5GONB

Structures of a beta-lactam bridged analogue in complex with tubulin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 169
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5gonB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5gonB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5gonB01
4O2BB 5GONB 5EYPB 5LA6A 4I50B 3N2GA 4TUYA 4X20B 4WBNB 4O4JB 3CB2A 1RQ2A 1JFFA 4M8IA 3HKDA 1FSZA 3JAKB 1TVKB 4I55B 5FNVB 1TUBB 5IYZA 3WGNA 4O2AA 5JVDB 5LOVB 1Z5WA 2RHHA 4U3JB 5CB4B 4O4HA 1RLUA 3VOBA 4IHJB 3RYHB 4ZHQB 3RYCB 3R4VA 4HNAA 4YJ3B 5J2UA 5LP6B 4X1IA 5IJ9B 1SA0B 3JARA 3M8KA 4EB6B 4U39A 1FFXA 2Q1YA 4FFBB 2RHOA 5CA1A 5J2TB 4O4IA 3V3TA 3JAWB 4O4LB 4IIJA 5GONA 5EYPA 3JASA 4X20A 5JH7B 4WBNA 4ZOLA 2R751 5M7EA 5KMGB 2BTOA 1TUBA 5MN6A 3WGKA 5CA0A 5KX5B 3ZBQA 5JVDA 3HKBB 5LOVA 4E6EA 5LXTA 5IJ0B 3RYFA 5LYJB 5MN4A 1W5FA 3M89A 4X1YB 5CB4A 3RYCA 2XKBA 1W5EA 3WGJA 4I4TB 2BTQB 3N2KB 5EIBC 5IJ9A 5EZYB 2R6R1 2VAMA 4EB6A 4F6RA 5ITZB 2VXYA 3ZIDA 4TV9A 4FFBA 2RHLA 5JCOC 5JQGB 3C8LA 3JAWA 3E22B 3UT5A 3RYIB 1OFUA 5JH7A 4B46A 1W5AA 3HKEA 4O2BA 4TUYB 4I50A 3JALB 1JFFB 4O4JA 4ZI7B 4EI9A 3JAKA 1TVKA 4I55A 5EIBD 5FNVA 5JCOA 4DRXB 5KX5A 2GVIA 5LP6C 5IJ0A 5LYJA 2Q1XA 3JATB 4TV8B 2VAPA 4U3JA 4B45A 5C8YB 4IHJA 2BTQA 3N2KA 3RYHA 4ZHQA 4YJ3A 5EZYA 4X1IB 5LP6A 1W5BA 4DXDA 5ITZA 4X1KB 3JARB 1SA0A 4LNUB 3VPAA 1FFXB 3HKCB 1Z5VA 3VO8A 5J2TA 3WGLA 4YJ2B 3RYIA 5BMVB 4XCQA 2RHJA 4O4LA 3JASB 4ZOLB 5LA6B 3JALA 3N2GB 4ZI7A 2XKAA 5KMGA 1RQ7A 1W59A 3HKDB 4DRXA 5CA0B 5IYZB 4EI8A 3HKBA 4O2AB 1W581 5LXTB 3RB8A 3RYFB 3JATA 4KWEA 4TV8A 4X1YA 3VOAA 5C8YA 2VAWA 4O4HB 4I4TA 4X1KA 4HNAB 3ZBPA 5J2UB 4LNUA 4F6RB 3VO9A 4TV9B 3HKCA 4EI7A 5MN5A 3WGMA 5JQGA 4YJ2A 5BMVA 5CA1B 3UT5B 4O4IB 3E22A 3HKEB 4IIJB
chains in the Genus database with same CATH superfamily
3ZHQA 4ER5A 1Y9EA 4YI5A 3IV9A 1J97A 3CPQA 3AXTA 2Z1NA 3TLAA 3G3EA 2XGJA 2IS1A 4HZGA 4E94A 3EOAI 4XDZA 2YC2C 4GFDA 3PCXA 3HHPA 2P0YA 4QUHA 3K12A 1A97A 1K5QA 5EMLA 2BFPA 5LLSA 3K5MA 2AYXA 1KK2A 5AK3A 3USZA 5L95A 2YIJA 5DBFA 5F64A 1NM5C 2WD7A 3NOVA 5B1DA 5K0JA 2XUHA 4F91B 2HLDG 1E9VA 2RONA 3I8SA 4CEIA 2VHYA 2MMGA 2PT9A 1SC6A 1WB9A 3G7SA 4TQDA 1Q1AA 5T5QA 1IJEA 1T6ZA 5I8PA 1S2OA 5CX1A 4UC0A 1FMTA 1P2FA 3ZV4A 3QIVA 3NVDA 1K5DA 5HOEA 1GHTA 5CK4A 3NOQA 3ESXA 4M1SA 2FXIA 3DXRA 4IJWA 2QX9A 2EV9A 2BSKB 2YXLA 1D9ZA 3G0BA 1PSZA 3T61A 2NW6A 1X92A 1ZAUA 3EQ7A 3O8NA 1L5WA 3FNIA 4EDFA 1EZ4A 2WMOB 3DDHA 3CPWU 2ZETA 1ONIA 2L17A 4RYDA 4ZZ1A 2FPWA 2HO4A 3HPLC 3DBVO 3WO1A 4MUIA 2ZUCA 4KKVA 4S1VA 2AR9A 4MI9A 1AQNA 1E7QA 1U4OA 1XHLA 3UAXA 2O3UA 3CVYA 2CE2X 4L5JA 4ARBA 3KJJA 4HFJA 1OGJA 4WJZA 2FN9A 1GZHB 1H65A 4MKFA 4BQQA 4QARA 4NZYA 1RTTA 4JJFA 1WX1A 4L0CA 5GQSA 5BXQC 3K03A 1G7CA 1I4OA 1ZISA 1KF0A 2H7VA 1X7YA 3AFHA 4E30A 3L79A 1GZ6A 1T2UA 4IJVA 1L2TA 3E5HA 5EK0A 5GPBA 5AICA 5GZ1A 5JO0A 1DQRA 4YACA 3AR7A 2Q29A 2GCIA 1QKKA 3ZH2A 3KT6A 3G82C 4B0OA 4DZZA 1VL2A 2HU7A 4AECA 3RVSA 4CIDA 2XH8A 4TVSA 3SVTA 5G4KA 1M8JA 3LWPC 3GAZA 2AMJA 3WJ7A 3QYPA 1FYEA 5ALDA 2BJVA 4C0LA 4PICA 3JSLA 3EYAA 1HNXO 1W0JA 3AH8A 4WIAA 5JALA 3WGJA 2F3SA 3SR3A 1N57A 5ESDA 1YC5A 4F97A 2IG8A 5JQGB 4J1TC 4FM1A 3ZJVA 1W36D 2OMKA 4BX9A 3K0KA 1CRLA 1QH9A 2O2GA 3EVNA 3UXHA 5KNCD 2JKYA 3GLIE 2PYDA 2CLFB 1YB6A 3CCLF 2WAOA 4HQFA 1RR6A 1C9YA 4M0PA 2HVJC 3NHAA 2VJKA 2LBWA 4WWHA 2NU7B 3TMAA 3LPCA 1EJ0A 2VSXA 2UZAA 2BE9A 4DR7O 4D97A 2RIRA 4V2UA 4JT8A 1I2ZA 3LKVA 3KEOA 1WMAA 4MW2A 2XITA 4FGWA 1JFRA 4JI1O 1G4UR 3N86A 3S40A 3IPRA 1VIYA 2IZZA 2G08A 2QI9F 5JH7B 4B71A 4O4IF 3KR1A 1US6A 2V4DA 4LFCO 1BGVA 3FCSB 1RQLA 2C4MA 4DR2B 5GVSA 3UAVA 1V48A 2DR2A 1FTQA 1ROPA 4ABMA 1GO2A 2C96A 1ZHFA 1NRWA 1YB5A 1SVWA 1P81A 5IK2A 3K1AB 2N75A 1MB3A 4OOEA 4TMKA 3U4QA 2EWWA 3ZP4A 4PR3A 1FQKA 1JWBB 1UBLS 1MA0A 4NYMQ 3O92A 4MR8B 1QG4A 4Z7QB 4Z1MA 2CDBA 3AGPA 5LQRA 3B9PA 1OU0A 2IH3C 4IM7A 4AL4A 1TM3E 2A0UA 5H80A 2EP7A 4PS0A 3SE0A 1T5SA 1NUUA 3I9OA 4J0KA 4XVQA 4CFZA 3P3NA 3CZ5A 2VJQA 1T8PA 1I4WA 4TSFD 4H4EA 3A06A 4G9GA 4PQFA 2N1MA 2CLDX 3VI6A 1OU4A 1J8FA 1VI2A 3QUQA 4LDZA 1X3LA 4PHGA 1WB7A 1GPDG 1FRZA 1N2BA 4MLZA 5FEUA 2X5NA 4QNRA 3WFIA 4LRQA 2MSNA 4E31A 1V54B 8LDHA 3GU3A 1IBCA 2D8AA 1Z5OA 3K0CC 3DPSA 4IIXA 1W581 1Q16A 5CVCA 2OZVA 1V9LA 2QTVA 3A0HZ 3V7QA 4IDBA 1SOAA 4NIMA 2ZEJA 1C4WA 3K5PA 4F5EA 4KAJA 4HLQB 3D0RA 4FGUA 1J6UA 1SBNE 3U49A 2FPSA 1VQ5V 3CVWA 4NPCA 2Y0PA 1AZTA 1F6WA 5CFNA 4I08A 5AT1A 4D8UA 5KOJB 1GGKA 2EQBA 4IG4A 3AJDA 4XJTA 3PS9A 2XHZA 3U40A 2HI0A 4Z4CA 1IYZA 1JB1A 3WO0A 3TAXA 4DWVA 5BNZA 1WEKA 2E4WA 3N07A 5JMPA 2XSZD 1EGVB 2P6NA 3THXA 2NO5A 2ILTA 2RH4A 5CH5A 3QUSA 1S3FA 3DEFA 4G9BA 1LJLA 4OPMA 4P3PA 4J76A 4M6WB 4WLOA 3ZXIA 1PU2A 3WRYC 5DTQA 3AG2B 3D7NA 3GVCA 2YIBA 1K75A 3QY0A 4LHWA 1W9MA 4AJJA 2VYCA 4J2HA 2HA4A 4GLOA 4MWTA 1MO3A 3ZTTA 4DM4A 3Q4HB 3CX8A 2F1RA 3D1JA 1A5AB 3ZIUA 2CV0A 2IUYA 1FUEA 2P7IA 2GHRA 5J2UA 5IJ9B 1ZMXA 2J41A 4FFBB 3EH2A 2O3SA 1P72A 3E8BA 3S0YA 2OCCB 1PZXA 4QYTA 5JLJA 4UBOA 1W5FA 1ULZA 3RU3A 2L0XA 2QXUA 3F74A 3N2LA 2DFDA 3B2EA 4IGIA 1BVUA 1UJBA 1H38A 3DTUB 2WLHA 