRXA 1HL7A 1K2WA 2EZ8A 2YXNA 1HSZA 3HEMA 2J5XA 2JFBA 4V0OA 3NTUA 3HNOA 5BY2A 3IKLA 3MMSA 3L8MA 3WGOA 1OH8A 3WB9A 1YQWA 4YCNA 4PWZA 5G3ZA 4OU4A 1FFCA 1PSDA 2J32A 5DOZA 3MRVA 1AS0A 2ZVZA 1IEWA 3DZ8A 1OILA 1WB4A 5CPFA 3IMFA 2F1HA 5EXTA 1MFPA 1V5IA 4PYKA 3CW2A 3VPSA 3HM2A 3IQDB 2QZ4A 2WA1A 2A7QA 4XVRA 5IJAA 2BLLA 1NY6A 3DR5A 3O8OA 2E37A 1L7RA 3FPJA 4MWDA 4KSBA 3C1TA 3EE6A 3UKDA 3V8EA 4B32A 5U9CA 2Y4NA 3JXEA 1T2EA 3Q8MA 4O4LA 3EAFA 1RM0A 3BH0A 4U2FA 1IEVA 4ONEA 4YQZA 3F6SA 2CDCA 1ES9A 4LBZA 2DHDA 4ESVA 2J6CA 3CUVA 2VEDA 5HPYB 2MYTA 4LHVA 1L3CA 2J85A 3C9UA 1JEQB 1YZGA 3STXA 4RMNA 1QMPA 2GAFA 1DDOA 1E1KA 1PLLA 2QN9A 2CL0X 2QRQA 4CPDA 1TKAA 2OV4A 3LY7A 1IY1A 1HSOA 5AI0A 3RTDA 3AFMA 3CY6A 5BUQA 1RJEA 3D8HA 1F6DA 4G9BA 3B20A 4H6VA 1YIDA 5EE3A 3ULKA 1MABB 2TMKA 3K0BA 4HNSA 3DL7A 1SAYA 4HSGA 1V9LA 4Q6WA 5BP7A 5IANA 3B2EA 3WL8A 2D4AA 3E58A 4KX3A 1TCUA 3VKHA 4J7UA 2AFIE 2B20A 2RG7A 1ZH4A 1E4EA 3B6EA 3LDHA 3LT0A 3P32A 4G23A 5JI2E 2AF4C 5G4KA 4EG5A 3V32A 1Z6AA 3AWDA 3IPAA 1A71A 4BQSA 2IUEA 4GBJA 3WIBA 1JFFA 2NXJA 3GJRA 2QY6A 2RSLA 1SBNE 3G2IA 1SWVA 3L0SA 4LGYA 2J0QA 1Q3TA 4MR7B 1I14A 4M1YA 5HIJA 4OHWA 1XUOA 1OLUB 3DOFA 1XVUA 2P9EA 3CCEF 4Q4LA 3FSRA 4WZBA 6AT1A 2WDZA 4E88A 2NMUA 3ZE6A 1MVLA 3H3FA 1MG0A 1XB2A 1NAHA 3O1LA 5CAEB 1XD2A 1TYDE 3D3EA 1ECGA 3RJMA 3KR2A 2IE8A 2QROA 3B1JA 4HX9A 3KBOA 4NQZA 1MXFA 4DLSA 1PV4A 2UYYA 1E1QD 3O2JA 5B7QA 3IMKA 4BE4A 1S7GA 5JCXA 3D2CA 1N2EA 1Z2NX 4FJ2A 4Q16A 4X71A 1UP7A 2IYTA 3GHYA 4Q4HA 3N6XA 1DRKA 1ZXXA 1OFTA 3PFCA 1C29B 3NOOA 2YZNA 1WG8A 2AX4A 2ZXFA 3H5VA 4C08A 2RGDA 4COOA 5CG2A 2V3CC 2E1RA 2UV8A 5GOZA 3TZ6A 2ZWIA 4BZQA 3PG5A 5CITA 4KZPA 4LOIA 3FHLA 2A9QA 3RWOA 2VYND 4GWKA 4U9HS 4Z54A 4RTQA 3OZVA 3P10A 3OEEA 2CDAA 4EA6A 2HS0A 2OO3A 1P1BA 1DP4A 1XT6A 3ZCXA 5IJ0A 1I1OA 4GYWA 4JKYA 5A5DA 2H5JA 3HXOA 4I1RA 4MV9A 3YASA 2B8WA 2A9JA 1TF7A 4H1TA 1JZTA 3OSUA 3U9SA 3B3JA 1GILA 4URZR 3MQWA 1J0AA 4NUTA 3LNCA 2FGJA 1E4VA 3NWOA 1T1SA 4KODA 2XOXA 2BFPA 2I62A 4FEGA 1CZRA 2IPLA 2VZ0A 2VZEA 3VTAA 3P19A 4BQIA 1P1RA 4Y67A 5T8KC 1X1CA 5SZJA 3WNBA 1RJWA 2PX6A 1U9IA 2WU0A 3W3AD 4YQFA 2Q5OA 3B3GA 3KDPA 3H9UA 4MJLA 5EXXA 4B6SA 2ST1A 2PANA 3PCRB 5ISMA 5ER9A 4PZDA 4QHTA 4OQZA 3JYPA 4YRDA 2VUHB 3N7AA 5D3MB 3VHQA 2FVYA 3O8DA 1T5DX 1JAZA 4MIEA 3JVEA 1C8BA 4F6LA 2ZJBA 3CRVA 4M0FA 1N78A 3O74A 4ZOLB 2O3UA 2NXEA 4DTIA 2NVUA 2FSFA 2HRUA 1H0RA 3FTQA 3OZFA 5LQAA 1ADYA 3BSWA 3MYYA 2AN5A 3PA6A 3PEUA 3T12A 4G4GA 3TM5A 2Z5GA 2GN9A 2I8LA 2FE1A 3LUCA 2IITA 5EZYF 5BSRA 3TLCA 4IIXA 3A6ZA 4BZZA 1L4UA 4D46A 4EUKA 3GJ7A 4PO9A 4KXFB 3FFWA 4IJWA 3V7UA 4QYIB 5ERXA 1K89A 5BW6B 3EG5A 1GUYA 1GP2A 1XIVA 4WKBA 1YB2A 3DM5A 3OLCX 2O2HA 3H8VA 2I87A 1F0YA 1IPFA 2ZE6A 1IV2A 4P22A 4CLXA 4EKGA 2FMIA 3LWRC 1JT2A 1TGVA 1UEJA 2R6ZA 2YXPX 2H63A 2QE6A 4C6TA 4EARA 4HQLA 3WK7A 3PEYA 1ZH0A 4F97A 2ZPTX 3Q41A 121PA 1FXWA 3DV9A 4BC1A 3UW1A 3VKWA 1RU3A 1GV1A 4FDMA 4CYMA 1E3DA 4F9TA 4C7BA 4WLOA 2AX3A 1E7KA 4ENUA 1MO4A 1WU8A 3JQ7B 2JFZA 3GDHA 2B37A 2J31A 3FPLA 1CC1S 1NBAA 2YINC 3QVGA 2OTCA 4R8VA 4WN9A 5HDQA 4FPXA 3WHLA 1DPGA 4A4DA 5DSTA 1G8PA 1J2RA 3IAHA 3GOQA 1I80A 5AJTA 5EFZA 4CQLA 1JKIA 