5GONB

Structures of a beta-lactam bridged analogue in complex with tubulin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 169
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5gonB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5gonB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5gonB01
5IJ9A 3E22B 5KMGB 4ZOLA 2BTQB 1W59A 4O4LB 4WBNA 2Q1YA 3RYIA 5JQGB 3RYCB 4IHJB 5JVDB 5ITZA 3JATA 4O4HA 2RHLA 1RLUA 3RYFA 3JALA 4DRXA 2VAWA 1W5FA 3VOAA 1W581 3R4VA 1JFFB 4XCQA 3RYFB 3M8KA 4YJ2A 2Q1XA 5JH7A 5KX5B 1RQ2A 1W5EA 1TVKA 4X1YA 3JAWB 5BMVB 3N2GB 4O4LA 4F6RB 3JAKB 4HNAA 3JASA 4WBNB 5CB4A 2R6R1 3WGKA 4X1YB 3JATB 3ZIDA 5EZYA 3WGNA 4YJ3B 5LYJA 5LP6A 4X1IA 4TV9A 3WGJA 5M7EA 3N2KB 1FFXA 4X1KB 5LA6A 3JAKA 4HNAB 5LXTA 3E22A 4U39A 4O2BA 5IYZB 4DXDA 4I50A 1TVKB 4O2AA 3RYHA 3ZBQA 3HKEB 5J2TB 3RYCA 1TUBB 1Z5WA 5FNVB 2VXYA 3HKDB 4O4JA 3V3TA 1FSZA 3VO8A 3HKDA 3UT5B 4I55A 1OFUA 3HKCB 5JQGA 4M8IA 3RYIB 2XKBA 4I4TA 2VAMA 1SA0A 3RB8A 5CA1B 4TUYB 5KMGA 4EB6A 5J2UA 5JCOA 4ZI7B 5JCOC 4O4IB 5CA0B 5MN6A 2XKAA 4U3JB 4TV8A 4EB6B 5EYPB 5IJ0A 5CA1A 3N2KA 4X1KA 5LA6B 3C8LA 3VOBA 4FFBB 5EIBC 4YJ3A 5EYPA 3JARB 3UT5A 4U3JA 2RHHA 5LOVA 5IYZA 4ZHQB 3JARA 5C8YA 5LXTB 1W5AA 4LNUB 3JAWA 2BTOA 4I4TB 5BMVA 2VAPA 5LP6C 3WGLA 4E6EA 5LYJB 3HKCA 5C8YB 3HKEA 4TV8B 4O4IA 3HKBB 5GONA 3VO9A 4O4JB 2RHOA 4EI9A 3CB2A 3JASB 3VPAA 4FFBA 1FFXB 3JALB 5LP6B 4O4HB 5MN4A 5ITZB 5J2TA 4ZHQA 3ZBPA 2GVIA 4O2AB 5CA0A 3RYHB 3HKBA 5GONB 2R751 4ZI7A 1JFFA 5J2UB 4B45A 4TUYA 4ZOLB 5FNVA 4X1IB 4LNUA 3M89A 5IJ0B 2RHJA 4I55B 4IIJB 4EI8A 5LOVB 4X20A 1RQ7A 4EI7A 4B46A 2BTQA 3N2GA 4F6RA 1SA0B 5CB4B 5IJ9B 4DRXB 4TV9B 1TUBA 5MN5A 4X20B 5EIBD 1W5BA 5EZYB 3WGMA 4IIJA 4IHJA 5JH7B 1Z5VA 5JVDA 5KX5A 4YJ2B 4I50B 4KWEA 4O2BB
chains in the Genus database with same CATH superfamily
1GAQA 2ODAA 4PYIA 2VWGA 3PQ6A 1GM7A 4DLBA 4EG4A 1TFRA 2AE1A 3UMFA 1NFFA 2Q0XA 5A9RA 4ALLA 1CLIA 5KQRA 4HWPA 4TSRA 3BWDD 4XI9A 4INOA 4AJJA 1N36B 5JCJD 2R9RB 3ZDDA 1KKUA 1OHHG 3QEKA 4EQ6B 3PX2A 5JCJA 5LD2B 4AURA 2I87A 1ZG3A 3QWAA 1K3FA 2PGLA 2HK7A 2X5OA 2VP3A 2G6TA 2Y4NA 3DV0A 3M81A 4A8JB 4NMLA 1QH1A 4CQMB 4Q21A 1CRPA 3LWZA 1K68A 3GB7C 1COMA 5GONF 5B37A 1XDDA 3OI7A 2YEVB 2V55B 1PZMA 2QZZA 5L3VA 5BN4B 3DZIA 3DMNA 3DZKA 3GLSA 2FSGA 4JLNA 1U9YA 4X8AA 3L4JA 2WD9A 4GD3Q 4ZT7A 2HLDA 2QI9C 1NH2D 3H2HA 3KEFA 3UMRA 2XWBF 3JZMA 4GPEA 4GOXA 2XIQA 4AQ7A 1KSGA 4AY3A 1BS3A 1IATA 3WGNA 5AJWA 3QPDA 2AXNA 4N8EA 3TQRA 1G8GA 1SBHA 4IAOA 3G2MA 4BE9A 2Y6UA 1RAGA 