4B7KA 1IONA 3ROPA 1CZOA 4KRFA 2Q9LA 3H2HA 1XDSA 5A4JA 3ZRVA 2VR1A 4P98A 4K81B 4G1BA 1FK8A 4I1OA 3PPWA 2XF2A 4P0PB 5ALUA 3QTBA 5CNJA 3QUAA 4P84A 2X0RA 4OBXA 3OMAB 3KSUA 2WLLA 1I14A 2YHAA 3BE4A 1OAKA 5EESA 2QTPA 5F21A 5TVKA 3OY2A 4RPKA 3HH8A 2BOCC 1YE5A 1VQKV 2QUHA 4XWGA 3NGMA 2WAXA 2YV5A 2ACWA 2GD2A 6GPBA 1SKYE 1VARA 2QBYA 1GTZA 2YDXA 1E2GA 1V3TA 4QTUB 1OHHG 1W94A 3L4KA 5HFAA 2BM9A 4FM0A 4YCLA 3UAGA 2IU4A 2KLBA 4CLHA 1C1HA 3IMPA 4KUGA 3C9UA 2BWJA 4DV1O 2D8MA 1I0LA 1IZYA 1PDOA 2P6OA 5L3RA 2EGGA 3BE6A 2OBYA 4FFMA 1AK9A 1BE3H 3L1VA 2QTZA 2F9ZC 4NMWA 2X5OA 4ASUA 2FRXA 4RQFA 4O29A 2ZXWB 3W1WA 5KNDA 4TQUS 1E2BA 2YZGA 1IV3A 2H9YA 2WLMA 2B6HA 2QWNB 3ZLBA 3D3WA 5DYGA 5CEFA 5IW8A 3TNJA 1BCCH 4Z86A 3OFSA 4LRXA 5C81A 2PVCA 1JH8A 1B00A 2J67A 5JSZB 1MC4A 3C6BA 1U2ZA 2R7AA 1FUUA 3ERCA 4TKUB 2GPYA 4RW0A 3LE8A 1I80A 1JG7A 1C4XA 4M87A 3DEYX 1W9HA 3TGWA 1TKAA 1XKQA 2NZXA 3OFNG 3UMVA 1JXAA 4X93A 3A3PA 3CUWA 1FXHA 4D79A 3DGEC 1ZD5A 3N8DA 3VSAA 2HSJA 1IY8A 4LXHA 2HJHA 3DZDA 3NW9A 5KX5F 3HJBA 1Z2NX 4NX2A 4MYSA 5CJPA 2YINC 3VU9A 3IEWA 1GDDA 1QE0A 5KA6A 1E3IA 3X2QB 4GSLA 1G7RA 4MJXA 5HY0A 2OO3A 1ZOOA 3L7JA 1Z5PA 4OK6A 1Y6RA 3MIZA 2OT5A 2OG1A 3I9KA 1F6DA 2F1OA 1Q0QA 3U0OA 2XWSA 5EXEA 4CEJA 1EUCB 5F76A 3ZY4A 1P18A 2SCUB 4EVQA 1KI7A 4WFQA 1L7RA 1R6XA 1E9BA 4UBMA 4W6QA 4NYJR 3GNSA 2AN4A 1IDSA 4JBWA 2C9OA 1AKTA 3N59A 1U7UA 1LUAA 1XVAA 1W35A 2ZRFA 4J1NA 3QMPA 1WL8A 4H7HA 2FPXA 2NP7A 5EVJA 1V55B 2WILA 2B8NA 4OKSA 3JU3A 3WP0A 3NV9A 4N12A 3T5CA 1NGSA 3ELUA 1GU7A 2QN3A 3II6X 3R8CA 1MSWD 1AK1A 3BBPA 1JIIA 4I3HA 4EJSB 4UMFA 1ZA1A 4IIYA 5EIOA 2W98A 2UVQA 2XMQA 4Q3DA 2ZUDA 4CM1A 3DD1A 4MMZB 5KTNA 2P9QA 4OOFA 3MRVA 3VJMA 3U0VA 1QF7A 1B14A 2PHZA 1L5HB 3AU8A 2WUDA 3R9WA 4LNUA 4ZCQA 2IF2A 5AJUA 1UR5A 3K1ZA 4JHLA 3CCJF 4WSOA 2JFGA 2O3QA 3JAKB 3OQJA 1I8TA 4NULA 4HS9A 4JI6O 2W8BB 3T5BA 2ECKA 2FG5A 1DC5A 1DG9A 4B08A 3L1IA 4LRYA 4UDXX 3VH4A 3HXPA 5DNCA 1E3MA 4W9MC 1PTJA 1O8BA 4BX2A 4Q1AA 2I4TA 4XM1A 2JFOA 5J59A 2P4KA 5LKAA 4LZNA 4BZWA 3GX1A 5L7YA 5ICGA 1FNKA 4NCAA 1INLA 4OXKA 1TZ2A 1TYAE 1VYHA 1EM8A 3BORA 4TTQA 1JMKC 3TCKA 4EQ6A 1LPPA 1SC9A 2AOUA 2HS3A 2QRJA 4MS1A 2FPPA 4MUFA 4Z4HA 4HEQA 3ORFA 1TGOA 4P6VF 3IQHX 1WBJB 2ZRJA 1EJBA 3P10A 3CO0S 5E3IA 4AT1A 1PW7A 1COWD 2OPHA 1TQ8A 3FAZA 1W73A 1ST2A 2DWEC 4H18A 4O5AA 5BVGA 4IMRA 2A92A 4XJXA 4QREA 4WOJA 3D8TA 3CMCO 4X3PA 3HKDA 3UMGA 2Y0IA 3L8DA 3AR6A 2ZBEA 2HMAA 3W7VA 1PWXA 2B4AA 1P0MA 1QIDA 4HG2A 3JZMA 1KYIA 4Q20A 1NQXA 2YVLA 6AT1A 2IHUA 1QYDA 3HL0A 3A05A 2JFXA 2NZJA 2EU8A 3IP8A 3J7AC 2IZ1A 1PV4A 2XOKA 1Y89A 3IIJA 1PR4A 1KIMA 3FNFA 3NBAA 4K35A 5CBPA 1EUDB 5FV7A 2Q7XA 4P3XA 2BM0A 2LV8A 5I4CA 4FHEA 3BMQB 1CQXA 4BMZA 5A7GA 5LU9A 2CK3G 2Q3CA 4RLSA 1E3WA 3U0BA 3E8GA 2GSMB 2IXAA 3SR2C 2ZI3A 1R3UA 1F4LA 3DDUA 1XP8A 3WQHA 4QFMA 2FDRA 1C7ZA 3I4CA 1ZJJA 1J42A 4YAOA 1EDOA 4M2LA 3A3KA 3ANXA 5JAQA 4DSOA 2X6AA 3O4RA 1K86A 3TQHA 4P32A 2PUCA 4EW2A 2ZUWA 2AZ0A 4G5GA 1QFSA 5LHIA 4FGZA 3ZZUA 5DM1A 4Q03A 1AVTA 1ETHA 1HEIA 3AEXA 5KLVH 3RIYA 1GJRA 2OUIA 2YY6A 4HZIA 6ABPA 2JNWA 1J90A 3FSEA 1V43A 1XJCA 3TJMA 4ARIA 1DKQA 4YPFA 4LX8A 1ISJA 1G4YB 2FF5A 3SYPA 4BNDA 1T3GA 1W0JG 5FOTA 1XZDA 1PG5A 3CG0A 4AJNA 3M2PA 3PEFA 4L28A 5J47A 1EXNA 2ETVA 4P3OA 1NMEA 2I3DA 1P0QA 1ZU4A 3PZRA 2OCKA 1RM0A 5IT5A 4BUJA 4Z1VA 3ECSA 4B3GA 3WMEA 1WXQA 5AW1A 3U7FB 5KQGA 1B6RA 4LSZA 1YH3A 1E0DA 1NBAA 2QZZA 1UK9A 4TSKA 3TRKA 1O9HA 1PT5A 3WZLA 4L5YA 1XDUA 3ZY3A 4GBJA 3CLSD 4PA6A 1ORWA 5D3KA 1II0A 3GWOA 2GO7A 2QRZA 2VDVE 4I4CA 1CUZA 1DOAA 4DR4O 2XOXA 3EA0A 1QGED 3EPPA 5FNVA 1XR3A 2G17A 3SDLA 1S1CA 1XBIA 1QDEA 5CXXA 5EKDA 4L6IA 2P9TA 2W2TA 3KQHA 1HW7A 2EC5A 4IQ8A 1OT3A 4M9SA 3ZJ5A 2C1ZA 2P2YA 4XQ0A 5AQ1A 4PLGA 4FMDB 2WHPB 2AZ2A 1RRMA 4GL4A 4A23A 2BFFA 3ABSB 1BYUA 1HR0B 5HP4A 2DWOA 1PEAA 4QVIA 3ETCA 3T99A 4ZAXA 5DNYB 4BN5A 2QJOA 3JQQA 1TZCA 4LE2A 4DADA 1RQPA 1WZUA 2I2DA 2MJLA 3Q3CA 4GX5A 2QQEA 1IFXA 1KBZA 5JASA 3I0ZA 2VQ6A 3JXEA 1EVJA 1R0LA 4AY5A 4PLZA 4YO8A 3QW2A 2VF5X 2REXB 2WF6A 1H93A 3F0GA 1XCMA 1BW9A 4EYSA 4LVNA 3TO5A 1C3VA 4M0CA 4RK4A 1YXMA 2WWFA 2Z83A 3O1JC 5TC4A 3AM1A 3F6CA 3OFKA 4B3JA 1DEKA 3OZGA 3UAOA 4Y30A 3M1LA 4PPFA 4AJOA 1AJEA 4M8NE 5KVCA 3QPBA 4R71A 1WM1A 3WQRA 4W5OA 4FFDA 1QHIA 4R41A 2BONA 5DFAA 4JYAO 1KZ6A 1M9NA 3P9CA 5HKOA 2CXRA 5AKZA 4H7FA 4WINA 4O59O 4YMUA 2B1IA 3HM9A 3PK0A 5DMHA 3VH1A 4AURA 4MUKA 1RWVA 3SP1A 5EYPB 1QLJA 4JAAA 4CLEA 3IAHA 2J85A 1E9DA 3CYPB 1V3UA 3BD6A 3ZQKA 3V2IA 1UPCA 4ZHQB 3BABA 4K88A 2PD6A 5IZCA 1X1SA 3SKYA 4ENVA 1G5QA 3AOGA 5CA1F 3VYRB 3AK2A 3U4IA 4Q82A 2GTHA 1NFFA 1BQEA 5KWVA 1NDQA 3S4YA 5T67A 4EEQA 4U6NA 2ZYUX 3QEMB 4QX6A 4R9UC 2PIDA 5J4YA 2JA1A 2A6PA 2Y9PB 5JCOA 1WVIA 4JA0A 5I8WA 2PIAA 3L9XA 3H6HA 1NTRA 3KLNA 4PN3A 3IIEA 3LFUA 5BV0A 1B3RA 8OHMA 1N5JA 2JCVA 4IO0A 4RIHA 2QL7A 4FZ5A 1BJTA 1J0EA 1PJRA 4C4ZA 4YT4A 3RHFA 4RO2A 4WLVA 1P4HA 2GO1A 2R9AA 4Q39A 1G60A 4NTZA 5AVZA 1MCZA 4ZK2A 1GG2A 1BXRB 1HRKA 4TGLA 4JVLA 4BUZA 2JRIA 3FTEA 4QRDA 4LDRA 5KYWB 3QVUA 1ZC4A 4JENA 2MINA 1SC5B 3BMOA 3QY9A 4S12A 5LQJA 3R6TA 3ICXA 1SDSA 