1FW6A 1XMOB 1U04A 1KJ9A 4PHGA 1GT91 3WLRA 5EJIA 4DW8A 5KDOA 4NSNA 2GXAA 3MPUA 1PYOA 4N5IX 4P7KA 3UKJA 4JASB 4LXUA 4CL8A 4AKHA 4UPEA 5IM4A 2Z8ZA 1EDBA 4XCVA 5TY0A 4XYBA 3WMFA 5FWNA 3KIPA 5KNBH 1S4MA 2BR3A 2R6HA 2YXLA 4OJKA 1I4OA 4UBOA 5K51A 4F3RA 1QK4A 1D3AA 2NTNA 3I76A 4QTYA 3LOQA 4FP9A 4GLOA 4YMGA 2QAGC 3BMCB 2PLWA 5HRCA 3GMSA 2BHLA 1WBDA 1W94A 2B4KA 3NS7A 1R1DA 2GK3A 1P61B 2PMWB 5IVIA 3LJKA 1AGRA 2ZUBA 4KH0A 3KKKA 1E60A 4OYRA 4RPIA 4MVCA 1SXGA 1VBMA 1OA0A 3IV7A 4GLJA 3QVMA 2B7LA 4IOJA 3SZUA 1S96A 2XMZA 1A4XA 2D54A 4D81A 5K0JA 1X1QA 5K3BA 1NG9A 4U7TB 1TTTA 4Q7LA 1P0MA 1QB8A 2ZOVA 2ID4A 4LMBA 5IXJA 1UDWA 3IPRA 1IJBA 2BP7A 3DL0A 1ZU4A 1V4NA 2F1KA 4IJKA 4KPUA 4PONA 3UGKA 1WRBA 1OJ7A 3FVRA 1AG9A 2J3IA 2OOSA 2ILVA 3S70A 3WLAA 3FNBA 1EB9A 3KJQA 3ETLA 3QE0A 3SDSA 2EKZA 1DBFA 3UT5B 3W9YA 3WYEA 4YV0A 3R7SA 1NE7A 1AXEA 4E31A 3F46A 3FX2A 3C3XA 1YOVB 2TECE 3LHDA 2Q5QA 1QOZA 5LUBA 3VCZA 2JH9A 2OFWA 1OTYA 2UUPA 3B8EA 3LVFO 4DUGA 5I7OA 5KNLA 4YASA 2HMUA 1CFJA 2WD7B 3L79A 2PS0A 2ZRPA 1FTSA 3ER6A 3EGWA 4MR9A 4QLAA 1KMCA 4BO7A 4LDQA 4IHJA 4PZAA 1VQ8F 4OHUA 3SFZA 4C82A 4PCVA 3F96A 5L7YA 3WK5A 3STWA 1RWVA 4HNGA 2I7VA 2IQIA 1KTIA 2W6ZA 3P52A 2ONYA 1RZUA 2V4UA 4C3UA 1SXJA 4NV3A 3S4YA 2FPXA 4Q3CA 1BGVA 1TD1A 4LJAA 4UM5A 3EVEA 1RNLA 3HH8A 4Z7QB 1DXQA 2DERA 1W35A 2HV8A 2IPXA 1P60A 3W8RA 1ND6A 3J81M 3ZXYA 4CV2A 3IHKA 2IVFA 4W1PA 4BB5A 4RS3A 3EXG1 3TUJC 3T5TA 2Q5IA 2NSYA 4HDNA 3R6DA 5BMVA 4RCYA 2PHZA 2VH2A 3R9XB 3V3TA 2XVMA 5LDDC 3GGOA 2DWCA 4GE3A 4R8RA 4H1VA 3FFMA 4Q1CA 1RKQA 1T1RA 5IJWA 2Z1FA 2XCTB 5HWSA 5F4ZA 4YUVA 1LPOA 1D7OA 4IDEA 5CA1A 1HYGA 3CUKA 5AJYA 5IHXA 3KQHA 4Q0MA 1X7YB 1HRDA 2WIFA 5EIXA 3RTBA 5JY6A 3LO8A 1DO2A 3NDJA 1UBTS 3U3OA 1XTQA 1PV1A 3ZV6A 1JIXA 4DREA 4QJ3A 3MJFA 1O96A 5F3WB 3N0WA 2OECA 3IX7A 1PNQA 4RS4A 1IMJA 4UNSA 5HRUA 2PMKA 3D8TA 1E5DA 2XWBF 2ZSKA 3RFVA 1C9MA 4DEYA 1TQ4A 2ZRIA 4AZSA 1YJAA 1M8KA 4GRDA 4XDHA 4WLUA 1RXSA 1QYVA 4YRQA 2XYHA 4G84A 3S81A 2XGJA 3M5PA 4GR5A 3G0CA 4LY0A 2HRDA 3OCJA 4XWYA 3GJTA 3QBVA 2LBPA 1XZGA 1P6QA 4LJSA 3WGTA 1DOZA 3BF7A 4L4YA 3TNFA 1FDWA 5TQJA 3ZDEA 1FRZA 4EMUA 5EIEA 3FUUA 5LZ2A 2AYXA 2JF0A 5H68A 1FMFA 4UVGA 3G7SA 3K0FA 3O8RA 4PFSA 2QI2A 3EMDA 1IXZA 3EN0A 3OZIA 3DLAA 3P96A 4JXKA 1XV2A 3IMEA 1T43A 5AW2A 3KT3A 3QG5A 1K5GA 1YR9A 5KWVA 1ZA2A 2E89A 3LYBA 2C4HA 2ZTUA 4FJ0A 1H93A 1N0IA 2BPOA 2DPMA 5DTJA 1AUPA 3I30X 3FOBA 3ESCA 3OQVA 4TS1A 5TARA 3VKFA 4IIUA 1X38A 4XJVA 5DM4A 4EW2A 3H75A 2Y0DA 1KRHA 1FYWA 4NYIR 4L28A 5BSWA 2BGWA 3MT0A 5KU7A 1K66A 1TCCA 2VAWA 1JG1A 5TQVA 1B6TA 4ZHYB 3X1JA 4MW0A 2AB0A 2ACEA 1UBLS 2WM3A 4HLUC 3RE3A 2VJMB 3KHSA 3Q8XB 2Z43A 3P45A 3VZQA 2YYAA 1U6KA 1EEXB 3PQ4A 1FP4A 3ZWCA 4DJFC 1L7OA 1NVBA 3MB5A 4BEVA 2FC3A 1GTZA 3VPAA 4DSOA 5EJEA 3NTLA 3W6ZA 3ESJA 1HKUA 2H00A 3HGMA 3MTDA 4NYJQ 3RYHB 2J59A 4PVDA 4G8CA 3WV5A 4DIDA 3QE2A 5JMWA 4NK4A 1UXGA 1CIVA 1IHYA 4LMRA 2ZAUA 2RJNA 4RMGA 5AM3A 1QYRA 1SKYB 4RVHA 4O2RA 1PFYA 4TV8B 1RHRA 4YIKA 3R7WB 1MUUA 2DSNA 2WC1A 4D8TA 1YRQA 1E89A 2IS6A 3RFTA 3NYQA 1XTTA 3PFNA 1GKKA 2IYRA 3Q1KA 2B5WA 1M2JA 3Q2OA 1LDMA 1X86B 4O3MA 3IQZA 2CNWD 1VDZA 3RS0A 3UJNA 2ID9A 3WO0A 