2RHJA

Synthetic gene encoded bacillus subtilis ftsz with two sulfate ions and sodium ion in the nucleotide pocket
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
ASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFLENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell Division Protein ftsZ
publication title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 109
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 2rhjA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 2rhjA01
5JCOC 4M8IA 1FFXB 5KMGA 2VAMA 1FFXA 5LOVB 1W581 2VAPA 4IIJB 5LOVA 3V3TA 1FSZA 4O4IB 4IIJA 1W5AA 3WGKA 4O4JB 4O4IA 4F6RB 4TUYB 4O4JA 4IHJB 5ITZB 5BMVB 4EI9A 4TUYA 4IHJA 1SA0B 2RHLA 5ITZA 5BMVA 4I4TA 4ZHQB 3VPAA 1SA0A 4WBNB 3ZBQA 4B46A 4ZHQA 4TV8B 5KX5B 5LP6B 3RYCB 3N2GB 4WBNA 3RYCA 5KX5A 3N2GA 1W5EA 4ZOLA 5JVDA 1TVKA 3VO9A 5MN6A 4FFBA 5IJ9B 4X20A 5JQGA 5IJ9A 5CA0B 5CA0A 3E22B 3WGMA 4DXDA 4O4HA 5JH7A 3ZBPA 5M7EA 1OFUA 4I4TB 2BTQB 3C8LA 3E22A 4B45A 3M8KA 5JCOA 3VOAA 2Q1XA 5FNVB 4YJ2A 2BTQA 4O4LA 4EI8A 2RHOA 1W5BA 3RYFB 5FNVA 3WGLA 4X1YB 5CB4B 4ZOLB 3UT5B 3HKBB 5JVDB 3RYFA 5EYPB 5LA6B 3VO8A 2VAWA 4X1YA 5CB4A 1TVKB 3UT5A 5IYZA 3HKBA 5LYJB 4EI7A 5EYPA 5LA6A 5J2UB 4FFBB 5LP6C 5LYJA 3M89A 2RHHA 3HKEB 4X20B 1W59A 5JQGB 5MN5A 5J2UA 4DRXB 3HKEA 4DRXA 4U3JB 2Q1YA 3JAKB 4O2BB 2XKBA 4U3JA 3RYIB 5JH7B 3JAKA 4O2BA 4O4HB 4E6EA 4X1IB 2XKAA 5C8YB 3RYIA 4LNUB 4X1IA 3VOBA 4YJ2B 3WGNA 5C8YA 5IJ0B 4O4LB 5LXTB 3CB2A 4LNUA 1RLUA 3WGJA 5IJ0A 3N2KA 5LXTA 4ZI7B 4I50B 2BTOA 4TV9B 5EIBD 2GVIA 1Z5WA 5GONB 3JALB 5IYZB 4ZI7A 4I50A 4TV9A 5GONA 3JALA 4XCQA 3R4VA 4HNAB 2RHJA 4YJ3B 5EZYB 1Z5VA 4I55B 4HNAA 4YJ3A 2R751 1JFFB 5EIBC 5EZYA 3JASB 3RB8A 5J2TB 4I55A 5MN4A 1TUBB 2R6R1 1JFFA 1RQ2A 3HKCB 3JASA 2VXYA 4U39A 5J2TA 1TUBA 3HKDB 4O2AB 3JATB 4F6RA 3HKCA 3JAWB 4EB6B 3HKDA 4O2AA 3JATA 3ZIDA 3RYHB 3JAWA 4EB6A 4X1KB 1RQ7A 1W5FA 3JARB 3N2KB 3RYHA 5CA1B 4KWEA 4X1KA 3JARA 5LP6A 4TV8A 5CA1A 5KMGB
chains in the Genus database with same CATH superfamily
1MX9A 3R0PA 3M81A 2YJ3A 4FYJA 4K7JA 3RREA 1YU9A 2R6ZA 3W5UA 2VAMA 1V3VA 1NOKA 3BGVA 2F1HA 2FPMA 3A6LA 1R6DA 4A8HA 2GO1A 3TJRA 2FW0A 1KJ9A 2H48A 5FV7A 3EWNA 2I2CA 4XR9A 1N75A 2BDUA 3DV0B 5HZGA 3BE4A 5B55A 1P73A 2G71A 3DLBA 4JI2B 1I4WA 3EGVA 2JIOA 4FSDA 2QE7D 4M53A 4Q12A 4KVGA 2JKVA 2FE4A 3R0VA 3B9RA 4FDVA 3WLAA 3GCXA 4ISBA 1M9NA 3IAHA 1W40A 1J0DA 3J81M 2C0PA 1U7ZA 2WSSA 1GL9B 3RYTC 4R0NA 3STHA 1AUVA 1TAQA 1K6EA 2XTMA 4OO3A 1WZEA 1GYRA 3TDKA 4UCXA 2JCXA 3PX2A 1WLYA 1BXRB 2AQIA 1SQ6A 1WP9A 2AOWA 1XA0A 2FOLA 3TLGA 4RO0A 4JP1A 8OHMA 1SBZA 2OKCA 3IAS6 5T5QA 1W2BF 3MOSA 9LDBA 1Y7HA 4NYIR 4BMZA 1TAUA 1VPDA 3EARA 3C6MA 3MOIA 3Q0TA 4RH1A 1MX1A 1C8BA 4NYJR 4NCNA 3AB8A 1T1EA 1Z4KA 2XB2A 3WRWA 5ALGA 5E38A 3I9V6 3ZIAD 5A3JA 1A9SA 1CZRA 1NXQA 2BJWA 3AR3A 5F73A 3U26A 3K5WA 1ZJWA 1AURA 5CITA 1LX7A 2XTAA 1GT6A 3G17A 5C7LO 2YS7A 4XDHA 4DSOA 4QVIA 5ELXA 3MT7A 3FDXA 3OF5A 5IM4A 3WV4A 1ODSA 1XTRA 1U3TA 4UUMA 1KYXA 3DFUA 4N0QA 1CBUA 1RYDA 4UCFA 4F06A 3IEMA 2EBUA 2OCBA 1XL0A 5J4LA 2UZ1B 4MYUA 1M72A 1RJEA 1Z0FA 3QU9A 4FMBB 1QAHA 4LDAA 4BZWA 2YASA 1JLKA 2W5UA 1TCUA 3C6XA 2XMBA 4M38A 4YREA 1ODCA 4PG4A 3CX6A 3EF3A 3AYZB 4UQPA 3GZTB 2AE1A 3G0OA 2WFMA 3PPIA 4JJ4A 2VCYA 3A4YA 3PT5A 5FPHA 2W2NA 1NVMB 3DYIA 2E6KA 1RBZA 4Y1FA 2D74A 2GJAA 3VNUA 3GFSA 1SBQA 3KQYA 3JVIA 4R51A 1SOUA 1KMCA 2CKDA 4LJ9A 1G8KA 8ATCA 2JVIA 4OXIA 1PWYE 5IM5A 1RPTA 4QGHA 4OLAA 1O97D 3OZDA 3G5LA 4UOQA 2CFTA 3TOVA 1E3WB 3U7EB 2J7PA 3FPBA 2UYPA 3CSSA 4J91A 3PFIA 1TM4E 5FPYA 3SLGA 4E11A 3CLRD 3OQVA 5F77A 2W58A 2GNPA 4R40B 2YZNA 4DEYA 5KNBA 4YRAA 2HD4A 1JBKA 3JAWB 1PZFA 3P9NA 3GNSA 4J0HA 3LMEA 5E9JA 1W19A 4GKJB 3VZPA 3WKAA 1LQUA 3DM5A 2RDMA 1GSIA 2JFBA 3BICA 4P22A 2FW9A 3L7AA 3TH5A 4H4DA 2BOVA 1YHQF 4JFRA 4ARCA 4EZEA 2VJNA 2E5FA 4IFBA 1TA0A 1QX3A 2J3DA 2CL6X 4DCGA 2BJVA 3F1LA 3ZWKA 5HVNA 2D00A 5CYGA 2ONCA 3EC2A 2QEXF 2ETVA 2Q8QA 2ZPUA 4PEVA 4AYXA 3DDUA 3SYTA 2QRVB 5IM4F 4UC0A 4ZVPA 1TTQB 3QVGB 4Q7QA 3X1JA 2G80A 5CJ2A 1WS6A 3PC6A 3ZBQA 4M9UA 1MTOA 5ALFA 2NUAA 5KX5B 2X5OA 1UKVY 2GXUA 2IZ1A 2Q1SA 3AINA 3DVLA 1JSRA 2GN1A 2DHEA 4BMNA 2FPWA 5KWEA 2Q46A 3MUNA 3H16A 1KORA 2G7ZA 1QOQB 3V8MA 3ZLBA 2CL7X 4DJEC 4Z99A 1PEAA 2WB4A 1NUUA 3IT2A 4OJTA 1U9IA 3TQQA 2I1QA 2HW8A 3WO1A 1GA1A 3DOIA 4QEZA 4UFPA 3VR0A 5DYWA 3C5CA 3LWDA 1CQZA 3L6RA 1ZN9A 3JWIA 2NUPB 2MMGA 3CGGA 3ANXA 1R0LA 5G0WA 5C34B 3DZIA 4YAOA 1Z4OA 3R3UA 5EVCA 1OZHA 2PL3A 2WFAA 3E9CA 4ILKA 5DRYA 4EUFA 2H2IA 2IRWA 2FUEA 2YNMA 3FMFA 4FFNA 1F8FA 2GWRA 4DE5A 1ZD4A 3COPA 5KC9A 4DMRA 2XLCA 2GAFA 1KBZA 5BWOA 3AVXA 5F1KA 2YS6A 4JK3A 1HY3A 1P1RA 1T4BA 1C30A 1TVKB 3KJXA 1SUWA 4IJQA 4X6UA 3WRYA 2IYSA 3L8YA 3STYA 4FLEA 2G6BA 1EJ6A 2J9YB 4B4KA 1ISFA 4ESVA 2XITA 2UYGA 3KL2A 5ADWA 1XAHA 3DLPX 2I7XA 1QF9A 2A0FA 1MAAA 2O4UX 4RV5A 2CYAA 3OE5A 4E5PA 1TYBE 3DOFA 4RZ2A 3S2IA 1AQUA 3T7CA 4B3FX 3ABSB 3KHNA 1QOPB 4CMGA 1ZIDA 1L4NA 1OYYA 3PXCX 3RARA 1W46A 1VJRA 2XDQB 2Q07A 2VSQA 4KR0A 5JSQA 2I91A 4G9GA 2XY4A 1K8ZB 1H93A 2JIZA 1DKMA 3A06A 4D2IA 6ADHA 2NXEA 5F51A 1N5MA 1DAHA 