5GONB

Structures of a beta-lactam bridged analogue in complex with tubulin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 169
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5gonB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5gonB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5gonB01
4B45A 5MN6A 2XKAA 4X1YB 3RYFB 5ITZB 5ITZA 2RHLA 2Q1YA 5JH7B 4EB6B 5IYZA 3VOAA 2BTQB 4ZHQA 3HKCB 4HNAB 5GONB 5BMVB 2VXYA 2BTOA 4X1IB 5IJ9A 5KMGB 4I4TA 5J2TB 5J2TA 5FNVB 4I55B 3RYCA 5JVDA 5JQGA 3V3TA 5C8YB 5EZYA 3CB2A 4IHJA 3JARA 5LYJB 2XKBA 3WGNA 4O2AA 1JFFA 4X20A 4WBNA 3HKEB 3HKEA 3JALA 1RQ2A 4TV9B 3WGJA 5LP6B 4FFBB 5C8YA 3VO8A 4E6EA 1Z5WA 4O2AB 5EIBD 3ZIDA 5EYPA 1W59A 4IIJB 4IIJA 5EZYB 5JQGB 1TVKB 5LP6C 5LP6A 5CA1B 3JAKA 4F6RA 3HKCA 4HNAA 3JALB 4EI8A 4WBNB 2RHJA 3HKDB 4I50A 4O2BA 4TV8A 3RYHB 1OFUA 3JASB 4O4JA 3R4VA 3ZBQA 3VPAA 4TUYA 4TUYB 1W5EA 2RHOA 1TUBA 5JVDB 2RHHA 5CA1A 5IJ0A 4O4IA 4EB6A 3WGMA 1SA0B 3JAKB 4F6RB 2VAPA 5GONA 2R6R1 3ZBPA 3UT5A 3UT5B 1W581 1FSZA 1W5BA 2VAMA 4O2BB 4TV8B 3RYHA 5CB4B 5JCOC 5JCOA 4YJ2A 1W5FA 5KX5B 3M8KA 4XCQA 4LNUA 1TVKA 3C8LA 3JARB 4O4HB 3N2KA 3RYIA 4YJ2B 5LA6B 1FFXB 3JASA 4O4JB 3RYCB 5CA0B 3HKDA 4I50B 1RLUA 3VO9A 4FFBA 4I4TB 4DRXB 5LXTA 1TUBB 4O4LB 4ZOLB 3JAWB 3JATB 1JFFB 4X20B 5IJ0B 5EYPB 4KWEA 5LA6A 4IHJB 3E22B 4LNUB 4ZI7A 4U39A 3N2GA 4O4HA 5J2UB 3WGLA 5M7EA 1RQ7A 5EIBC 5CB4A 5FNVA 3WGKA 5LOVA 3JAWA 4X1YA 3RYFA 4EI7A 3VOBA 4X1KB 4YJ3B 5LYJA 4DRXA 1Z5VA 3JATA 4U3JB 3M89A 4O4IB 4O4LA 5IYZB 3RYIB 1FFXA 3N2KB 4TV9A 5BMVA 3N2GB 5LOVB 3HKBA 5J2UA 1W5AA 3E22A 4ZI7B 2R751 4M8IA 5CA0A 4X1IA 5IJ9B 4DXDA 5JH7A 4ZOLA 5LXTB 4EI9A 5KX5A 2BTQA 2GVIA 2Q1XA 3RB8A 5MN5A 4U3JA 3HKBB 2VAWA 5KMGA 4X1KA 4YJ3A 5MN4A 1SA0A 4I55A 4ZHQB 4B46A
chains in the Genus database with same CATH superfamily
2N42A 1MEOA 5JFTA 4LBZA 4V03A 2D62A 1E94E 2JJYA 3TR6A 4CFSA 1YJ5A 4HX5A 5JH7B 4GEGA 4UNNA 2N9UA 4QDTA 4Y1RB 4Y2GA 2P68A 4MS3A 1FXUA 3JVIA 3NJ8A 4OBEA 4TT3D 1FVXA 4FYIA 4LPSA 5AHWA 4B4UA 2Z1MA 5CU7A 1WD7A 4JJKA 4M0MA 2OZVA 3HO6A 2L26A 2EILB 3S0WA 1E2PA 4KQXA 3MCUA 2LP7A 4D9FA 1AN0A 3WLJA 3Q40A 3H2HA 4CMJA 4BASA 1M9NA 3I23A 3K4QA 5AOVA 3I2HA 4V1CA 3O38A 4G4SP 1AV6A 1DFIA 2BSAA 4AFNA 2G4VA 3OZBA 1MABG 2HU7A 1XMIA 5FLYA 4JGSA 2OHFA 3WJQA 4LF7O 2A35A 3OQVA 4PY2A 3JD4A 5FOQA 4KQ6A 2XNDG 3RTGA 1ID8A 3QELB 1B8OA 5DDIP 3NTVA 4TL9A 3FTCA 1SQXH 4QJBA 4AQYB 4EAQA 2KG4A 1RHUA 2R87A 4L3OA 5FUBA 2BRUA 5LJLA 2W6JA 1EN6A 5A3SA 4OLBA 1MT3A 2HX0A 1S3GA 1X7GA 3W5JA 2WEKA 3HCNA 3COVA 2NT4A 4JOSA 2WVHA 1XREA 1G8KA 1JPVA 1ZICA 3JASB 2ZYIA 4JYMA 4DQUA 1J06A 1WXXA 3EDRA 3A28A 4G86A 5CRIA 5KTNA 4M1EA 1Y37A 4WMLA 1L8AA 1O8CA 3NXSA 2OBFA 4KLAA 3RU2A 3O47A 1ORDA 1V3UA 3O4HA 3B9RA 5AK5A 2UXDO 1KP2A 4AK9A 2Q62A 3DAGA 5HWEA 1ZIPA 1PFQA 4PHHA 3G9TA 1J8DA 1E7RA 3Q0EA 4BRUA 5BVHB 4O2BB 4DV0O 3Q8KA 4PGMA 2NO9A 5L3VA 1JFSA 1N0UA 1XZFA 1P4RA 5CLGA 3ESAA 2DCMA 2VNAA 3K0TA 3ZBHA 1AR4A 4DYDA 5K4AA 4C29A 2RGNA 1I2BA 4D6YA 3D0OA 3JXEA 3V4DA 1Q2XA 2IHYA 3K0KA 3QIAA 1LGYA 4YJKA 5P8WA 1IHPA 3SKXA 4GX2A 2TMDA 2R97A 3EW9A 4H7PA 1MG1A 3GHZA 1KAMA 5TGZA 3GJTA 1HORA 4WLEA 3IIIA 5TS3A 3DYBA 5LXTA 1LRKA 5EERA 4DMHA 1RM5A 4Z1MD 4B32A 4UDOA 1N2HA 4KWEA 1JQJC 1MRZA 2G70A 3F5WC 3H9GA 2MQEA 1YHYA 5EA2A 3SN6A 3WGZA 2CL6X 4UPEA 3I72A 5I9IA 3H8VA 2FVXA 2Q6TA 3VI4B 4BO3A 4YRRA 5DTRA 4TLDA 3OH8A 1CXZA 1J2RA 3RUFA 2R8EA 2XT0A 1P5FA 3UGQA 4ZGWA 4R0VA 5JWOA 4FPXA 4ZYZA 2FRXA 1HGXA 4NMMA 4M0EA 4HAOA 4NU8X 4A8JC 2FV8A 3M99B 2G0AA 3PEWA 1W55A 2JHCA 1PGOA 4RHXA 4K35A 3RS0A 4JQZA 1WUIS 3CCQV 3FR7A 2AJ8A 2QLBA 5EMNA 1M2EA 3OZ7A 1I30A 2HDWA 3QX7A 4I5GA 1EM1A 1Z0UA 4UU8A 2AZ0A 2DYSC 5E1DA 3JY6A 3FD8A 4XDYA 2GA8A 4B08A 1MXFA 5A0FA 2IUUA 3B48A 3CMAF 1SC4A 2ONKA 3GZJA 3C8DA 1NYLA 4TX1A 4YPFA 3UY4A 2DC1A 3R3WA 4BW0B 3DBLA 1REQA 3DC5A 3QI7A 3QV2A 2VHWA 3HJNA 2Q4TA 4N82A 4QUHA 2VRCA 1DKRA 2IVFA 1GZ0A 2Q1SA 3VOAA 2E18A 1U8TA 2ID9A 1YS4A 5MF6A 3W8EA 1Q7BA 3F98A 1HYEA 5JBNA 1YQNA 1RMYA 2W8BB 5H9VA 2I6DA 2XDYA 3S7TA 2OC4A 2EIJC 1F4NA 5BV2P 2BI4A 1IV1A 1QH1A 4LF9O 3KZNA 1QDEA 1ZISA 2CDNA 1SZDA 1H6CA 2O0LA 1ZIXA 2OENG 2JAHA 1MMFB 2FQ1A 3H5TA 1VH8A 1WXHA 4WE3A 3U37A 4KHZA 1V8PA 1JLHA 2JFXA 4LJ8A 3VPSA 5J1SB 3DE5X 1E6WA 2R4TA 4FOPA 3OZWA 3OPQA 5D5PA 2JD2A 1SOMA 2ZI9A 1R0WA 1TC1A 1J8MF 3FNQA 2YJGA 3EA0A 1TRHA 4QRIA 4NARA 5E9JA 4E6EA 3JPWA 2N46A 3JW8A 1RQXA 3VU9B 1WUTA 3ZWQA 3P27A 4BMOB 2RCVA 1T36A 4H08A 3PEEA 3WBFA 1N8KA 2PT5A 3NTRA 4J1TA 4KNVA 3RN4A 2AZ2A 3JD0A 3AI7A 4TKUB 3SE0A 4BU1A 1WQ1R 3DLCA 5TB5A 2EILC 3OMAB 3K0AB 4JZ2A 3PS9A 4I7ZB 2WPNA 5CCXA 2IYFA 5IC6A 2FA9A 4YIOA 1W5EA 1VJDA 3ABOB 3I37X 1KO5A 4ZYLA 3N05A 4BQFA 4YV2A 3EFFK 1KYTA 1Z26A 4GEKA 1EBBA 4RETA 2OAQ1 2Y1EA 1Q1ZA 2REQB 3UA3A 1D9ZA 1GK9A 4IDPA 3FJOA 5EMKA 3WLTA 4CLHA 3EOZA 5JVDF 1A7JA 1RAIA 4HZ3A 1U7OA 2EJBA 4R16A 1Z47A 3C1TA 1D6NA 4L72A 5GY7A 4HQNA 1XQYA 5DYGA 1HO3A 1YNSA 4MDYA 4J29A 4WCFB 1HSOA 1H5NA 3WFVA 1AN9A 4I9WA 1YKSA 2CVQA 2OAEA 3IQWA 1B7GO 3AUFA 4JITA 4JLBA 1K5SA 2GZ1A 3D6TB 3RVPA 1QTQA 5REQA 1W5SA 3DZIA 