The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
169
|
sequence length |
428
|
structure length |
422
|
Chain Sequence |
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb |
molecule tags |
Structural protein
|
source organism |
Gallus gallus
|
molecule keywords |
Tubulin alpha-1B chain
|
total genus |
169
|
structure length |
422
|
sequence length |
428
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2016-07-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF00091 | Tubulin | Tubulin/FtsZ family, GTPase domain |
B | PF03953 | Tubulin_C | Tubulin C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix hairpin bin | ||
Alpha Beta | 2-Layer Sandwich | 60s Ribosomal Protein L30; Chain: A; | Tubulin/FtsZ, C-terminal domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Tubulin/FtsZ, GTPase domain |