5JVDF 3OA2A 4KJXA 1HL3A 1FPQA 1SBNE 3R4VA 1BSVA 4ONEA 4YALA 1A0OA 5DLQC 3ZS8A 4IO0A 1UWVA 1DKPA 1O6BA 3GC6A 1Q0RA 2PZJA 4KJZA 3SJUA 3WJ1A 3LYHA 3WMEA 2PX8A 4KI0A 5AT1A 1NYLA 2FPOA 2W70A 2JGMA 2PYDA 3QY0A 4JNKA 4I2VA 3ERCA 3LHFA 4D44A 2PQMA 3RH0A 3B1JA 3L4SO 2IYZA 3EUAA 1GILA 3WDKA 3KQPA 4C43A 2AYYA 1ZVKA 4RD0A 1EHIA 5DGIA 1UUFA 1J8DA 4FR5A 1QCDA 2CJPA 1GQOA 2P5UA 2PH5A 2QI9F 2QRPA 3MMNA 3MJCA 1M1NA 4K1LA 1U98A 3QJ5A 2WU4A 1NYRA 3CIOA 3HBAA 5I9SA 4E1VA 4O4LF 4M1KA 5G4VC 1YS7A 1UEXC 5AH0A 5CXUA 5HKOA 2O8EB 1KYWA 1QIEA 5FF9A 5HIJA 4B34A 1N6IA 5EMHA 2RGDA 4FUQA 2DSTA 3Q8WA 4ZCRA 2ZJAA 4JEMA 3LKZA 3ULKA 1JHUA 1QHNA 3WPWA 3H83A 4JROA 1NVUQ 1Q2UA 4AN0A 1LTKA 4B0OA 5JARA 5B12A 4PZPA 2HLHA 3H19A 4Q4LA 4A03A 4ZGGA 3D9QX 3NKVA 3O1JC 1GFZA 3THYB 3RFXA 2H2DA 4IWXA 4PYRA 2HBQA 1G66A 2ICAA 4WLOA 5DNUA 4MI9A 4RFSA 5E8JA 3QUAA 1ATIA 2J45A 1ORDA 3FCYA 3GV0A 3HMKA 3HXLA 3LCUA 5I9MA 1SUSA 3QWHA 4J3JA 4OSOA 1T8UA 4EFNA 1DTWA 2RH9B 1IUNA 3GAAA 2C8JA 4UHDA 4WLVA 1LFAA 1TKBA 3HUUA 3LWZA 1F4VA 2QTHA 2ZYTX 4PM4A 4NWIA 4OH7A 3V3KA 3X43A 5CURA 5ADUS 3LWQC 1XCJA 1GZSA 3O73A 3PHIA 1Z13A 3AFGA 1ISGA 1ZW1A 2HU8A 3KJGA 4M83A 5CNKA 5LZ8A 5TQ2B 4C2AA 3FTFA 1D6MA 2AXEA 2C8KA 1W30A 4ND6A 2BFCA 4LSWA 5B6PA 4YRPA 3AYXB 1R6VA 3G23A 4OKSA 3TQIA 3KP1A 1Z6PA 2A1TR 4KG7A 4EB0A 4YCDA 1PTKA 2PUAA 1AA9A 3EBOA 2O8DB 2JFGA 1Q0QA 4LHZA 2NAPA 1C80A 2F62A 4GXQA 1CXZA 4NFSA 4MW5A 3U4IA 5BOSA 3IXQA 3RK1A 3OW2F 5D3MA 5C1IA 2O5CA 3WQHA 1YE5A 1I1HA 4ERHA 2K5UA 1DJOA 3G8BA 3IEQA 4WVFA 4X7MA 1Z22A 3I8OA 1SCJA 1DX4A 2HV8A 2VYVD 4MIEA 3F5QA 4R3NA 4D74A 2XE7A 2PZGA 4RPLA 5EINA 1NBAA 1DRVA 3FDZA 1R66A 5B2ZA 1A82A 1J0CA 1M2OB 3R2JA 4OY3A 3EOZA 4DLLA 1QIFA 1HUQA 5G2OA 4L8VA 4U5QA 3CVUA 3IQHX 4BJ1A 1T9CA 1DPFA 3TB6A 3THOA 3E8XA 4RGBA 4NMXB 4D02A 2P6RA 3O1LA 1K5GA 3OP4A 3OWXA 3L5OA 5K0NA 1A1VA 4NULA 4UTNA 5GPBA 5FBHA 5CB4F 1LCIA 1NQUA 3PQ7A 4X92A 3BH6A 3H1AA 1EWRA 2G5PA 5A6VA 4BE4A 4S05A 4MCAA 1MAWA 1ZWLA 3ONWA 2WB2A 2FK8A 4XQEA 2WD8A 4OAPA 5DP1A 2YINC 3OAAD 4WK6A 2E6UX 4EVRA 5B64A 5BORA 1YV9A 4ZHSA 1KZ6A 1G4UR 1XQWA 1XZHA 2WFZA 1A69A 4WLFA 4U2GA 1NBOA 4S04A 4NV0A 2CHGA 1JFTA 3U4CA 3E82A 2MSNA 1P6UA 2W2KB 2EDCA 3LK6A 3OCYA 3OJFA 1KVUA 4I6JA 2ZULA 5DXJA 5JH7F 2CJXA 3ZOKA 2PWZA 4NCXA 1CQJA 1U7HA 1P45A 4DMUB 3AW8A 2JIDA 4C4ZA 2A5GA 5KHLB 4NQZA 3UHAA 4XOUA 5JCOC 4J43A 5JISA 3G6KA 5KMGA 2AZ4A 3HCNA 1PJRA 3TGLA 2GXQA 3P0HA 4HYYA 1RJGA 3PC8A 3OIWA 3RABA 1J1IA 4G4YA 1EWVA 1MAHA 3P97A 3KWJA 1U43A 1JEDA 4CR6A 4XDYA 1YA4A 2YHUA 1NM5A 3K05A 4MKGA 5KNDH 4B09A 3QKSA 2Y8EA 3PQFA 3PX3A 2R7NA 4GWKA 3W3ZB 4MQMA 4YECA 2XXAB 1G8PA 4C4OA 2FZEA 1Y1LA 2RAVA 2VZ9A 4I9GA 2P2SA 3DFIA 4BNGA 5LIRA 1YOBA 2HVYD 2PGOA 3G82C 4BLVA 3KHSA 3OZCA 3IP8A 1Q0ZA 4Q66C 5K3CA 5LD2B 3VPCA 3VAYA 1A72A 4BEBA 1TU4A 1A8HA 2VHYA 4XUGB 3TECE 1OASA 5DI3B 4OJYA 5F3DA 4HSGA 3Q8KA 5H82A 3D54A 4LY0A 1IG3A 3TE7A 4Q48A 2B69A 4NG4A 5T57A 4A0SA 2W0MA 4C22A 2G25A 1VJCA 3BH0A 4RUKA 4F56A 2R00A 2XX3A 3P45A 3BAZA 2HOQA 1T9DA 1BIFA 2HPVA 3NW9A 1NYQA 2X7HA 1N3LA 2NUTA 2DJ5A 2V7EA 3GXOA 3PDJA 1FBNA 2CCJA 3HGMA 3L4BC 2UZ0A 1R1DA 1ZMRA 2JI7A 2QAGA 1GCUA 1Q1GA 5JEEA 3C8LA 1A9OA 5AXBA 2QW1A 4IRXA 2V4MA 3DE7X 1A9PA 4J03A 5FP0A 3LDTA 5JDCC 1W9HA 3VR4D 5KOJB 2A1UB 2Q6KA 4N3AA 2PR2A 1EPUA 2R8ZA 1YJAA 1IQRA 4Z5XA 4CMHA 2YUIA 4C7MA 5T3UA 1R15A 4BVFA 4WZAB 1ZM4A 1MW8X 4U00A 2VBIA 4DG9A 1NASA 3Q3JB 3IB3A 4QPZA 3OPYB 3MTQA 5EP4A 3V4VB 1FDRA 3LMKA 4TRJA 1FFHA 5HDBB 1ZUWA 3AVVA 3ZE1B 1XHEA 3CPJB 3VU9A 1FBTA 4G41A 5MDHA 2VATA 2HCRA 1RYZA 4QZVA 3NBYC 1DQRA 4KIJA 4PSAA 3VH4A 1Z6XA 3VTFA 4D3ZA 1REQA 1ZM7A 4ZVOA 3QNUA 2B94A 3HB9A 5JMWA 2FEWB 2FSPA 3N7UA 4AN4A 3QNMA 4X1IA 4R9VA 4YJ2B 5HSGA 4NXMB 2GZAA 5J4VA 4LNUA 3H84A 3B36A 4J0KA 5CT8A 3KQOA 3G6EF 2JHGA 5L53A 3EG5A 2G0AA 3LA6A 3NUGA 3SF8A 3TMAA 2HL6A 1YF3A 2I3DA 2Z9DA 4OB6A 4RKWA 4RQTA 5CNIA 1R8XA 5IBQA 1K7SN 4UTPA 1SB8A 1NVBA 3QMVA 3R7FA 1TEVA 2XUPA 5BR8B 1O6CA 2E1PA 4QGFA 2GX6A 4XX0B 4US1R 4D3FA 1NV9A 3JASB 4EOGA 5KUTA 2H0QA 3RBZA 2IYUA 1S7GA 4YACA 2E48A 1TJYA 2HK7A 3OMWA 2ACVA 2H29A 2YOGA 1LVHA 4NBUA 5HA5A 4B6GA 5EXEA 1ESMA 1PHRA 1VBKA 2GF0A 4MVCA 1ISPA 5SV2A 3VR3A 5LQJA 5DI9A 3PGVA 5CGZA 1X1TA 3B1FA 5KS2A 2QVYX 4MV8A 4JVMA 2P4UA 3HJFA 1DRKA 2CXUA 4A7PA 3PYXA 1Y4AE 1KO7A 4MV6A 4PS0A 1VQLF 1A9YA 1PSWA 3KYCB 1C4WA 3ER6A 3D3KA 4WE3A 1YZYA 3UV3A 1ZUNA 5KYWA 1TYDE 2QTBA 2ECKA 4KRYA 4K0KB 3C5EA 1FFSA 3UMSA 2QN6A 2N1BA 2Z0MA 4LF8B 5B6JA 1A76A 4IGIA 4CWAA 3AI3A 3LKDA 2ODNA 2DE0X 3WRXC 2X19A 3HDYA 1C0PA 4TZTA 4TUYA 4F6LA 2C5SA 2ZEJA 3FSGD 3IXMA 5FR1A 2D1TA 2C88A 2CNLA 3OLYA 3RUPA 4EQ6B 4YQFA 4KLNA 1XA3A 1E9VA 1L1EA 3KX2A 1YMVA 1NNUA 4L4SA 4WL0A 1YUMA 1SXJB 2J0UB 4BVLA 1IHYA 1JRLA 4TKZA 4D3SA 3LUCA 1X7GA 2BTUA 3AY3A 5M29A 2BLLA 3N0XA 4PC1A 2W00A 3PHBE 1JHDA 4TVKA 1NP7A 1P0QA 3R0ZA 4OQPA 2F3QA 5KSYA 1BMQA 3P9XA 4BGVA 5FA5A 1KOLA 4S1PA 4MS3A 5CA0B 5GAPK 1BMFA 3KO8A 4IDAA 3CKYA 1HDOA 3VHQA 1GG8A 2Q6OA 4KKVA 3ZLTA 1W73A 3MWFA 1EFAA 3KFLA 4EAQA 4BRWA 2O48X 4X64B 3L7LA 2UYJA 4RKRA 4PSCA 1R16A 3HBLA 3DAFA 3NK6A 5D3ZA 5E3JA 2F9FA 5CEFA 