4YJ2B 4NFYA 4RLQA 4IIFA 3KT8A 4IZIA 1W0KA 3L8GA 2X41A 4NFSA 3WK9A 2H52A 4QGPA 2CXTA 3OLZA 2UV8A 3ZS8A 1AGRA 4HZUB 2NACA 3QE0A 4F4IA 1EM8B 3WG7B 1WLYA 5KEIA 4B0PA 4L0DA 3IKEA 3NANA 2QMZA 4C5CA 3ZTYA 2PTMA 2GBOA 3BHPA 4QPPA 3T9FA 2BCGY 2N75A 2Y6UA 3ZQ4A 3DDNA 4DSNA 3CNNA 2ZYAA 3K7EA 4NSNA 4ZIBA 3ER9A 4P9OA 3BVOA 2QMHA 3GB9A 4GWKA 2BSKB 1DEXA 3ZIAG 4W8HA 3STWA 4J16C 3W8DA 2Y69C 5J4HA 3L0YA 4L8FA 2FZ4A 3A1DA 4DV6B 2A33A 4RZQA 4Q4LA 1GM7A 3ZPXA 1TA0A 1QHNA 3RKSA 5A6SB 3D3WB 3IIEA 3ZBUA 1Y7TA 5AW5A 9ATCA 3N2GB 1B0UA 1JSRA 2X0KA 4FT2A 3FD6A 3BBLA 3AVUA 3CMEF 3QG5A 1M34E 2AGVA 2CNOA 4XLLA 4XOUA 3O95A 5EWMB 4CL0A 1OROA 4OJQA 1MOPA 3Q8XB 3MTDA 3NC4A 3W1VA 2LUOA 1SXJA 2R1VB 2R7KA 4FEAA 4IGIA 1I7DA 1KR2A 3VO1A 1AQJA 2BEUA 3KHNA 5JAPA 2QTOA 4Y0AA 3GXBA 2H3EA 2V7QA 4JP2A 4LXIA 5JO9A 3RWOA 1NE7A 1NV8A 1HEIA 1Z4NA 2W11A 2P41A 3GD7A 4YBRA 2JGIA 4KI7A 3WZMA 2BEWB 2RKOA 4BVJA 5IN5A 2DP4E 2VYCA 3UQ8A 1NJ2A 4IXTA 1K8YB 1PM9A 1V4VA 2DFKB 1YCHA 2KLBA 4NKRA 4QFBA 4MWTA 4WAUA 4F4FA 2I91A 2DFTA 1MV8A 2W2MA 1TW2A 1NASA 3KQLA 3OM9A 1Q3EA 2C92A 3BL5A 5FTWA 1MKYA 3TLXA 4GNKA 2JIQA 2NUPB 3HYTA 5EIXA 2JIZA 5AVXA 2HOQA 1W4LA 3A4IA 3IP5A 5E0OA 1GPKA 4YCJA 4YRDA 2XB4A 4KWCA 2K2QB 4MV8A 3HACA 5EXTA 1JHOA 1A2QA 2DWUA 3QUCA 3PNBA 2GV9A 2QKCA 1ZIYA 1XMPA 5JQGA 4GO1A 1GAWA 3UO8B 3THSA 3LXUX 5AHXA 1A9TA 1EJ2A 2AKEA 2AW9A 1TTPB 4AILC 1NW9B 3DF9A 3B7WA 3JTMA 4HUQB 5IARA 4A2PA 1GILA 2O8CA 1E92A 2DSNA 2PKWA 1ZGCA 4QO8A 3RREA 2C8VA 4YK7A 1Z5WA 1JD1A 2LBWA 4NBKA 2H2FA 3PFCA 1CIPA 1KPHA 4TL8A 3ZH9B 1T8PA 1O1YA 2VF7A 2XOXA 1DXQA 1JMVA 2A9OA 3FUUA 2CDCA 4HNAA 1ZNZA 3A4YA 1QFSA 1IHDA 2WUEA 1Z62A 4K0RA 5JLAA 1WWKA 3HXMA 2BKUA 5H6RA 3BRWA 4FDAA 5LQNA 1OH8A 2WWHA 3IBYA 4OB6A 1GGKA 4PPNA 1OJHA 2IK8A 4HMPA 2PAAA 4RIFA 3R74A 1NLFA 2F1KA 3VC1A 4XRGA 4YMHA 5JY1A 1XDDA 1NYTA 4PSVA 1NT2B 3CH7A 1E9VA 4KFMA 4YPOA 4N7RA 4U7NA 3EIQA 5B1HA 1FS0G 3PCXA 4DLKA 5LOVF 3DT8A 1W5BA 1AM4D 2H51A 2I4LA 4Q7JB 4U7HA 4XZ3A 4XUCA 3CZ4A 5KWVA 2FGKA 2NZ8A 2AN5A 3PI6A 1VJRA 1NP7A 2GH1A 3EZYA 4CM4B 5ARDA 3LLUA 4CM4A 4D43A 3R65A 4E12A 3IXMA 4FHDA 4JIMA 1GNSA 3N8IA 2UXCB 3IEWA 2HPAA 2WSSG 1WX1A 3KTAA 3ZIUA 4GKJO 3PK0A 1Q57A 2YS7A 4I9NA 4BV8A 2OQIA 4G5QA 1LDNA 4HTAA 4MS1A 3OEHG 3HCBA 2Y2UA 4PCUA 5C2JB 5KWSA 3HTXA 4DVGA 2DUNA 1IXZA 5HZGA 4KFCA 3FVQA 2FR8A 5IFLA 2MOKA 2VJBA 3HCDA 2H8CA 1M5UA 5DSTA 4MOWA 1XL1A 4ZI7A 3C3PA 3G5UA 2AGAA 2D0IA 1ATIA 3WLKX 1AVMA 1WVGA 2B3DA 4Q7QA 1J6UA 2ISCA 3G9ZA 1JR3E 4XLTA 3OUSA 4I66A 3L75H 1N3BA 3TLKA 3WU2Z 3F0GA 2ZI4A 3JAWA 1R3DA 4HTFA 3UJ6A 3H19A 3LRTA 3UJHA 4ZAVA 3H5RA 3R9KA 1PT7A 1G6HA 4LF4B 3BRSA 3MN1A 2CE7A 5JV5A 1EWQA 4LXYA 1ZP6A 5KAIZ 3L7KA 1KJNA 2XCQA 3B38A 3U7FB 1UDBA 2OHIA 1QQ7A 2Z0MA 3HSKA 4DC9A 5LWHA 3DOJA 1QK3A 3A04A 1KJJA 2DPYA 4ZEOA 4YRIA 2YINC 4EYSA 3FCEA 1PJQA 4JBGA 5IT9A 4QVIA 4IIYA 1QE5A 1JKJB 5A5VA 2RBGA 3C6ZA 1BROA 2GM3A 4FDVA 1JSZA 2ZYWX 1KBQA 3QYFA 3ZJZA 3MCQA 4O1HA 3X1DA 4CU5A 3U1BA 3P26A 3R8FA 1EBUA 3SXJA 1K3EA 4PAGA 1JFTA 1IQPA 5MN4A 1RPJA 1W76A 3AIMA 2IP1A 3IAXA 3N8DA 1SUAA 2Q50A 4JEUA 1L8LA 1BXGA 5LFAA 4C07A 1QIHA 5FHRA 2GDSA 4UASA 3UMJA 4KREA 1XKTA 2JB9A 3DKVA 2AW5A 5B7PA 2GF0A 2X3UA 5LHGA 2W90A 1XNRO 3DL4A 3K0BA 4HD8A 1XFAA 4Y2YA 2ZB3A 3AEKA 5TXGA 3TJZA 3TTTA 3VSEA 3DH0A 2A4MA 2BGLA 2J4CA 3PB3A 4LPKA 4DAOA 5BV7A 2V7EA 3BH0A 2XF8A 4EGSA 4MJ3A 3Q7EA 1YMQA 2Q8PA 3Q2OA 4HEHA 4DBZA 2VF2A 1IZYA 1QCDA 1E1KA 2GHRA 2ZATA 3RIXA 5C8YB 3KE8A 1DTOA 4ARZA 3T1TA 1GOTA 2PCLA 3PGKA 4C4ZA 1ISFA 1ZMBA 2N74A 1SUEA 4LRSB 5CCDA 3OLQA 1E9AA 3SM3A 1YR8A 5ALOA 4DDVA 1MJNA 2NVUA 5BW5A 1IDN1 1VPWA 4MO2A 2XAQA 4D42A 3S40A 4Y7DA 3KZMA 1BDMA 1BOOA 4GE3A 4FGZA 4HDCA 4D96A 2EJUA 2HVYD 4BV3A 3DQZA 1US6A 1E3EA 3BGOS 1V26A 1Y9DA 1E2EA 2UYQA 1JR4A 2WVJA 3ONVA 2WR8A 1G98A 4LZAA 1D6MA 4X66B 3F49S 1J7HA 3H5OA 5TMBA 2W0XA 1QB8A 3WO1A 1FVFA 3ECCA 3K06A 4YIHA 3WL6A 4HNUA 3L4BC 4FYHA 1WZUA 5FLXA 3DTNA 4I5EA 5HTKA 1DP4A 4RFLA 5K03A 3LUDA 4DSTA 1I5RA 1Q92A 2W2TA 4UVBA 2QB5A 1XV2A 3K9HA 1PJLA 1Y5IA 4MWSA 1UF9A 1VE1A 3FYUA 3KL4A 3LBAA 2RFLA 4HGRA 2OLJA 5F23A 2UZ0A 1UT8A 1WB6A 1K8XB 4R40A 3HVHA 4W5TA 5AWFC 4Z4CA 4AUMA 3HU1A 1C3OB 1KPIA 2XSZD 1P4AA 2Q1TA 4FCCA 3C97A 4IDHA 4LMBA 5F51A 5HDBB 2D2XA 3TAXA 1E5VA 1ZN7A 3HR8A 4YRBA 1GTG1 3K9FC 5DNUA 1JHZA 1K9SA 2XB2A 4I50B 3LWPC 2CY0A 2WJGA 3I6YA 5EMJA 5FD8A 5HZHA 2SCUA 3PUZA 1BQ4A 1S3JA 1ZGGA 2C5FA 1X59A 2HJRA 2R5NA 3IUJA 4Y2UA 2Y1FA 4YO8A 5ALFA 3VDNB 1DKQA 4CT0A 4P22A 1ECCA 2AR0A 1RAFA 2IW1A 3IAS1 4NBNA 4A5OA 3HGTA 3D2BA 1I94O 1FB5A 4TTVA 4UCWA 3UOAB 1K8RA 3OQHA 3UXMA 4CYMA 5JSZA 1KC1A 3EXFB 2X0LA 2F3UA 2W4QA 4KJXA 3BGVA 2ZXWC 4IS3A 2X0FA 3O4RA 2XWQA 3R7AA 2OFFA 1QV7A 4KQ1A 1HTTA 3BZUA 5KHIA 4IVNA 1FU8A 3VCZA 3T3GA 1GM9A 5FRDA 4WY5A 5EZYF 3VNAA 3ST7A 1ZD5A 1GZVA 4UDNA 1N9GA 4PRYA 4V0RA 3AF0A 1KUQA 5JXWA 2V7VA 3U4QA 1GNQA 1WQ4A 1G41A 3MFYA 4BGVA 5DCWA 3OTOO 2PT7A 1U8AA 1QQAA 2ZBPA 4FQ5A 2P22C 3ZXIA 4J42A 3JD1A 1ZAUA 3TWOA 4M0LA 1N2SA 3UGKA 4CF4A 2IYSA 1L1FA 3U3DA 4B3XA 3K2XA 1SC3A 1HK7A 3EG5A 4I5SA 2YNMD 3AJEA 3DL2A 4MEBA 4YAFA 2QAGB 