4MW7A 4B6OA 1XKXA 1C81A 3S0HA 2ZFUA 3FWYA 4MV5A 2Q0QA 4ZGBA 1L4FA 1OXSC 1YONA 3WQHA 1T0IA 2H54A 4JVMA 5F73A 3IPCA 2OAEA 3KOOA 4G9GA 4XCXA 4AY6A 4C6RA 1VLQA 2PSJA 3D02A 3K1AB 2EFCB 4XQ9A 1DELA 3VNUA 4KXWA 4MWCA 3IKVA 1KI8A 5I9TA 4L1KA 4E3WA 2W6ID 1EFTA 1ZLYA 2AUMA 1ABBA 2XD9A 2F9ZC 4FFOA 5AVKA 1C7JA 3PGA1 4QPDA 1TT7A 2HDWA 5DBOA 4Z1MA 4M1QA 1MO5A 1Y3FE 4PYRA 2X3YA 1DHRA 4NBNA 4D3FA 1LBHA 2W2NA 1Z36A 5JR3A 5J2UA 3OPVA 1QRDA 3EQ7A 1W30A 4HHEA 1QHSA 3RCBA 4H3HB 4ENWA 1DG3A 4MUXA 3ZJVA 2QYOA 2P3OA 2MR6A 3WL7A 3UMGA 4IIYA 3KLMX 5FNVA 4IUCS 4V39A 2IBTA 4B3BA 2H06A 3REFA 4RMJA 5CYOA 1CR1A 3ZD8A 5L45A 5KO2A 1U11A 2IVZA 3PDHA 1V41E 1TK2A 1QFZA 2HCRA 5CB4A 3JZDA 4RVUA 4ZPXA 2CJWA 4MVJE 1KIAA 1EIWA 5KBYA 2C59A 4LI3X 3HLKA 2CCKA 4RSMA 3LTEA 3LXMA 4WAUA 5DNDA 1YV9A 3WLKX 3TVDA 1M0TA 3B2NA 2FH5B 2R60A 5KVVA 2RGNC 1MF7A 3JVIA 2AZMA 2C4VA 2VNAA 4JI4B 4GKKB 3OM8A 2PKQP 3KSAC 2PV0A 1XTIA 1XQYA 2ARKA 2H0QA 2RH4A 3HDJA 3PQ2A 3C7AA 5ALJA 3VPCA 4IEIA 3DJYA 2VCEA 3DONA 2ZAGA 1FUYB 1Y5IA 2XQJA 3O4HA 4RHEA 4U2CA 4KN5A 3Q8HA 1RCUA 3MWEA 1XN4A 4X5OA 1SQ5A 1PR5A 2XNJA 5DK4A 4BVFA 2X3FA 3PJRA 2X41A 3CB4A 1RWNA 4W8GA 2ZE7A 1N9KA 1WSWA 3I34X 2JARA 5FHQA 3USCS 1O1YA 1BW9B 1J8YF 2G25A 1K0UA 1UJ5A 1LSSA 4QBIA 5FO1A 2X5OA 1HDXA 1MP0A 4DCJA 2G4CA 2WJIA 2WJ3A 4LPKA 1K63A 4ROTA 3FM9A 3IVCA 1HV8A 1Q5PA 1JS1X 1K9MH 4C20A 1M7GA 1BRMA 1U0EA 2CVHA 2RK4A 1JHPA 1K92A 3KR0A 2XECA 5L6MB 1UOPA 3ER8A 3MW8A 2WYUA 2O7VA 4OP2A 5AOVA 1C0LA 2GPWA 3FPAA 1NQOA 5H83A 4XYMA 3ZHQA 2HA4A 2XTMA 3SYLA 2EC5A 4CKEA 2G9RA 2PBFA 3KVYA 3U81A 4LFBB 3E48A 2RAUA 1R7RA 2AFRA 2I2WA 2XW6A 3W4KA 3I28A 1AUVA 4KQKA 3CZ5A 1JJ7A 2EL9A 3FY4A 2D2EA 3QV1A 1BKYA 1L4YA 4M8IA 1IK6A 2XVXA 3CPHA 3DEKA 4RPJA 3WLHA 3BXPA 4EDHA 2KTVA 2VAXA 3MWYW 1BKSB 2NO4A 1A96A 2YWGA 2XTJA 1RMQA 4AZVA 2BZ1A 3VR4A 1SG9A 2WTMA 5F7XA 3DGEC 3BYZA 2BFCA 2JI4A 4LRYA 1HTWA 1A77A 3TRDA 2D0PB 2PXCA 4JEIA 4RD0A 2WYWA 3DZFA 1HBJA 3E4DA 4AY4A 4I9FA 5KNBD 3UV3A 3LT5A 1T9KA 2G9QA 2JCBA 3CR8A 3F49S 3OZTA 3X1KA 1NOJA 3HS3A 4QOJA 1HQYE 1PU2A 1UWLA 3BHIA 2HMVA 2PCLA 5EP2A 5K3SA 3SFVA 3UXEA 3UA3A 3EH2A 1N3YA 2EJBA 4FCTA 4PG5A 2RHRA 3H42B 3PUVA 4EY3A 1XZNA 3KOWA 4QE3A 4UUBA 3S40A 1IOVA 4PO8A 4IJ5A 2YV4A 4M55A 3HA5A 1X7XA 3HKEA 3PYMA 1LDNA 1KKMA 4WZZA 1XZHA 1JXMA 4DM3A 4B6GA 2HA7A 1G5TA 3CMMA 4UDXX 3FHTA 1E0KA 1CN7A 1U1FA 5LN1A 3T7TA 2ECQA 4QDKA 2R1VB 4F5ZA 3WXMA 2VFAA 5A6SB 3RQIA 4NCHA 5K8TA 1WEKA 2P4QA 1QG6A 1RXVA 4QPPA 3WHPA 1GTVA 4LJYA 3K0KA 3OCXA 1V71A 4DV2B 3LQ2A 4FX5A 4PF1A 2FEXA 1RWMA 3H1BA 3DB1A 1CUYA 5F12A 5G0VA 5BN4B 5FOSA 4NFSA 4U8HA 2NSLA 4HATA 4RPLA 3TS1A 4URHA 4NQ3A 3WWYA 4H3SA 1M2FA 2BFOA 2ATCA 2YHUA 1NN3A 1M7HA 4ALLA 3A1CA 2AMVA 1U2TA 2H1HA 3P9NA 4ZAFA 4I46A 5C80A 3NAMA 1D2MA 3QXSA 1X7GA 2YRFA 4WQMA 4UTPA 1QB7A 4TLLB 1I3NA 2N9UA 2YW9A 4REMA 4EG6A 2QTRA 2B4AA 5CYFA 5BQ3A 4EBFA 3GLFB 3TINA 1DQRA 1F60A 2H7VA 2YW2A 4HNHA 2QQGA 3ZLBA 4B1FA 4TKMA 4E03A 4TLMB 5AUPB 3MTEA 4NWOB 3LKVA 1OXMA 3O95A 1HLFA 3PNSA 4E21A 5BR8B 2O5CA 4PBTA 3NEJA 5FQNA 3SK0A 1L4KA 1TMKA 1LTHR 2I4TA 3KYDB 3LY9A 4V0LA 1CHDA 1T0UA 5HMMA 3T35A 4AJ4A 3G2MA 4XA8A 3NP9A 1Z4JA 2BGIA 