2PRZA 4GMFA 4B79A 3T3PB 1NUQA 5FNVA 1OXXK 1C3VA 1GKIA 1X80A 2BFDA 1KHTA 4AMZA 1IEVA 2WSBA 5DLDA 3ETHA 4EI7A 4OQXA 5F52A 5BQPA 4OXKA 3ZQJA 1KRHA 3CC8A 3SNKA 3TPFA 3HVJA 4HAXA 2CD9A 1W76A 1U9JA 3EQ2A 4OK3A 5BN3A 1F8GA 3D02A 4DLTA 1SXJE 1YIAA 1C4OA 2W4QA 2ZROA 1XNJA 3KQVA 1OREA 1T6YA 5L3SA 4AJ9A 3KUXA 4A6EA 2XQIA 3FOBA 3OHMA 5EMMA 2I4TA 3SXUA 5C8YB 4NARA 1PDWA 5B3AA 3WB0A 3ADKA 3JQDA 3FWNA 4CEIB 1FYXA 1U2GC 5F9HA 2LE0A 3NWEA 5BMVF 1VSQA 3QYJA 4LF9B 1M2GA 4KOEC 2GCOA 1GKKA 4N12A 3E05A 1GUBA 3DYBA 3MWDA 3I2FA 2AL7A 4B7AA 2PKEA 1EUQA 4KACA 1Y1SA 2FSGA 2VRWA 3QHPA 1ZNYA 2ABWA 7MDHA 4YJ3B 2QTLA 3HN6A 3UFXB 1E7RA 2PZMA 2PGJA 1C50A 3QVJA 3WGQA 1F3OA 3OM0A 1PJ8A 2CHVA 2D7CA 1FF9A 5FJIA 1E5XA 3W3AH 1NY5A 2XB8A 5IDYA 1NHGA 1N5JA 3GJXC 4CTMA 4NFYA 5A9SA 3DKRA 1WHTA 3N53A 4I1VA 3ABIA 4I5EA 3SEFA 1R9NA 4M0MA 2IYXA 3LX6A 1IAVA 2HLDD 2VZ8A 2A3NA 1PQYA 1OBVA 4C8GA 2VH1A 5H0IA 3LBFA 1QVWA 3GRRA 1QUEA 2G82A 1OPXA 4WVLA 3LNTA 3AY6A 1MQSA 3ML1A 2JASA 3RM3A 3AY7A 1Z2CA 1NV8A 3FYUC 3TRKA 2NSYA 3O3CA 3ZKWA 4B83A 4D9EA 1QO0D 1BQ3A 4M9QA 2ZBDA 1QUFA 2R7LA 1DEKA 2FPUA 3TQSA 4HMQA 4PHCA 3JWHA 3ESDA 4KUEA 1P4JA 1YRQA 4PPGA 3ZC3A 3WKDA 3ZHUA 3I0MA 4J6EA 5IAKA 1UPBA 2XBMA 3BTVA 4RHAA 2FPKA 3K9CA 1YZLA 2EF0A 3LA8A 5BT9A 5LN1A 3ZKAA 3AM3A 4S1WA 3Q88A 4EHJA 2FZWA 2OBFA 3GAMA 4MYSA 1RZVA 3QEOA 2J4FA 3KOZA 1GLNA 3DZDA 3GFGA 4NENB 4E07A 4WBNB 4YRSA 5LQKA 5IVDA 3AUYA 3HADA 3IJRA 2EG9A 4INOA 1X94A 2AI3A 2VXOA 4P0TA 5IKPA 4IY1A 5ARBA 2WPDD 2FMFA 2J85A 1VB5A 5TDHA 3NFRA 5GINC 2JHFA 1RTKA 4JSTA 5ICCA 4MW1A 5EXDA 5JANA 1RWNA 1UXJA 4Z0TA 1YWGO 3ZPXA 3CH4B 4CPDA 1GPBA 3CT4A 4F92B 3PIDA 4QLOA 3IMPA 4MAFA 4EKDA 3CRRA 1FP6A 1XLTA 4MVWA 3DVQX 2HGSA 3UJ3X 1ZJZA 5EZYF 1E2KA 1MA0A 3QMMA 1JG7A 1GQFA 5EMNA 1QWSA 1UWKA 3ECCA 4G4GA 4LJRA 2ZCUA 2C77A 4MUAA 2UYNA 2LGJA 4NRDA 1UBNA 2ECPA 2VT2A 3DD5A 3G1TA 3T5DA 2FN7A 3CLTD 4LJ8A 1P2SA 3MJTA 1LD3A 2AVNA 4QM7A 1F1JA 3HUTA 3FUUA 3D6JA 1F20A 3WGLA 1ILWA 4HH1A 1II8A 3IERA 4EMBA 3VZRA 1R0ZA 1WD7A 3CV3A 3L8GA 4NMHA 2BL4A 1HQKA 3QUQA 4FOSA 2Y99A 1V4VA 3AGPA 5KEIA 1GZ0A 4A3SA 1SWWA 4HEA6 4X20B 1Q92A 1LTQA 3PGXA 4RLFA 3HH8A 1A9QA 4BNVA 4F72A 2GUGA 1Z2AA 4NFHA 4Q01A 3D8BA 1A8QA 4BV3A 3WGVA 1XRQA 1Y8AA 2OORC 3BWBA 2OMEA 3HYCA 1V2HE 3HZRA 4XJTA 5EERA 5L7WA 4CGZA 3AVUA 1NVVR 3LUBA 1WB4A 1V4NA 3NPMA 4RS4A 3ZI0A 5IF3A 3AI7A 1HI9A 2YBEA 1YZNA 1IY2A 1RFGE 3D8NA 4QBFA 3C7DB 2DT5A 2QL7A 4I0WB 2BP7A 1IY9A 4BV8A 4EW3A 2DMRA 2Z8YM 3ZBUA 2QZSA 1H2BA 1Q6ZA 4PO8A 1U1CA 1TZBA 1UBHS 3QM1A 5F4ZA 5CCDA 3E9MA 2XVZA 5B3KA 4RZUA 3OY2A 4DAOA 2RI1A 1EX7A 1PJTA 1QH9A 1H4VB 2FRVA 2XCRB 4JDPA 4P53A 4U2BA 1ZAKA 2ZSJA 4URYR 1KK2A 1YQ9A 3NGXA 1H0KA 3HC7A 3OFSA 1QG6A 2VPQA 4TLMB 3S7ZA 3WMFA 1ULBA 2J8ZA 1JFFB 2VAVA 1E9DA 2ZR8A 3E2MA 3IHTA 2EKQA 2HPHA 4Q1CA 4QTZA 4GGOA 4ZTUB 3C74A 4AAYA 1A5AB 4HEHA 1G5HA 4M0LA 4KPFC 3F46A 5GOZA 3QMWA 1JDTA 4Q7LA 3FVTA 1AUOA 5TF0A 1ZD1A 2PKWA 4J90A 3VSDA 3U49A 3GRYA 1RXSA 2CXQA 5FOXA 1KWKA 1ZOLA 1U94A 4NU8X 1HNWB 2AZTA 2C4TA 2VA9A 4ER5A 1E77A 4FMCF 1UK9A 2P6PA 4JJEA 4AXXA 3J7AC 2AEEA 4E12A 2HM7A 2GEBA 2A67A 4B62A 4TXJA 1NLFA 3WP0A 2IEAA 3AIMA 4M55A 3WNCA 1G20A 1C3OB 1NIJA 1PVDA 3A0UA 5A2GA 2CWDA 4V1CB 4C04A 3TEFA 1E4YA 2WHYA 5HE8A 5LDGA 5E8RA 3BJRA 1R74A 2EFGA 1NT4A 1YL5A 4GS5A 1ZO8A 2H2HA 1U0JA 1T8YA 1VA4A 1U8YA 1E1NA 3GQBA 2OENG 3KIPA 4K3UA 3ID6C 1PI3A 2ZPTX 4LQ4A 4R81A 4YJGB 2IHKA 2WIDA 4D0NA 1IONA 1O87A 1JEQA 2WIJA 3SSAA 3U3JA 4MWCA 2VS1A 3LGXA 3T4PA 4F2PA 5F98A 1OAPA 1W85B 4MROA 3D4IA 1P6QA 3QUWA 2EZ9A 4FE4A 2PJUA 3JWPA 3DLHA 2MINA 1BXGB 2RK4A 4XM1A 1H2RS 5JQGA 1P61B 2IHUA 3PE4A 3GOHA 3RKRA 1UOEA 1Y3AA 3WIVA 4RTNA 4R2JA 4RVSA 4UEQA 1FRVA 1NN5A 3EQ6A 3ZXIA 4PQEA 4R1NA 1CDOA 2YV5A 4DXDA 3AUJB 5BR7A 2DPYA 4G0OA 1IK6A 1DQYA 2JDID 5JCOA 3RC8A 3WIOA 5EIHA 2VH5R 1S3IA 2P5TB 3MW8A 3KBOA 2FUG6 2CLEB 3RYFA 1C29B 1V16B 1RLOA 2H07A 2QXYA 1RIIA 2V65A 3HYSA 3P9PA 3VR6D 1D4AA 4POAA 5L4NA 1TCAA 4KHPB 1RFLA 3QEKA 1P1CA 4BFSA 2MU1A 3AKYA 2RHHA 2NU6A 3D0QA 4GMKA 3ICVA 2BEWB 4H7DA 4IXNA 4JYBA 3AGQA 4L5BA 4MR7B 5B1IA 5IJAA 5JIBA 2QBYA 2BSQA 1YJBA 4XOIA 2VUIB 4C1BA 5TJHA 1XVAA 2PMPA 3GHZA 1OHHA 4BTEA 2W8BB 3PFBA 1QB7A 3SE0A 1ZLXA 3JQGA 3NTOA 1K6IA 1OROA 8GPBA 2HRQA 3TNDA 2G77B 2XRMA 3RT1A 5EHXA 2QDXA 4DR3B 4RJLA 3FGNA 3WGNA 3HFSA 1BW9B 4RWZA 4H17A 4LHXA 2WIBA 3TW4A 5BNWA 4CEHB 2ZVYA 2Q5FA 4L4UA 3LDAA 3OCWA 2PUVA 2XXBA 3UENA 4BE9A 1OLSA 2O8BB 1E2BA 1YJ9F 5L3ZA 3IAAA 3UV6A 5AJWA 3SIPA 5DV9A 3VSBA 1XKLA 2DUUA 2XDAA 5HE9A 3WYFA 5CEEA 5JI2E 1ZRNA 3IFSA 1GCGA 2ZRMA 3DNMA 4U2EA 2HF7A 4OFWA 1M2EA 1ZXXA 1ESNA 4TL6A 1ISSA 2GFHA 4ZN6A 1CRPA 3PXBA 2PZLA 3KTDA 2JVJA 2X2OA 5MN4A 2CHQA 4L50A 3MUEA 2DWCA 2BZSA 4FDMA 1Y7IA 2AH5A 5FPKA 5JDCA 4XRGA 1O97C 4Q9LA 4N48A 4PN3A 3RYHB 3UQYS 4AXBA 2IYNA 5KYTA 3SDSA 2HCBA 3H9QA 1FZTA 1N3IA 1BC5A 5E6SA 5JBQA 4IHQA 1SHLA 3C16C 1ZLYA 1OV4A 1HDCA 3CLRC 4RJIA 3ZWQA 2KLBA 4FDLA 1QYVA 1MGPA 1KJ8A 3UY4A 3WJ2A 2OCXA 1DUSA 4F91B 3CF6R 5CH5A 5H59A 1Y6FA 5D1NA 2LBTA 3HBNA 3HZZA 5H68A 2NZ8A 2ZIZA 1DAIA 4H59A 4E4YA 4BUJA 1AT1A 1N4DA 3AUXA 4IIJB 