2CF6A 2X7HA 4QWWA 1I13A 4GOLD 5IDQA 1IHDA 3G71V 1VSVA 2HJDA 3EFFK 3RAGA 1W5SA 3H1BA 4XH9B 3I34X 5FHRA 1VTKA 5EUCA 4N76A 1UXHA 1GAQA 1SUPA 2I6SA 221PA 3KQMA 4GAEA 3QWHA 4UZEA 2VZ0A 4Q9HA 3HRKA 3QU5A 3RIMA 2XA1A 5C9ZA 2G70A 5CDUA 1KEWA 1U2PA 4PHHA 4MXDA 4TUYF 3DHEA 3PNSA 4A92A 1M0EA 1M10A 5L53A 4MS4B 2CHGA 3J81A 1QVZA 4HWOA 1RQGA 4PAMA 1J1ZA 1VQPV 4WK0B 4LHSA 2YFKA 1H1LB 3EVAA 1JKJA 2HLDA 1L0LH 4P4GA 3CISA 1OF1A 1EQ2A 2AD5A 3A27A 2Q6OA 3N7UA 1NVXQ 2BKEA 4FONA 1KK3A 2D0IA 3RQIA 2F4NA 5LOVA 2AMYA 3A9VA 1GRVA 1C3OA 3O9MA 4P2BA 2RB9A 8ATCA 4ABYA 1OTXA 1YJ8A 4J0QA 3FTNA 2I8CA 5BPFA 2IF0A 1P3DA 5IH7A 2VRCD 4CKXA 3D5EA 3QBDA 5JSKA 3SDSA 4DEXA 1NX6A 2OLEA 5L3VA 4TTPA 4H17A 1WUHS 4I0XA 4B4UA 2ON6A 2F9FA 2QUIA 1X7ZB 1KJZA 4NENA 5K8UA 5BNWA 1JA1A 1MNAA 1CCWA 1TLLA 3KSZO 4ASUG 1HDIA 2PWPA 4LHZA 1M1YA 3NTRA 3KIZA 2XUDA 2WJJA 2B21A 5BQOA 5IEBA 4HDQB 3I9JA 5HUHA 2WE8A 2H31A 4KFMA 3RJTA 4GSYA 3UGJA 4Z2AA 3HWWA 3H9VA 2RK6A 2CE4A 1RRPA 1DF4A 4MK4A 1XA0A 3P26A 1CJUC 3GK3A 2OVFA 1K1EA 1QG0A 2LCIA 1ELOA 2FNAA 2QD3A 5SZJA 4YMVA 3VKUA 3RT9A 4O8ZA 3P9YA 1E2EA 4UAGA 1ISFA 4I8IA 4X3MA 5HCUA 1GYPA 3D3KA 1Y1TA 3DMNA 2GTSA 1ZMRA 4I5DA 3D31A 1H6AA 1CUCA 2YWHA 3Q1KA 5I7HA 4LE1A 1T43A 2DY1A 4G1CA 3HADA 1BS1A 4X61A 4PYMA 2OLJA 3H9BA 4TV9B 4LV8B 1RPTA 5JANA 4X00A 1ODFA 4FT4A 1AGYA 4RMGA 2QM8A 1KAGA 4IWXA 2QX4A 3JD3A 3GDFA 4CIVA 3Q3IA 2KTUA 2J6HA 5T57A 2X23A 4HFRA 4L0DA 1U3WA 5IKPA 3CW2A 2R1TB 1YMVA 4WJKB 5FPOA 1E1QD 1RHRA 1EP3B 2JFWA 1AF7A 1L7MA 2PZ8A 3F5WC 3X2EA 3ZCQA 3DJFA 1WDMA 3WXMA 2BEUA 3E03A 1N3YA 4TN5A 4HDNA 2VVTA 5TGDA 2QTHA 3ZVNA 2Q1SA 3NXKA 1RI2A 2CBGA 3FSRA 4ZRDA 3D4IA 3QG1A 1QTRA 3RRNA 4B48A 4A2CA 4A0HA 2A14A 2LNDA 2RJ3A 4DRXA 1RXYA 3I30X 1U8YA 1E4VA 4M0MA 3ZK8A 3CGGA 2CHFA 2I87A 1JEEA 2DUJA 2NSHA 1JJIA 1YZFA 2C3YA 2ZJ0A 1OTYA 3U26A 4EY3A 3DB1A 2HC9A 2RI1A 4MAMA 3PC3A 4BT7A 3F7NA 4HSGA 3PFCA 4N54A 2YUIA 3RSOA 3QO8A 1NMQA 4TZ0A 3KNZA 3VHLB 4B9EA 3ZCVA 3V7WA 3TKLA 1CQZA 5BMOA 2VWJA 1WZEA 4ZPJA 5K1ZA 3ZCTA 1TF2A 1MRNA 3HEAA 2YWCA 2Q3JA 5JNTA 4U2KA 3D3QA 3K6SA 1E6CA 4MQEB 5F9FA 4C8GA 5IZ4A 1C9EA 4RFLA 1RADA 2CVQA 1F4NA 2VUTA 5DSTA 4YAGA 1V41E 4JA2A 4ATNA 1WSWA 4I2VA 2OAEA 5DXFA 2A94A 4PSAA 4KSCA 5KS2A 5KUTA 5B58T 1YZGA 5E1AC 2L82A 5B3LA 4X5OA 3PHIA 3DTVB 3L0YA 3H4VA 4PYIA 2PUAA 3FHJA 3GGGA 3VFDA 2WWXA 3GFGA 1EK2A 4PWYA 4UU1A 1R4NA 2MSEB 1KAMA 1U8CB 2JH3A 3W1VA 3DA8A 4Q1BA 3ZGNA 4CXMA 2WSIA 5FH9A 4C0AC 4QXQA 2F43A 3G85A 2G6TA 5TY0A 2DHRA 3PPVA 3CC2F 3UFXA 4RAIA 3MWLA 1XRPA 1ODIA 2CUNA 2G0TA 3NOOA 3JD4A 2GHQA 3VTIC 3VO1A 3RRBA 4OGFA 2NLJC 2A3QA 4YQZA 1CY2A 4N0DA 3GVHA 4YLEA 3WDMA 2VPZA 2D7JA 3MWJA 4A91A 5K2OA 4V1CA 1N6KA 2XOKG 1E32A 3D02A 1ZH8A 3S06A 3KC2A 2EFEB 4EHJA 4JFAA 2W9XA 3UCEA 1YJWF 2ZR7A 1SRQA 3QX3A 3GBPA 5DM4A 3AG3C 4G0XA 3IUEA 1UDRA 5JMWA 4EY7A 5ESRA 4IDQA 4OP2A 1KDVA 3H4IA 5IRCD 4FP9A 2NPOA 1G5RA 1KSJA 2Z2JA 3A6KA 4E4EA 1GNPA 2XWBF 3K9QO 1P5RA 2CB0A 1E0JA 2ZPAA 1AKEA 4R7GA 1Y3IA 3UMRA 4M21A 4AY6A 3L7IA 3JALB 4NXMB 1H1TA 2Y8EA 5CFRA 1JQLB 2YMLA 3L7BA 2ZWVA 2DSTA 3H1GA 4FQ5A 2FE1A 2OTJF 4A0SA 1YJAA 5COAA 4JX9A 4CT0A 5A03A 4KZKA 2QQGA 1M1YE 1TD9A 4KIFA 1BKYA 5IAGA 1YI2V 1Q6YA 3GXBA 4Q7EA 2G3YA 5IBRA 3SFVA 4CETA 3I3FA 3OLWA 2QVZX 5I5EA 4IH1A 3U9SA 1AN9A 3C90A 2Z8ZA 1Q8IA 1VF5B 2FZ5A 1ZSPA 4CS4A 1DBQA 4ED9A 3O4GA 1NLMA 4LQLA 3PU6A 3ZCXA 5IAEA 4XWOA 2LQTA 4MVRA 3UKJA 1Q0TA 1HE2A 4CCYB 4YAIA 4EM6A 3HKBB 4CMGA 5F5NA 3RYFA 2Q0AA 4HTFB 3SYTA 2BZ0A 2NSLA 3TLCA 3D0KA 3L93A 1QFJA 4HNVA 3ZRWA 5EJ9A 3D4BA 3L41A 4CG2A 4TS4A 2JK5C 3OD5A 2DECA 5IFKA 3PA8A 4M86A 1W4LA 4WFBV 4F46A 3DOOA 2A0LA 2IYXA 1T5IA 2Q5JA 4I5GA 4FIZA 5CA0B 1ORIA 3PTAA 4PLFA 3LS2A 2X42A 3L6DA 1KZ4A 5LGNA 4GOKA 4C7UA 4C5AA 1KNJA 3UMYA 3Q72A 5HIKA 3D4PA 5AKXA 1ORRA 2YWEA 3H5IA 1HDEA 1NW8A 3M1IA 3IBTA 2TMYA 4QUJA 1GM5A 4MTGA 2FMIA 4TYYA 4MYUA 1OYYA 2W93A 2NN3C 2FQ1A 1ECLA 3ZYCA 2CAZC 4FVTA 3HFSA 4B6OA 521PA 3DYIA 2ZE8A 4AG5A 4KPUA 3I73A 5C3UA 1QNLA 4QOJA 4HRAA 3RVRA 6LDHA 3ISJA 3HR4A 2QSUA 1K7YA 3R7DA 4CR7A 2BMFA 4FYIA 1Z7GA 4XR4A 3LYBA 4HUQB 1H66A 4K28A 3OFNA 1JBEA 3VR2D 3BQMB 3EARA 1J99A 1X7PA 3FKQA 3TZLA 2PRKA 1E2HA 8GPBA 2BIFA 2Q3EA 1S3IA 5NULA 4CQLB 2CDRA 2KX7A 1EVZA 5JI2E 4MUEA 3V1LA 5LZ8A 4PLPA 3E7FA 4B3MO 2A06H 3L8HA 4M7PA 4LGMA 3I0MA 4K9PA 4FPXA 4LDPA 4HPWA 1XNRO 2JARA 3BC1A 1U11A 4J75A 4FYPA 2WTUA 4X65O 4E2LA 1KI1A 4WZBB 1NLZA 1A9OA 2W4IA 2IYLD 3IUBA 3LCUA 1GSOA 3ND8A 4LZJA 4OQMA 5BNTA 4XB1A 1XB2A 1DOZA 1OX4B 1THZA 1E2MA 2JD0A 3RSHA 3ZWYA 1W44A 4W5RA 5CGQB 2G4CA 1L1QA 1B76A 3JATA 3G89A 1T2AA 2ZODA 2DT8A 3CNEA 2VSNA 1CIJA 1ZW1A 4OB7A 5AW0A 1Z56C 1S7GA 3DAPA 4G3XA 1QAHA 1X2BA 4JWTA 1R12A 3ND5A 1H9BA 5DCVA 5BR4A 5E6UB 3R3HA 5CNMA 2ZYGA 3DOCA 4XRRA 3AG1B 3L6BA 3BXEA 1EXMA 2BEVB 1YJ9F 1SUDA 2YV3A 1LRLA 3CRNA 3MB8A 1EDZA 1VMIA 3GRZA 5F2NA 5JT1A 2W70A 3A1SA 1O4VA 5L3FA 1N2IA 2VS0A 1XTIA 3FSGD 2OBNA 3K4PA 4TL9A 2ZP1A 2D3TA 2VF8A 3D6MA 1MVLA 3BVOA 2FUG6 1SVOA 2VAPA 1KARA 1PJBA 1DRJA 1ICEA 4FMPA 2I2AA 4LV5B 5JS6A 5K0LA 5K09A 1NXXA 2I4RA 1GNRA 4WVLA 1JQBA 2LIVA 2V3VA 4Y1EA 