4UHCA 5G53C 2O4CA 3VR6D 5TB5A 4BO6A 2W2VA 4K6MA 5TRTA 1N7IA 1W46A 3MMXA 4UC0A 1Z68A 5KYKA 1K7EB 4ZOCA 4EKYA 1YDWA 3N07A 3PQ8A 4JROA 2C2OA 1LNQA 5ICFA 3PQEA 4NJOA 2AK2A 4AUNA 2JIMA 3AVYA 4KP7A 1ORVA 3UPUA 3VJRA 3UCXA 4NX2A 5BQXA 1P7PA 5HXZA 4PU0A 5BR4A 4QAQA 3BORA 2HSWA 4CE6A 3NR2A 5LYJF 1HR0B 4L3VA 5HK9A 2OZKA 4W5JA 2SICE 3IPXA 3RVNA 4EA8A 1RZ3A 3ISJA 3CC4F 3IUQA 2QQFA 3RYCB 3H6KA 1VQ9F 3RLFA 1R18A 1GTL1 2WIDA 4TTIA 2XMPA 2C9DA 2HQBA 1NUPA 1C1DB 4ZI7B 5BNWA 1M66A 2BUBA 5AW3A 3LWQC 2CHQA 3IIMA 1XEXA 3AEUA 3LAWA 1EU1A 5K0ZA 2VK8A 4TYMA 1XA0A 3BD9A 3BE5A 3CZ4A 4KR6A 1E1LA 1SC4A 3K0SA 2CL5A 3CX4A 3OI7A 1K3TA 2MSLA 4KWCA 3DE2X 1A27A 5LOVB 1VI2A 3LHIA 3PU6A 4M8KA 4OMDA 4TV9A 5BNZA 4X66B 1O4WA 5BVHA 1QWSA 5JZMA 4YJFA 1ZJJA 1NTOA 4RQUA 2Q6TA 3SHTA 4UPDA 1NVFA 2QUBA 4V3BA 4RD2A 5FBWB 1FL9A 4IXNA 4KJZA 5I9MA 2GHIA 2J3LA 2PSDA 3HJHA 3MGGA 3OTHA 1M0EA 4N54A 2R11A 2W4IA 4BPBA 4K26A 3MFQA 1HNNA 3BT7A 5K3FA 1JA0A 1U8CB 1FXUA 3GUCA 2C1EA 4C88A 1JPJA 5KB3A 1LXCA 1YWGO 3ZE8A 4LZNA 2ZG6A 1EFPB 3QENA 2FX2A 3ABRB 3B6IA 4P7GA 1W2WB 1ODKA 4CG0A 1KP9A 1FQOA 1PS9A 3EUEA 1KI2A 3OZEA 2WAMA 3PDUA 4ACBA 4QU0A 3M9LA 1GD1O 2PGAA 3U62A 4MUNA 4S1OA 3D3JA 1VG1A 2EAUA 5KJCA 4P3XA 1FS5A 1DJQA 2ODBA 4FINA 3E3NA 2IIVA 2GBGA 1AA9A 3LWDA 4N0QA 4W7IA 2N75A 3ETDA 1TUBA 4L5BA 1MIOA 1O94A 1P2FA 1BXZA 2AZDA 4CIVA 4NV1A 3JQ9A 2QR2A 3MUOA 4PRZA 5LMCA 4AY2A 5FOXA 1IL0A 2Z8YA 4AWAA 5JAQA 1KNQA 4RZ2A 1F2VA 1O57A 4RPKA 3W9BA 5HUQA 5JNTA 3TTXA 3UUWA 4FGWA 4ZALA 3UTDA 2HSGA 1RIFA 3CO0S 1S6YA 1N2CE 1IEXA 3QPUA 2NZYA 3COVA 1NJGA 3P4UA 2GM9A 1PZNA 4FVTA 3CZPA 5KAMA 4RVDA 4WADA 2JJ1A 4ARSA 3PYXA 5H5JA 3D59A 1N36B 1ENZA 2YTZA 5HM6A 1PJ4A 3C3BA 4KVGA 1XQXA 4EI8A 3NBQA 3VV2A 5BR1A 3NT2A 2J0UA 3H0KA 3P4XA 3OO0A 4B74A 2ZETA 2F1JA 1WTCA 4JUAA 4YHBA 4AL4A 3O8BA 4L5CA 2JEZA 5I7FA 4MZDA 5LSAA 1K7SN 4HEA1 3RTCA 4AMVA 1N2GA 4Y2GA 3UOWA 1DPFA 5CBKA 3PGLA 1LJ8A 3OZBA 2ZSUA 5AVXA 5LQKA 1I2CA 2PTHA 2P3LA 4XFDA 4RC9A 2GAIA 2JFGA 2P67A 5F5LA 1M3SA 1MB9A 1PV2A 2CDNA 1AS3A 2OHJA 3DDUA 3U7QB 4C06A 2XGMA 2PJDA 2FQQA 4DMFA 1PCXA 4P35A 3RIEA 4F3YA 1SXPA 1G4HA 4BLTA 5M7EA 2GYYA 2H0AA 2V74B 5F77A 5FI1B 2QZPA 5T3UA 3MCTA 4NS1A 3DDCA 3EARA 3SM3A 2CJXA 5EAIA 5K0BA 4PCLA 1R4MA 3VDMA 4CT4B 4YV7A 4BB6A 1M2GA 1NC3A 1H6CA 1YB1A 2AWOA 2XI4A 3M6UA 1Q74A 4F96A 4CL2A 8LDHA 5FJJA 2I2BA 2XB4A 5GGYA 1BN7A 2XA1A 1SURA 3OJCA 2ADMA 5KVSA 3PX7A 3VHXA 2H1SA 4FW9A 5BQFA 1YIJF 5DLEA 3NCHA 3EF0A 5T4FA 5ELLA 4A2WA 3VOAA 2ZRMA 1IBSA 4UTRA 4H2DA 4AKTA 2Q1TA 1SU6A 1E92A 3BICA 3GG9A 3G6WA 4JD5A 3DBRA 5FD8A 2BE9A 2GLXA 1Z8DA 4YCMA 2X1MA 3TRKA 3IKTA 3EGIA 1PEAA 3TLMA 3HP7A 5BV1A 3HTXA 1DLJA 1H23A 1JSRA 1R8XA 2FMHA 2PBLA 4ZA2A 1I3LA 1YNSA 3DLPX 4K1XA 1ZCBA 2QSZA 5F1OA 3QFRA 1HPLA 1E79A 4YA6A 2YRXA 4GMFA 3D0RA 3HXKA 3KUKA 4KQGA 4PC7A 4R1QA 3HA2A 3WFZA 2Q2QA 3MCZA 1MC5A 3HJFA 2FZEA 4BYMA 2W2LD 5FLXA 3QEKA 5CM9C 5EO3A 1IK4A 3OX4A 2ORED 3GD7A 2O8FA 3K9GA 4UEJA 2NU9B 1NNLA 4MW4A 2FZLA 2I5PO 2ORVA 1COWD 3BVPA 4D82A 1Z74A 4P3PA 3SIRA 1E7QA 1F3LA 4X85A 4EB6A 1RPJA 3CXRA 5IMBA 2AXQA 2FPLA 1P77A 2VTBA 3OZAA 1C8KA 3AJRA 4ZODA 1PVVA 1XDGA 2NTEA 3I9KA 3L93A 