4KXYA 4ZALA 1GNQA 4QG7A 3F98A 3IMCA 1Q2XA 2PUTA 2BR5A 3G9ZA 2RIRA 1LLDA 2JZCA 3DXZA 1Q16A 2O7RA 4A5OA 2CSLA 3AF0A 4HMPA 2CHEA 1K66A 2XE6A 4HQLA 2ZIGA 5EHIA 4FE7A 1L7MA 1JP7A 1SIOA 2NZWA 2NSHA 4JP2A 5BVHB 4RH3A 3UKJA 3LRPA 2OEPA 1TB4A 1VK3A 2DEUA 2JL1A 1EFRD 2EHJA 5HBGA 3IIIA 1JDJA 4YRFA 2Q5JA 2XT0A 3PF9A 3RG8A 1N0VC 5KQSA 3ROXA 1H1DA 1W0KD 2B3TA 2ZSBA 4CTJA 4Q00A 4TMZA 4W1SA 1E1CB 4XI9A 5BYKA 2ZTSA 1VM6A 3N28A 5G0TA 2ZM5A 2VNHA 1HO3A 4L2IB 2QJFA 1SXHA 4GOMD 2VH2A 4AURA 1AG9A 3SQDA 4ML3A 5HQ3B 3FBGA 4XSHA 3IXLA 2BH2A 2PKCA 2DR0A 4FU0A 4Y6PA 4TKMA 5D5QA 5CVTA 4M0KA 3OZGA 1P44A 2QUKA 1YDWA 4GI3A 1P1JA 4JA0A 4L72A 4CN9A 4D45A 7YASA 5EJ4A 5LUAA 3I3FA 3LWRC 1L8OA 3DHWC 3G49A 3O3NB 4DKJA 1RXVA 4KAXA 4BMOB 3SKXA 4ARBA 3GBPA 2VLIA 3PXGA 4CRWB 1E79A 1HLDA 1KSFX 1Q0PA 5EKSA 4YP5A 4NE7A 4AKTA 2IUYA 1BVUA 1P4AA 2IEDA 2IXBA 1T13A 1VQKF 2Q0QA 4NU5A 2EEPA 2HS0A 2IHJA 1ZJ4A 2GJ8A 3TLMA 4U02A 3K09C 2NZYA 3EGXA 4MVXA 3JD1A 3QTBA 3GEDA 4EPYA 4UXJA 1SUAA 5JHHB 1UANA 1KAEA 1H85A 5AD1A 1ACJA 2F3TA 1S4QA 3FYTA 1OD6A 3VU1A 1IM8A 3W6OA 5JS2A 3WRXA 3BGWA 2JEOA 2ZZNA 3A3PA 1KFKB 3X2FA 1RAHA 1Y8RA 3M4JA 3TFOA 2EWWA 1O2DA 5HUHA 3QTTA 4O4IF 4U3JA 2B33A 2HNKA 4JI4B 4IDNA 3ZE2B 3B1VA 1YZHA 2R7MA 4G23A 1D5WA 3CC2F 2HA4A 2RBEA 2WR8A 3AIIA 2K87A 1CF4A 1KAQA 3JSXA 4M36A 2AE2A 3C45A 2C2MA 1VQ5F 5TE9A 3RTGA 5EQDA 1RJ9B 5SYMA 4AG6A 2PLAA 3F8TA 4AKEA 3P9RA 2XZOA 4TWBA 4RGYA 1I1OA 1R64A 2ZRDA 3QU5A 5CIQA 3UPDA 1XTUA 2AJBA 3DMGA 4Q37A 4RA9A 5FNZA 5ISMA 2FPRA 2C42A 4YAIA 2CFIA 3PNQA 1WB9A 3AZQA 2P9TA 3IPYA 3JQ8B 3K2BA 4ZD6A 5GQSA 5AVXA 3EPPA 5JSHA 2KHZA 4PY2A 4WXEA 3QMPA 3HB1A 5KSPA 5LKAA 2DLCX 1I1NA 3MG9A 4D4GA 4E4RA 4KLCA 5D7BA 4A1FA 2ZS8A 3NGLA 3PDIA 4QUHA 1W5FA 4Y0VA 1VLZA 3ZU5A 1ODIA 1S2LA 1SMKA 2NSDA 3H8VA 4IFIA 2HF8A 3VHLB 4ZGWA 5TQ0B 5IHPA 1Z7GA 3C97A 1MHPA 3LO5A 2BZ1A 4H6WA 1JMVA 2D5LA 1C0LA 3PKZA 4AFNA 4ER0A 1HNNA 5HK8A 3QUCA 1KL7A 1GUYA 2R1VA 4QDUA 5ICGA 2IGTA 3FNEA 1WWKA 3O8DA 1O0CA 3C1OA 3OIUA 5DE3A 3FVRA 3KSZO 5K03A 1YRAA 3NHRA 4EG3A 1YDFA 1W41A 3L0ZA 5JAMA 4CETA 4PQYA 1E4EB 1U2GA 1Z33A 2W6CX 4ZJPA 1VYUA 4EEKA 3DVAB 1C1XA 1EVLA 2V54A 2P0YA 2YYAA 3D6FA 1XTPA 3IURA 3KV3O 3R0IA 1ZN2A 4QBTA 5ITZA 1VLJA 4TT8A 4WGFA 1NNSA 1YA8A 3PE3A 3RKUA 1WCIB 2VDLB 1NBMD 1YZVA 2AW5A 2O3JA 4IICA 4LWQA 3LDUA 4R9NA 2QRKA 2P9QA 4KQGA 2Q28A 1Z38A 4EA7A 1EUDA 4BVBA 4YCMA 1TZMA 1ZM2A 2L2QA 2R2GA 4BB9A 1F7UA 3CLUD 4KH0A 3MBMA 1ETHA 1LGYA 3L0SA 3PSAA 1MR3F 2O59A 5A0TA 4Y2RA 4EAAA 1VGQA 1PCXA 4M8NE 3AB7A 3Q7TA 4MP3A 3UT0A 4JXJA 3N2ZB 2C98A 1Y5IA 3F6BX 4ZHYB 4GVXA 4BEJA 2P2GA 1OH6A 2OCAA 4N47A 4RULA 3O4VA 4RY2A 1H3NA 4WKOA 2CHFA 5IEJA 2JA1A 2B37A 1V1JA 2P1DA 1E3SA 2R1UA 3ABOB 3VJLA 2WJJA 4ZZ1A 4RZHA 2NPOA 2A59A 3L49A 4YUZA 1W5SA 3OTQA 5A7HA 5IG2A 5JAPA 3ICPA 1EVEA 3AWIA 3BZUA 4E03A 3IJ5A 4EG8A 4CKEA 3UO8B 3FYUA 1ZD3A 1BVRA 2WWIA 3II6X 3BFPA 1XYGA 3JZIA 2VNSA 1I3OA 3UNXA 5CDTA 2OQIA 3UK1A 2X1HA 4EITA 1OVGA 3FOCA 4Y2JA 5C46F 3OPXA 1JI0A 3DBOB 2E87A 1PV4A 2Z2YA 3L6UA 2Y67A 5C7OO 3G7NA 3QPVA 1FLDA 1XCLA 2OZLB 3BGIA 5CFOA 4JV5B 1Z37A 1YXMA 4QGAA 4BJHB 1FJGB 1UPUA 1FUUA 5E4FA 5ENVA 3GFPA 2CF5A 4YCAA 1JALA 5E9QA 2H1OA 2Z3WA 2BF7A 1S3SA 2RB4A 2D4HA 4BQPA 5L3QB 1XK6A 2V98A 4WXRA 2QQGA 1M67A 4XARA 1E5TA 1U9CA 2AOUA 5EL0A 4G1MB 1ZH2A 2OCGA 4ZA2A 4K2AA 2ZAUA 3RIEA 3FPJA 3UJ6A 3GY0A 4F3CA 1YRHA 4ESEA 3N86A 3T9AA 3V8BA 3JYOA 3JALA 1XRLA 5DMXA 3A1EA 4CT4B 3F0EA 1WVIA 2CD7A 5IUNC 4JJ7A 1Q7BA 5J3JA 3WFZA 5E2IA 3B6MA 2OZKA 4EBBA 1U0GA 4Q1AA 1J2TA 1IUOA 2AK2A 2WAAA 5BPHA 1GFIA 5IARA 1H9BA 1GRVA 4TTIA 4UM9D 3M9XA 1S96A 3G2KA 3M6UA 3U3ZA 5G3ZA 2JCBA 3PDHA 4Z4HA 1W4BA 2IY7A 2YIJA 3F97A 4AO8A 2O0JA 1I3LA 1NRXA 4G4SP 1CYEA 1NAIA 4GR5A 1IWBB 2P1ZA 3AJ8A 1NJ8A 4HQFA 4URZR 5FYQA 3KUKA 4JBGA 1LY1A 1W52X 5CG1A 1J6UA 1V6AA 3B9PA 4K5QA 5JSKA 4P86A 1QCZA 3HHEA 5CDFA 3JARB 5TPWA 5C32A 5GIPE 3QV2A 2VKTA 1S01A 1ZIYA 2FRDC 1L4FA 1B4DA 1DKOA 2OGZA 4K26A 3VR5A 2OZVA 5K8VA 3B1ZA 3F0DA 1M1YA 1OQAA 4B3XA 1OXKB 1PVOA 1N5RA 4HF7A 1PG2A 2OORA 4YPOA 3H4VA 2SICE 4G84A 3SZMA 3AL0C 1BO6A 3ECAA 1EHYA 1GDHA 2R47A 3IE0A 3LC7O 3F4KA 4OP2A 2OHOA 4PRLA 3SQOA 1XXHB 3H4MA 1IOVA 2WTAA 1Z5PA 1XMVA 3HPQA 4F0JA 1JVBA 1YD7A 2NXNA 2ZG6A 3QHQA 2AQHA 4B85A 1DX9A 1BYUA 1XZ8A 4D9IA 4EUSA 1OX6A 4JHXA 1V71A 1NKTA 2OB2A 1XMQB 5COQA 3HA3A 3SZOA 5KVQA 3H11A 1FX0A 2BEUA 2GCGA 1IRIA 3AQIA 3MNFA 4YYEA 1F14A 1AZSC 1FUIA 3G9UA 1VMKA 2C2GA 5HJ5A 1MB9A 2I62A 4DA9A 1XMOB 1PFYA 3H2KA 4ARUA 4F3TA 4DLUA 4MR9A 1VIDA 1H9CA 2ZZKA 3WLQA 1W4AA 3PL1A 4H7PA 2BHSA 3RHFA 1C9YA 3OPQA 4B4VA 4CMEC 5C2JB 3DEIA 1U8EA 5EJ6A 2FMUA 4X3MA 3KLOA 3V6MA 1AHNA 3R7NA 5JAZA 5KKNB 3K6SA 2O2CA 1WUKS 3UAGA 3JAMM 3WBJA 1T5HX 4DR2B 1GO1A 4XVHA 2OECA 5HK9A 2DQSA 3E5RA 1TA9A 1ESCA 2RHCA 4KPGA 4W7IA 1NMQA 5DHTA 4MWZA 1XXHE 1SOVA 2RHOA 2OAGA 3RVRA 3HJGA 2QTMA 3EQ9A 4MKRA 1ZD2P 5ILGA 4B5CA 3UTDA 4B6SA 4KR9A 3TCKA 1KZ1A 2R7AA 2XUIA 3ITKA 3C3MA 4RL4A 1RE1A 4MRSA 1QH0A 2DT8A 3B5JA 3M3PA 3ONDA 4X71A 4TSFA 3ZYZA 4C0LA 5J2UB 3QVSA 1A7JA 3S0WA 1OLUB 1ZHOA 4JB3A 5DCVA 2ONKA 3OBIA 3FVQA 1O0BA 3ROQA 4HLNA 