3GNTA 2IUTA 1E3WA 3EYAA 1L4KA 1W8DA 1PT6A 2CYBA 3K0FB 3L7AA 1AMNA 3H4VA 1E63A 1U4OA 4QQRA 1XEXB 4HDSA 4FS3A 3D00A 1ST2A 3D8HA 4EABA 3NZEA 3CSSA 2J46A 3EQ6A 2J4FA 4FKZA 2DM6A 4ZHWA 2V7BA 2FXIA 3QW4B 4I5FA 4PAWA 4Q6BA 5GPBA 5HW0A 2Z6UA 4EG5A 1YQDA 3KT3A 4IG4A 4N5NA 2JCBA 4WESA 3FDIA 1CQIB 4HX9A 2UXBO 4QKQA 2M2IA 3P0FA 2HVJC 4NCAA 4YC7A 1YR2A 1W19A 3RGGA 3IXQA 3MJDA 1LS6A 1GNPA 5IWAO 1R0BA 2EW8A 4IP0A 5BNTA 5K09A 1F23A 3J81A 1GX1A 2AI1A 3MTEA 2PUEA 2W48A 5HS4A 3OLVA 4I1UA 5CK4A 5IBCA 1Y6QA 4X88A 3CRQA 3FFAA 1MEEA 2E3JA 3E4DA 4NOKA 3MDOA 1FP1D 5TPWB 2G1KA 5JEDA 2AS0A 1A9SA 3ZHCA 4B81A 5AVZA 2HIMA 3CC7V 3I9JA 3RS3A 5CLLA 4ZV9A 1SU4A 2IJIA 1THMA 2O2HA 1NNI1 2RB5A 3FUVA 3LKDA 4BRZA 2QG9A 2F2TA 4ER6A 2AIRA 4G23A 3VRHA 5C8VA 3OR6C 2WWRA 3VSDA 1OFUA 3DULA 2QWRB 2ZSHA 4WECA 3RVQA 4DCNA 4QE7A 2NZ2A 3CCBA 4KNYA 1Y1RA 1JG3A 4JOCA 1BHO1 2B6HA 3S55A 2HNKA 1KU9A 3A1CA 4KMRA 1GG8A 3NUGA 2JFNA 2OV4A 1RYDA 1ISGA 1T3TA 4GF5A 4HFNA 3COJA 4RJKA 1SD1A 1QF9A 1GZHB 1D2EA 5KTSA 3EGVA 3ZX6A 3VH3A 2ISQA 4C4SA 4ECEA 5AVTA 2OCBA 2HBYA 4KWTA 3MS7A 3B7PA 4Z7OB 2WJIA 4DCOA 3P4EA 4BO0A 2Z1FA 4NQ3A 4BPBA 1TEXA 1Z5NA 2NYVA 4HRXA 4F9TA 3IRVA 2B61A 2Y76A 2OXFA 3EHDA 3GJSA 4FZ3A 1RXWA 2BMDA 3UHJA 4HDNA 2J09A 1XQ6A 5H2FZ 3J80M 5HBRA 2Z8YA 3EGCA 4RTNA 2MCFA 2VDQB 2FZCA 3PAFA 2DRIA 1FLDA 3HUTA 1DTWA 1YR1A 3OIGA 1K7XB 1AK2A 4PX5A 3L0DA 1V16B 2K4MA 4QAQA 2X13A 4DGQA 2XBUA 4L8JA 3VR2D 4HDRA 1KQ3A 1CZLA 1WO8A 3EGWA 4CMGA 1QQ5A 2JFYA 3AL3A 1UL1X 3EZNA 4MKHA 4ID9A 4OQMA 2BJHA 4URFA 3RD5A 3V8EA 4AWBA 3OO0A 1Q1GA 2ZTLA 4NC9A 3FDJA 4D56A 3DE0X 4CR8A 2PTGA 2XITA 4UKDA 2FMKA 4K03A 2V7QG 3SX2A 4ZDWA 1WA8B 1DAOA 2CLHB 2R11A 1T5TA 1F06A 3IDQA 4CL8A 4V1CB 2OUIA 3IIKA 3PEUA 3MSCA 3K1ZA 1PR3A 3E9CA 1ZN9A 3AM5A 3MXTA 1G9TA 3ZZNA 4KIFA 2H1HA 3SVLA 3C5HA 4BIZA 2MR6A 3K0CA 4ZMRA 3QHPA 3LH5A 4Z99A 1D8AA 2AF3C 1TZ2A 1Z16A 1U3WA 2OKCA 2W37A 1LSSA 4L8LA 1C1XA 4ZQIA 1OH7A 4KR3A 3DUFB 4Z0PA 2VCHA 3TJTA 4P2BA 1O96A 5ALJA 4EMUA 4XCVA 3Q0TA 5CHEA 221PA 2B6NA 2XMGA 3MJSA 4YBZA 4EJFA 4U02A 2VF4X 4IDEA 3G2NA 4NY1A 4M0UA 4K9RA 4CC5A 3B1VA 2FTKE 2OCHA 2E4UA 3V1LA 4LFAB 1CJUC 2D4HA 2HFKA 4YRCA 5AICA 1ZU4A 3VMMA 4AZ0A 3Q87B 5KOHA 3IUNA 3L0CA 3E1YA 3ZU2A 2EEPA 1Q6HA 3PVCA 1JDNA 1DO2A 2AD1A 2PU5A 1SETA 3EGXA 3JVDA 3QOXA 4KOEC 3ZWNA 4BP3A 4C76A 2EP8A 4H1WA 3AI2A 1LI7A 1UBRS 2MR5A 3NWBA 3ZNQA 4R7TA 4DV5O 5BMVB 1GAXA 1BJRE 3MT8A 1UC4B 1X9GA 2A86A 5ENDA 4MDEA 2Y71A 4B2IA 1U43A 2ZXFA 3E7FA 5DMXA 3F9RA 4KLRA 3VHQA 2ZKLA 3HN2A 5TY0A 4CQLB 4JI2O 1GMGA 3V3TA 4E5SA 2RJNA 3FF1A 4LK3A 5J9PC 2NSLA 3FMOB 3IBSA 3WBJA 4E32A 4OGGA 3FNIA 5AT1A 3HU3A 3MINB 1UK8A 1V25A 1NULA 2O5RA 2A84A 1YIAA 2ORYA 1C3EA 1ESNA 3BL8A 4FCTA 3VKVA 4IWYA 2XWJI 4ZJPA 2P65A 3NHZA 2JC3A 3OPYA 3QMWA 5DHAA 5E3JA 3P9RA 5EGSA 2BUBA 2GB4A 5BORA 1P1JA 5NULA 4DUZO 2G5CA 5L3SA 3WLIA 2ATXA 4MVSA 4CDGA 2V96A 1YBAA 2Z2KA 2ZIOA 1X7XB 3F5TA 1G42A 1W96A 1DI0A 1KDZA 3NVDA 2AR9A 2NO1A 1MAVA 2I2FA 5DRTA 3CHYA 5CG2A 3AG1C 1OXTA 1VA5A 2BBSA 2WSSA 1NXOA 3CT6A 3GN2A 4W9NA 3CW9A 1I2AA 1JIJA 4EF4A 5E9QA 2XZPA 3M1AA 5B8FA 1PJSA 1UWLA 2B34A 4LTDA 3ADBA 4TMXA 4NR1A 1PHPA 4EKYA 4JSRA 5GIOE 3GF4A 3LTEA 5E2IA 5CBPA 4P82A 4D0GA 3EN0A 3S8EA 1CY1A 5JNUA 5L3SB 2Z5UA 2PS0A 3MWDA 3T2MA 1DCKA 1UBSB 1EJ6A 1VSQA 4IMRA 1I94B 3WQHA 3VJRA 2BWJA 3F3KA 5H68A 3SHFA 1ZONA 5EJ9A 3DZBA 1N2XA 4RFSA 5EBLC 1KMHA 5LPNA 4QXRA 2PY5A 3VOSA 5J2TF 2XB6A 5IUKC 1TLFA 3H9CA 4TWBA 4DJTA 5LB2A 5KC9A 3DG9A 5EHGA 2HLHA 3AQIA 4DCVA 2BFCA 1SCBA 3CWZA 1AVTA 4GRDA 4PZYA 4R50A 2Y93A 4KB5A 5B12A 1GG5A 3UPUA 1RRVA 1X52A 1US8A 4X8HA 5EPUA 4JT9A 1ZJWA 2AZ4A 4KO2S 3X3HA 1QIGA 2P11A 3KPVA 4H7IA 5LA6A 2HJFC 1Z0KA 4UREA 1CC1S 2EYUA 4QDXA 1E62A 3K0GA 4EELA 2BKAA 4UNIA 2IV7A 5LJIA 4DSOA 5CM2Z 5EIBC 4EQ6B 3NHRA 1FNNA 1YZYA 4XSVA 2VDMB 3RYFA 2WNIA 4RZIA 4RGBA 2ERYA 1UBLS 4H7EA 2D0OB 3GCDA 1FQWA 4M9SA 1WPXA 2SECE 4OHPA 3K8ZA 1NKSA 2H92A 3WOHA 2CB0A 3GRCA 2CNKA 4U2DA 4BVBA 3T3OA 1H9CA 3A6PC 2VK1A 3ZE9A 4GYJA 1T0UA 2WJ3A 3GVIA 1RWMA 1YAJA 4PV1B 2YMPA 5BQOA 3RQSA 3TNFA 5FPPA 1Y6RA 3IA7A 1IBMO 4DYHA 4YMTA 5JNVA 1GYPA 1IHYA 2YZNA 1J7JA 4UMFA 3ZXSA 3CZCA 1YO6A 3C3YA 1TM7E 1IUPA 1QKIA 4O3FA 4X92A 3V3KA 2RCNA 2NTJA 4TKUA 2OTMA 3OT1A 1EDOA 2HRBA 2Q3CA 2ZQMA 1HQDA 3H1AA 4BT4A 1XRJA 1DGQA 1C7IA 1QMGA 2FMUA 2QU7A 3PPWA 4I8IA 4RH3A 2ITDC 2EEZA 3PIIA 5H5JA 1I3KA 1VSUA 2JZNA 2XAAA 4RK7A 3UZUA 2ZJ6A 3LPAA 4B5LA 4EYEA 5MDHA 3PNVA 3T5TA 5B6IA 3CE9A 2JASA 3BIOA 1JIKA 2R7LA 1ZSYA 5DJ5A 3NT2A 3ILYA 3RT9A 5IDXA 2PBZA 3M33A 3TRFA 1UUFA 1WCV1 1NLMA 1XPRA 1E8MA 3QKIA 4QFMA 1UAAA 1A88A 1J39A 1D2HA 1EIZA 4RTRA 1M1KH 5K8UA 1J7KA 4E31A 1KBZA 1QFZA 4B80A 5LUAA 1TJPB 1DXHA 1PFGA 3IUBA 3NC1C 4H2DA 2GDZA 3PWKA 4IXDA 1XMQB 1UQRA 3A0RB 3SI7A 1VJ1A 4DYLA 3B4SA 2BSXA 4Q1BA 2HCFA 1RHMA 1QAOA 4G67A 4LV5B 1RPZA 3LRXA 2TECE 1BE3H 2WVAA 1NGSA 1ZXBA 3KNZA 3PXBA 3EPJA 1DX4A 2BF4A 2XQGA 3ORSA 4GWLA 4Q7MB 4ZO4A 3ZOZA 4KFSA 5B30A 5D87A 5F1YA 3IC9A 1A50B 1ABBA 2XXAA 3R0JA 1PZMA 2V7QD 4EA9A 3J7AU 2WLIB 2HDNB 3UKOA 3W2IA 3AHHA 2J87A 2V5UA 7YASA 5BY1A 