2NZUG 1K34A 2R7MA 4HQKA 3QWIA 4B74A 2ZAIA 4EW3A 1ZCFA 3PLNA 3BE8A 4EO7A 3FBGA 3L82B 2BSAA 2PLFA 1QO9A 2O2HA 1O8CA 4CU2A 3L0CA 5K8LA 3MGGA 4HDSB 3LNMB 2D1FA 2GZMA 5AKYA 2RKBA 2J3LA 2VEOA 4CI0B 1ICIA 1HF3A 1Q7TA 2QL5A 1WZIA 3ZIDA 3HU5A 4C3OB 3A6GA 1C1DB 1OQAA 1ZSYA 2OB2A 1ML4A 1CHNA 4LOKA 2C8VA 4Z7OB 1R0CA 4N5DA 5EMNA 1ZPDA 5D8DA 2VJOA 2VP4A 3FDXA 1C7IA 1XD2B 4UNIA 3APQA 4D99A 5HQTA 5KJFA 3ASZA 1D2RA 1F2UB 2VPTA 3MWEA 2M6RA 1XHFA 5BQPA 2BMAA 4EGAA 2QY9A 3TJZA 1FJ2A 2W4QA 4MULA 1H8HD 3L43A 5KPJA 4G1VA 4QNMA 2LPMA 2TMDA 4J42A 2OXRA 3HN2A 2VJYA 4GKAA 5KOHB 4NBVA 3DDZX 3MJTA 1I7LA 2CK3A 2LDXA 4LFAO 2XVAA 1LLFA 3NKVA 4YRGA 3KVRA 3WK9A 5JYCA 3FM9A 4DCVA 4MCAA 1ENZA 4XGIA 3QBVA 4G63A 3TW6A 2XR1A 2JZNA 5LQNA 3PNLA 5E4FA 4YRRA 2QD2A 4JBLA 1PJ8A 5AVKA 4RL4A 5AOBA 3IBSA 3S1AB 2HPVA 1TMYA 2WFAA 3PUXA 2ASEA 3SPCA 1CK4A 2BVNA 2YRFA 3F0DA 2PJDA 2OKGA 4D2IA 3PFKA 2E85A 2X1VA 1BE1A 2PZLA 4JV5O 2C77A 3ZHYA 4O4IB 3ENVA 4OD0A 4E2YA 3MRSA 3OPMA 4ARVA 4KW7A 3TW4A 5BP7A 1DTWA 1H0SA 1KAEA 3H5TA 2DHDA 4X41A 2GFQA 4MWGA 2EJVA 1ZUNA 1V47A 5JVDA 2G40A 2XCOA 1I7DA 3EBOA 4DARA 5A2GA 2HJSA 1EKXA 1E2FA 1HNWO 2J3QA 2QG4A 1KNQA 3I8OA 4R8VA 4OAPA 2NTVA 2Q4TA 3RAJA 2FG7C 1TU3A 4WAUA 4A8HA 4NF2A 4ERXA 3MUOA 3GCWA 5CLIA 1A4XA 3QIAA 2DEUA 4AKHA 5MFPA 3IQDB 9MHTA 2IYNA 4KIUA 4KE6A 4WHMA 5AOVA 2C3OA 2KG4A 1F7YA 1SRYA 4BE4A 4A27A 2N05A 2Y0CA 1Q5OA 3REOA 3CHXA 5IVPA 4PQEA 4EF6A 3EZ2A 2RAFA 1T0AA 2WJ6A 1C4KA 2CGNA 2XQJA 3AUAA 5GZ6A 1UBRS 3E4DA 4ZA2A 3BHMA 1SMKA 2MYNA 3OM1A 3KR9A 2OQ2A 4ER6A 1F60A 9ABPA 1P7CA 1SUEA 4U2CA 3TE7A 3SF8A 4LYGA 3FUUA 2B78A 2I0FA 3AP2A 2WQ7A 3OZWA 3GFPA 4FN4A 4O2LA 1Y4AE 3PFHA 4ILEA 4CF7A 5FBRB 3I39X 3KKLA 5E2IA 4COOA 4NQZA 3FR7A 2HV9A 2BMDA 2VK1A 3A28A 5HTOA 1P4GA 3UHPA 5A0TA 4MWEA 4B3BA 3CRCA 1L3IA 5D3MA 5EIWA 3TQIA 3H1JH 4AI6A 2OIGA 2J09A 2HNAA 4CV2A 5G1NA 4FM9A 1XI2A 1HTTA 3J80A 2EW2A 4URUR 1OFGA 2BUAA 1PIWA 2HT1A 1I7NA 3HVJA 1ZICA 2VQEO 4RD0A 2FSFA 3LX4A 4LJ7A 4NY1A 3K73O 3FBTA 2W0SA 3KZMA 3GRRA 4PGHA 2A8YA 1RC8A 4R1OA 1I30A 1LUWA 2EJWA 4N47A 5FYDA 3OM3B 2IP1A 1J7JA 2FSUA 1G1MA 1ZK1A 4GZMA 2QHXA 1V1MA 2RHRA 4RWZA 4CTKA 1BS2A 3PENA 2FG6C 3EVBA 1E96A 3RRMA 4G56A 3G2MA 1L8QA 4OX9Y 1C50A 4BV3A 2XCRB 5B3AA 3ZE8A 2BTQB 4RACA 2G9VA 5ALLA 3V1KA 1YMUA 2DLDA 5L40A 1FFCA 2R8PA 1EVEA 1URFA 4G0UA 2PH7A 5HNKA 4P80A 2F43G 1WZCA 3CQ9A 1PCXA 2OYCA 3QWBA 3VZCA 2V9CA 5CM9C 5DI3A 2R7NA 1RI3A 3DV0A 1ZIYA 2SECE 4U02A 4ZWNA 3OTGA 4B40A 1YVRA 4CM7A 4NBSA 1FUIA 3B1XA 3JY6A 1T0IA 4W5TA 4PPYA 2ZRAA 1CRQA 2O2DA 2QNBA 3R20A 2WWTA 2ZAUA 1IAVA 3GP8A 3R2JA 1J95A 1YCIA 3C3CA 2YXEA 3DXFA 1AGRA 2OO5A 4A9AA 5DJ5A 2WY2D 1QGOA 2ODEA 3E8XA 4B3TO 3H1LH 3BCCH 1CP2A 3RYCB 2PSDA 4EB6B 5KHAA 1LW7A 2B7BA 4MW6A 1FD9A 3EXFB 3ZP7A 4N6OA 4EECA 3K3WA 3UCFA 1E2PA 3I5YA 4XUCA 2BN4A 1E8DA 4XWAA 5I7FA 1QRUA 4F84A 5EJMA 3C8DA 4GZLA 1NPTO 1REQB 4OXNA 5H4GA 821PA 1YQWA 5KAPA 1DIAA 2C2WA 3EE6A 4CVNA 3RASA 1T9DA 2VK8A 5DEIA 3PI7A 2P0AA 3LDGA 4UCQA 4KR0A 4X63A 3UO8B 2YZNA 4W4LA 1TA9A 2VNSA 1N2JA 3E8SA 1L3BA 3M5CA 4TS1A 1MAHA 2OA0A 1SZXA 2FK7A 4HC4A 4MW0A 4OLBA 4UVGA 4EZEA 4IJ5A 2CWJA 3GFQA 4LZAA 2H3EA 1BCSA 1TTHA 1X59A 5BXZA 4KYTA 3IMKA 3BJRA 1NVTA 4KODA 3V55A 4BMOB 3P27A 2X4GA 4BNJA 3WA7A 3H16A 2EL9A 1M66A 1WABA 2HFKA 2A9JA 2AYYA 4YCMA 3EAQA 4MLDA 5DISB 3MBMA 4PN7A 2OXEA 2GUZA 3LUCA 1Z25A 2VPYA 5E7IA 1LVGA 5CBHA 4U2EA 4QPKA 4F12A 3DC2A 3K1JA 4C2BA 5BN5B 3QVXA 3ZQJA 1QC5B 2XV1A 4BC1A 3G2QA 2JC3A 3PGMA 1QQ7A 2HN9A 3A4IA 4MVJP 1M1NA 3BPSA 2DPXA 1NR7A 4N7BA 3RHSA 3Q8XB 1VECA 1GM7A 1UJ2A 3HYCA 4D8VA 4TTIA 2BHTA 4MQMA 1C2YA 3WIBA 2FWBA 4JI8B 4FW9A 3JVHA 5EHGA 3STYA 1QBGA 5MN6A 2W2LD 5BSRA 3WLIA 5FAKA 5KX5B 2YXYA 3SC2B 5KJCA 4YRBA 2X6QA 3FD6A 4OGWA 4DBVO 2XKBA 4BKQA 3PNQA 4HP8A 2YYEA 4KX5A 2JFBA 3BWVA 2HEPA 2B9ZA 4EMBA 1VQ8V 2Y68A 3TW8B 3RIHA 4YRQA 2ZINA 3RQSA 2BSKA 4DF3A 4D4HA 1PJ3A 1Z6ZA 1QLEB 5TPWB 2XCQA 3WYBA 3TOSA 2RARA 3WAJA 3WHLA 4RK7A 1R9JA 3AL0C 4RA9A 3KJXA 1XE3A 3FRHA 1CUXA 2X9NA 3OF2A 3V00A 5HGXA 3PZBA 1ZD4A 4F72A 1S2IA 1AH2A 1OV9A 5EP3A 2ADQB 2ZAYA 3RH0A 1HSZA 2X5JO 1N6LA 4FWTA 5A4DA 4L3WA 4LX0A 1K6JA 3SBOA 2CLCX 2HRUA 2ZOSA 4CM6A 1SXJD 2YYSA 3TJTA 4X60A 1UFVA 2O06A 3GYGA 3LSYA 4I5EA 3HVIA 2XAJA 2ZZKA 2ZVPX 1PT9A 4NJEB 2JFNA 3E70C 5EIXA 2PMPA 3K70D 1PS8A 5GW7A 3VDXA 2PUDA 1W40A 1KMNA 4JAVA 2JS7A 3LOQA 4OIFA 2FFJA 2G9UA 5BPHA 2XUFA 1ZRSA 3R76A 1JHOA 3AKCA 3THSA 3KWLA 2QRKA 1G6UA 2Q8NA 5FI3A 3GEHA 4FDUA 1DFHA 1YCGA 1P7WA 3EUAA 2WFMA 1JI0A 1JLSA 3O8RA 4KDEA 1GNSA 3ZU2A 1F1JA 4DLKA 4EK9A 4R68A 3V2HA 5E7MA 4DWWA 2QB5A 4ZJUA 4A73A 4ARSA 1UMCB 5LNK6 3ZW9A 5JQGA 2WT8A 3TX6A 4I2NA 4WKGA 3P4UA 5KSPA 3QSYA 4BAUA 3FRIA 4DNFA 1YJ5A 3QJGA 4HNRA 5LZ2A 3DV9A 2C5LA 3TVYA 1S8OA 4RTSA 1JJ2F 4PRYA 1OH8A 2FGYA 5IVDA 4DCJA 2YW2A 1Q81H 2CGEA 1P1FA 1TUBA 3DHNA 4L08A 3LT4A 5EXDA 4U7FA 2AKEA 2QD4A 3M6IA 3G7UA 2UYPA 1ENOA 2QZPA 4MV9A 2A78A 1ZAKA 1C30B 2G5TA 1C41A 4OH7A 1NT4A 3KUDA 2JGJA 4E5PA 3PQ8A 2LVBA 1SR8A 5AJVB 1Q77A 1FNJA 1Q7BA 1ZIOA 2GSDA 3T15A 4HPJB 1Z12A 1VQ1A 2Q5OA 3D8BA 3UAZA 3AY7A 