3LP5A 5GWXA 5DTMA 4CUJA 3TTUA 4Y1RA 2L69A 3ZHQA 1DBVO 4RL6A 1VSTA 2LXNA 4G1EB 2BR4A 4Q4CA 5I8WA 1F2UA 2HMYB 2WIAA 1A7AA 2CEAA 3GVXA 1E8NA 5BYJA 4BS9A 4COKA 5I01A 4N82A 4LYHA 3GP8A 5FJJA 3VH3A 2Z1NA 4BFXA 1I30A 1KK3A 2NLOA 2VOJA 4FJ0A 4RD6A 3WIEA 1XHLA 5K4AA 4IJ6A 4BLWA 1V3UA 5FAKA 1NWHA 2ZSDA 5IYZB 5FA6A 3PL5A 4DA7A 3S0JA 4Q3LA 4I1UA 3AFMA 3QX3A 1ZH0A 1OLOA 3KE1A 3SZGA 2C0CA 2LIPA 2J41A 1RWMA 3SS9X 1JWAB 2IHZA 3A1CA 3GJYA 3CPSA 4L51A 2FSSA 5A3RA 3D0KA 3VKUA 4LTNA 3KWFA 3HBMA 4HDMA 2Y0CA 4DBLE 3N3BC 5C52B 4F6RA 4ZU6X 2O8CB 1TTPB 2GZDA 5GP1A 2F3SA 1Q5PA 3AVPA 2QDKA 2OG2A 4O4HF 4P38A 3ZHVA 2FFAA 1MEJA 3BL6A 4ENWA 1V7QA 2WMNB 3QFCA 4FLMA 2WJPA 3ZIAA 4BP1A 4NBSA 2UZ4A 2C3OA 2CB9A 4TV8A 3K6KA 4WSOA 1P9NA 2O5VA 4I4CA 4N5HX 4CMAA 4D4MA 4ED9A 3GPLA 1TKAA 2WE7A 3OOYA 3V2HA 4RDHA 4AWBA 4LRXA 3R3VA 3NVAA 3THXA 2PFKA 4CMIB 1CE8B 4BBZA 2J08A 3PNBA 3D4LA 2B30A 5DEIA 3VO9A 3R6LA 3LUGA 3U7HB 3U9SA 3CF2A 3PRKE 4F8JA 4CDRA 1RT9A 2AGVA 2FN8A 4LJYA 2BE9A 4MJ7A 4ZMRA 5HX7A 1FRZA 4D57A 1EK1A 3K0EA 2OFFA 4P4GA 1TX4B 1ONPA 2VP9A 2CLKB 1NN0A 2AC2A 5G4KA 4KR7A 1CFJA 1ESDA 2ZCVA 1OT3A 4Y7DA 1S72F 4DADA 4MS1A 1ND5A 1YR1A 3KYDB 5B6IA 4JJAA 5EIAA 3C5WP 4YWHA 1HTBA 3PIIA 2RK6A 1ZN7A 1NF3A 3SS7X 2C5FA 1E9AA 2YZ2A 2XMDA 3R3XA 2F8SA 2W22A 3QOWA 1IPEA 2WG1A 3CE9A 3OSZA 3VR1A 1DT3A 3FMOB 4ZP1A 3IHKA 3UC5A 2NU8A 1I4LD 2NO4A 4I1OA 1H2ZA 5E7JA 5BN5A 4MUMA 3G2JA 4R68A 5AK6A 4YAUA 2CL5A 2JIMA 2BY4A 4BAUA 4DNOA 1HLPA 3TRFA 2D8AA 1XNHA 3M8KA 3MBOA 2D5CA 2P9ZA 2Q1XA 4HQ0A 2V7VA 4I7EA 1CJMA 4DGSA 2HJGA 4TKUA 1JTVA 3ZOZA 4A23A 4AX4A 5HXUA 1E0SA 3GLGA 3AKEA 3HFJA 3UG6A 5LA6B 3L4KA 3I6QA 1UPFA 1C7EA 5FWXB 2VDOB 1JIUA 1NXTA 1Z0DA 1QIIA 2WSLA 1SRQA 3RUEA 5LP6C 3L9XA 4J0CA 4UUBA 1N2CB 2VDWA 1UXIA 5ALKA 1EEHA 3RS2A 1VGVA 3INRA 5DN6A 3RV4A 2HF9A 2QV0A 2WRZA 3I7TA 4FYHA 2HMWA 5DISB 2ADFA 1HYHA 2B7LA 4HFMA 1LNSA 3MCQA 1H8ED 4FFMA 1T9GR 2FSVC 2BEKA 1E99A 3DDNA 1SPBS 2P5SA 1QPBA 3EY4A 2NZXA 1EUYA 5BWLA 1W3EX 3EIFA 4TM8A 5DHAA 1A9RA 2Z5GA 3ZV4A 4B9AA 1E9CA 2PPLA 3NGMA 1DGQA 1TQ8A 3OQBA 2QTZA 2PJRA 3VKHA 1YCGA 3CN7A 2WJWA 3FZYA 3TD5A 3FUCA 4WA7A 3W90A 5GADl 2IS1A 3R40A 2IU3A 5IRCD 1XD2A 3KDSE 2FH5B 1JLHA 4Y2SA 4BWYA 3AIKA 3LC2O 5AK5A 1E98A 5E7QA 4U6SA 4IFEA 5U9CA 3DV2A 3Q9LA 4FC7A 4REOA 3H2JA 4NECA 2PK3A 1U1EA 2W2VA 1AMOA 1YJQA 1QJ4A 4H3HB 2L18A 2EKPA 3EUEA 1N2CE 4QXPA 5KNCA 5LMNB 3FKJA 4KTTE 1ZNQO 2XB9A 4JI0B 4ETWA 3HV0A 1US8A 4U8GA 2RGAA 1QO7A 2BSAA 2FWBA 2J33A 2PT5A 3MJDA 3D59A 4X7RA 2C04A 1RQNA 2HQSC 1SXGA 1T2EA 1E1DA 4RVDA 3K09A 5BSTA 1RR6A 4YONB 4NOLA 1QD9A 2CFSA 2J6HA 2XAAA 3I64A 4FFOA 4YP9A 3IIMA 4FCCA 3BM5A 4LFCB 2PX0A 1K3FA 3BK1A 3RNLA 2IUSA 3LAWA 3T0FA 4M8IA 4DWVA 3BXEA 3L18A 3BYQA 4URUR 4DV6B 3KWMA 4XWOA 1XJ5A 1MF7A 4C0WA 4EX7A 4GWGA 2WJ3A 5A2QM 2VYFA 3VYWA 3EYWA 3CYQA 3EA5A 4PHGA 1G98A 1YZGA 2PN1A 3V1UA 1IV4A 3OEHD 3UGJA 3MPOA 4EH1A 2ZRGA 1KDOA 1U5AA 3TUIC 3TSWA 2ANBA 3FNIA 3OSUA 4WJLA 4PCVA 4ZO4A 1THTA 4HMOA 4OMFG 3DLAA 4NU6A 1LBQA 3FF1A 1ZK3A 2NN3C 4PU0A 5DLPA 4BO8A 4HZGA 3O8NA 1AMUA 1C7JA 2N0SA 1Y8QB 3D64A 5FBWB 2FG5A 4NDNE 5T41A 4UCWA 1MVOA 1EP1B 3GPIA 1WHSB 5KC8A 1KKMA 3L7DA 1U5BA 5E4TA 3ER8A 2RGGA 2PSDA 3T99A 3KSUA 3RAEC 1ID1A 1FMFA 1Y34E 3DXFA 2PT6A 3GEIA 4NYMQ 3U81A 6REQA 1C2YA 3HN7A 4UEOA 4DSZA 2WAYA 2AR0A 5IAEA 3OFND 2GN2A 3QVTA 2HXGA 5DSZA 3Q7IA 5CIWA 2OTMA 3BRWD 2C3UA 3TG2A 2WT8A 5J58A 1CY6A 4GIBA 2D4AA 4ALIA 4OI2A 2HSDA 3TD3A 4U9IS 4XPIB 2KSQA 3FE2A 4UM8B 3VSEA 2QR2A 5TIIA 2QX9A 2VJMB 4XQ9A 5AJHA 4UREA 3Q3HA 1X1SA 1Q22A 3CVJA 5DX1A 5HILA 1DFHA 3SF0A 2I2AA 3VBCA 3GLIB 4RPHA 3N8DA 2Q6IA 4C3ZA 4Z7OB 5D3KA 4C7JA 1TEZA 1CY1A 2QTCA 3CFYA 3CLTC 1DC8A 2V3WA 2QEQA 4GI1A 3PVCA 3T3OA 5JCXA 4BVRA 3GP5A 4PSVA 4ARZA 4NLLA 3L92A 3MINB 2CMHA 4RK6A 2WF8A 1HG0A 2FEXA 3E5NA 1XPUA 3FOAA 3RSLA 3W4KA 2E18A 2J32A 1UJNA 3PX7A 1N0WA 1U3FA 3M9LA 4GKVA 1LJLA 2ZRJA 3C4JA 4HSEA 1AKEA 1GAJA 3K8OE 5K2OA 4RTSA 1S0UA 2IHVA 4YT4A 1LU9A 4ZPJA 1JDUA 2V6IA 4LMBA 3L0IB 4I50B 5D1HA 4TV9B 1A7UA 2FC3A 3CUYA 3KYIB 3QU4A 5TGZA 1S8NA 2VQEB 4ZI7A 2W6OA 2AN4A 4PZLA 3PQ8A 4BRUA 4ECAA 3NVKE 2HZBA 5BWMA 2G70A 5EXXA 2F3PA 3SGLA 3TTVA 5LBTA 3E2IA 4QQKA 1J5PA 2FW7A 1LNQA 3U9TA 5BQXA 4DJFC 1XWFA 4MWEA 5J5AA 1G7TA 2GKGA 1KE1A 3RCBA 3Q3GE 2PY6A 1K88A 4HAYA 3QG1A 1JZTA 1OOEA 2RBGA 5BW6B 1JEEA 1HMYA 4C05A 2FFQA 1XELA 1XNGA 2GCIA 3ZDRA 1LSUA 4CYMA 1PFKA 1IV1A 1RAAA 5L4LA 1KYZA 1Q77A 3PEWA 4G4ZA 3F7NA 1FU4A 2QTRA 3LZ6A 4HKTA 1KFBB 1WDKA 1LA2A 2GDZA 4JBLA 2HX1A 5AYVA 5B1SA 1KI3A 4H6XA 1T3SA 4N3BA 4JIGA 1AY0A 1KAGA 2AZDA 1N5OX 1CR0A 3I8XA 3MXOA 4MWDA 4PSUA 3UPTA 4ACBA 3G8DA 1O8BA 3EDCA 3VU8A 4A6DA 4YRGA 1P2UA 3GJSA 4JLWA 1CDZA 1FVXA 1X39A 3AUUA 3ESXA 4IDCA 3L07A 2OWEA 2Q0HA 4CG0A 4OHYA 4IHJB 2IITA 3LOPA 4BCBA 4MI3A 4XFKA 1VHJA 4YP0A 4YC7A 4AQ7A 2F3RA 1UC8A 2Q3MA 4AB1A 3COWA 2UKDA 3CU5A 1GFWA 4JXKA 2R0QC 1IY0A 1L7EA 4GLOA 4ZHQA 4FMPA 1JDBB 3LZDA 5LXTF 4JXZA 3HEAA 2R8OA 2NNLD 2XF2A 3TKLA 4J0QA 2IOFA 4R8VA 4W63A 2C4VA 2H7XA 5F5XA 1SVKA 3C7TA 1X7OA 3KCNA 3L7QA 5A4KA 1QF6A 1L5YA 1A95A 1KO8A 1RHUA 3PITA 1RM3A 1BU8A 1T3LA 