4KL1A 4WBNB 3ZP4A 2YOHA 3ACDA 3DOFA 1YS6A 2GZLA 1X9IA 2FR8C 3JTEA 3N2IA 3O2NA 2BPOA 4KXMA 4N6GA 5JSYA 3RV3A 5FAKA 3QA9A 1P0PA 3S44A 5EHXA 1BCRB 2MJLA 2G9RA 4O4IA 2IF2A 3AJAA 4NOLA 3TQSA 1GFSA 2VYVA 3G5MA 1ZL8B 3F4LA 3G4SV 2O5VA 2W6CX 5I7WA 2EGUA 4IUCS 4KTVE 1X80A 5LQRA 4W1RA 2VUHB 1FNCA 1PL6A 1JHYA 2GYVA 2VTEA 3U4HA 1NXQA 3RYHA 1FFTB 1WVMA 2WJYA 2P4EA 3PFWO 1NM5A 4NS1A 1EPUA 1SIWA 4ZVOA 4GU5A 4GBGA 3BD7A 3G49A 1EZJA 2QN2A 2X8AA 3WL8A 5A2GA 1KEKA 5K4GA 2BR5A 2F8MA 3E58A 5EP1A 1VC2A 2I7TA 3ESCA 2ZIXA 2HI0A 3LF1A 1PTJA 1APBA 5DEDA 4M83A 4F3KA 1USVA 4JMPA 3FHTA 2MDTA 4WK6A 4C8EA 4YQEA 2PX5A 4ZI5A 3WIEA 2IXDA 4DCCA 4L5CA 4CZZA 2D8AA 1U0FA 3PNQA 1RRKA 1L5KA 1UZAA 4IAOA 1NF2A 5EKUA 4ICGA 2QAGC 3LUFA 2X15A 3FAVB 5FPSA 4BO2A 3VZSA 5FPQA 4PLPA 3ROXA 3HCCA 4RW0A 3GPDG 2O2DA 3D3WA 3FD5A 4Q1EA 4ZZ3A 3WJAA 3G02A 4R7ZA 1JEOA 4P7GA 3BERA 4PG4A 4OUDA 4XWGA 3ZJVA 2E37A 3RF6A 3AG6A 1ENPA 1U1FA 3ZHYA 3VOUA 3DFZA 1SPXA 4GYWA 4QPJA 4MKIA 4PWZA 4MDFA 3SOPA 1KI6A 2R9AA 4DUZB 1EP3B 3KM0A 1MRSA 3AF3A 1X7ZA 3DPSA 1GQ2A 1QYCA 3KLMX 2BBTA 2H0QA 2WUVA 1ENOA 4H0CA 1TEVA 3WJRA 3SJBA 2RK3A 4BKQA 4FFMA 5LGNA 3DHYA 1RLTA 5EVJA 5NLLA 3EQ8A 4DLVA 1GV1A 3IEXA 3U4CA 7REQA 3AERB 2PZAA 4AZ3B 1N0IA 2UYOA 5HILA 2FSPA 1QVGU 4AJKA 4F46A 5IHPA 1UXGA 2ZGVA 3Q10A 4MV1A 3RASA 4ETMA 1KKLA 1UXHA 2IX9A 1JHUA 1D5NA 3K0HA 1G8AA 3A4MA 3GI1A 3QVKA 2GBCA 3WLMA 3FYDA 3OURA 4LE1A 4QECA 2DBVO 1TFRA 2OD2A 4I7EA 3IDZA 4KAFA 1TTQB 4HYQA 4Q4HA 4ZCPA 4BZZA 1GQFA 1ORVA 1QH8B 3L0PA 3ZHQA 2I67A 1YMUA 1S1CA 1NOKA 1SXJC 4BQIA 4O0MA 1Y4SA 3ZU4A 3MRXA 1F7UA 1C41A 5AJUA 5J2TA 3TW4A 1W30A 1S8OA 2QI2A 4LCKA 3SMVA 1VXOA 4LFAO 4G6ZA 2EX4A 1U3VA 4NG5A 4OHWA 4ERNA 1VSTA 2KYRA 2QRJA 2ETXA 3CB2A 1XMJA 1EMDA 2J9GA 3G0DA 3QTLA 4QPCA 3KOUA 2YIBA 3PDJA 3EF0A 2FSHA 2OGZA 3H9VA 2QTWB 1RQ2A 3MLAA 4N9WA 2X0DA 5KOJA 3AR5A 3P8ZA 1I6MA 5J5CA 3DBHB 3DBHA 3RBVA 5ENVA 4OGLA 3SMQA 1GPH1 3ZZTA 3E35A 4QM6A 5AKKA 1PQYA 1PZFA 2NUBA 3HXLA 4BEWA 1F3OA 3RK0A 3SXPA 2H0RA 3CG6A 4EHNA 1GSOA 3IALA 2Q7XA 4WNCA 2FKNA 4DV3B 4NNJA 1XC7A 2C4MA 1R7RA 1Y7PA 2BLLA 1EFTA 2QYTA 2RH9B 3IQGX 3M5CA 4N4AA 4O4JA 5AH0A 5C51B 1GZSA 5JSQA 4EKNB 3TXSA 1BC5A 4ASUA 3TW8A 2B21A 3HXTA 4KITB 4YP5A 1EUQA 1L3IA 4BS9A 1PX2A 1Y5LA 3H7IA 2WSMA 2Q07A 3ID6C 2IU0A 1R0CA 2WJJA 1F9AA 1S8NA 2XCUA 3FYUC 3MTGA 4HCJA 4AECA 4FE7A 1SD2A 3G9QA 2A3QA 1DRWA 2I78A 4H1VA 5F5NA 4RV5A 3VBEA 3T4PA 3S2UA 3FOWA 1JL3A 5K3EA 3IODA 3IPXA 2FYUH 2I55A 1TVKA 2QLJA 1ZXXA 4NX2A 2PTHA 3KR2A 4JT8A 2IH1C 4HAZA 2B83A 4EPWA 2A7WA 4I4CA 4Z4GA 1K5PA 2B4TO 2IGBA 4GBJA 3BCCH 4IDBA 1ISHA 1XRNA 4OY3A 4RM2A 5GAJA 1DIOB 2JI8A 4UFNA 2VQFO 4YY3B 3OC6A 4CLEA 1EXDA 3JYQA 3X43A 1KEVA 2A4KA 2IEDA 3AWDA 3NAQA 3H13A 1R6VA 5G41A 1XZBA 3HB4X 5SYNA 3G6EF 3VTKA 4MYSA 3IE1A 2QN9A 2PUDA 1ZNYA 3NEPX 1DAHA 3A6GA 1T9GR 1DBFA 2E48A 1GUFA 3D8CA 3CT4A 3V7NA 2PQ0A 2VHXA 3MGKA 3CX5F 3Q72A 4IBOA 4RK6A 5JAMA 1NSFA 2IUEA 1BHQ1 3P30A 1VCHA 1BQ0A 2Z6VA 1YQQA 3GVMA 1C50A 1CS0A 1TUGA 1ONSA 1Z0IA 3MFQA 4KX3A 4PPYA 4QTYA 5IWCA 4KXXA 4OB7A 3QX8A 1GKLA 1H9BA 4UHHA 3I7TA 3RE3A 1RLOA 4Y6PA 3S8YA 4KYTA 5KUTA 2XVAA 4FFRA 1U8FO 5IF3A 2UZHA 5EWRA 3C85A 4CMCA 1NIJA 2R8RA 3ZQUA 5HUQA 5JO0A 5DCVA 2YZMA 5LZ8A 1XTZA 2GOYA 2PR7A 4RK4A 1KH1A 1XWWA 5LXTB 3ICWA 1A9XB 1AK9A 3ILSA 4OFXA 3E0QA 4G1VA 3BG5A 1J8VA 2W0MA 3CURA 4G1BA 2Q1XA 3FH0A 4CF3A 4UNRA 1DB3A 4X1KA 4WL0A 3UK1A 1EVEA 4YCNA 5BN3A 1IMJA 3NLLA 3H3XA 1R4NB 4S1WA 1O6GA 3HUDA 1MMMA 1MVLA 1LSUA 1JLLA 5GGXA 1G21E 1OILA 4R98A 3ENNA 2JRLA 2OLKA 3Q1KA 1N36O 3V33A 5ALVA 4F6EA 3OEEG 3R75A 4R3WA 3KV1A 5EFZA 2XMQA 3IL2A 1LQTA 1JN0A 4JI2B 3K9AA 1EWRA 3PF9A 2VH1A 1DBWA 1RPTA 4KGVA 5D3MB 1R64A 1L5WA 1B42A 4FMCB 5E4YA 3IOCA 1X15A 3RNLA 5I4KA 4TTJA 2CXOA 5CNMA 2ZXWB 1HDJA 1AX9A 2QTZA 3F90A 5D51S 3GP5A 3N07A 3QPWA 3TSAA 4BE9A 5I7RA 2ZRCA 3L8ZA 3DHWC 2CFRA 3QEKA 4RENA 5L3EA 3L1JA 4UNPA 3OTFA 1NUHA 1TJ3A 2EF1A 1LXCA 2CCJA 1UZNA 4X3MA 1PDVA 4K5QA 3C3TA 2DHCA 3U7QB 2O8CB 3HP1A 3IEVA 1NJSA 2WM2A 1HG0A 1CE8B 1X74A 2XXBA 3LBYA 4UU7A 1ATZA 3WAJA 1R4MA 1QIIA 2ES4A 3CVOA 3AG4B 3NS7A 4PX2A 1IWBB 3NHSA 1P2BA 4Y6QA 3HB3B 5CNIA 5JSKA 5EZYB 2XRMA 3SIUA 1SEPA 3BIFA 1TADA 4OQPA 3FDFA 4BAGA 4KO3S 4MVJD 5ED4A 3FOEC 1G3MA 1QMPA 4X8MA 2YC2C 3ENKA 1NKTA 1M5RA 1PD0A 1LTQA 4ALMA 2AMFA 2PRSA 2VDWA 3AFOA 1Q0QA 4EY4A 3GLHB 4TYPA 3I34X 4QTXA 2Q3DA 3T7TA 4G9BA 1EA7A 1O0SA 2HDOA 2J41A 2LKDA 1FXHA 1IZ3A 5GONA 2R68A 1XTRA 1DC4A 4R9SA 1GFIA 1W2HA 3LLSA 4OBBA 4LRQA 3GUZA 1WETA 4K46A 1NR7A 1IEWA 1XHXA 1R15A 2HMTA 4BLQA 2IPMA 4CTJA 5A3VA 5IVHA 3MB8A 3NH6A 1DELA 4GRIA 5FKJA 4AROA 2WICA 4DJAA 5JYDA 3AG2B 2YIBD 2C5LA 5JPIA 2D5CA 3E20B 1XU9A 2IH3C 1N6HA 1E2DA 2I0FA 4FMDF 2I2AA 3PX3A 4TV8F 4F6CA 3MAJA 3CISA 3EULA 4BGEA 4WOPA 3PLRA 1HH4A 4UM7A 1KQOA 5FLXN 4RE6A 4RYLA 3RIGA 3T4DA 4IDOA 2YZGA 3NP7A 4KBGA 3OM8A 1CLEA 1L4LA 4RA6A 4C20A 1X42A 4ZJYA 2ZTMA 4MW3A 3TW0A 4DY4A 3DBRA 3JYHA 4D74A 1F48A 5JYBA 4R2HA 1S7CA 4PDVA 1C9EA 2IDKA 2XVZA 4W7IA 5U1PA 3SK0A 1G8HA 4JI8O 1HTWA 2YJTD 4ALKA 4KOAA 4G09A 3SYNA 1RI3A 1VMIA 4Q7KA 4YMLA 5K6TA 