4TYMA 1TC1A 4MW5A 4KITB 3RWOA 3L0BA 4XQGA 4FQ8A 3NIFB 4JHXA 5ITSA 1NZDA 2E82A 1QGUB 2IDZA 5DV9A 2ZG6A 1LPOA 1I3NA 3LFTA 4YWJA 5AKJA 3KEFA 1Y37A 3LDTA 4WZBE 4HZUB 1J49A 4OMFG 5GIPE 4K87A 3E20B 3WFJA 5DASA 1LBSA 3T0FA 3E7PA 2FN7A 3GQVA 1J22A 3CYQA 1GKKA 4MA0A 3UQZA 1KOGA 3GELA 3WKDA 4MR8A 2Y4OA 1QKJA 4NYJQ 2BI7A 4BBAA 1DSSG 3BH7A 1E2UA 4F93B 2ZRQA 3AEUB 5JD6A 1R15A 5B1IA 3EGVA 4HXYA 1D8TA 4J7UA 2UXCB 2AMFA 3EDCA 2ZM6O 1M73E 2CMFA 5F3RA 2B4RO 2DH6A 1WULS 5KHIA 3G68A 4LVCA 1G0NA 3NVIB 1L7DA 1NUPA 3ESQA 3SNKA 3I12A 4B32A 5C35A 2QWXA 2WUGA 4H7KA 5L3SA 2R8EA 3LUDA 3ER8A 2RAPA 5GTIZ 1PNVA 2QF7A 1THTA 3D6JA 3K96A 3K05A 5AW8A 3ELCA 2VLIA 4DV5O 4OJYA 3OKCA 5D00A 4BTLA 4ZYLA 2VPXA 4D44A 3GJ0A 5T4FA 5TGTA 2OEPA 4G1UC 4KIWA 3FFQA 2GRUA 4MUYA 4G5SA 2EHDA 3LYAA 2DQYA 1U9YA 3F71A 4LZWA 1TUEB 3V3TA 4J6FA 3HYTA 1JR3D 3DVLA 4ESVA 1VPDA 5CB4A 3G9UA 2LP7A 4HXFB 3DVQX 1LFDB 2QQFA 3VQXA 4GPZA 1TF7A 1ES9A 3KOUA 1JEOA 2R00A 1JN1A 1I2BA 3QHPA 3CX7A 3Q9LA 3B8HA 4I66A 3FTQA 6NULA 1RRFA 5TVGA 3EZNA 4MA5A 4OYHA 2YR0A 3EXAA 2IH2A 2WWHA 1U98A 5F1PA 5KOJA 2GKGA 3S1LA 4QUBA 3U31A 2GB4A 4RTJA 3HJAA 3OM8A 2ST1A 4ZEWA 3A6DA 5ALJA 4JLWA 5A7HA 4F21A 3ED1A 1GKFA 4QTXA 4H27A 4KQ9A 4AUKA 3KAKA 4CDNA 2AG5A 3E8MA 1H4SA 1FMCA 3FLBA 4BLRA 1RPZA 4IDCA 1W36B 1BROA 3U17A 4LXTA 2GKSA 2J7KA 3CH5A 2IY8A 4M6WA 2ZRDA 3RFFA 3P9IA 1BRTA 4C0QC 2DHEA 3CURA 4LCEA 1T10A 4GOXA 5KWSA 3A31A 3KVNA 2WZQA 2VTDA 4XDYA 1R37A 1XTQA 1L5LA 2R62A 2WFZA 2Y77A 4O5OA 2YZ7A 1JA8A 4GIBA 3U80A 1KZGB 1IJFA 2A79B 1GQYA 5F2EA 3L0ZA 4KXQA 4JQYA 1KWGA 1VH8A 2WKWA 2LP4Y 3TGLA 3D8NA 5AXCA 4MSWC 2OTLF 1NRJB 2HH9A 1YIDA 4L4ZA 2QT0A 3TM5A 4CNBA 3AONB 1YFZA 4MWOA 4AO7A 3QLVA 4INOA 3K92A 2GEFA 2HS4A 4MVUA 2ODPA 3TSYA 3EXG2 2P4UA 4HT3B 2HRYA 3SIPA 4LI0A 4EEKA 2CNKA 2V7EA 3DF9A 1E3JA 3UM9A 4OLAA 2EWMA 1RAAA 3G5LA 4Z49A 3BKWA 4BCBA 2K6GA 3THYB 5J1SB 1XD9A 1RQXA 4S1TA 2R6HA 4L9SA 2PGOA 5CAEA 1T1IA 2O0MA 3OPVA 2JEZA 1TEVA 4EP1A 1PKEA 4K3AA 4N3AA 4JXZA 1VL1A 3G8CA 4O4LF 3CB4A 2VFAA 4RQUA 3D4OA 4OU4A 3VYVA 2FEMA 1P73A 4ZMRA 1U8ZA 3KUUA 4WD3A 3OOSA 1QK5A 1Z7BA 1SERA 5EZQA 3GHZA 2Q5ZA 4YDHB 2B92A 2IPAB 1CU1A 3PDJA 1IM5A 3AFMA 5KYVA 3TEJA 3KLBA 4FLFA 2W2QA 3GFOA 3VDQA 1M1KW 1GRJA 2FE4A 5CA1B 3H84A 4DS3A 1KMIZ 3M5WA 2P8SA 1EK0A 4GYWA 5B7GA 4X6XA 1UKBA 4OXIA 2QJTA 2CCGA 1NJ6A 1PDWA 4XGNA 1PBNA 2VWKA 5B2ZA 3X1XA 3GT7A 5LFAA 1C3XA 2A5LA 4ZREA 5TT1A 4DCSA 1T4CB 3GN2A 3V4DA 2HXGA 1Z6GA 3RS9A 5GJCA 4FLYA 2I76A 1K8AW 4D3SA 3F0FA 4LXQA 3CYFA 1FX0B 2IX3A 4R9VA 4MROA 4LHVA 2XUMA 2Q7DA 3O8OA 1JN0A 4JYZA 5KOIA 2Y76A 3CKMA 3P4YA 1P9RA 2HRDA 5JSZA 1Z5VA 5IVKA 1NF8A 1PYOA 1IV2A 3VYTC 5ECWA 3L7YA 1JT9A 3ABMC 2E37A 4EKDA 4WCFB 2DYSB 4ENTA 3AHCA 3M4YA 4RCZA 3U3ZA 2AC2A 4IL6Z 3OC0A 3LY5A 1RQ2A 4ZVVA 1QRSA 5CIYA 2OCHA 4C4WC 2BGUA 3OHPA 2ZPUA 4CUZA 1LGYA 1TXGA 4DC0A 5HE9A 1A3CA 3WR5A 4D6PA 3GUYA 3LBYA 3C2QA 5C8ZA 2HR1A 2YY7A 3EPLA 4OG2A 1XEAA 1HLPA 4C6TB 1IG3A 3DB2A 4ZVTA 1F1BA 4B4DA 1NQVA 3I5DA 3BY6A 2FX3A 4W5QA 4TUYB 1BYIA 2HQRA 1XC7A 1SVUA 2X0JA 3CZMA 3ZWPA 2ZRPA 3BMNB 1OYWA 1XFDA 1HFEL 5EKXA 5CYFA 1YZLA 3AY0A 5EXTA 1OVMA 3USCS 4R9NA 1EUZA 1RI1A 1T9ZA 1I2MA 1TB4A 5LQDA 5ERXA 2O9JA 1WAZA 4XJVA 5AKHA 5B4TA 4AKEA 4R0NA 1XN4A 2ZSFA 1E63A 1K08A 5KQLA 4L4YA 4BMDA 1FP2A 1RXIA 1E0SA 3D6NB 2D2CB 1SD1A 4DKJA 1FFAA 4L4UA 4Y98A 2RHHA 3QSGA 3UUFA 2CHVA 5DTIA 2F66C 4F4CA 4NHOA 2Z09A 4EHLA 2WPNA 1PFKA 5C34B 4IG9A 2ZE5A 3ZWCA 4KQ6A 1IV4A 2C8KA 3KTAB 5JSUA 3O85A 3EZLA 1GPMA 1LLUA 4Y1FA 2GBFA 1T2NA 1N0UA 2A5GA 2Z5GA 3LLCA 2X1MA 1PYGA 2Q2WA 1CR6A 3JAKA 1JE1A 3ZI7A 4N49A 2W8BA 2Q6LA 1F2TB 4KLCA 5AQEA 1U43A 1G7TA 5LJIA 2WJAA 2X58A 1YS2X 2X15A 4MW1A 3R66A 3DMPA 5CLFA 1QVGU 2ZBVA 1BNCA 1N5MA 2W6ID 1QX4A 3IJ4A 1U4SA 4XD7D 2JBAB 5AH0A 2LDBA 4DVJA 1AF4A 4IV5A 1WXXA 3HDTA 4WFFA 1W42A 3PUYA 3H65A 1DBFA 4LXXA 2VQFO 1DAMA 2AJLI 4GQAA 4PTZA 2AMVA 3IVGA 3KL4A 1Q6IA 4FDAA 1I7SB 4BLWA 5FULA 4BPRA 1N6HA 5GONA 1SC4A 2BMWA 4PIMA 5AYVA 4C0BA 4UM9D 4DOMA 4QJFB 2PGIA 2VATA 3KD2A 2HAEA 3S2UA 2AFIB 1VHJA 4NMMA 2IBMA 3BRWD 4Q4AB 1ZIXA 4FXPA 5BUSA 2VYQA 1P4RA 5LL6P 3HLTA 3HY6A 1WA8B 1WRBA 4JI7O 1RQ7A 1ZGBA 1KI6B 1AD2A 1MG1A 2IS6A 4HEHA 2IPLA 1MJGA 4YB8A 3KPYA 3QVLA 3JAMN 3CZ9A 5DK4A 3WKCA 1D2CA 4PGGA 3JQGA 3PUZA 4CJXA 1I2CA 3KCYA 4B75A 1LI5A 3ZE0B 2V54A 1LDNA 5K3BA 5CD1A 2Q9UA 3OT1A 3UPDA 5FLXN 3VR6D 3EZYA 1R3DA 4QGFA 3R74A 3BMQA 1CR2A 3FFTA 2EKPA 2QPTA 1SH7A 3HFGA 3ONEA 3FPGA 2HY7A 1IZZA 4E6EA 1CERA 1IJKA 3PA6A 4B47A 4DEVA 3UT6A 2Y1WA 4C6RA 3C7DB 1E2JA 1RT9A 5KHKA 1PV0A 3S6JA 5FCDA 5C53B 1MU0A 4C8IA 5IJ0A 2H3OA 4ZOQI 2AE1A 5K1PA 3EC2A 4UHBA 1G8SA 1QG2A 3ZHUA 2B8TA 3ON1A 3CP1A 5GM2A 3ZVLA 1DL5A 5JMTA 4C01A 4BJ1A 4OI1A 3HWRA 5IEJA 1U28A 2QRUA 4XXHA 2C2GA 5B3SB 2OKCA 2OXIA 3C87A 2XUKA 2XBUA 5AUNB 4OJKA 5HQ3B 3H75A 1DLBA 5KYYB 2Q4DA 3GJ3A 4QASA 2VNJA 3DXXA 3OEEA 4DA8A 5JAPA 3W5AA 2Y27A 2UZ0A 5F5XA 1DX4A 1O54A 4OVKA 3A6EA 1MX5A 1FFEA 3QE3A 4UQOA 5JD3A 4X66B 1E7SA 2C2XA 1OREA 3U37A 1R6UA 1O6BA 4QULA 4OQZA 4PQYA 2GXSA 4YCNA 4DV7B 1SQBH 1DIBA 5ILQA 1F3OA 4MJLA 1KC8W 3S0HA 