1Y3BE 2ZE7A 3N7TA 4PZ0A 3WNZA 3IR5A 1PYGA 1T5TA 2EXXA 4RK4A 3FSRA 4Z8YA 2ZWOA 1J0XO 2ORWA 4QU5A 1RWQA 1XD8A 3ZHBA 3I61A 3BSWA 3I4FA 1BCSA 3BAFA 1WVGA 5EQTA 5C8ZA 3I2JA 4ZOAA 5EEGA 2RAFA 4CCAA 5JXJA 3FWPA 5D3QA 3HZHA 3AU9A 1H0RA 4F4DA 5KAPA 3HBFA 2FRDA 3R8XA 4ZVSA 1EDZA 3T7DA 2WUDA 2RKOA 1J7KA 4WUVA 3L79A 2PSJA 1KEEB 2QNRA 1GPJA 4KEAA 4QYIA 3S1AB 5JUWA 4CL2A 1CSEE 3M5WA 1SEPA 2A1TS 2J30A 1IZYA 1QHFA 4JDUA 3EVEA 1EFVB 3GJ5A 4L0QA 4O0LA 3IP9A 1XVTA 1MQ9A 2VF4X 4PZDA 1UR5A 3JQCA 3HKEB 2CB0A 2HWWA 2PGNA 2E0IA 2Q45A 4FYYA 4JFAA 5ENZA 4GKKB 4L8YA 4NE2A 2W42A 3NIWA 2Y9PB 3CZ5A 3K20A 4GZLA 1ODKA 3PWTA 4QC2A 4Y2YA 1KNJA 4MV0A 2CBZA 3PF8A 1J8YF 2ZBGA 4W7HA 4YMGA 5I4CA 1AQ6A 4QPPA 1NJ6A 2BGUA 5KDDA 1SOAA 1C1DB 2I66A 4EY8A 5B1YA 3THRA 4Q4HA 2VDUE 3COVA 1S2NA 2XUKA 3H5TA 1IVYA 1PS8A 3U7RA 3QBDA 3GL9A 4JUIA 5COBA 4FGWA 5FI5A 3A4TA 1TW2A 4HT3B 4JI8B 5KYVA 3K32A 4P4NA 1FXUA 4AVYA 3FNGA 1S7CA 4IMJB 4GLBA 4DYHA 3KSDO 3LM8A 1JQKA 4CMEA 3P0ZA 2DZDA 4U7TB 3H5NA 1HT1E 4QXMA 3P9KA 3GARA 3UBMA 1PF7E 2O52A 3WLRA 4WK4B 5THXA 4UTXA 3GFQA 1NL3A 3JYQA 1YI8A 4H3VA 2OHXA 5HMMA 4EG4A 3DMRA 3L7IA 3OTIA 4FOTA 4J1QA 2OV4A 1KA9H 2H5EA 3N39C 2ISCA 5J2TB 4AP9A 1Q0LA 2P3SA 1SAYA 1LSOA 2P91A 1ECCA 1WO8A 3TTWA 4GVLA 5K2MA 3CNQS 3FUWA 3SIVA 1E5VA 2J46A 5TJ9A 4BY9D 1IUPA 4HDNA 4NJMA 3JATA 3FIJA 3KPJA 3VYSB 3V7UA 4NDAA 1DMRA 1KDTA 3BBPA 5KYNA 1MU0A 4HX2A 2AEMA 1DEOA 2BI7A 3UT6A 3FFAA 3GG9A 1IEXA 1KU0A 3GBSA 1EP2B 3EDQA 2CVHA 1GP2A 4Q4AA 5CDFE 4NMLA 3PXAA 1P18A 1E6UA 3CF0A 1EWKA 2A5FA 2BE7A 9ABPA 4LUCA 4K28A 3L6CA 3ETJA 1DP4A 1KI6A 4FSXA 4V2IA 2ZI3A 5KNBH 4QAJA 5DHSA 2QWXA 3ZU6A 4O29A 2HQBA 3OQNA 3QU2A 4P58A 2G28A 4N4AA 3ZBTA 4DQKA 5K3BA 1YVUA 2TMYA 2OKGA 5HYVA 4IEFB 2JI6A 3D4OA 2Q27A 3HLYA 4EW2A 1EGHA 3G89A 4BKMA 1GRCA 2VDVE 2HK9A 2HY7A 4NV3A 2TMDA 3VTIC 3I62A 1GXSB 3RUHA 4QOFA 3ONNA 4QTTB 3ZK8A 4AJ4A 2BZGA 1B14A 4BVEA 2DKOA 1XP8A 2FEMA 3C3EA 5IT9M 2OFOA 3L8MA 3K0FB 1FJHA 1S5PA 4KX3A 3WK8A 3SC6A 3KJEA 5TARA 1Q0UA 3H7AA 5BRAA 5I51A 1H4TA 4OHOA 4RW0A 2X0RA 4BKOA 1II9A 2YY7A 4G8BA 2VGMA 2DPGA 3OQPA 1M66A 1PZEA 2WF7A 1BJKA 5BSUA 1MG5A 4DIMA 3AHJA 3MS4A 5BXYA 3A4VA 4MV5A 2X40A 2CVFA 5ALLA 5BP7A 4ZZ3A 1KJIA 2E89A 3K30A 2H2FA 1CLIA 3TRJA 3S4YA 3LDGA 2FQXA 2XKKA 4X65B 2AKEA 5TX7A 2FFJA 4WJZA 3TW8A 3WVNA 1BA2A 1O57A 3AJ9A 4HXFB 1K2WA 5CB6A 5JC1A 3KR2A 2QD4A 4XTRA 3K1AA 3N8NA 1YRYE 3V00A 3QUBA 3G2MA 2WM9B 3PD7A 3SZ3A 1KI1A 2G9ZA 3A1WA 2AMLA 3RUCA 4WXHA 2QP4A 2X9VA 1QGUA 1B3BA 5EZ6B 2FPGA 3A4LA 1IBRA 5LWHA 3B2NA 3HVIA 3UMMA 2QX6A 2ODAA 5JBIA 4YRRA 3IBYA 3K0AA 4RACA 3PRYA 1XWWA 3RRBA 3UV7A 3HPRA 3W5HA 4KN9S 1FFBA 1JR4A 2ZVJA 2JI8A 4H4EA 4D42A 5KWVA 3FCCA 3DBHB 2XDYA 3JZDA 4OAQA 2ZWIA 4D9KA 1TO2E 5H8WA 1MRSA 2Q2OA 3LPDA 1U81A 4X3OA 4MVJE 1OZFA 3FSGA 1J99A 3NTQA 3CEHA 3AZOA 1V95A 5CAEB 3SQLA 4OQFA 3MCTA 1KQGA 5EWJA 1F12A 1ULTA 2HUPA 3OIDA 4A2WA 2AMFA 2BONA 1OAKA 2PO7A 2QL5A 3LQRA 3HJAA 4KXWA 4YGXB 4R2KA 5JD5A 1DRWA 2Q3CA 2IV2X 1ZR4A 2BMEA 2G9UA 1AS3A 4LJKA 2FZ4A 2ZJ3A 4U0KA 5L45A 1KC8H 3H1GA 2OY0A 1BX1A 3PI6A 1L0BA 1WM1A 1Z62A 4E5DA 2JAWA 5SZHB 2F3UA 1ANKA 4G0MA 1DV1A 4FKZA 1AQYA 1EU1A 1E6MA 3WLOA 2DBYA 3DO8A 4CKBB 1RAGA 1IN5A 3IAM1 4KZPA 4YJ2F 4ZQGA 2HWKA 3SYKA 4HDQB 5DB4A 2JD2A 3ZV5A 5LP6A 2CSXA 2NSLA 3MMPA 2ZM6B 3GRZA 4RQOA 2H11A 2O50A 5IJXA 2YV4A 3OQJA 5B7PA 2G72A 2QS9A 2OHGA 3MCUA 3ZWYA 4R1QA 3C8DA 4LOKA 3ECSA 1GADO 2IEZA 4RJKA 5AW3A 4ARVA 5JCPA 3GLFA 1URPA 4F86A 2UDPA 2FSVA 3L04A 2WHXA 1I36A 1NG1A 1XI2A 5CLHA 1EE1A 4YIKA 4A82A 3GD5A 1IZZA 4I36A 2ZGVA 1HE3A 2WDPA 2F90A 2XGMA 4E5KA 5BT8A 2ZLBA 3KLMX 3WBFA 1GL7A 2QGZA 2BHLA 3TM4A 3T8YA 1F0KA 1CZUA 4QU9A 3NH6A 3IPCA 4ZT2A 1T24A 2EL7A 3WWPA 5JPDA 1IEQA 2C4MA 1YS1X 2CLOB 3GYQA 3FETA 3K9HA 3P0JA 3QYPA 2G0NA 4HRAA 1IH8A 2VPTA 1LDEA 2H8GA 2X1VA 5KYUA 3PUVA 4X94A 3SJAA 3CNEA 1L5LA 4Y2PA 1NW5A 2ZBFA 2SKEA 4CKCA 4WZBE 1IZ0A 2Y68A 3LW7A 3NYQA 3T0IA 2QI2A 3CBGA 1JXMA 1D6JA 3NK7A 2ZS7A 4RDXA 3KSMA 3MDOA 1Z26A 3GT4A 3IR9A 2Z57A 1YR2A 2QV7A 3GEGA 1IPFA 1JKMA 5K0ZA 3SXPA 3CLUC 2HQSA 4PO3X 2QTAA 1K5PA 1YE3A 1AKUA 3G0IA 4RSRA 1NWCA 1G3RA 5JPIA 1SU4A 3TEJA 4F11A 1G55A 2QB5A 4OOEA 2N42A 1AKMA 5EE0A 2QA4F 2C99A 3A3OA 4PZZA 5JYDA 2QUBA 4PYQA 5DULA 1PR5A 4O2LA 3O9ZA 3T9BA 1XRGA 2VT6A 3VISA 1L5VA 4NEHB 2ZR9A 4ZEOA 4D9FA 2OK7A 2DFKB 4EY3A 5CCEA 2P68A 4X90A 3IQDB 1X1DA 4DNXA 4E30A 2XCIA 3UWDA 2J9FA 2PT7A 4PQRA 2UVDA 3UA4A 2QM7A 1G3MA 4L4RA 3N58A 1T43A 3WLHA 1EDBA 1HYBA 3PIRA 4JB8A 5KTRA 1R4NB 4KV7A 3DH0A 1QO0A 3EW7A 4ZPXA 3A2MA 1M2VB 5BPFA 2W2TA 2VYQA 3K70B 2QMOA 4KXXA 3IVRA 3LBIA 4XRRA 4I9NA 1D2HA 3L7NA 3QX9A 4JYZA 4PBRA 1VYHA 4H60A 3DEHA 4IJKA 1T0BA 2EQAA 3W77A 3OQOA 1NGSA 3THXB 2P9BA 2GASA 3DHNA 1XAIA 2RK3A 3BHIA 3V4PB 5CCBA 3CPWF 3I12A 1XDWA 3EXEA 1I6WA 2H65A 2GCPA 2YMLA 1CF9A 2WPDA 5E9AA 3T15A 5I4BA 1IHXA 1JHQA 1GNSA 1JHOA 3QG5A 4CM9D 5BW4A 3VVCA 4C4PA 2OILA 4MJXA 1J2JA 1U0HC 4TMWA 4E5NA 5MGBA 2R751 3OLVA 1X13A 1DXQA 1V7ZA 2YFHA 4R1SA 1Z7EA 3PQ6A 3ELDA 1E20A 3ZHSA 1XTJA 1NMSA 2C9MA 3F6SA 2ZUSA 1EVQA 3QTLA 4Z9XA 3C85A 3JYLA 3MPUA 2ID4A 3WQQA 4A1OA 