4TLBA 2WJ6A 1L9XA 4ND7A 1CNEA 1QAOA 3KKLA 3SC2A 5B7NA 1K7CA 2I71A 3L7CA 4BE7B 2WUFA 1PFQA 1JYFA 1VQ5F 4AF8A 2UZ0A 1KR2A 2V0GA 1ZWZA 2ZRKA 2V7GA 3ZY3A 5JQGA 1KZGB 3B53X 5C1BA 4D41A 3QWFA 1AIPA 1H22A 3EULA 3BHJA 4C0JA 2ZS9A 1IN6A 2FW0A 3UUFA 3ZU6A 3KE9A 1RQLA 2FZ4A 3SHWA 3GT7A 3ICCA 5GVSA 5GQSA 2ZJAA 4JB8A 3TUZC 2NSDA 1WVGA 4CM1A 4DA4A 1GG9A 4NOJA 1DBSA 2EDCA 4WJZA 3UB3A 2G08A 1YVDA 1GYQA 3R7DA 3RRXA 3T5CA 2L17A 3LUJA 1ORWA 1BSVA 5BQ5A 2W2QA 4ZZ3A 1I7NA 1L7BA 3QYFA 4KR0A 1FMTA 2VJYA 1XJQA 5CLIA 3DFMA 3C6XA 4DR7B 3ZI0A 4JUFA 1VCMA 3D0OA 4C4ZA 2Q1UA 3CF4G 2HRQA 1YXMA 3QU7A 4MUAA 3IT2A 4JFAA 5A7FA 4HZUA 1VKRA 1UI9A 3LPMA 4P81A 4E13A 1HWYA 4DJAA 3OZGA 2GD0A 3E7FA 1U9JA 5K99A 3NOVA 4RNDB 1T3ZA 3UNXA 3X1XA 1QZTA 4YXWD 2Z01A 3ZPXA 1ZM4A 5DRYA 4LNUA 4GC9A 1QV7A 2C2WA 1L5QA 3DXXA 4ZCSA 3NMUC 1ODSA 4BHTA 4A1FA 3ZP4A 3NJRA 1HEYA 2DTEA 2EX4A 2BWJA 3NFRA 1N0WA 3W4JA 4EO9A 1N75A 1O87A 4HEHA 3RRYA 4TRNA 4V03A 4MROA 1UAGA 3WKAA 4EZEA 2KWIA 2W9XA 4RANA 4G0UA 2QI9F 2PNJA 2MT9A 3E2PA 4J9UE 4JR1A 4B47A 5DEOA 5DI3A 5JHHB 1TEVA 4WFKA 4X54A 1RYEA 3WGKA 4G85A 4HLDA 2Y1FA 5FADA 1SZDA 5CNJA 2GOYA 1X8LA 1SQ6A 4RXMA 1DC3A 2AUNA 2SKEA 5ECGC 5EKTA 5JLAA 3AVXA 6ADHA 1Z4OA 2PX3A 3H05A 5EJ6A 1NN0A 4OQPA 1QGUB 5C1PA 4PYNA 4AWXA 3U5TA 3ND9A 1Z5UA 2D59A 2HWUA 1RLGA 2REXB 3ABOB 3DOEA 3ORHA 5AOBA 1AHIA 1Z22A 2VHWA 3S8MA 4UHEA 1NQ5A 5ALPA 1S4QA 1KA9H 1RXYA 2EJWA 3RS3A 3RVDA 3TZHA 2Y1WA 5HY2A 4G36A 4M1EA 4L0DA 2JIBA 2VP6A 3C6ZA 4OB6A 1QPGA 1TPZA 4PLPA 4XPZA 3T6KA 1IOWA 1GRVA 1KOFA 4G8DA 4HP8A 5FI5A 1N6RA 2XMCA 3R4VA 4X3CA 4ZIRA 3QFCA 1WP9A 3A3PA 4GSLA 5CIQA 4RMHA 2I2FA 2IH4A 2ZF8A 2RGGA 4FFBB 1Q1BA 1QR2A 4U0KA 5KNDD 4G4JA 4DQ0A 4G0YA 5JEEA 1R6BX 1EFLA 2VA9A 1R00A 1Y81A 3MBOA 5U1PA 5T57A 3AR8A 3ZEIA 4E4TA 4MPDA 5KDLA 1E6WA 4W8OA 3D4IA 3WWCA 1QP4A 2YVLA 1LJLA 2RHHA 3BN3A 2JFWA 1ID1A 3ZCUA 3IUYA 3OCCA 3ORFA 1TU3A 4J2HA 1FZTA 1CJVC 1G7RA 2JDID 1ODLA 4EHFA 3BOSA 3CXUA 3NBUA 4XLLA 5CFZA 4IBOA 3EQ6A 2B92A 1RRGA 4YRBA 1JP7A 3THYB 2I9KA 3NDBB 3TIFA 1BJRE 3PFHA 1KYQA 4JJAA 5AXBA 1KDRA 1CDOA 2CXSA 2O23A 1KYTA 1U2RA 1HM5A 2QL9A 4QTTB 5JTUA 1YF3A 4R3WA 3U7FB 3RJZA 4BLOA 2DLDA 1TM4E 2Q0XA 3RTAA 3S2EA 1WB5A 4KIJA 3I4LA 5CT8A 2VDKB 4WESA 4HWPA 1S89A 2VF4X 3IOBA 2QSJA 2Q6KA 3QTYA 3IUNA 7GPBA 2O6HA 3C70A 3R0JA 2D5AA 3N6RA 4MV1A 4UBIA 1GZ0A 1EHCA 3DWIA 2C2XA 4LNAA 2OCAA 5AJVB 1QKIA 4MGIR 1QDLB 1A9OA 3WGQA 4TXLA 4CU2A 4MQEA 5GV8A 3TLEA 2FZCA 1O9GA 2PKYX 4DA0A 4ETMA 3GP3A 4RTLA 1JEAA 3L4EA 1LVGA 3CJRA 5DN6A 1PEKE 2FZGA 4DY6A 1V1MA 1WPGA 2DFDA 2HPHA 2IDKA 3VVLA 1YU6A 3A6DA 2WM9B 4LYEA 3GTZA 5BSGA 4YMVA 1RBQA 3W6PA 1I3OA 4N9QA 5ALRA 1HTTA 2ZANA 1K68A 3BCSA 3FJ1A 5A5GA 5JU6A 4R51A 4OXQA 3OU7A 4HV4A 4RABA 1NHWA 1YR6A 4HQKA 1I4WA 1RBMA 1KKLA 4UUQA 4EJSC 3C1OA 3TZBA 4DV6B 1R5OA 4PHCA 3GUHA 1K2VN 2R85A 1REQA 4DILA 3GRZA 3H1TA 5DKFA 1JHXA 2AI2A 3MNFA 4HEJA 2HJGA 2YJ5A 5B30A 1F8GA 4B4OA 4KO4S 2Y1KA 5EEGA 1JHAA 3U0VA 4KMRA 3U4QB 2FTKE 3LFOA 3CLVA 1AKMA 1NVMB 4KKXB 5BORA 3KUCA 3TEJA 3WDLA 3K0AA 2VJOA 1Q2UA 5E3IA 4XIYA 2VO1A 1JG2A 1E0SA 4EHAA 4ZOQI 2QXTA 3CLKA 3INNA 2A1TS 3O92A 4M49A 3EFEA 3L01A 4V2UA 