3BMXA 3IERA 1USIA 2E55A 1CUUA 2PBRA 2VCYA 2CJYA 3H8SA 4XFDA 2IVFA 4J2TA 4NZPA 4PSVA 5AXAA 1ADJA 1ACJA 5KAIZ 2Z1FA 4CL2A 1UADA 4U1RA 5ALIA 2XB9A 2GBIA 5TNXA 1JAHA 3IKVA 2PX3A 4JB2A 1FNBA 2N3ZA 4MV7A 3ASOC 5GM1A 2W2PA 4FI3C 3FKSG 4LF9O 5DTJA 4E3ZA 2Z9CA 1N6PA 5FV4A 4BVHA 4DV6O 1U7ZA 5TQJA 1Y4UA 1ULSA 3TZQA 1PTJC 1XAJA 4OUKX 5F1KA 2QP9X 4FILA 6PFKA 2GD1O 4EA6A 4M7RA 1ZIDA 4L9RA 3VPFA 3A6LA 2C7QA 3GYBA 1RKVA 4KDCA 4DL9A 3C8LA 5K5EA 1I33A 5K6RA 3OCJA 2R79A 4J0EA 3BB3A 3UKDA 4P3YA 1T25A 2VL7A 4TWAA 1NR5A 2H9AA 3U5ZB 4Q1EA 3DL2A 5JS1A 1ZZGA 3UEOA 3IC9A 1D5NA 1R6BX 4ZI7F 4URYR 3R8XA 1PT6A 2DLCX 5F7OA 5L4NA 1WF3A 4YMIA 3O8DA 1FJGB 1ZH6A 2HD4A 4FMCF 4CR6A 3CLTD 4UFPA 4Q3EA 1SHTX 2CJFA 3OA0A 5CBKA 1GU0A 3O8QB 3M49A 2HQ1A 2IYWA 3HE3A 3C3WA 1U5CA 3AG4B 3RGBA 4KQFA 1V8DA 1AKWA 3DKRA 4LMBA 1E4YA 1G4AE 3BQ9A 3FF1A 4I50F 4MSUA 4UKDA 3IUJA 3F47A 3ENKA 2W4MA 4P7KA 3CXRA 1VKHA 4QJBA 3IRVA 3F7OA 4DR6B 1RABA 5HFJA 3UWKA 2ITCC 3K57A 2Q8VA 3TSAA 1Y8ZA 2I1QA 3UJ8A 4WCEV 1B04A 1SIOA 5EJ7A 4LF6O 4ZHQA 1UOQA 2C99A 3EWAA 4YAJA 3IR9A 2G0AA 4DXWA 5L7TA 2R1VA 4WLNA 2G1AA 1NJ8A 1P33A 5AVOA 5G4VC 3FMOB 5JJKA 1JEAA 2C07A 2RK4A 3VNVA 1YGYA 3RFRA 1VQ6V 1H2FA 4U7NA 3QEMA 1LVHA 2GDSA 1A8UA 2Q7HA 1E20A 4M3NA 5LD2B 3ZDAA 4FLUA 2IPNA 3V32A 2R8YA 2WJ4A 2F00A 1NJGA 3RF6A 4DDVA 1FW8A 3S2FA 1HG0A 3OZCA 1VQMF 2PR7A 4GRDA 5A9RA 1ZJWA 3UA3A 3JS5A 5JBQA 4WXYB 3RSGA 4DDTA 1UODA 1KDOA 2WPDA 3SJZA 1CY7A 5EQDA 3EDOA 3ZHXA 3MTDA 3NWPA 4BO9A 1FRNA 2ID9A 1NLFA 2JIZA 2GZ2A 3ZKWB 3W7WA 4BEJA 1D9XA 4YXWD 1A2KC 1BXRA 4PYJA 4XX0B 2HF8A 1NVMB 2FGKA 3G6WA 3WLRA 2PI5A 1A2QA 2C31A 5EZYA 1T5EA 4H0CA 4KVZA 4F5DA 3QW4B 5IDVA 1YAJA 1Z33A 2N47A 2FSVA 2ZQZA 4B33A 2PO5A 3W7SA 3ROGA 2ZDQA 4D4JA 2PRYA 1ORQC 4GT1A 1VJ5A 4HLNA 1DV2A 4ZZIA 4MR7B 1UXGA 1QV7A 4DSUA 1ZONA 4BIIA 2FEWB 4M0UA 2FWNA 4P5PA 3GEGA 4YRPA 5DCLA 5FOWA 1OAAA 4AUEA 5IDJA 3PQ4A 4UB8Z 1W49A 5KQPA 1MFZA 4YMTA 5GIOE 5C8VA 3THWB 3SSNA 5FTJA 4ZMBA 1RCFA 3ETQA 1IMJA 3FSJX 3B6NA 4ZVPA 4DUYB 2ZD9A 1UPTA 4MS4A 1QOQB 2DR0A 1I0HA 1T0PA 1T1RA 1YIJV 1N6OA 4G41A 2EBHX 3JCZA 5A6VA 4PZYA 1H1LA 3FGZA 4FOOA 1UMDB 3KT8A 1LRJA 4BFUA 3LCJA 5D51S 1MC1A 4BX8A 3CSUA 1NNI1 1DX9A 5CEJA 2P90A 1LNQA 1S76D 3SXUB 4ARZB 1YE8A 4HVAA 4WDRA 3QVGB 1H0KA 3NUQA 1BEZA 2GCPA 4EO4A 5JFGA 3M7IA 5JS7A 5BMVA 4UD2A 3O38A 3OURA 3T4ZA 2G7ZA 1A9ZA 5LBTA 4JGSA 2XCSB 2VWPA 4WLUA 1R6TA 3BGIA 2HWWA 4BNWA 3H5LA 4D3DA 1QRAA 5KU1A 1QFXA 1DO2A 4X90A 4URHA 4WBNA 2BTOA 2YHIB 4BO3A 2Y69B 3QKRB 1FCJA 2GBOA 1K4MA 2VBGA 3ZWQA 1XI1A 2G1UA 2PKRA 4I1SA 2BR3A 1OA0A 3W5SA 3TTVA 2YXZA 1FX1A 1X0VA 3J81M 2CLKB 2P9JA 2QXTA 1HYHA 2GJ9A 4G84A 3I55F 3H83A 4ENPA 2M7WA 4HB3A 1TMGE 4IDNA 4MVXA 5T8KA 5F7ZA 4Q4HA 1F6BA 3WYCA 1PR2A 1SY7A 1W4RA 3GRUA 4YS6A 2UXDB 3RRZA 1GGEA 3SQXA 3N7TA 4IDGA 3K72B 3NC0C 3SHFA 4LF5O 2IHZA 3MHTA 3D3EA 2JAPA 4FLEA 4QTZA 2E21A 5DM70 5BRNA 2WOJA 4Q9IA 4JVMA 4XOUA 1N3IA 5EWLB 1UJ5A 2Z2XA 3K8ZA 5CK5A 1K2WA 4IMPA 3OQVA 2RD2A 4FBGA 1CDDA 2HBZA 1RKUA 2HKIA 4W1RA 4LKOA 3EC7A 1AI6A 5IZCC 1Y8CA 1NZJA 2DBQA 3EMBA 2AVDA 1RHQA 3CWQA 1XCLA 3G88A 3JQ8A 4PX9A 3UK2A 4KXYA 4F9FA 1JHPA 1T2CA 3NHRA 3X0DA 4GSKA 1PVVA 3PQFA 2KQXA 4TV9A 2ES4A 5JCOC 1ZGAA 2QG6A 2VP9A 2UZIR 1IXSB 1RAEA 4U6QA 4G8BA 3O93A 3REFA 2PKEA 2PD3A 2OB1A 5CN0A 4FIDA 5DO9A 2REOA 2WT4A 3LVBA 3GFRA 3I6BA 3FW1A 2PY6A 4KFSA 2KG7A 3EWNA 4BRSA 3ZEAA 2LKDA 3G4SV 4C22A 2EILB 4UE2A 4UBLA 1V9PA 2CNWD 5FUVA 1OXVA 3T7SA 3KQWA 2V7WA 1YIOA 1V5IA 3OAAD 4TLEA 1GL9B 3ISVA 2YQ5A 2C3MA 2QJRA 4MRVA 4NPHA 4JD5A 4DQUA 4DXAA 1FC0A 1GITA 3TLEA 5EBMC 1BMFG 4M0DA 1EQUA 3DMFA 1ANKA 4RGBA 2H4YA 3H3XA 3WBBA 4WPGA 4B3RB 3PFFA 1N1GA 5HIAA 1IG0A 2JZCA 4AZSA 1MBZA 4MINA 4Z2YA 2ZTLA 2QLNA 2GM3A 3ZD6A 5HKAA 5F52A 4PPNA 4N8DA 1ECPA 1YL7A 4IKPA 5LHHA 4OMCA 1R4ZA 1U7DA 3I2GA 1UWCA 5HF5A 3BGVA 2ZANA 1DBPA 3QM1A 3ZWAA 1SO8A 2BKXA 1O1YA 2NTEA 1H1DA 2J4FA 3GJSA 1VL0A 1SVNA 4BTEA 1A9SA 3OPXA 1XT6A 2DCUA 5AM2A 2CY0A 3K0FB 2MOKA 3HZZA 2KGWA 2Q27A 4EPTA 2C61A 1BQ4A 1EP1B 1WZ2A 3TN7A 3QFSA 2IU0A 1QMGA 2DMRA 1VG8A 4E7OA 4MQEA 2ZSEA 2P9GA 3AVTA 2EZ9A 5K8TA 4R5MA 1NJIH 4ZOEA 4IQ4A 3HY3A 3K0BA 5BOSB 3VPCA 1ZU5A 3WRWA 2SNIE 2H2FA 2F67A 2XDAA 2GM5A 2DWQA 4X62B 2DUUA 4ZJPA 2QTWB 1NF3A 4P7JA 2KKWA 5ALQA 3W3AD 2HU8A 3JZDA 5D2CA 3PWSA 4UTOA 4BLOA 3NK6A 1NW4A 2DM6A 5FHQA 1SCBA 3FYUB 1XKLA 1FFWA 5ARCA 3H3JA 5ESXA 3KHUA 2DPYA 2VHWA 3N7AA 1U5AA 3ADBA 1GG8A 1X77A 2P77A 2VLBA 1BJRE 1MVOA 2HCTA 3EQ9A 2W37A 3ZD7A 3FD9A 2C4UA 5JNUA 2DF8A 1I0ZA 2IYAA 1AKUA 3PSHA 3OPYA 4GXRA 3LZDA 1TI7A 3Q87B 1H0HA 1GL3A 2AWOA 2ZITA 2FC3A 4BU1A 1K68A 4UHDA 1HLDA 1T9AA 3VU0A 3GLQA 1PO7A 1MABB 4HNAA 4IJUA 4O4HF 3M84A 3BAZA 2ALEA 4TVKA 4UXNA 1QWOA 1N0NA 2W0MA 4Z53A 3KQVA 2Q6TA 2FZKA 1ABFA 2WK1A 3ZY5A 1I7PA 3IQGX 5DW3A 3IEVA 2POQX 1YVWA 5AKIA 2V3CC 1RMYA 4I9FA 2VH2A 1CUFA 5GGXA 3RS4A 3F2IA 4QLOA 1G16A 4JC5A 1G42A 2RHJA 2O2CA 4JS0A 1URPA 3WYFA 1BHO1 2JIQA 2O0JA 7ABPA 2QKAA 5EJEA 1E9RA 3M4NA 2YNMD 3N05A 5EC1C 4BGIA 1KSHA 1GFZA 1XALA 4JOSA 2H65A 4YP6A 5ETJA 2Q6IA 2UUBB 3FHCB 5F9HA 2P2LA 2AFIE 3NHJA 