2Q4DA 2FWNA 3NJRA 3IODA 1WE2A 2ZAMA 3GDWA 2ZJ4A 5C8YF 2AOVA 3UGQA 4A0HA 1IVNA 4HNSA 3ZGZA 1KMHB 4GXNA 3F90A 5AM2A 4QDZA 2ECFA 2ZB3A 4CM6A 5FTJA 2OT3B 3VAAA 4QBIA 5B4VA 4HWOA 5SZKB 2ZTHA 2G5CA 3LKVA 1NQWA 3VKFA 3PUXA 3KXLA 4HNTA 4XVUA 4D0SA 5EC8A 2V97A 4FD2A 4WCFC 4PZAA 3GJ0A 4ZAYA 4ZZ0A 2QT0A 2VF5X 3R75A 1N34B 4G4WA 5HKAA 1FYWA 1SKMA 5IABA 1IBMB 3IBCA 4PX3A 1LJ8A 2R62A 1Z35A 1KNQA 5C4GB 1G5PA 1KFCB 1TPYA 4FI3C 2PMDA 4D97A 2IELA 3TXYA 1GLVA 2HH9A 1JMYA 3QPCA 2PZBA 1SA0B 3I05A 3DBRA 4NMWA 1KBOA 4ZAFA 1JJ2F 1XKXA 3V80A 3HR8A 1DKRA 1XK7A 4BZQA 5G40A 5DEOA 5DNYB 3F2VA 3Q9UA 3GJ3A 3FCAA 4O33A 5HPYB 1VJGA 5LNK1 2ZT7A 3MWGA 5KVAA 1U40A 1GQQA 1NN1A 3ZZNA 4C03A 3Q3VA 4H0FA 5EXTA 4R0MA 3SX4A 2HS4A 4NHOA 1IK4A 2H1FA 4LF7B 1FLVA 1GG5A 4QDJA 3EZ2A 4MV9A 4E88A 1A04A 4C76A 4P3XA 4XZ3A 4QFDA 4ZEMA 1UK6A 3OO0A 2QP3A 1NE2A 3HCEA 2FR1A 3C8MA 4G01B 1TQ6A 3EDOA 2D2VA 2WJIA 3R44A 4MQBA 4PAQA 1RU3A 1GU1A 5J47A 4HOYA 4RV4A 3KAKA 3ITNA 3ZD9A 5A1JA 3P7MA 4LBVA 1RZRA 3AKDA 2NUAB 4NOJA 3TLYA 2P67A 1N9GA 2H4WA 5JROA 3UAZA 2EP8A 4WBNF 1DINA 2AC7A 4GKAA 2CKMA 3OEWA 2OXCA 1I7SB 2EEZA 4KSCA 5CA1F 5CB4A 1YO6A 2A78A 2HXSA 4HS9A 4V0OA 4MZDA 3IKEA 3FUTA 1AHHA 3F6CA 3J81A 4FHCA 2O1WA 4X3LA 2I80A 4M1MA 4FHEA 3GA5A 1K73H 3JRWA 4REQB 3QVXA 5IAJA 3AV3A 4I9FA 5AFSA 1B0AA 1HDIA 1VMDA 3LFHA 3N0TA 4MB6A 4NC9A 4PSKA 3VX4A 4UAJA 2AFHA 2X14A 3AJAA 5AUPB 2NMVA 2YXZA 4IXDA 2Q49A 3G9TA 1ZNWA 4MINA 2YMQA 5ER9A 1ENPA 3DEYX 4XIGS 5HEKA 3V7FA 2Z1UA 2GTHA 2GLXA 4XWAA 2YDYA 2Z09A 4ND8A 1HA3A 2A9JA 3NYWA 4IUBS 1PJCA 4JASB 4RVNA 2XZLA 4PBTA 2QYHA 2TSYB 1PXWA 2GPAA 3UK2A 2CXNA 1XZAA 3B1XA 1KQFA 4JLMA 2HC9A 4NBVA 3T1HB 4YUYA 2C84A 1ZL2A 3OP1A 2BLNA 3O21A 1YS4A 1SOMA 2OYSA 2YWRA 3CRNA 3E53A 4IDQA 3ZHOA 4UNRA 4HUJA 2WVGA 3CXRA 3GAZA 4PYKA 4L57A 2HJHA 1GUFA 3UK6A 2W93A 2IPXA 3VFDA 1OLXA 3IPLA 2C5GA 4C5CA 4DTCA 4CKWB 3I1FA 4KYTA 4JR1A 1C41A 4L9AA 1BAPA 1UOQA 5ECDA 5DK4A 2FFRA 2X5NA 3FA2A 4NKRA 3GYGA 1VL2A 4CU5A 2C8VA 1F0PA 3OQHA 4GOOD 4AJOA 3HXPA 2UVPA 2GAOA 1WEHA 1A4UA 2JDIA 2J9XB 1ZISA 1N2SA 1VLHA 2MSKA 3AILA 1MFZA 4LXGA 4QKQA 3DJYA 2X8BA 1WMAA 5EE1A 4DM4A 1NIPA 2WWTA 3ADCA 1AF4A 3QV1A 4RZQA 5LYJF 2X15A 4OJQA 4TTTS 3QKWA 4QGGA 1DLJA 3VR6A 4F38A 3FI0A 3D2AA 2D8MA 1Z4NA 3V3TA 4G2TA 3AVWA 4BN4A 3G0GA 4X63A 1P62B 5EWRA 1X6VA 3EOBI 2WIGA 4ZIRB 1PF5A 2JBWA 3PEVA 4EKEA 3IULA 2OFWA 4NZMA 3RR2A 3MJHA 4WADA 4D0RA 2HWUA 4JS0A 3UB2A 5EJEA 1RC8A 1M1NB 3DEZA 2M6KA 3UJHA 4X9XA 1XQ6A 4NDZA 1AJEA 4GPZA 2KS6A 1FNBA 1XAGA 4FK8A 3GX1A 4AYTA 4B3MB 1MT3A 2SKCA 1TZJA 1T6XA 2ORED 3C3CA 2I3AA 3DQPA 2QQFA 4UXIA 2FWRA 3L06A 1CUSA 1I01A 1AMNA 1J5EB 3COZA 3OKAA 3QIAA 4BFWA 1NRJB 2ZETA 1Y9JA 1VE6A 4IHAA 4X97A 3WWDA 5J40A 1AKWA 2GPSA 4E08A 2IYVA 1L5ZA 4ZT4A 3ROTA 3N0RA 2X5XA 3ILVA 1T0PA 4ENPA 3EEOA 1QH8B 1UBJS 2X0EA 3LPCA 4KQIA 2J0VA 1XEWY 5F33A 3UK0A 1CQIA 1JQ5A 1V8FA 5HKLA 3OT4A 4QYWA 3DDCA 2I2FA 4HRXA 4B45A 1J42A 2RGXA 1M6VA 3C3KA 3KXKA 4D82A 5I7RA 3E9ZA 4EKNB 2GJKA 3CG4A 3KXIA 2J5QA 4MIKA 4WRRA 3IPAA 4D3XA 4JJFA 1ZUD1 1DTWB 3EIXA 4KVAA 4B4WA 4J6FA 5A4JA 1VB3A 1UBSB 3O7WA 4ARAA 3RS5A 4RADA 4B7UA 2VHCA 1J39A 1RMQA 1ZZGA 2Y1EA 3EK2A 1W96A 3SFZA 3TD6A 4EGJA 3MMZA 1R3UA 3AC0A 4M1YA 2Z8XA 5HJEA 1E2EA 1PJ3A 4BZPA 2BFCB 2PV0A 4D6PA 5CNJA 4D4IA 3A10A 3WLPA 4B2YA 1NXWA 1ZW6A 9LDTA 3IL2A 1YASA 1ZSNA 5HFAA 1K3UB 1I4EB 4YEDA 3SIUA 1HE8B 3G13A 4UM5A 5CBPB 3LVFO 3WQSB 3CM0A 16PKA 3I42A 4HP8A 1XMIA 4PQFA 1A50B 5HIAA 4FNMA 1NQ5A 1XRPA 4XJVA 2JLXA 3RS4A 1R6BX 1TF5A 2XA9A 4LSMA 1MZVA 3BXZA 5C0OE 1QANA 5EIBD 2WMDA 3D7RA 4G0UA 3WYEA 2ZWAA 1X7WA 4FCVA 3GRFA 1EFRA 3LWPC 3AR4A 721PA 4M7OA 2UYCA 3WJRA 2OXRA 1EM8A 2EVWX 3FDZB 3BB3A 3AUFA 3CD6F 1NRWA 5K3DA 4BUZA 4CQJA 4KSYA 4ME6A 1L9XA 2BC9A 1P9OA 5FWDA 3QSYA 2R87A 4TZ6A 3VDMA 1L5OA 3RQIA 5LLDA 2KQUA 1S2GA 4N5MA 3U3RA 1P8AA 4IQ0A 3QKTA 1N6KA 4OQNA 3EE6A 2O2YA 3V8RA 3WBBA 4YAFA 4DNQA 4M89A 4YJFB 4N7MA 2Q1TA 1F60A 3NALA 4G8DA 5IXYA 2AMTA 1XBIA 3DBLB 4EJ2A 5D86A 3HLKA 3KT0A 2FDRA 4IFTA 4JITA 3NHKA 2XNSA 1FFXA 2ZIFA 1KI8A 1UT6A 3NRCA 3PGA1 1NUSA 4QHYA 3T35A 2YYSA 5ALEA 4GDFA 1XQ1A 2AVDA 1N6OA 2XRFA 3EQZA 4V0MA 3EQ8A 3HBJA 4LV8B 3ZCSA 3ZEAA 2Q3JA 2Z2JA 3GT7A 1Y33E 4O3FA 5FLYA 4NHEA 3CVOA 4JI7B 3OM8A 3R7LA 1O95D 3NOVA 2HBYA 5AVKA 521PA 2JIBA 2DRIA 4LIPD 3FOZA 4QOSA 7MHTA 2C9ZA 3A6FA 1WQ4A 2I6SA 5EHQA 5J5CA 4RANA 1NJ1A 2CFCA 2JF0A 4QJBA 2V9YA 1E9RA 4LAFA 5AIBA 4RTKA 2DYYA 1XCOA 3Q12A 3G59A 1BRMA 5C1BA 2RCYA 4BASA 3LU1A 4HB3A 2I9KA 1EUCA 1P60A 1L3IA 1W5EA 4L8LA 4LMRA 4MOWA 4K2HA 4OQQA 5IDVA 4F3RA 1HH4A 3KETA 3NRBA 1VE7A 4BLPA 3PNLA 1COWA 4MCHA 4M0EA 2WUFA 3V1NA 4JBHA 1J0BA 1L2TA 3BCHA 3H4TA 2VZ0A 1TMKA 1VIYA 3TZBA 5IJ9A 1Z6TA 4IIJF 4LJ6A 2YWGA 3LCVB 2EZTA 4A8JA 4QE3A 2ZUVA 2DY0A 1Z74A 3P8ZA 4X6YA 4EW6A 2WSSD 3EZ9A 2GLZA 1CUEA 1S9DA 2C4HA 1CNMA 3ENQA 2GYVA 3GMIA 4JJGA 1BEZA 3VU0A 2AKAB 2XVMA 3P2JA 1HYQA 2G1AA 3OZVA 4R7TA 2Y0DA 1YK1A 1JF8A 4A73A 5HR5A 4ZOCA 1U8XX 2P0EA 4MP6A 4MUIA 4RHYA 4G5QA 4E2XA 5HKBA 4XA8A 2XRYA 4RKFA 3CF4A 3FZEA 2AI1A 2OQ2A 4GU5A 4MW6A 3UT5A 1Y8CA 2FWJA 2IYRA 1JIJA 2LBXA 1KH1A 