1OV9A 2WQZA 1YVPA 2Q9CA 4WJKB 2A0LA 4Y1EA 1YOBA 2FPIB 4D9JA 3S3WA 4WXRA 1SRRA 5KYVA 3RLFA 1F4MA 3IC7A 2D5IA 1GL7A 3O8NA 4HBGA 1NN1A 2WBLC 3H1EA 4M0CA 4WY8A 4ZRDA 2VRZA 4GMKA 5M5BA 2ODPA 2CJWA 4MWBA 4O63O 1GQYA 3TQOA 4NBRA 1VQLF 2FKXA 3QUWA 3B1KA 3MJTA 3OQPA 2BGNA 1J9ZA 2HHJA 4K05A 1C1HA 1VMAA 4PONA 1WPBA 1BYUA 1E1RG 1QHEA 2IYPA 4J16A 4Q9KA 4EEKA 5KTKA 1SKVA 1V43A 5KX5F 3UIEA 3BE5A 5BV8A 1CNFA 2WOOA 2R85A 3BWVA 4MI3A 5FXMA 1KFJB 3VU0A 4CEHA 3UEOA 4E2FA 3W5BA 2K1EA 1ULHA 3FPHA 3C1UA 2JHAA 4UD6A 3AMVA 3W34A 5B3SC 2BH9A 2HLDG 4PIPA 3K96A 1Z5ZA 3RVOA 3RAEC 4ZYWA 5U4QA 3EVEA 4Q0MA 1OWPA 4EO4A 2X9GA 4K9SA 2AN4A 4OX9O 1DAIA 4FSHA 1J23A 2XEDA 4QFCA 5H83A 5KNDD 5GINE 5EHIA 3UB4A 1RTKA 1UK9A 2ZSAA 3AI3A 4WOBA 2BTQB 1QWOA 2ZUWA 3AR6A 4IJMA 3TMYA 1FXWA 4BFZA 3RS8A 3ESRA 2ZB4A 3W1EA 5IBQA 1C9MA 4X7RA 2WIBA 1C9JA 3KOMA 3UB3A 1HDYA 2ZWMA 3W9SA 4BO4A 4C7XA 3UXEA 3ISTA 2W2PA 1K8AH 1GQRA 3AUKA 5ESXA 3LUCA 1U4SA 2GLTA 2XRYA 1XZHA 4D3XA 3B60A 3H1LH 4M8NE 1GDDA 1KEWA 3E5RA 4KMMA 3EUEA 3RDPA 5KQMA 1PLLA 2FN9A 5CR9A 1VQVA 1NBIA 3JALA 4GUDA 4R83A 4WK0B 3TSYA 5ITSA 3BJIC 5JZMA 1B74A 4ZQGA 3I8SA 4ME6A 3KSUA 4OHKA 8ATCA 4R1MA 3HBJA 5DTQA 1G8GA 4LRXA 2CHGA 5AOBA 3QTCA 3UN1A 1YDGA 2BFNA 1U6JA 2MYNA 3RJZA 2XYPA 4C43A 4E2WA 1R1MA 1T8WA 2X6BA 4FW9A 3QBEA 4E2YA 5DHPA 4J1TC 2H1OA 1RWXA 2ZSIA 3OF2A 4M1OA 3R9IA 4HWRA 2LE0A 4B8YA 1NX9A 4RDHA 4N40A 1KQGA 5CBGA 1PJ8A 3H04A 3T8YA 2DWCA 1B6QA 3PTLA 4IQGA 1CYEA 1SKAA 2Q4DA 3EJ6A 1LW6E 3ABUA 1DNPA 1GCOA 2WKWA 1UOOA 3ASYA 4RGYA 4LZZA 4ZZIA 3FYTA 1VG1A 1T35A 4HHEA 3OAAD 3ADKA 3R0QA 3L7YA 1YTUA 3PXUA 1I3MA 2HSEA 3GLIA 2OIEA 2QTHA 4JUFA 4KDRA 5AKJA 4XVUA 3GEHA 4O29A 4OAPA 2REXB 4KR6A 2O5CA 5ADWA 1O96B 2IYEA 3KYDB 3AETB 3E0XA 3L93A 4L85A 4HBNA 3B78A 4XD2A 4DNXA 4WEQA 1H6BA 4BNLA 2VJKA 1FFGA 4RQBA 1JEYA 2UYPA 4FGLA 3PYLA 4PFSA 1UINA 2AMTA 4AJOA 4NECA 1ZDMA 4L4UA 4EUHA 2Y0DA 3F3YA 1WZ2A 5KWJA 1ZAYA 2QTCA 1YFZA 3AONB 4YRKA 1CVRA 1WA5A 5HFMA 1FTNA 4MKZA 4BUZA 3OEHD 2W4IA 3ZLVA 2R00C 1TT5B 1Z0ZA 2PUHA 4MGIR 3Q5GA 2BHTA 3JV7A 4X6XA 3ZHVA 2DTDA 2RHRA 4KMOA 1T6YA 3IX7A 3P10A 1K08A 4G9GA 3DEJA 3UJNA 3KKKA 3V34A 4DWJA 4NK5A 1M8GA 1QO0D 1YQTA 1Z6GA 1XDSA 4MR8A 3GPIA 2QNIA 2W6IA 4HYYA 1WMBA 4KPUA 2JCGA 3PPXA 4WGGA 4X3PA 3H1PA 2WU1A 1WSAA 4O4LA 2ZE5A 2R66A 1AV7A 4YLGA 4UAJA 3HKBA 1MO4A 1BE8A 1PJZA 5EEGA 3X1WA 2J1LA 1CUCA 1FTWA 5IBRA 3FLEA 5KLVH 5H82A 3WYCA 4KQIA 5BYAA 4WLOA 2IS2A 4M8LA 1VGVA 4MVJG 2Q5OA 2C9OA 2C7GA 2PV7A 2QEQA 5AVVA 5FWXB 2JH3A 4MITA 5GTDA 5M04A 1S9HA 1W9MA 3TN7A 3X2EA 3B1WA 1OX6A 1R9NA 1YTFD 4I55A 4UE2A 2O0KA 3HCEA 2UVDA 5LL6Y 4EWLA 1QCYA 3NJRA 3LYLA 1HNZB 1DT5A 1NXSA 2TMGA 3TVYA 1H1LA 4KH0A 3NRCA 4F6LA 1TUEA 1X86B 3CCSV 1N0WA 5LSAA 1VARA 4WBXC 1AKEA 3F8TA 3IH5A 4OA5A 5B2ZA 4MB6A 3M6IA 4AN4A 2BF7A 1KFCB 2FQXA 5DN6G 1IBKO 1H5QA 1KY4A 2FW7A 2ID7A 2JAOA 2PUWA 4G01B 3AOEC 3VHLB 4R05A 1AGPA 2Q5CA 3UBTA 1M2NA 1M1KW 3I56V 4G07A 3WGTA 3GFBA 1VL0A 1QB7A 3WISA 4ZCTA 4MUMA 3JARA 3UFXA 1TM2A 2IZOA 4JVSB 2C42A 3RJ9A 4EFDA 3EVDA 4DMUB 3B2NA 1Q44A 1V39A 4LNAA 3REGA 1PVDA 2IWHA 4GC5A 3WAKA 3O2JA 5I8PA 3I5YA 2H9IA 2HU8A 1KOJA 3GMDA 4UZSA 4MS2A 1G3RA 1PN3A 1ZH6A 4LHVA 4KE9A 1V5GA 2YVLA 2X2OA 1PSDA 2P91A 3OT5A 1TNDA 2C3MA 4HXGA 4WDQA 2GHTA 4L27A 4N8DA 1X1QA 2OORC 3ASOB 4URXR 5DM70 3UV7A 2RH8A 3TKYA 1M1YE 2VCYA 4BFXA 2NU6A 2Q2WA 4WFFA 3NDPA 3TPZA 3W5IA 4EFLA 2P7HA 2O0HA 3P9QA 5YASA 3UGTA 4LYAA 1VF7A 1FQKA 2GXSA 3IMEA 3U4IA 1KKDA 4Z4IA 2FDRA 3IBCA 2HX1A 1A7UA 1M0TA 1RQGA 1TQ2A 4E2XA 4KSYA 1RM1C 4L5AA 2V1DA 4M0DA 4AL4A 2N1BA 4LYJA 2R1TB 3TDNA 4NKGB 1I4TD 3V6LA 5LR6A 4QO7A 2WB2A 1RZRA 1ZUIA 1QS0A 3LPMA 4K9QA 5K05A 3AK2A 3FKSD 3NV9A 4DN6A 3ESQA 1SBTA 2HR3A 3F4KA 5FLKA 1BN7A 1GQOA 1TCUA 1U11A 2YBDA 4FYKA 4OQNA 1JRLA 2BI7A 4Q1AA 2PV0A 2NTNA 1I01A 3MMNA 4R8RA 5TEVA 3V4VB 4F3RA 2TMYA 5ALEA 4ESVA 1J2UA 1NSYA 3GROA 4N7JA 5ALTA 2QXTA 3ZU5A 4LGMA 5DN6A 5A4KA 1RACA 4XGKA 1VLVA 4B3SO 5B37A 4IQ0A 4CM6A 1V1JA 1GJRA 4MKXA 3GGGA 2WZBA 2B2CA 4I36A 4W9RA 2LTAA 3QV1A 1JVBA 2JFWA 2Y1WA 4PWYA 4H6WA 4Q3AA 4A5SA 3ILHA 2AUMA 2JLCA 5C7OO 3PA8A 1RP1A 2NLOA 4XVRA 3SGLA 2WSBA 3AHJA 4JGGA 2WMDA 4R8VA 1PWHA 3S3XA 3C3AA 5CP8A 4CIYA 2C7RA 1LUWA 4XDGA 3E61A 3L1KA 3DD5A 3U0OA 4B6GA 3VH2A 3E8HA 2NMUA 1HDIA 2QW0X 5B1IA 1X3SA 3T4UA 5I9BA 1T5LA 2IBZH 4WN3A 1B3BA 1NJ8A 2YDXA 1BGYH 4B4DA 4PSDA 4BFWA 3T5DA 4C30A 2GEFA 2FPXA 4GE0A 4LDZA 1I80A 1LJ8A 5EY5B 4JB8A 3TL6A 3V2GA 4BVLA 4RSGA 3Q3EA 3RODA 3V6MA 1VQ6F 1UKZA 4CT4B 2W71A 5DXFA 1W73A 4O4IF 4FINA 1NU6A 4KFUA 4DMRA 2DPGA 3IPYA 1G8FA 3QW2A 4HSGA 4HPXB 3THWB 1XL6A 1L4MA 4DV7O 3RB8A 3QVJA 4NVPA 3FMVA 5L3QB 1FRZA 1P1BA 4N54A 4ZHYB 3ABLB 2FSIA 2PH7A 3U80A 1T0KB 3KJXA 5IUNC 3SHQA 4RFVA 4ZZ2A 3TUJC 2QP9X 1NVEA 5LNK6 4Z51A 3CC8A 3DXYA 3EXFA 5IM5A 2HCTA 2WUFA 4JOQA 1JDVA 4WLVA 3LRPA 1BO6A 2GR9A 3NC0C 4L4XA 4U6NA 5AI4A 2Z83A 5CBKA 1YRLA 4UTOA 4DW1A 3DVAB 4L8WB 3VYTB 5JXIA 1EVQA 2J59A 4PZCA 2QX6A 1SJ9A 3KOWA 3VBCA 5BPFA 3HB7A 5CD9A 5LZ2A 2Y8EA 2GM4A 3A6HA 2IUSA 4I19A 4YCMA 3TTXA 1PJ4A 1FUIA 2GCEA 2HK6A 3HSYA 3NUQA 