5IJ9B 3JALA 4NFLA 1IIRA 2H6LA 2J5QA 4L6IA 1WP4A 1XVTA 1KS9A 3K1ZA 1Y7LA 2JFOA 1FSFA 3MZ0A 4RKQA 4A0QA 4B0OA 5BVGA 4BT5A 2X2PA 5ALZA 4U3JB 4L6CA 5HKKD 3K09C 1OH7A 4XJTA 2BN4A 2IEDA 3U09A 2GKSA 2NZJA 4FOLA 4W5HA 2X76A 3FNEA 5EVJA 3CWCA 1VYVA 5EFOA 4J0KA 1IONA 2WT8A 2OVBA 4NCXA 5LD2C 2FWNA 2HA2A 3ZJ4A 4DL9A 2RGRA 2X5JO 3QY0A 1HORA 1V47A 2GKGA 1ZMRA 3K0CA 1YJWF 5AH0A 4XE5A 4G3XA 4ZV9A 1VKNA 4YQEA 2HR1A 1IN7A 3GX1A 2QZJA 2GXSA 5HFJA 4JVSB 4MUYA 1KQSF 1YCFA 3P2IA 2OTJF 3ZBQA 1H2YA 1ONPA 3QEJA 1PAUA 2BKXA 2R62A 1TM3E 1BWPA 3ONDA 2VDWB 2QTGA 4P5PA 1A5TA 5LXTB 1GQOA 3QMVA 1ZC4A 4OL9A 4MCIA 2WU8A 3SICE 4E2YA 4Y9TA 4Z0TA 4QZVA 3PIIA 5D8DA 3OM0A 5ALWA 4BWFB 3DT6A 4A0HA 4WBNA 1NWHA 1ST3A 4I50B 1VTKA 2ADOA 3ZW8A 3UV6A 5K6AA 4K6GA 1Z26A 3DCJA 2QTLA 1MX3A 4B6EA 1PDOA 3M6MD 2JAXA 2YFKA 3L7DA 2GPYA 1ZX1A 3CRMA 3TSZA 1NUUA 1P9RA 3LPLA 1TZ2A 3CMAF 2AC7A 1XDWA 1TYBE 2C1XA 3NEAA 1WVIA 2PU7A 3NM5A 2BV3A 3OCZA 3RS4A 3LGAA 2HRYA 4KHPB 2IYVA 1HLGA 2GK6A 5IYZB 2PA3A 3D6UA 5KCZA 4XWWA 3NHAA 1RM3A 3OECA 1NQ3A 1Z06A 4GM4A 3WMEA 1BMQA 5I7UA 4ARVA 3L4KA 4WOJA 1MMFB 2VHZA 3PV0A 2GBFA 3EDRA 3E8XA 2G8NA 1Y8QA 1AUQA 2VQFB 3DNFA 4AJJA 3RC3A 2WOOA 4J1QA 3A2MA 2J4DA 3H8WA 3SF8A 4EABA 2IBSA 4PIPA 3NFYA 3G2LA 4NDZA 4RUKA 3SLKA 3TDMA 4BJ1A 4EGJA 3W7BA 5AW6A 2CXPA 5HJEA 1TYEB 2ET6A 5FUWA 1KZHA 4LXXA 5JPIA 3ZG6A 4DG9A 2EBUA 4G1CA 5D3ZA 2PKQO 4FFVA 1H1LA 2G9NA 2PL3A 2FG6C 4MGHA 2E5LB 3PF9A 1SZJG 4RDCA 5EMJA 1CERA 1BXGA 1LW6E 4MS1B 4R0VA 2FX5A 3HDTA 2XA9A 1LQTA 3KSBC 4MITA 5CA0A 3HKBB 1QIEA 1EGMB 3KP1A 4D9MA 5I7EA 2QZ9A 5T5QA 3WRXC 3ZEAA 3ZKWA 1SNYA 4V3CA 1P2VA 3AZPA 4Y9RA 4DUPA 3AC0A 1BD4A 3UXMA 4LDZA 5LWHA 4ZU3A 4A8JB 1YBHA 5REQB 3AQ4A 4W8HA 2F3UA 1JIUA 3R3YA 1CLEA 3IAFA 4OREX 4ERHA 4Q9LA 4DR1B 1K8ZB 5AQ1A 2HLDD 2H4FA 5AHRA 1EK5A 1U2ZA 2CL6X 4BLPA 1CS0B 2FSVA 1P0FA 3KB1A 3KO8A 3A6KA 1N77A 1AXGA 1VBFA 4WEOA 1D4AA 3ZDYB 3FROA 2NUBA 4KUGA 2C7OA 2BSQA 1YIOA 4TL8A 3I0MA 5KTTA 5LNK1 1LC0A 2HI0A 3ZOKA 4HN9A 4A7PA 3LUFA 3MQFA 2ERCA 4LC1A 4BNDA 3SMQA 3S27A 3FN4A 3HI4A 3KLNA 3BC1A 4ER0A 6ABPA 4IVPA 2PXXA 1RZVA 2PAFA 3V4RA 2WK1A 2V4MA 3B6JA 3K2EA 2JHGA 3K8YA 3OQIB 2X6TA 5LA6B 1JG3A 2I1LA 2ZWVA 1Z83A 4TWIA 4WACA 5FO0A 4HNAB 4LJ5A 1BCSA 3GGJA 1H3EA 1KMMA 5KMGA 5B3LA 5JSZB 2WRZA 4EO7A 4JGGA 4LW8A 3WWDA 4RTMA 1YT5A 1LW7A 4DS3A 3E5HA 4XPIA 1NE2A 3HHPA 2NYVA 4NC9A 3ADPA 1EM8A 1MNAA 4I9UA 1U3VA 2ZM6B 1DTWA 1KARA 4UW9A 3NORA 3OMLA 1O95C 1RQ2A 1OTHA 3ZK8A 4NATA 3UUGA 3EPKA 2LR0A 4YMLA 3SYRA 2Y3IA 4BMCA 4X1IB 3NUQA 1FFXA 5CLGA 3QNUA 4IFEA 1X52A 3U19A 3AM1A 4JK3A 4L16A 4J6EA 1XA3A 4K9RA 4MAAA 3MJTA 3WPXA 1JQ3A 1IATA 1GQYA 3KZOA 4IM7A 2GT1A 1ZGJA 2IC5A 5EJ8A 3L6BA 3DP7A 4DZRA 1EK1A 1H8ED 2VNKA 3OFVA 4QGAA 4YRSA 1ESEA 1D5CA 3Q7EA 3VC1A 4ZK6A 1IB6A 5EPOA 3U31A 1L8QA 3OUUA 4BP1A 3S8EA 4NYJR 2WSLA 4YGYA 1E3JA 1P3Y1 2YV3A 4EUFA 3C97A 1Q0ZA 3PLAC 4WHMA 4CEJA 1T2UA 4CGYA 5AXCA 1G16A 1YACA 2WMDA 1T2NA 2KSQA 2P5YA 3L6OO 4ZYUA 4X1KA 3GNQA 4N0PA 1Y37A 2ZYGA 3IEIA 4EYKA 3VI6A 2X86A 3W06A 5CG1A 1C7RA 2O5RA 3WOHA 4B82A 3N8KA 2J9FB 1T6XA 1NW4A 4CN8A 2FZ5A 4EJ2A 3GXOA 4HYQA 1U0GA 3CF4A 1Q6YA 3MWGA 3N2EA 3U3RA 3RABA 