2HCJB 2JGAA 3GMSA 4X41A 3F6RA 4KIWA 3CX8A 4UFOA 4CLOA 1JIQA 2P4QA 1D0VA 2FHPA 3HGTA 5A3QA 3IQIX 2Q9AA 2PZFA 1NKVA 5JMPA 3HJCA 2AD5A 4NZ9A 1NZFA 3P9IA 3QF4B 3CCSF 1MRNA 3FN4A 3I6BA 3TPZA 1KEWA 4OHCA 5FRDA 3KHTA 3FUXA 2QYTA 3I8SA 4PTZA 1IATA 4O4JF 3ZP4A 3BPSA 2O8VA 3SC4A 4O6VA 5A03A 4Q9JA 1EGQA 2IV3A 1G8HA 2RGEA 4MQFA 4OGKA 1XCPA 1BGVA 1CUAA 1ODTC 2QNBA 1CUHA 1Z6GA 1G6Q1 3L3BA 1KMIY 1SXJD 2EP7A 3RFFA 3BD7A 5IMSA 1KQSF 1RQLA 4PANA 1GGMA 2WWGA 1NLMA 3TWOA 2VG8A 1E0KA 4AJJA 1VQOF 3MCWA 2RG1A 1DEHA 2ZRCA 4Q4JB 4MLDA 2XBLA 2D7JA 3EY9A 4YRMA 1BU5A 4YXFA 2VK2A 5HWSA 1FP4B 1E7WA 4B3DA 2DY1A 3DNPA 1LX6A 1Q91A 2Q1UA 1XJWA 4ZU3A 4B33A 3R9WA 3OFVA 2LNDA 1Z0KA 3HN2A 3UOWA 1REQB 4DIFA 3TFQA 1TUBA 4MLZA 4RGVA 1XFAA 2ZYAA 4GHWA 3BMQB 4MKIA 3PEEA 1T0HB 2AB0A 2QM0A 3A9UA 2O57A 1QP8A 1B76A 3S1SA 3ZJVA 3ICOA 3IP7A 1RIFA 4JYMA 4B80A 2DB3A 2R8XA 1G8GA 1W2HA 1YONA 3LWOC 1DWOA 2VI5A 1PRYA 2WLTA 4R8MA 4C3UA 1H0HA 3SF8B 1WSBA 1GG2A 3BBLA 5DMHA 2ZJ8A 1JKIA 2JBAB 3JQRA 4GQIA 3IE1A 4BWFB 2J7PD 4I19A 3T3DA 3EX7C 4MQ5A 1Y5RA 4HADA 3M6MD 4Y0NA 4IM7A 3TAXA 1IHDA 3ZCVA 5JY1A 4AYWA 4G5OA 2D59A 4H31A 3QVWA 3ZWAA 3AEQA 3GLFE 3U44A 2QLFA 3ESRA 4C29A 2D0DA 2FEPA 3NHMA 4WOBA 3KQNA 3IDSA 2EBHX 3W9SA 2GGSA 1CRWG 3ELYA 4AROA 4P3KA 1BCRA 1E1LA 4DEVA 1BWSA 2HEIA 5KWSA 1QKJA 1WABA 4YMTA 1CJVC 4O1MA 1QXSA 4E7OA 1WQ1R 3PCTA 4R7ZA 1Z88A 1NQTA 2JFUA 1SXPA 2QRUA 3SHOA 1ZMBA 2X8AA 2JFNA 4HAVA 5HBRA 5A7GA 2XR1A 4C20A 5HKKD 5J4YA 3T7EA 1RA4A 4EPXA 3WWYA 3ZIUA 5IVKA 4JX9A 2H52A 1S2DA 4JELA 4M0UA 4TXHA 2WD7B 2YWFA 3PZRA 4D3DA 2IW3A 4OP1A 2BV3A 5GIOC 4M1SA 5A3SA 4WKNA 3REQB 1NFRA 4OB7A 1FW6A 2DBRA 4V0KA 1V48A 3HXQA 4FW8A 3EIOA 3KJJA 4GPAA 4FFSA 4G0XA 1SCIA 3U4QA 3LYAA 2DUMA 4PYOA 4DWWA 2G1KA 3I4CA 1CQWA 2HHHB 2C2XA 3M6WA 1W49A 4KQJA 4UVEA 3QVOA 2K4MA 3V4FA 3WB1A 1NPTO 4F5ZA 1G1AA 4NCHA 4FLFA 1SC9A 2BD0A 2PVCA 4WCFA 5B1DA 3RVDA 4DCOA 4HV4A 2G7MC 5EXPA 5EYPB 1Z5UA 3IKLA 4ID3A 2H3EA 4A5SA 3B6NA 2CYBA 2BFAA 4WECA 4P4UA 4MMZB 1KNXA 4UBOA 3TX6A 4EELA 1XCBA 5IKEA 3DHVA 3E81A 4E15A 2P8SA 4G4JA 3OG9A 2VHVA 5HNKA 3F6YA 3IV7A 1BMDA 4MS3B 4YB8A 2ZIVB 4YV2A 4R0VA 3WO0A 3I39X 3AEUB 1WU7A 4EFKA 4QUGA 4DCSA 4EHHA 3RWMB 1M8GA 2P4EA 4L6AA 1F6BA 1HFJA 1M2JA 1QHHB 4G67A 3U7IA 4X00A 4LISA 5EHGA 3KQUA 4LCJA 4IIGA 1KZHA 1T15A 3V9PA 3O8QB 4I1YA 2C7RA 3Q87B 3EPRA 1X80B 1RD4A 5CXQA 2BGRA 4W6ZA 3O4HA 2BFDB 4FSHA 2E2WA 1G5IA 2HSEA 3BMOB 1P3DA 3MCAB 4OGFA 1Z5OA 2IS2A 5JSZB 1V11B 2IC5A 2VTKA 5LZ5A 3TX2A 4WZZA 1FNDA 3NBZC 2HPAA 5DNAA 2ZITA 3V4OA 1E0DA 5BN3B 4CM4A 1HF3A 2IYOA 1E2HA 5B37A 1DTSA 1V3QE 2QG9A 1C1YA 4FWIB 2CMGA 2G88A 1TCCA 4OTZA 3OQIA 2GM3A 3E0QA 1M5TA 1IHOA 1XZKA 3A14A 1V8DA 4MUJA 4EB6B 2YXEA 2QT1A 5H83A 3EWAA 1H1LA 2JIZD 3BK2A 3IUYA 5C8DA 4M6WA 2R6DA 3PHJA 4ZWNA 4S1NA 3F8SA 3I3OA 4QOHA 5KU1A 2GNAA 3TQFA 3P10A 4OHUA 2ZTVA 3SY8A 3L2OB 2JG3A 3T94A 5KYGA 1C9JA 1E2FA 5A4MS 4J7CA 3LUPA 1BE6A 1UXHA 1ULZA 3OIFA 1RPAA 5CEJA 2FX2A 2MSEB 4DMFA 3UQZA 3COJA 4C2UA 3EOAI 2WW8A 4LECA 1LLUA 1UIRA 1NVTA 2QRLA 3BN3A 1HSZA 3LBAA 4MS4B 5JZMA 3GLHE 1U3VA 1GGKA 1L5FA 1USIA 2BM9A 2FF5A 1NP6A 3IAS1 3KZKA 3N2LA 4TS1A 3WSWA 3O8RA 2G06A 2JFYA 1PGQA 3IESA 3P26A 2OQVA 1I7PA 4DRYA 3IEIA 4WY8A 4C07A 3TQHA 1W1WA 2YYEA 1Q1EA 2IL1A 4V0RA 3UMCA 4X8MA 3ENKA 5LYYA 4E46A 3IUPA 1JG2A 2UVQA 1D1QA 1E0JA 3KKZA 1LDGA 2ZB8A 3WLNA 5JXGA 2C3YA 3I9V1 1UJBA 4MUYA 2VJOA 2DX7A 4MGHA 2HDNB 1GWNA 3GPBA 3KM0A 4AMUA 4BXOA 1HG1A 4DIOA 1G21A 1N33B 4DV0B 3OCVA 4ND5A 5AMXA 1PAUA 1DNPA 4KAAA 4MUBA 1UMCA 5DGTA 3T3IA 2ZUDA 1W93A 4B6QA 4NNPA 2E4YA 1NOIA 2RH4A 3MBKA 4BNYA 1YQTA 3QKRA 3UC9A 2FPPB 3T5GA 1DPGA 1P2DA 1YIOA 3A6ZA 5H4HA 1XF9A 3RRZA 3CG0A 2QVCA 1NHWA 3IUSA 1PYDA 3F7OA 3FTQA 1PG0A 1ZEJA 5DHUA 2YN2A 3H65A 3GLUA 1WUYA 4LZLA 5WRFA 4AUMA 4RZXA 3H9GA 1JVSA 3L0OA 5HOEA 1X8LA 1RW4A 2I6RA 4BVAA 1EGMB 2QSZA 4ICIA 4PTLA 1MIHA 4JLJA 2WJAA 3SQWA 2AFIA 3TIGA 1A2KC 1THGA 5FWAA 3CZPA 4FYXA 3DQQA 5EJ8A 1PO7A 2IU0A 5E1OA 4ZCSA 2GK4A 5ULLA 4U7DA 3RSQA 1QAQA 1GTL1 3NMUF 3P19A 5TEWA 1THMA 2D2EA 4IIVA 3PQ4A 1G5RA 3GFTA 4LDPA 3UVEA 3WY9A 5KTYA 1AKTA 1VHDA 2J3JA 5IPFA 5COAA 5IZ4A 2GFQA 4LHVA 2XF8A 3VTAA 3ZZUA 1YIJF 1NMUB 1JT9A 3Q5DA 4UU7A 3D6VA 2UYNB 2W71A 1KJZA 3X2EA 2WY2D 5A9TA 2PU5A 1QZUA 4IZ6A 4LPKA 1FNSA 1R0BA 1SIBE 4FGLA 4G5RA 2AFHE 3ELUA 3Q8HA 5JLJA 3HI6A 4ZTZB 3I55F 4YASA 5CDHA 1WA5A 3SBXA 1II8B 3K92A 2QMUA 1VQVA 3LWVC 1B42A 1QORA 1PHPA 1R0XA 2VP4A 3IIKA 3LPMA 3P0IA 4MX8A 4J1SA 3TLBA 1V45E 4BDSA 1ZUIA 4DYVA 4EKGA 4WNAB 3CUUA 2VDRB 5ED0A 4AZ0A 2O2IA 2P1RA 2Y2VA 2VHEA 3UMGA 3P2KA 5J2UF 1UPAA 1RJDA 3QKUA 2C92A 1P72A 3RB8A 3V4RA 3OOEA 2ZWVA 4YRNA 4WQMA 4U6QA 4XQCA 3FTCA 3M82A 4RELA 1JXQA 3KR9A 2XBUA 1POXA 1O5IA 3ON5A 4MZXA 1J8FA 1PR3A 3DEAA 4QFCA 3V7QA 3C3AA 2P9FA 2CF6A 2IOFK 2PS1A 2Z43A 4JBWA 3W2FA 1E1MA 3LCJA 1P2GA 1VL6A 3IVXA 3P9QA 1GPYA 1IL0A 1M10A 5SY6A 1ZK2A 2CVOA 1G4HA 3D6MA 4QOJA 1N7JA 2X0DA 4F04A 2OHIA 3AM5A 4JCOA 3WZMA 5KYYB 2PLFA 3ZX5A 1PX0A 2WKQA 5EE5B 1DO2A 3O74A 2GPYA 3WYNA 2VTBB 1WMSA 3I37X 4P6VF 5IYZF 2LBWA 3G8YA 4RQBA 2YW2A 1JPUA 1ZRHA 3EHDA 3R7AA 3TFWA