4L5IA 3PEYA 4MIYA 1NRWA 2DPMA 3EB9A 3UWMA 1IXKA 2HRRA 3ESBA 1ZUNA 3MCTA 5H3CA 4K8XA 2QI9F 2Y0BA 1DFHA 1M57C 1Z8DA 2BEUB 4WZZA 1WNTA 2B33A 4P7BA 1BXRB 2ANBA 4XFDA 1U8EA 2BZ0A 1VA4A 2P9FA 2P9EA 2ZIGA 3EEYA 1MIOA 4IFBA 3KJFA 4MJXA 2ZIXB 5HF8A 5THXA 4BMPB 2A67A 3QXSA 3GZNB 2BGJA 2OGWA 3SQNA 5EJ4A 3OY7A 1E7KA 3ZD7A 2X7JA 3SIXA 3O8OB 1N1EA 1ZZEA 2HF9A 5ESDA 1ZVQA 2QAGA 4M60A 4W6QA 3RNOA 4YT8A 5JZ9A 1JIUA 1N2ZA 2E5WA 2G1JA 4I3HA 4BFUA 3DEAA 3NJ4A 3PX2A 4II2A 4B3IA 4UOZA 1OI2A 3CG4A 2NN3C 2ZREA 1J1UA 1HP8A 2DLDA 1Q21A 4F92B 3CA8A 3LWDA 1J2TA 1HYQA 3TAUA 5GIOC 1WP8A 4UPDA 5AI0A 4YHBA 1CG6A 4TUYA 3ETGA 3NBKA 4IRXA 1HQYE 2DKNA 3RE1A 3QZUA 1RPOA 5GZ1A 4XH9B 4JL6A 1TQDA 3D59A 4HVAA 4TMYA 5GZ3A 3GMIA 2X5XA 3LDEA 3A25A 3DZCA 4HRAA 3WYEA 4BC0A 5CBPB 2J9RA 2Z58A 1GR0A 1GTMA 3BJEA 2IHNA 4M53A 1R0KA 2X2PA 1VLZA 5KNCD 3A58B 1KVUA 3OJXA 3ITKA 4JK3A 4OG2A 4QTTB 1CDZA 3KVNA 2F66C 3N59A 2C7PA 5JC1A 3QO8A 3HYSA 2DETA 3FLBA 4RFSB 1NDHA 1MPXA 3DCIA 1UP7A 2QA5A 4EFKA 2PGLA 4G5OA 5DT9A 5A3QA 1UJ2A 3PJFA 3TQTA 2GAJA 2M6KA 3LA8A 3QVNA 3DFIA 4E4TA 3QMVA 5ADVA 5GZ6A 4BWGA 2AG6A 1PAUA 5F98A 2HXYA 2CVFA 1U2PA 4MW1A 2LR0A 4X44A 1OFTA 1H47A 1KYQA 4N1AA 3ESYA 1Z6PA 5KQPA 2P9ZA 2YOFA 4BNKA 1NVDA 4XQ0A 4UFZA 3TQFA 1ZWLA 1FP6A 4C1NA 2JIZD 4EKWA 1OLUB 4IOJA 1JR3D 1WABA 2FPLA 2PD4A 3C7DB 2X77A 1HW7A 4FFKA 3TL2A 1TD9A 2DKOA 2XLCA 2VZ9A 1F2DA 1LJLA 1W5TA 3HJAA 5G0SA 4QAJA 4DPMA 4RACA 4UHBA 4JX8A 1XHOA 4CM3A 2EKQA 4OKIA 2DHEA 1QG6A 3K5WA 4P8RA 3RRBA 3T9AA 1M6NA 1Y74B 4JS0A 3GC6A 3BTOA 5DHUA 4WNAA 5CA0A 2DLNA 2WJVA 1JYFA 3FFXA 2I7CA 3M1YA 5CJ2A 2GZMA 4IUYA 4ETWA 1N3LA 1A95A 3RUIA 3A10A 4K8OA 1UFIA 3DE4X 4KACA 2L69A 2OFOA 5HE8A 2QN1A 3WXMB 1WRBA 3L0ZA 1JEAA 3VR6A 2CE4A 3HWRA 4LK2A 1GPDG 3WKAA 5FWNA 5C7YA 3E9RA 3JZDA 1NRXA 5L3FA 1U8XX 2CSUA 2BP7B 2BP7A 2OCKA 3KQQA 4Q1FA 1RZVA 2VBGA 1RRMA 3U56A 1M3SA 4U7PB 1KSFX 1TU0A 3LKBA 1RP7A 4W9MC 1Y33E 4NOJA 2ZBRA 5EJ8A 1AK1A 4B09A 1ISIA 1E66A 1A8SA 4JI5O 1JWAB 3LS2A 5CNKA 4F9GA 1QYRA 3GELA 4E5MA 1J0EA 1S2IA 1MG0A 3PC3A 3LWQC 1QVZA 3WG7C 1Z2AA 2O2XA 2A0UA 3F8SA 3VI6A 4PTZA 4B6RA 1X1BA 3KYIB 4O4JF 5DYYA 1K6XA 2X5KO 1JJ2U 1FU4A 3KIPA 1CF4A 1T5IA 2Y9PB 4PHCA 3CYFA 1L7QA 2FPSA 5ER6A 3OAAG 1SUSA 1HNXO 2ZOVA 3HKEB 3HKEA 1FUUA 1LNZA 1VG0B 3HP4A 2RGXA 1ZD9A 4IVPA 3SZMA 3D3NA 2Y48A 1F38A 2D13A 5JG7A 2ECKA 1FYXA 2PX8A 5C8YF 3AEQB 4HRVA 2D1QA 5H9CA 3JQ6A 2QSUA 1BX1A 3T95A 3K4HA 2G7MC 2VWJA 1KBOA 3PDHA 1LWNA 2XA2A 4TLMB 5EIAA 4RNCA 5CW2A 5LP6C 1SGWA 2GAIA 3MW8A 4OA8A 3KSDO 4Q4JA 1RDFA 1H8HD 3BH7A 1Y67A 3CXHF 2CZCA 2Y4OA 3W5VA 1Z4QA 5CX1B 3GGCA 3WADA 1QVVA 3S8MA 1Y8RB 5HIKA 2P7IA 3TSCA 2PSDA 1S2MA 2CHUA 3OD4A 3T4ZA 1JR2A 1R88A 2BMEA 3MJEA 3OF3A 4BCBA 2RJZA 3VAAA 3C4VA 3OJCA 5JS6A 2ZFUA 2ZYUX 4JYPA 3ZJ4A 4BMCA 1YS2X 1O9BA 1PQPA 2QIPA 4HG2A 3RC9A 5JMOA 1AGNA 3F71A 2AMLA 3GUVA 3VSCA 4J76A 4FC6A 3PWZA 1U0TA 2QKSA 1M5IA 1HMYA 1GU1A 1IG3A 4ND8B 4NPHA 4KVAA 5IY5C 4IIBA 3N0TA 1G8SA 2CK3D 2BJWA 2RGWA 4DMMA 5ELXA 3KKNA 1RJGA 1USWA 5KVSA 4L4YA 4KQEA 1Y6FA 5DM4A 3RC8A 2B5WA 1E1RD 1T2AA 1E5XA 1EXMA 4LFCO 3LFOA 2G3YA 5F5LA 1FJGB 2X4IA 3U48A 4FLUA 3TGPA 1U2TA 1AI5A 3I5UA 1OI3A 2EKZA 1JEQB 3IHLA 3EODA 4M88A 5I9NA 1KGSA 4QGFA 1GZDA 3TIFA 1NA5A 5C46F 3KVRA 3GBVA 4MTLA 4MARA 5TQJA 4C3ZA 2XCIA 4U39A 1RFYA 3BICA 2JK5C 3BWEA 4OHZA 1KJ8A 4MVJA 3STLC 1PL7A 3OE7D 3PFNA 3PRJA 4JI3B 4I3FA 4LBVA 5HWSA 3TBHA 3OFNG 5A71A 1DRJA 2KG7A 1R6AA 5E7IA 4ZOAA 1R3JC 1BWRA 2YJ5A 4J4HA 2QPOA 1ULZA 1RCFA 2PSHA 4V0MA 4CQMB 3CD6F 4OUDB 3EQ7A 4A6DA 1NBWB 4H6XA 4PN7A 4B7XA 3CYOA 1JYEA 4B8WA 1IM2A 1NW3A 2I6TA 4P31A 2WC1A 3RGBA 1SXJB 4ABYA 2XYGA 2YN4A 3GJ8A 2GFHA 5J2UA 3MXOA 4MIKA 2HHCA 1NFRA 1SC6A 1RXYA 2RGEA 1MJFA 2ZR7A 1OCOC 3EDYA 3FW1A 3L4EA 4OATA 3ZY2A 1X2EA 5IKMA 4QYIA 2E6KA 4QJFB 5F9MA 2V0GA 3WNBA 4KH1A 1WZCA 1D2DA 3EGOA 2NUAB 1ZITA 2A0FA 4UE6A 3SVTA 1O0CA 5F3WB 1PCXA 4HATA 4TUYF 1IE3A 2P9CA 2W22A 1Q1EA 4C05A 4P08A 1LF0A 1CULC 1QLWA 2CF5A 2Z4TA 2QMOA 4WD3A 1PE0A 4DUGA 5D3MA 3JVUA 4RDIA 2GKGA 3OE7G 4RV4A 1CUGA 3BXGA 2ATEA 3D36C 5MN6A 5K0BA 1M4UA 4IYIA 2I22A 1PGJA 1IQ0A 3CHXA 1VQNF 3H17A 3OA2A 4DG8A 3L7BA 4XD7A 4NCNA 4J94A 4ZVNA 3C7TA 3I5XA 2YWBA 2AFIA 3LFUA 3PR2B 4P2GA 2VDRB 1FMLA 5CFRA 3LVFO 5HIIA 1ULUA 2WQ6A 1K8AW 4ZO9A 4A6EA 3GPBA 4B9AA 3K0DA 1E5QA 1NF9A 1ADBA 1Z75A 3ASVA 4H6PA 5DYNA 1N2CA 4ZU6X 5DYTA 1X6VA 1OAPA 2GVNA 2X40A 3JQFA 5DE3A 2CLLB 3DCNA 2VEDA 1ZM7A 2A94A 2EFEB 3SQXA 3EVCA 4NZMA 4DIUA 2DFNA 4HAYA 4PN3A 1ZGZA 1Q7GA 5JU6A 1H4VB 2ZI6A 2B8NA 2DOKA 1JHXA 2ZSUA 4KAAA 3VKFA 3I61A 2HA4A 4QHYA 4CW7A 2Q2QA 2WD7B 3BWXA 2DR2A 4ZEMA 3HUEA 4BNHA 4EHFA 1CUWA 2VG8A 3L4BA 1Y9EA 5DGIA 1LD3A 1Z0AA 4HPJB 1FU7A 3CXCF 1AS0A 1LDMA 2ZSBA 1RLGA 1O2DA 1SAYA 1XCGB 3O31A 2EW2A 3IV6A 4QBTA 4EO7A 2Q68A 4NNOA 1SRQA 4OSPA 2QIOA 4RKQA 1Q81H 2WWVD 4TZ0A 5A06A 4CCWA 4BKMA 4MHOA 1KKMA 2DYRB 2YIAA 2FUEA 5GQSA 3ZYCA 4FFVA 1VP3A 1SQBH 4X9QA 1P91A 1ZD1A 3AXSA 1VQ1A 3D4LA 3KKPA 4UVEA 3TI9A 2UYHA 1EFDN 4PPGA 2WV9A 4URHA 4P3NA 8LDHA 5FYDA 3PYMA 4B7CA 2AN1A 2Q6IA 3G6WA 2FUNB 2WJHA 1H2NA 1X7DA 1CUYA 