1G5FA 2JANA 3V80A 3C3AA 4Q7JB 2GNPA 2YDYA 4LBYA 4ISCA 1P61B 1A8QA 1KRXA 4LNHA 3UB2A 4O3MA 3UBTA 5FBWB 2ZTVA 3HDQA 3OEEG 3ICVA 3F3SA 3LY8A 3G2IA 4YN3A 1YQGA 5DIZA 4PX5A 4S35A 5FWYA 5C5IA 3TLBA 3PRYA 3UJDA 4J16A 1IU9A 4BO5A 3KSBC 5JNVA 2R6FA 3H1TA 1SU7A 3R3JA 4E1BA 4K0KO 4GYKA 1Z34A 4RBNA 3HKBA 3DSRA 1J0CA 3WLLA 4B5CA 2JIDA 4UPVA 4HTFA 1N2CB 1ZX3A 3SYLA 2RBKA 4ZYWA 2Z8YA 4XTRA 4OB8A 4KR2A 3ZJUA 4FDLA 1QFYA 3URKA 5BSEA 2ALJA 3WS7A 4BV9A 2V59A 1DARA 4GBGA 3T9DA 1RNLA 1TO1E 2WKSA 4M1WA 1XMOO 4W8GA 4RY8A 4J90A 3UICA 4HCJA 1L7QA 3VOSA 1RD4A 2GAIA 3IUNA 3K2XA 4X7PA 3FPJA 2ZBRA 4DR3O 5L51A 5CA0A 2Q4BA 2C2KA 1VJCA 1KQFA 4I55F 1LK0A 1V8PA 1VZ3A 3ZZMA 1M33A 3OZVA 2VYNA 4GEKA 1XAIA 4DLWA 3ZJYA 3AEKA 3SSAA 4X3OA 1J1UA 1N5OX 2JF0A 3Q5GA 4EITA 5C1DA 2O5CA 1FMFA 5E7JA 4R3UC 3SOPA 3E83A 3BHNA 3NIBA 3HYLA 3RVMA 1M2FA 3I6ZA 5KYNA 4BO4A 2I2XB 2QG9A 1AUPA 3TQTA 4LI3X 5JCJA 4ZU1X 5B7NA 2HK7A 1E6KA 1M8PA 3IA2A 2XTZA 2WJWA 1L0BA 2JIMA 1JYFA 4LNAA 4S0XA 4UTRA 2WYWA 4BRWA 3JRWA 1CR4A 1C14A 3NM4A 4XTCS 2ADPA 4E5DA 2ZWIA 3DTYA 4R8KA 2FUEA 3CZRA 4JXKA 4GICA 3LP8A 3VAAA 2V5VA 1LU9A 3LQYA 3T1YO 2EARA 1L4YA 2Y4UA 3FI0A 2ZWMA 4WQMA 3ZY2A 5JNWA 2IOFA 1C4OA 3B6EA 2I7XA 2J1LA 3H8JA 1VDZA 1ZJ4A 3KZNA 4XB2A 1HNZO 3BA9A 3FD5A 4A5UB 4DV4B 2MCFA 3JYLA 1ITZA 1A7AA 1HQCA 4QDOA 4Y2QA 3WDSA 4NDAA 3SIVA 3TZBA 1OV6A 2NNLD 3VPAA 5BSKA 1YHQV 4D41A 4X7MA 4CCAA 4AX8A 1KFCB 4OJMX 1Z7WA 2W6NA 4BKRA 1Q82W 1R8JA 3A36A 3FA2A 1Y4DE 2F48A 4QU9A 3IFSA 1R6NA 5U1PA 3SR4A 4RZIA 4DIEA 4KBGA 1C7JA 1K7XB 4ZJYA 3CE6A 3GEMA 4WZBA 3MAJA 4PO1A 2JJ1A 2XTNA 2VUHB 2R68A 3NGXA 3CVJA 1Z0SA 5EWMB 4J7AA 1OX4A 4B17A 4JFRA 5H6RA 2H29A 1Z07A 3JX9A 3ZJTA 4RTRA 1A4UA 2DWCA 5F4BA 4Y7DA 2XOEA 2C5GA 3KL2A 2QMOA 4NJMA 2GWHA 2GVNA 4BHTA 3M9XA 4ND1A 1WPRA 3I8XA 1K8ZB 2QRNA 1OW3B 3K35A 4YV1A 1QHEA 3O74A 1H2ZA 1UBSB 3QOFA 2WPDG 5KKAA 1QB8A 5A4IS 5CHEA 2BFCB 1MX3A 3ROEA 2ZTHA 2JIZG 5A0VA 1E1YA 2R11A 4P30A 1J5EB 2G9IA 2WVAA 4BDTA 1E6WA 2XGMA 2KTVA 4FFSA 3HJUA 1O5OA 4BVFA 4TV8F 4Y2XA 1Z2CA 5GANK 2EIJB 4G0NA 2EX1A 4ZDIA 3H9EO 1KEZA 2W0FC 1WJGA 4QYXA 4OKIA 5BRAA 1OCCC 5LA6F 4J07A 3V8EA 2JFVA 5E95A 3BERA 2D4HA 2NT4A 1T5LA 2OZPA 1KNXA 421PA 4ESEA 3FB5C 1NVUQ 4F2GA 3H9UA 4GGOA 1H2YA 4YAUA 1XQYA 3PTLA 5B55A 1P9NA 3T7JA 1L7AA 2Q0XA 1SCJA 3S5UA 1Y8QB 2G71A 4ZICA 2QMUA 3G5MA 2H59A 1YR7A 2AN1A 2BOVA 1ZEJA 3I9V1 3W5BA 4KVFA 1C80A 4R1NA 2QTTA 1W4AA 1Z2AA 5AKKA 4I8XA 4JUDX 4P1ZA 2ZYVX 1ZUQA 4ICGA 5DNWA 4IL5A 1Q20A 2IM9A 1RTKA 3RF7A 5EN4A 1XTBA 4J41A 4V0LA 4HDSA 4Q9AA 4BJHB 4ZOCA 2OYRA 1WQ1R 4JBNA 2TRSB 1VQ9F 3M3HA 2TECE 2H2HA 2C54A 1C1DA 4INAA 1XRQA 4QYSA 3QWFA 4OM7A 3VR5D 4B4VA 2EBWA 1M6YA 1SQXH 4RD2A 1I36A 4U3JB 3K14A 3IRUA 1PW5A 2QJWA 1E7YA 4BMNA 4W1QA 1G5PA 1ZOPA 2RC5A 3VR6H 2FSHA 1HZJA 4AF6A 4C3ZA 3OONA 2PTGA 2QE7D 4YRAA 1L4FA 2O1XA 4FLMA 2ZXFA 4PIPA 1P44A 2ZCJA 4FCWA 2XNDG 3NVMB 5BN3B 3AHGA 1E60A 3I1IA 3VHRA 1CQIB 1C5KA 3TD9A 5KOHA 3MMZA 2HA7A 2NXJA 2QRLA 5FJJA 1KD1H 1JG3A 2VNIA 3JW8A 3HB7A 2VJLA 4XBFA 3I3OA 3QEKA 2FKXA 3UKMA 3DMGA 4LY3A 4DTCA 4YI3A 3F8WA 3KVOA 2WTXA 2GJSA 5TEVA 1XZNA 3C3MA 2VJNA 2INGX 4V0OA 1E1LA 4INZA 4KC0A 3UK1A 1KERA 1W8DA 4L6CA 1U0SY 1RKBA 1U1GA 3K94A 4BNHA 4ZQBA 1VHWA 4Q1CA 3AIIA 1LS6A 3LIIA 4ZCMA 3MGCA 3MXTA 3Q8MA 1M56B 3H87A 4TM7A 1N4CA 5DT2A 3S1AA 1MG0A 2VDKB 1BH2A 1G0OA 3I83A 3KD3A 4GLBA 1JU4A 3D54A 4G8DA 3VH2A 2HJ9A 2J3KA 5FRDA 3V1TC 4L1KA 2J3EA 4B5LA 4XGQA 3NHSA 3K2IA 1I0IA 4MB2A 4MQLA 1SESA 2J7PA 1PZHA 5AHXA 4ITRC 2XDYA 4UVDA 5EMKA 2XKKA 3E3OA 2VA8A 3ZJ4A 2FZVA 3OCZA 1ZJ5A 4CH6A 3MILA 3TQCA 1R4MB 2Z6AA 4F4JA 1RWPA 1VE3A 3Q7IA 1PNTA 3K59A 4GM4A 2DQSA 2RJOA 2D0DA 2NT3A 2ECQA 4M8IA 3O31A 2NU7A 4M54A 3FF4A 4HNTA 1AV7A 2YV4A 1DWUA 4BWYA 1EWVA 5YASA 5IXYA 5D7BA 1AKVA 3C7CB 1PZMA 3LP5A 3F6YA 2HX1A 1NZ6A 4R2XA 2HRBA 1SJ9A 4H6VA 2DJIA 1FW6A 3FKSA 4RMHA 3T1OA 4LDNA 3VNRA 1G2IA 5JH7A 1K3EA 2Z2KA 3GRKA 3FDJA 1E64A 5EIBD 1U04A 2NTYC 1D5AA 4JP5A 2R3SA 3CVUA 4UDNA 2HMTA 3AESB 2RJNA 3IQEA 2PMFA 1KU6A 2K5UA 1V7CA 5LB4A 3IKMB 4QGGA 1M1ZA 2M6KA 4KIGA 3K1AA 3DE6X 1K4KA 5AM0A 1ZP6A 1N8RH 1PZNA 3EPHA 4EA8A 1HDOA 3HRHA 4FGLA 1K98A 1K0UA 4K9SA 2E4UA 5HF8A 1OXMA 1JYSA 3S2IA 2OYQA 1TYBE 3EHDA 2P4EA 4QOEA 5SY9A 3TL6A 3O7MA 2Q49A 2ZCEA 4L57A 2ETNA 2H1LA 1T2EA 3RUPA 3VAYA 1PFYA 4RGQA 3DXYA 4KI0A 3RI3A 3RTDA 2QPLA 3PQ3A 2EZOA 4H1UA 3JQAD 4B83A 4UW9A 5JJBA 4LK3A 3CBQA 2WYIA 3TG2A 2X2OA 4D0RA 1WMEA 1X1DA 3K5IA 4UZFA 4R4JA 1KR5A 2PZGA 1ZG3A 2ORIA 2CH7B 3CCVF 3CCUV 3FPHA 3L5OA 1HYBA 1WDLA 3LKDA 1C7FA 2C58A 4FFVA 1PFWA 2ZJ4A 1MX9A 3BA1A 2F90A 4QEKA 5ECDA 3TRJA 3RS2A 3OF3A 2KI5A 2JEXA 4BDSA 1IRIA 3NXSA 4HDRB 2OZBA 3KKOA 1UPBA 2IYPA 2LKCA 1NPYA 1RM5A 3K0HA 1T0JB 2XWPA 4C03A 2GK3A 2I4LA 1U7HA 3R65A 3UNXA 2NXCA 3N0XA 3CEIA 4PRZA 3J80M 2C95A 3AWDA 1ZNYA 4TVOA 3VJRA 1UZUA 4BT6A 4A0FA 3BYQA 3O5AA 4IXNA 2ZVDA 4FZVA 1E1CB 2VAMA 1O6GA 3WWCA 5KTTA 2VSYA 1FP7A 2YOFA 1TAEA 2ZULA 8ADHA 4QGBA 1IZ3A 1MXFA 3V8NA 3RKSA 1TNDA 3C70A 4FYKA 4ZDKA 1V5EA 2YN0A 3T4XA 3VNUA 1ZR4A 2CWWA 4WW0A 4OLJA 3QV2A 1QU9A 5AD1A 4KQMA 4TZTA 3RIEA 