3M81A 5FPYA 2BZ0A 5DIFA 4ARAA 4OSPA 1I4LD 1SY7A 2GNAA 1FDTA 2YOGA 3R6WA 2I7XA 1FCJA 3O1IC 1LNSA 5LZ4A 4JX9A 1ZGCA 2QRVB 1JJBA 4L75A 1DFHA 4D4IA 2QJRA 3LL7A 4FUTA 4NXNB 2A78A 3QEMB 1GEGA 1KHHA 4IY1A 3M6AA 3ZD7A 5L7TA 2G82A 3R5TA 1A04A 3QKSA 4KQHA 1JBQA 1Z17A 4J7AA 5AK5A 1BS1A 1P1KA 2I2XB 2OT3B 4MRSA 3TDKA 3ESAA 1XZPA 4FOPA 3O8NA 3RTGA 4D6XA 5J2TB 4B71A 3WV4A 3P5SA 2BJVA 4IQGA 4FQ8A 4L4ZA 3K1TA 5B57C 3FYUC 3UXHA 1VCOA 1CY7A 4X92A 1JKFA 4Z8XA 5KOJA 1II9A 2FX3A 1P19A 2AOTA 3LVQE 4B3XA 2ZBDA 4NENA 2Z6QA 2R6R1 1FYEA 1U2DC 4O8CA 1R15A 1H0KA 2PMDA 1AXRA 3JAWB 3C8DA 4BJ3A 1VPTA 1JYEA 2OCGA 4X8OA 1MHTA 1I6LA 4URVR 2HJSA 1V39A 3ECCA 3IJEB 2O2YA 5D5HA 3TQRA 1WX1A 4RTJA 3Q7RA 4B6QA 4BO3A 3AIIA 2CC2A 1F8YA 2QJFA 3FR7A 3GLQA 1GAWA 1N2BA 4BNYA 1Q21A 3TLZA 1WDLA 4A0FA 3FZEA 4XDZA 1SJ9A 1NW8A 1A4RA 2CLMB 3CHYA 3M3HA 2NZWA 3VPBA 3WYNA 4OHXA 4NLLA 4A73A 1TJ5A 2J3HA 2IDMA 1O8BA 3GJXC 4BIIA 1WQ3A 1WZ2A 3IAXA 3H4MA 1IAVA 3QKRA 4D56A 4ZCIA 1QG4A 3X3HA 5IW8A 4TMVA 1H2WA 4ZDWA 1U0FA 2NSHA 4NMHA 2VZLA 1W1UA 5JH7F 4HXEB 3A9VA 5BNTA 2EXXA 2AOWA 3GMIA 2ZIAA 3U44B 3QVUA 2FFJA 1KWGA 3SQOA 1HDRA 4I1IA 4JI2B 3GUYA 5JZ9A 2CMGA 5ESRA 5DTEA 5BMOA 2D7DA 2YZMA 1L5FA 4YJDA 2NWQA 3L0OA 4MV8A 1Y1SA 4UE6A 1BDMA 5E1OA 1PWHA 1G20A 1YJ5A 2VPIA 3IP9A 1C9EA 4KO8A 1TMYA 2QLTA 1DT9A 1ZICA 3AERA 4DPLA 3G3EA 1GKLA 3R3XA 2LXNA 2L18A 2AN1A 1PR9A 3UAWA 2OK8A 2NO5A 3QU9A 2ZI3A 4HFNA 4GMGA 1D03A 4DNPA 3QUTA 4FB5A 3DEHA 4TYQA 4TUYA 3WGLA 2EG5A 4ZT2A 1A5SB 1DG1G 1KAGA 2DHEA 2VAMA 1HE4A 1TAQA 3ACBA 3GD5A 4O02B 3HV0A 4K81B 4NU5A 4PE5B 1VMKA 4F9EA 1RM4A 5L3QA 3AF6A 3R3VA 4MVJM 2QQ5A 5E6SA 1P74A 2WG2A 2WTNA 2QW8A 5FI3A 4AO7A 4GYYA 4PN7A 4G0WA 1E2KA 1VE9A 1XR3A 2GHRA 2I3BA 3EXIA 4L5IA 3NBFA 1MO6A 1OU0A 4TWBA 3V1UA 4BKPA 1N8SA 4X8HA 1T1GA 2JH8A 5J58A 1IOLA 4RJIA 4I4LA 3DVRX 1K5PA 3CLTC 3UF0A 5AVRA 1DIRA 1FNSA 4KO2S 4IV5A 4JOQA 4F21A 4O2BB 1HFJA 2Z3WA 2II6A 9ABPA 1OWNA 1V8DA 3T0FA 2QTVB 5FPTA 1VL6A 1UBOS 1WA5A 2I3DA 3BGIA 3CM0A 2VZ8A 2YZGA 3JQEA 2P9QA 4GZLA 4BNFA 5BWBA 2CVQA 4NPAA 4A91A 4Q48A 1M0WA 2AQIA 1S01A 1WUTA 3EIXA 3NTXA 1N34B 4HLCA 5FORA 1U4SA 3P9SA 5FR2A 3SQXA 1UXHA 3T5AA 1L8OA 3NNSA 3EGXA 5CFOA 1H4QA 1OKKD 2EJUA 3KXPA 5AIAA 1QU9A 2VRNA 3A25A 3PL1A 3QVWA 5DHPA 5JPCA 1WPRA 1AK1A 4CMGA 2Z3VA 3UGJA 1NNUA 3SR0A 3IHWA 1R9MA 2XODA 4X8MA 1IDN1 2KQUA 3QVXA 3AUAA 1I4TD 5C5DA 2Q46A 3M4JA 5AO9A 2RGXA 1U90A 4EGSA 5DXFA 4OQXA 2WIAA 1X1DA 3ZHRA 5M3BA 1UPXA 4H1UA 1JG7A 3DZJA 3I45A 3KQWA 4YALA 4DIOA 3V2UA 3LC1O 3UK2A 2BEWA 4DA8A 4OM8A 1U9YA 3HB5X 1U5CA 2DGDA 1PR3A 1RKXA 3CF2A 3I9MA 1VA4A 3D7RA 3NHBA 3P9PA 4IDOA 4JLBA 4BY9E 5EHNA 3OPXA 3HR4A 1FU8A 4HKTA 3ZXSA 1HOTA 1ZK2A 2Q29A 1C3XA 2IEBA 3PICA 5D2CA 3VPDA 1DWQA 1KH1A 3FWZA 4GBGA 1MC1A 1VL5A 1C0KA 1N57A 2H4XA 3T80A 4KE7A 4N65A 3WC4A 4DSZA 1PL6A 5ES4B 4LXIA 4FBGA 1FFSA 4FMDB 5EKXA 2I54A 4BGDA 3D3KA 1X15A 5GP1A 2WFLA 1W25A 2XGOA 5IC5A 2E3JA 3R8CA 3TAUA 1V95A 1TQDA 5HBRA 3EODA 2PUVA 3W77A 1KSFX 4YBRA 2FFAA 3DWGA 2NZUG 2WWRA 1RI5A 2B9EA 4IOKA 4Q93A 3ZV5A 4DE5A 1IVSA 4L02A 3OIVA 3EC1A 3ENQA 1Z18A 3F8SA 3FNIA 3HN2A 3LLVA 2VTVA 4OQQA 2JVIA 4Q1VA 1I4EB 5CB0A 2XQFA 