1NF8A 3JQPA 3QELA 4LQDA 4XEHA 3GGSA 4ZTZB 2W6QA 4B3SB 4X64B 2ZCEA 1MO6A 2YHIB 4DJJA 3HTNA 4ZRNA 4BQRA 1CF2O 2ZJZA 4IVRA 4XW2A 2OMKA 3H2YA 5TQVA 2EP7A 4C5BA 3N2KA 4DA6A 4C81A 5LQUA 3EZ9A 4P80A 4JQOA 1Z25A 1H65A 1EZVH 1NPYA 4L0MA 4ZP1A 3SFVA 2FWNA 2YICA 3E7PA 1LK0A 4C78A 4OX9Y 2PMBA 2AQHA 2XASA 3G1UA 3WZLA 1Q77A 3ZRSA 2Z01A 1U3FA 1W85B 3DT6A 1TVCA 3HFSA 3JATB 2AJBA 3KLNA 3M1LA 1OGJA 3UTCA 2XGJA 1QH9A 3DTVA 5KJ1A 3ZNNA 4O1IA 2KQUA 1PEYA 1NLZA 4UJ5A 1SQ0A 1P1CA 3CYQA 4M9UA 4MGYR 4FK5C 2ZYGA 3CUWA 2FPPA 5FO0A 4TMZA 3OUUA 5G40A 1PBNA 1MA1A 5AW9A 4QUKA 4ND4A 4UTRA 5LQDA 1Z17A 5JRDS 1KK0A 5TPWA 1B41A 5HIAA 4F2PA 1FXWF 3O4JA 4MUHA 4LNHA 4DV2O 2VBCA 4K2HA 2XH8A 4AQYO 5AXAA 4E21A 2UU9B 1A8HA 1HE1C 2IZ5A 2MSKA 2O23A 3DE6X 3VQTA 1WUHS 2FWBA 3UPDA 3R7WA 4XJSA 3VFDA 1CEXA 1QNFA 1I7FA 2VAWA 3BMOA 4Q05A 1Z39A 3N74A 3H99A 4G1MB 4HAMA 3W7SA 2EIMC 4G4WA 1AUQA 1DBPA 3JQ8A 3IAM6 3K72B 4R9RA 5EGNA 5EINA 3SZOA 3UV3A 3GGDA 3BGIA 3HY6A 4BO9A 4DRYA 5K8TA 4PDMA 4UCSA 2C77A 3UYLA 2X5OA 4N3BA 2F48A 5EXDA 5EO3A 4AS3A 1H3EA 5F9FA 1MFPA 3AY0A 3WS7A 1IOVA 4B6QA 5AMXA 3SYOA 3IUMA 2HIHA 1RP3B 1J9GA 2ZP1A 1T5DX 4WX2B 1XI1A 4EX6A 3UJCA 3JQAD 3SU8A 2H4WA 1P39A 4GICA 2P1DA 4LXTA 2JEYA 5C8XA 1DVRA 5KNBH 5IHXA 3GV0A 1GKUB 5IH7A 3PVZA 4YCAA 4NI5A 2H1LA 2RK4A 2EIXA 1AS2A 2GI4A 5IM4A 3KO8A 1Q3KA 4LVOA 1QM5A 2O8BA 2EX3A 4BXOA 3DYIA 4D4IA 1HWYA 4RGQA 1JBKA 1SZQA 4OK6A 4O6VA 3DLBA 4Z53A 3LT0A 2P6JA 4LSZA 3NEAA 2GNAA 3IQZA 3LL4A 2QBYB 4F4CA 3SR4A 3UH1A 3ZMSA 4XQ9A 3PRYA 1OAAA 4D9KA 5JBIA 1N1GA 4JLWA 2Z6AA 4YXFA 4EBBA 1JLMA 3LT2A 4IGFA 3CINA 3QUTA 3HFJA 2FE1A 5CB0A 4KPGA 2BFFB 2XA1A 4F8EA 3WIDA 3WA6A 2WF5A 4U6QA 4K6KA 1M93A 5F3DA 3RU3A 4MZDA 4JV5B 3KBOA 1MJGM 3GLKA 4FCVA 5IX8A 1BJKA 1IHOA 2JGFA 4MS1B 4GQIA 3DZ8A 4CLXA 1ULSA 1KAHA 4OP3A 3TK1A 3CPHA 1P0MA 3UJDA 1NBMG 4C7VA 1H42A 1XV5A 4RSMA 4HWKA 4XPIA 4INPA 1TIKA 4HQFA 2F1JA 4Z4EA 2IOFA 3FOAA 1UJMA 3L1IA 5KOHB 5COBA 2AR7A 2QS9A 3CF4A 3LD9A 1GSHA 3QKSA 4KDEA 3TRDA 1YR6A 2Z8XA 3O8CA 3RRMA 2DE0X 1A9YA 1F4PA 3DMDA 1L4UA 4O4LF 2QE7A 1QBZA 1I10A 3ZI4A 2FRVA 1MV5A 4ECAA 3ZU6A 4BV9A 1TF5A 1S72V 4QD3A 3USCS 1L5MA 2ARKA 4RTKA 3GRFA 1VSBA 1PVOA 4H16A 1U0NA 1XN1A 3STXA 3SHVA 4AULA 1SELA 3GRKA 3L7OA 2QQFA 1E6KA 1WV1A 2D2FA 1J0BA 2C95A 4CR7A 4CIXA 4WJLA 2QKYA 4JH0A 1PGQA 1RM3A 2GPWA 2P4HX 3E84A 5DN6D 3AQ4A 3G88A 1WMEA 3Q0IA 1E2NA 1CQJB 1OBFO 3KB8A 4AQ7A 5I3CA 2C03A 3IUQA 3QTBA 1F1JA 1HZZA 2RBKA 2RHMA 5HVNA 1M0WA 1BIFA 1PKEA 1U8YA 1AE1A 2GBGA 2ZIFA 4RMHA 4LCJA 1HTBA 4TMFA 3OCYA 3STZC 2RKBA 5DCUA 5KNDH 3ZDBA 2K6GA 3W7VA 1BH6A 1TKBA 3I55F 3I05A 3IDAA 4LJ9A 3CCUF 4C87A 3D3QA 2QL6A 4DUGD 4NU5A 2HNBA 5BPHA 1IV2A 5IBPA 3WIBA 3EUWA 2IRWA 2DPXA 1E99A 4HZGA 2XAGA 4FOLA 5JXGA 5AVMA 4UUBA 1V7ZA 2WYUA 1NJIH 1HA3A 3QVXA 4Q4DA 4CDRA 4JLSA 1J5XA 1KFBB 3G0BA 4IHKA 2H07A 2Q9BA 2EATA 4F72A 4UTPA 2X22A 2PQMA 1EBFA 3I1YA 2V4MA 1YZTA 1N3YA 1T9AA 3SYQA 3E2IA 4MRMB 4V0LA 5KU1A 1RM0A 3R0IA 4BB5A 3UCEA 4DIFA 5LMUB 5IJZA 3P52A 1Y8CA 1VQ7F 1N92A 4IICA 2J9FA 4LWSB 1FXKB 3T7DA 3OJWA 2JIPA 1HFEL 2BFMA 2I4TA 2VT2A 3C14C 4MSUA 3VHRA 4AF6A 2LXNA 5E6RA 5EIFA 2XOKD 1HM5A 5K9ZA 1OXVA 5KO2A 1OGYA 3J80N 1E2HA 2GS9A 1P29A 4WESB 1XNRB 5F7XA 4FN5A 1CQXA 2D2EA 2ECQA 2FQYA 4Q34A 4N21A 2E4VA 4JC0A 4YDHB 3RHSA 3LVBA 2VTVA 4B3HA 1NX6A 3URMA 4QQNA 1Q6ZA 2WJWA 5MFPA 2XD4A 1DHRA 1WCXA 3QYPA 4US1R 5FOUA 5F9HA 4UOQA 4LVUA 2FHSA 1ZK1A 3R5XA 1PJBA 2POCA 2ZJ0A 3WGNA 3N39C 3VMFA 4ICIA 2LFSA 2CB9A 3V4ZA 1U98A 4HH0A 1JR6A 1GZ3A 3EEQA 3TRJA 3ROTA 5B3SB 3PSAA 4ONEA 3O0TA 4Q9DA 3SX4A 3FHOA 2PLFA 3VGPA 4B33A 1Z15A 4C3VA 3AR3A 1HI9A 2NO5A 2OVFA 2BR3A 2RGCA 4L4RA 5DBEX 2QM7A 3GCZA 3IIMA 4MMYB 1RWVA 3ZI0A 5LQMA 2XXAB 1T5EA 1P5ZB 1T4MA 2PNFA 4JLAA 3WLQA 2VDJA 5A6VA 1GVNB 2XMSA 3HA5A 3ODGA 2I3ZA 2AK2A 2DWOA 2Z04A 1WY7A 1PYDA 1ZK3A 2ZJ5A 3KUUA 4UAUA 1FQJA 2Q1UA 5EKTA 3SJ7A 2QU8A 4QUBA 2Q5JA 4XVQA 1N34O 2QN3A 3QEJA 3PJSK 2YIMA 4FK8A 1HLGA 1VHWA 3M6FA 3VJKA 3WG9A 2PGOA 3Q3IA 2N48A 2Q8NA 3O4IA 4UTZA 3MERA 1G1MA 3Q6IA 4Z9XA 521PA 1RWPA 3E1KA 1EG7A 4PLCA 4OGWA 2J6CA 1N33O 4RMNA 4WQMA 3ZOKA 3QXXA 1XZPA 5I8WA 3NU1A 2WHXA 1XCOA 1ZUHA 2VUIB 2PMEA 1Z22A 1QIFA 1I2CA 2JI7A 2WE7A 3H97A 2VR1A 4UXJA 4YV1A 5K2OA 4XIIA 5IDJA 1JIIA 4M1KA 4DLBA 4LC1A 1KRWA 3UA4A 4XDZA 2C00A 1O4VA 3BSFA 1C7ZA 2YYZA 5E1BA 1ZGJA 3UATA 3IOBA 3KPJA 4Z4QA 4D2IA 2Z5FA 5C93A 1P9NA 1RE1A 1YB6A 5DT2A 1WBDA 5CDGA 2O07A 2Q0QA 5HKKA 1O5IA 4JJAA 4J03A 4S1TA 2LO1A 2R47A 4DQKA 2YCBA 2AK3A 4GMGA 1NKVA 2P27A 5CAEA 3NHYA 2O3JA 4IHQA 2RI0A 3Q7SA 4UHDA 1JDBB 3FUCA 4EKGA 2WTAA 1A27A 3OQIA 4E30A 2VDLB 3M4XA 4D3SA 3I53A 1OCOB 3NT4A 2JVJA 3P94A 3TOZA 3LO5A 1TK3A 3D7NA 3MWLA 1N9GB 2Q7HA 1ZMXA 1QGOA 2PH3A 3FETA 3O8QA 1UDWA 2PA3A 2XADA 3LZDA 2XQVA 4DBLC 8ABPA 2QD4A 5KAPA 2ZSFA 4D79A 1I5EA 2BONA 1ZSNA 2A5JA 1OLXB 2G82A 1KO1A 3Q88A 1G8PA 4HQLA 1XLWA 4IDDA 5SZIA 4BT6A 1MZPA 4GPBA 3K09C 4D81A 5JQGF 3V7YA 2W4MA 3B1JA 3U7EB 1TLLA 1JPNA 4NYIQ 3CH6A 4QL3A 3UAVA 1YVEI 1KAEA 4GCZA 4HFMA 5DWVA 4REQB 1T1IA 3M6WA 1VQPF 2RGRA 2OQVA 1OYYA 4ND3A 1P1KA 4YCDA 