2DPHA 3QVSA 3CC2V 2YBEA 3QEJA 3UH0A 3GLGB 1JA0A 2AX3A 4GI7A 4BBJA 3DEZA 4HMQA 3HJHA 1PI3A 1REQA 4PXAA 1O6CA 5DCYA 4BRUA 3OJOA 3RC8A 3N87A 4OAQA 4F7WA 3KSMA 4D4KA 3KPJA 3ADPA 1BXGB 3H0KA 1ETUA 1F17A 3DLHA 3R3UA 2C97A 1QP8A 3FFBA 3TLXA 4O4LB 3S8EA 2K1SA 2D2EA 4QFDA 1Z5GA 3HB5X 3G2JA 3Q4HA 3LTEA 5LN1A 3OPNA 4YIOA 4BAYA 5AJTA 3P2JA 1XTVA 1M2OB 3QMMA 1Q1NA 2JGUA 2W11A 5IJ9A 1YJWV 4ZCSA 4FFBA 3OZIA 1X0XA 4BFXA 3NDIA 1GGFA 5HZGA 1TRKA 3K5WA 1CNMA 5IWAO 1NUSA 3SYCA 4DR1O 1L5FA 4LSMA 1YZNA 3D2LA 1K3TA 3KWJA 1KFJB 3R3WA 5D1HA 5AUOB 3LBIA 3LT1A 4CGYA 2IEBA 1U2EA 2NUBA 4EI8A 1L4EA 4QTTB 4Y0NA 5M34A 3F2VA 4EFNA 2RKWA 1EN6A 3FVVA 4R54A 5BSVA 1KY3A 2BOBC 4MO2A 2B69A 3LRPA 3LUTB 5JHHB 1Q44A 1GADO 1BKDR 1JX9A 5EC2C 5DNDA 1Z88A 2C5AA 3TWOA 4U39A 4K6FA 1YF2A 1GNQA 4MVZA 3PXEA 1QC5A 4A2WA 4QDUA 1IM2A 5JV5A 2BF7A 3OKPA 5H3HA 4CKBB 4L8JA 4ETNA 3U1BA 3LDCA 2HSEA 4ZQCB 1ADFA 3EOBI 4BWVA 1P1KA 3AVXA 1GO1A 3ROZA 3FOAA 1W0KD 1GO0A 5A3JA 3PGJA 1CUBA 1X1QA 4HFMA 3K1TA 1AILA 1ZRMA 1VQNV 4A15A 3KIPA 4JI0B 3QWAA 3AC0A 2IHVA 3SC2A 3T3MB 2FUG1 1MGPA 5E1BA 3OE7D 5IS2A 1EX9A 3B2NA 3ZN2A 4XUGB 2JVJA 3OW2U 4NUTA 3V3KA 3O82A 3A58B 5HW0A 3R4CA 4AXBA 1FVXA 2FDXA 3P0HA 1TL7C 1U1EA 4N6GA 4B2LA 2OTMA 3CH6A 4XARA 3TW8A 2JHFA 5FPTA 4M89A 2NOAA 3CRQA 4GWGA 5FUXA 2PUEA 1LQTA 5TPWA 2DAPA 4V24A 4O2BF 1SFRA 1CZNA 3E9MA 3ZDYB 3FPFA 1JFSA 1UPGA 2AD1A 3FB8C 2H94A 4IEFB 3S8YA 3QFHA 1H2XA 4TKUA 4QT4A 3E9RA 5JJ5A 1JA9A 1AR1B 2L42A 3EIQA 3LL4A 1FLDA 2D2XA 4L5AA 3LVQE 2IOQA 4BOYA 4MHTA 4RIIA 2AG0A 5CM8B 4JUIA 2OBFA 1R0YA 4B84A 3WDLA 3BG5A 1RYZA 4RF5A 3ER6A 4JF3A 1Y6XA 1W8IA 1CBUA 3AUKA 1N5IA 4ETWA 3KDSE 1ABBA 2VWGA 5D3ZA 3BPZA 2OO5C 2JCBA 3H6GA 4FS3A 1VE9A 3CNNA 3FPLA 1AY0A 2A0XA 4DMGA 2XMDA 1KDTA 3OMIB 4TLCA 3O4FA 3FCYA 1F4VA 5ITWA 3CMEV 5BR8O 4HB2A 3NCHA 1ENYA 2H7XA 4I4IA 4KQXA 2C88A 1U0RA 3OEWA 1Z5ZA 2JW5A 5TARA 3MFQA 1GARA 1EUCA 1ZUHA 4DIBA 1CZLA 2JJ1G 2H4HA 4BZPA 1H05A 2SCUA 5EFZA 5HPYB 1UMCA 3DAGA 3VSEA 1F4MA 1OE0A 3O7WA 4RVFA 4I1UA 2QUKA 1M57B 3BL6A 3CUYA 1BMFA 4B44A 1BDHA 4C4PA 1EBOA 4CL8A 4MWBA 4IRUB 4BWAA 4RQBA 2LR0A 3TVTA 1DU4A 1IEQA 3H97A 3S8MA 3SJCA 2GAAA 3MDSA 4EJSA 3C3EA 1NY6A 1U8AA 1AHNA 1UWVA 2Q9CA 1QH8B 1I32A 5AJHA 4ARUA 1DADA 3RVOA 3TS1A 1QZ3A 3D3JA 1C30A 1CEXA 5JZOA 3E58A 4B3SB 2A3RA 1ZR2A 3BZBA 2EKQA 1L5HA 3NBFA 1JHXA 2P78A 1COMA 1ZOLA 4MLPA 4OU5A 3D8HA 2IDKA 3BTVA 3KHKA 3ETDA 3MBIA 3EGCA 3L3BA 4U7JA 2J30A 2ET6A 4DR5B 5EERA 1TJ3A 3FFWA 1TU4A 3UW3A 3WOHA 5AW7A 1YJCA 1OV4A 2ZUSA 2HYDA 3DD5A 2CXUA 4KFRA 3W3AH 3H1AA 3NU1A 3WWYA 4NK5A 3OWOA 1W7AA 1M2GA 4AZ3B 4II3A 3RTCA 3RJ9A 1IJBA 1M1XB 3E2PA 2WTNA 1NXVA 5KNBA 3MTBA 5JWPA 2X6CA 4YONB 2GN9A 3ZNOA 2VTKA 1CNFA 4CM9D 3TTTA 1FVHA 1OXSC 3D8SA 3M82A 2W22A 1SETA 1V2GA 1GUAA 2NZ2A 1KXJA 1FSZA 2YMQA 3LK7A 5FQNA 4N6NA 3PQDA 2AN5A 1PF5A 2CVLA 3B6ZA 3RODA 1G1XB 7ADHA 3Q2OA 2JGLA 4HH3C 3WTBA 3B5EA 4BW5A 1RWOA 5E79Z 4WOKA 2BBSA 3PP8A 1ZNQO 4BMYA 5EE5B 3ENWA 4NHEA 2EWCA 3VTAA 2M6SA 1Q84A 3JQ6A 3H5OA 2CSUA 4TWJA 3FDIA 3WPXA 3ABQB 4OHYA 2W42A 2PMKA 4CM8B 1CSEE 2J5RA 5K0GA 1KZ7B 1NC1A 3CKYA 2EFCB 4IIGA 3WLAA 2YUAA 3IBCA 3G80A 3U19A 5ADVA 2QTLA 2JK0A 3ZZTA 2A5JA 4PI2A 1GTVA 1TUEA 3LNTA 4IF6A 4UM8B 4X24A 1GAXA 3PITA 3OQHA 5CT8A 3FLMA 2IODA 1WW8A 3S7ZA 1R73A 4G5HA 1EUDA 4P5EA 1D0SA 4L8VA 1A7JA 2NMVA 1SXJB 1Q0LA 1DT9A 4NBRA 5HEKA 4ES6A 2FN3A 2ONJA 3T7CA 2EQAA 1XN1A 2AI2A 1V9SA 2QSJA 1R88A 3K70B 3FYIB 1KIFA 1MG5A 1NXWA 3PDHA 2X19A 2Q07A 1BHQ1 1V4BA 5A7FA 2WF9A 4KACA 1OB2A 4JY7A 3Q8WA 4D4LA 1VHAA 5I9LA 2JCXA 3VR3D 4JAVC 4EBFA 4IIHA 4LJAA 4M38A 3ZDDA 3ID6C 3KQQA 5TS2A 4I3GA 3INYA 4MW4A 4RHAA 2VRZA 3SC4A 4ROSA 1QRTA 2VC2B 3MJCA 1H3EA 3PFWO 1VJTA 4ZOBA 4NJOA 1W48A 2Q68A 4B45A 1Y3AA 2WJGA 2RI6A 4PTLA 3MSCA 1QTNA 3TUIC 5ALNA 3KJZA 3H5AA 5IKOA 4LZLA 2V98A 2IH1C 4YUWA 4RADA 5KNCA 1H9AA 1DUSA 4GGPA 5JIBA 1BXZA 5IJZA 4PX3A 4YDSA 2QN9A 5C8DA 4JI3B 2I55A 2Z9BA 3RSSA 1HDXA 3GJ5A 5JZBA 1NX9A 2GLXA 4PO9A 2QTBA 1PK9A 3NDPA 5SZHB 1VL6A 2AHRA 2QDOA 1NBME 1EWTA 3AB8A 4MT8A 3UGTA 2RE8A 1KTIA 2P30A 2WR8A 4C07A 1GUDA 1YHZA 1YDMA 1NUQA 3ZMTA 5F7JA 4ZI7B 2R6JA 5C4IA 2F95B 1BWQA 3DEIA 4Q6GA 5C31A 4K1LA 1F12A 1FTWA 2CNOA 2AK2A 4FMCB 4M99A 1EAMA 1ZM4A 1EJ2A 1K7FB 4X8LA 1C9DB 5C1OA 4GMDA 3THYA 3A1CA 3P45A 2VTEA 5AI9A 4G9EA 5FEMA 2JAQA 4RFSB 5B66Z 5LWQA 3IJEB 3CCLV 1YB7A 3ZHVA 1PEKE 4I50B 1ISMA 5GTDA 2QEQA 3OEHG 2WI8A 2X4DA 2WHPA 1SHJA 5AM4A 4RUFA 1Q0HA 4F2HA 3RNOA 2B34A 3L2OB 1W76A 2FPOA 2GNOA 4N3NA 1S5LZ 3PKIA 3KQPA 5B53A 2KB1A 1SG0A 2IJGX 3JQAB 3SQMA 1N3BA 3SSOA 4Z5XA 3E82A 3CVVA 2R9RB 4B3CA 4TSFA 5I45A 5JSFA 4MRAA 3P0IA 5C32A 4JCOA 4LRSB 3TQRA 1K88A 1DX6A 3NIGB 3PC6A 4TX1A 4P4LA 1YRBA 1C7EA 3LKBA 1RC0A 3QQ5A 1DRVA 1N7HA 3PHLA 2R9VA 3KBBA 4LC1A 3P0ZA 2VT3A 2PQ6A 2X0KA 3VZRA 1T4CA 4KU4A 3K71B 3JQPA 3E89A 3O9OA 2UXXA 4AJ4A 5KC9A 1ZEMA 1EX1A 1C8BA 3PVZA 5A04A 5KTYA 1DAGA 3CLRD 2O2SA 3RVNA 1V54C 2FEXA 4QHYA 3K8OE 3KQKA 3BL5A 4YRFA 2XZOA 4OFWA 4BNIA 2I3GA 5EYPA 4KXLA 4BKUA 4IYHA 3WJPA 1FFYA 1WJZA 1D6SA 3R7WB 3V4FA 1XZIA 3V1NA 2AK3A 1AUXA 1L5SA <