2OENG 3OC0A 2YNMC 1EXWA 4MB0A 3RC7A 3VBEA 1USVA 3SYKA 4OOFA 2YKGA 4CLOA 2E6UX 2A84A 1RKBA 1FDUA 1NMUB 2GVIA 3V4LA 4ALIA 4GQBA 4PGMA 5EI5A 1G6Q1 5DEIA 3FLEA 4XVUA 4PWTA 1NVDA 3Q7IA 3W3ZB 4ENVA 1R0LA 5FYDA 4I8XA 2CY0A 1Z2EA 2WD8A 3DWFA 2H65A 3NV9A 2JJ8A 4KWEA 1TKCA 3LMEA 3JQFC 3O8OB 1ZCZA 2R47A 1OE0A 4XVHA 1TKRA 4E5YA 3PC6A 1WMAA 3H5LA 4O4LB 2HEGA 1ESMA 4IF6A 4QG3A 4TPKA 3R3SA 2VPYA 3DBVO 4FIDA 1JJIA 4JT2A 2NTYC 1AA6A 1SOVA 2QYTA 3QITA 3Q98A 1MR3F 3WTBA 3E70C 3LKBA 1W3EX 4HEQA 4F93B 1U2GC 2IP4A 2EARA 5AW7A 3SHFA 4G1UC 1RR6A 3LDAA 3ZXXA 4JLJA 1C9JA 4QQ8A 4CMEC 3R6TA 2VN8A 4DQLA 2E21A 2ZTHA 1IULA 3FNQA 1EJ2A 1MV5A 1R9NA 3GFVA 1NVTA 4KI7A 4EW3A 4AXXA 2IW1A 4MJXA 4Y0AA 1FE8A 2WEKA 1ONIA 3OF3A 4RH3A 1O0SA 4BATA 4N03A 2NW6A 1OFUA 3VU1A 1PP4A 4L08A 3X1MA 2AMYA 2PE5A 3DMTA 1OGIA 2VDMB 3D4PA 3S2YA 1TUIA 3J81A 1E4EB 4GDMA 2JKYA 3D5TA 1YZ3A 1XZMA 5E6RB 4NDAA 4XQGA 1O95D 1VKZA 1DS6A 1CIJA 2WWTA 5FTJA 1QO9A 1WBJB 1ZZGA 1JFFB 4C5AA 1ZGAA 4BTLA 5FUVA 1PQ4A 3STHA 4I1VA 4JX8A 3SJAA 2PUBA 3BRSA 3OJ0A 4I4CA 3JWEA 1IUKA 3Q9LA 3BTVA 1B15A 3DQPA 3PR2B 4F1KA 5JVDF 3P0JA 4DLRA 2KBEA 1FB5A 1KSGA 1RWXA 1GVNB 1LTQA 3LYHA 2H52A 4OY3A 5U4XA 1XD2B 3SS9X 4HNQA 2OO5A 2G72A 2PMPA 3UA4A 4H0CA 4PX2A 3LDUA 2BI7A 1JN0A 2QPAA 2OCDA 7ABPA 1AU9A 1SQSA 2VF7A 4WNYA 3WYBA 4F3KA 2O8EA 3KV3O 4TYPA 3SE0A 1Q7BA 4H7IA 5C53B 2ERYA 3TPFA 4S05A 3DV2A 3I6MA 1Q17A 1AKNA 3DYIA 1KZ9A 3RSCA 2JKVA 5FPHA 2XKBA 3HY4A 1VLZA 2V8BA 3BE4A 4P4UA 2IYZA 4YNBA 2CXHA 2FU5C 5IC4A 1U2PA 2FPPA 2PSHA 5IF3A 5KUTA 4GLLA 1KI3A 3ENWA 1U2EA 5JATA 3Q6NA 4AECA 1T4DA 2E1PA 1MX9A 2LW7A 1ZK1A 5CH5A 3FSJX 2HMTA 4BGVA 5CLFA 5EHGA 4UDOA 1NMEA 3V4OA 5E9QA 2BGKA 3VSCA 5I3CA 4LVNA 3AONB 3UMCA 5IJ0B 4AZTA 1K7YA 4MP6A 4EG8A 1AHHA 3BRQA 3UV7A 4JUCA 1N2HA 2HMYB 3Q15C 5FBLB 4YMUA 4DARA 5KX5B 2ZXEA 3H5IA 3M70A 3V5NA 2XVAA 1QJ4A 2HCBA 1PJRA 4Z4GA 4HWSA 2ZRAA 4QBTA 5L7WA 3S7ZA 4KRYA 3CCFA 5ALOA 4EOGA 3R5JA 2GVZC 4U7WA 2VNIA 3CRQA 2GF2A 4OJQA 1DKPA 1PWXA 1THMA 1ZD9A 2XEXA 3C2QA 5HXUA 2NV0A 2MWMA 1P4HA 3C7KA 3O0DA 4XQCA 3EW7A 4EDFA 4GM1A 2XKKA 3A1WA 4NYMQ 4AZ0B 1DI0A 2JFFA 2C84A 4D9JA 3LXRA 4RX1A 3UIEA 2AIRA 3WLJA 3C5HA 2QGNA 2ZYIA 5K5EA 5EJ4A 1U9ZA 5J4LA 2VDUE 1RM5A 3I5MA 1E1QA 5KVAA 3QEOA 3OX2A 3EBPA 3ISVA 3MJCA 4XJXA 4ZVSA 5LZ8A 2NVUB 2EBHX 1MA3A 4G5HA 3S29A 4A23A 4KIGA 2ZT5A 2XSZD 3OTWA 1YCHA 4OHFA 1XP5A 2EIXA 1KIMA 2UVDA 1H3NA 1H0SA 4PAOA 1UFRA 4QEDA 4C21A 4OHMA 4MKRA 3AVVA 1WO8A 1CF4A 3DAHA 4BVGA 5HJ5A 3GPDG 4O5OA 2ACVA 3ELDA 3CINA 3RVMA 2IHBA 3CH4B 5SY6A 3WP1B 5L53A 5HF6A 4FI3C 1XTSA 2DVMA 3SJBA 2P78A 2FOIA 5KQSA 2ANCA 4RF5A 2QRUA 3A4YA 3DZHA 1P17A 2EW8A 3HPRA 2VNJA 3WADA 3DTVA 4NXMB 4TVOA 5GIOC 4Y2XA 3FJOA 2QBYA 4OBEA 3BILA 4OBBA 5IG2A 4F86A 1IOZA 1QNLA 1GVHA 3PENA 5BSFA 2YXBA 5KTYA 1ZFNA 5I4BA 4LOKA 3H7AA 2YHIA 1DGQA 2IYFA 3QWHA 1DVRA 1P29A 2QRZA 4J0EA 1T0HB 3VVCA 1PN3A 2AMTA 3NHUA 4K9OA 2PVSA 4RCVA 3QVGB 3I42A 1UAYA 5T41A 1GZUA 4Q3DA 3IKFA 1W1WA 1PG5A 4OKNA 4WN9B 4M83A 3AVOA 1N8RH 3A36A 4MAFA 5K05A 4CQLB 2DP4E 5IVDA 4OGFA 3UH1A 1TTPB 3R0XA 5ICGA 4XM0A 2VIIA 2QG4A 3COSA 4M9RA 2V9PA 4KFSA 1NW3A 4QUAA 1AMOA 1ZESA 2OG1A 3H16A