2E75B 5JPDA 4GRAA 3AG7A 3JSXA 1QYWA 2E82A 5BR4A 1BCRA 1UOEA 3NAGA 5H4GA 5FYQA 5CMLA 1YA6A 2F7SA 3VA7A 2JJ2D 3LV8A 1SHUX 4Q66C 5B3JA 1B6RA 2CD9A 3RVJA 4LF6O 1C4OA 1UC5B 1P6UA 4FVMA 1SUFA 2VDPB 2ZM6B 5L6LB 2FSFA 1M2VA 3NYWA 4JI5B 1ZM9A 3S7ZA 4UUQA 4BCDA 5ELLA 3ETCA 5KHJA 3SFZA 1NMUB 3QM1A 4OK5A 2B25A 1IV4A 1ULBA 5TC4A 4OIFA 5FPTA 5FNVB 1DS6A 3ZRWA 2NTVA 1P9RA 3GVXA 3W7AA 1ADFA 1U6IA 2O1WA 5IEJA 3EEIA 3CC2V 2XUDA 1Y3BE 4BTEA 4PYLA 3PXDA 4Q39A 3HN7A 1QR8A 1VCNA 3K6JA 2YXHA 2BV3A 3KCXA 5BZBA 2CDAA 2ZSJA 3BE6A 1H6AA 2IBMA 3A1UA 3N8NA 1U0GA 1XEXA 2VAVA 2RJOA 2XGGA 3FVRA 2Q5EA 1UMDB 2R44A 5L7WA 3P9ZA 3IKLA 2UU9O 3C9RA 5L3DA 1VQ6V 1A5AB 1C7QA 3FKJA 3K1YA 1BEZA 1OV4A 3DWEX 1CXZB 3FFQA 1HYGA 3EW7A 1LR1A 1A72A 1UXIA 1II8B 3EOAI 3LHSA 1H3NA 1ND5A 5LP6A 1ONBA 4M6WB 4N7BA 3ANLA 3CTMA 2I4RA 3A7EA 3U49A 5HYVA 1ODIA 1SC5B 1FW8A 1HLPA 3M6AA 3P9PA 5BXZA 1YI2V 1XJQA 1M90H 1GA6A 2PX3A 3QHQA 3MNFA 1R2QA 1AKTA 1U9JA 2RHHA 1MG5A 1QBGA 2B20A 2IJGX 1T3LA 3CRZA 2F00A 2WHYA 1W88A 2GZ3A 2HMUA 2PMWB 4I1VA 3MILA 4YUXA 1OA1A 5FEUA 3REOA 1WIWA 2Q6KA 3ROQA 5K3BA 2I7XA 2G4CA 1XEFA 5HQTA 1GGEA 2Z09A 4FHCA 1O97C 2FDCA 3QE3A 2FP4B 1W581 4IR7A 1WMAA 3VVLA 4B7UA 2IITA 2P30A 1FSSA 2XGSA 2IYUA 2QWXA 3LW8A 2FGJA 1XN4A 2FPOA 4J2OA 3KKZA 1MP0A 2R62A 1U80A 2ZI5A 3F97A 3A1TA 4J2HA 4K6HA 2Q4PA 4FZ1A 4RJIA 2IDJA 3S28A 4LECA 2VPTA 4BZWA 4U1RA 4R69A 1PF7E 3EVNA 3A26A 3BHNA 1U1GA 4O4JB 4ER7A 3KEGA 3OOEA 1YBFA 4WKGA 3RHZA 3T1HB 1TM3E 3I39X 4MUIA 1KYYA 2FUG6 1ORHA 1XJWA 3F0TA 1QDUA 4RF3A 1WW2A 2HK9A 3LWVC 1ISJA 2QP4A 2X7HA 3U4GA 5L7TA 1LRJA 3GG2A 1BW9B 5JNSA 4MI9A 4G28B 1ZEMA 3KTAB 2B99A 2JK1A 3OCXA 2C2XA 3MM4A 4IWNA 4RHCA 5H81A 5SY9A 2WJAA 2R96A 3FB1A 3EG9B 3EG9A 1LRLA 3O7MA 4P1ZA 3AIIA 2R9VA 3ZGYA 4CF7A 1E2QA 4LF8B 2HEIA 2ZBQA 3PQDA 4GX1A 3MD0A 4A0HA 1U7XA 3WGGA 5FUMA 1PFVA 5JNRA 4AKTA 1QANA 2RK6A 3HI6A 2WE8A 3QLVC 3C41J 1U3DA 1Y7LA 4IF4A 1M2OB 4A8PA 4TWJA 2C4HA 2C3PA 4KQWA 5KCMA 3U62A 5JAUA 2GRUA 1QF6A 1DUVG 4DXDA 5CB8A 4RHAA 4S0ZA 4E11A 4QJIA 5DM6V 1ZYUA 3TIXB 2E49A 5JH7F 1RADA 1XEAA 1P74A 2DYRC 2KW5A 1E3MA 5A9TA 2OM2A 2QVYX 3PR3A 3SYTA 4DWVA 2REQA 1IURA 1NZFA 1FYWA 5LXTF 4F96A 1VJ0A 2DAPA 3B36A 4EKEA 5C5DA 4MTFA 1XDBA 3C39A 3V8RA 5LQKA 2UZ1B 2XMZA 3C3DA 4BNGA 4JPRA 1I6KA 1GAQA 3R5HA 3OQOA 2Q1YA 4D0SA 1ZRSA 1OBVA 4GXNA 4YXWD 2JA2A 2YCLA 4KKVA 4PAQA 1OLOA 5FADA 4ZHQA 1BE0A 2JFHA 3AUJB 4XJTA 2BTEA 1R27A 2CZWA 4L9WA 3QBJA 3I5AA 4OI4A 4R2LA 4XQGA 4J11A 5EWMA 4B47A 2BOCC 3OPYB 1U63A 2H6LA 1PIWA 3RARA 4ZOQI 1F7YA 1EE9A 1S5LZ 3OOHA 3KU1A 3WDMA 2Y1OA 1V37A 2JS3A 2HRZA 2GPTA 5BYBA 3MWFA 1Q7RA 4BAZA 1N36B 1U5BA 3ZW8A 1AB3A 5CYPA 1JPUA 2XAFA 1K9VF 2AHZA 2AJDA 4MQMA 3U3RA 4BE7B 3U60B 4QBIA 4J91A 5CXQA 1GGNA 3LOPA 2GO1A 3G2QA 1E7MA 2YSUB 1PK7A 1XOIA 4K81B 4MCAA 1CY2A 3TE7A 5FH9A 1P3JA 2JLSA 4F11A 5KJFA 4B75A 3W9UA 2AWOA 3TQHA 3OAAA 3PDUA 3M34A 2CJYA 4JD5A 5CA1B 1VKNA 2Y77A 3V7EA 3L92A 3SC2A 1XK6A 3LP5A 5EE1A 2J7PA 4A6PA 1MB2A 4DIKA 5PNTA 3R4VA 1QG2A 5T57A 3GZ4A 1A9PA 1RJEA 2XUMA 1I6WA 1N8NA 1YE3A 3GGOA 1YCDA 1C8KA 2ZYTX 3NYQA 2F4VB 4RORA 4C4XA 4TUYB 4M0PA 4G4IA 1WS6A 2XTZA 2GXAA 2WFZA 2YJNA 3H1TA 4UUPA 3SZUA 4I1IA 1C3JA 3UUEA 5BUCA 3L9XA 3OMNB 1XLVA 1KI6B 3FYCA 4TZTA 4KU4A 1DARA 1ZD2P 1UAYA 2HQSA 1DZIA 1BRTA 2P0EA 3MHSC 4HH3C 4QJ4A 5DXJA 5SV2A 1IN8A 1E8NA 1ZH4A 4UBLA 1GEEA 3D8NA 1JMKC 1Z82A 2IXBA 1AG9A 2YW2A 4AZSA 2CMGA 4JJGA 4E5NA 1RZUA 1T5HX 1ZKDA 3HEMA 4N03A 4BOYA 4BX2A 1RHKA 1KS9A 3BGSA 2EIHA 1FX0A 3FDXA 1GUDA 4FMBB 4MEJA 4AAYA 5DH9A 3EDMA 3KDAA 4DILA 4WF9V 2JJMA 5FJJA 3IDOA 1EK6A 1YZLA 2JIDA 3I01M 3QWAA 1OHHA 3G17A 4LW8A 3TD6A 3OX2A 3Q5DA 3WYDA 1DBSA 1TA8A 3TXQA 2XPCA 4NBVA 4CQMD 3IFSA 3PQ4A 2I6SA 3G2HA 1JTFA 1DKOA 3THYB 1XDWA 1HDRA 1UZMA 1W47A 1WQ3A 2NYRA 3Q3GE 4MVJH 3SDBA 1KQPA 4HP8A 3LECA 1WU7A 1UBGA 3SM9A 3SJUA 4AC9A 3PGLA 2PEYA 3GJ6A 2X7RB 2PWYA 2H1IA 3ZE6A 2Z6QA 2MSNA 2IJJA 3KRTA 4OMFG 5CJJA 1BE6A 1S4QA 3SJQC 3VNSA 3H86A 3OX3A 2CLSA 3PX7A 1JU4A 4J49A 2Z2YA 1WJZA 5KZMB 3D43A 2HR1A 1PYGA 4LJKA 5LU9A 4XM2A 2X1HA 4RZSA 4YRZA 2QP3A 1Q16A 1L7BA 3PXAA 1H7MA 2V7UA 4XTRA 5CFMA 2RHWA 3R7SA 1AUPA 2PWZA 3K08A 2Q5HA 2KMLA 3LDUA 1JLSA 4JMLA 5J5AA 3ZDXB 1XMQO 2IUYA 5HY2A 2Q46A 1QOZA 4DBVO 1TTTA 3S2FA 4INZA 5T4FA 4RULA 4EY6A 1IVNA 2ACEA 2OZKA 2GBLC 2DSTA 2FW8A 3M9LA 2J3HA 5LC1A 1OT3A 5IH3A 5BN4A 2VWGA 4RVUA 3K53A 2P7TC 1SG6A 2HA2A 4UOEA 1SERA 4I9QA 3I12A 2NPIA 5B1BC 2ZRBA 1N2IA 3AL2A 5JDCC 5ITZB 2DYKA 3D6VA 1GDTA 4W5RA 4ZT2A 3WK8A 2HP0B 1VBKA 2P2YA 1QJ4A 4F4JA 4NCBA 2ECOA 1Y3DE 3P45A 4MIEA 2IEZA 1PLJA 4G8CA 5KS2A 5A9GA 3P9NA 3AYZB 3ESXA 4N18A 3NRBA 5IVDA 5TISZ 1CUHA 4LA4A 1WDMA 2ZWVA 3V7WA 1T91A 1GZ6A 3NM4A 1KMIY 1EN4A 1NBHA 3CF4G 4MAAA 1Y8AA 1P9LA 5IDVA 4GI3A 2X8BA 4OBXA 5CTAA 5CH5A 3EASA 3STUA 4DCUA 3VR5H 4I0XB 2B7LA 3DBRB 1JP7A 1R9JA 3H5AA 4YXWA 2OD7A 4PZAA 2WKRA 3MWGA 3E8GA 2JEUA 2VIIA 4XDKA 4HO1X 5BXQC 3BYQA 4QUIA 2HHLA 1Z6XA 1C4WA 2BZ1A 3AP1A 1QHSA 3KUDA 4QGBA 1QE3A 3DSRA 2HADA 2HBQA 3T7SA 1ZUD1 4AWAA 4DIMA 2WSLA 2Y1LA 3OCJA 2I2CA 4IDAA 1EX9A 3ZCSA 2QM3A 3ZCQA 2XZTA