4YACA 4EUNA 4KO1S 4QXRA 2XAGA 3QHDA 3A6ZA 4HGRA 4X62B 3D4NA 3IT2A 2QAIA 5D1HA 2UVDA 1KIFA 4PTYA 3TQQA 4RVUA 1YT5A 3BGSA 5EXXA 2IWRA 1QNFA 1NTRA 1T9BA 2EDAA 2H16A 2R96A 3AEQA 1KQNA 4B3CA 4YIHA 1UM8A 4U7FA 1Z5WA 1PVOA 3C3CA 3DEYX 5G0WA 5HZHA 2Q46A 5F9MA 4B3HA 3T4PA 2A92A 3A4LA 5JW6A 1WHSA 1W87A 2QQ5A 4CG3A 2LBPA 1M56C 3QE3A 2Z2XA 3A6EA 4JJZA 4AS2A 1H3FA 4DMFA 2FW7A 1OX5A 4DV0O 4MUBA 1XCMA 1W25A 2QP4A 3CLTC 4MJXA 1EVEA 2C2WA 1DFHA 2AR0A 2DKFA 3ECAA 1MPXA 5KNCA 5LZ4A 3DGFC 4QPKA 3FOCA 5C53B 5DYNA 4E31A 4N9WA 5KOIA 3FNGA 3U7RA 1NG9A 1OIXA 2BDEA 1UDWA 3WL6A 1UFOA 2LQTA 1BDIA 3FBWA 5JMOA 3L46A 2J0UA 3G1WA 3NIFB 1J6UA 2FWAA 4DM4A 1NW9B 2WINI 4JI3B 1FXSA 3G4SV 1DG3A 4GE3A 4HQNA 4RKFA 1UXOA 3WTBA 5AICA 2Y1LA 2C5EA 1GO3F 3B3QA 1W2BU 4F5ZA 1NULA 2X1MA 2G9UA 3FB1A 4CQJA 1GQ2A 2QROA 4AF6A 1I1HA 4DEYA 2B92A 2NG1A 4NMXB 2AEEA 4CV2A 1AJNA 2C98A 3W9YA 1FX1A 3L7AA 2YDYA 4MKGA 3WLNA 3CXCU 1KMHB 3T3DA 1E58A 2C84A 4MKXA 4OGWA 4C21A 2EKQA 3ZNQA 1OH7A 2FR8A 1J0EA 1Z4JA 3QFTA 2J0QA 4X65O 1CQZA 1G4HA 5E8RA 2Q29A 1E79A 3H5AA 2NSYA 1B2LA 2FMIA 5JG7A 4ZI7A 1WPRA 2QL7A 1E9VA 1GNSA 2WNSA 3HN2A 3VAAA 4B4KA 1FX0A 1NX6A 5FL7G 1WP8A 1A88A 3LWVC 4TTQA 2XAUA 4GOMD 2RONA 3G13A 3G3EA 3NMUF 3IC7A 3QG5A 1PT5A 3MTGA 3P0FA 4QELA 1RQRA 3QFHA 4EGCB 5IZ4A 3NKLA 5K7SA 1RKQA 1XNRB 5PGMA 1UZNA 1QVRA 4WLOA 2FZKA 1ODSA 4DSZA 1WKVA 2QTOA 3CMCO 3KV3O 2F00A 2BTQA 5B1HA 2ZJ7A 1KJ9A 2OTLV 2WSMA 5G1OA 4AAYA 1F6BA 1GYPA 1R6BX 2PXHA 3BTOA 2E5FA 5K0EA 5HY0A 3OLWA 1PL0A 1OCOB 2VRWA 1Y8AA 2GDJA 2OTJF 5LZ8A 1B8VA 4ENRA 3NM6B 2WTAA 4NMWA 5AKIA 2OUIA 1IY0A 5SY6A 1NQWA 4V1CB 4NTXA 1TECE 2EBUA 4BW0B 4JI0B 2KG7A 1QK3A 2CHQA 3BN3A 3CT4A 4IX1A 4HVLA 4BJ3A 4ZYWA 2RSLA 3NVIB 4J80A 3A3NA 1R4MA 5LWHA 4RD2A 4OL0A 4U7WA 1B2RA 1J5XA 1EFDN 2IUSA 1NOJA 3GRZA 4IUDS 4KIUA 2JB9A 1KIMA 2Q9CA 4CKBB 2WUFA 4EQ6A 1SXQA 2PUTA 4GZLA 1MT3A 3GDFA 5IJAA 3O3CA 3H1BA 3FHCB 3NWEA 1RMYA 3BIWA 4XWGA 3WG9A 2CTRA 3WAGA 2BMEA 4ZCQA 1HNNA 2BZ1A 1VE1A 4UCSA 1LNSA 3AR2A 4WKGA 1M8FA 3EARA 4IYIA 3F8SA 4RA6B 4B4DA 5D85A 1N9GB 1I6MA 4ND2A 3MUEA 4B3TO 1WX1A 3ZIDA 1R8SA 1TK3A 2VH5R 3C3WA 2QTMA 1IUPA 5KKAA 4D6XA 2AUTA 1GX1A 3L4SO 3QX8A 3LP8A 2NMVA 1C3VA 1ZGGA 2D2FA 4LRXA 4F97A 1N1GA 4GW3A 4KLAA 3TJTA 2FTKE 4CL8A 4C4TA 3ESCA 3ZN1A 2ZCUA 2NUAB 2XZDA 1PT9A 2B4QA 2EWVA 1SF9A 1DTWA 3N07A 4BP9A 2E75B 5LQDA 2AHOA 5C35A 1T8SA 1UPFA 3EPKA 3KYIB 4DR5B 4U00A 3GO4A 3QNWA 3H65A 2WF5A 4U63A 1ZHFA 1RHJA 3EJWA 1O97C 1K08A 3FOAA 4GP7A 4MVYA 2Z6VA 3BQNB 1IXSB 1PBNA 4Z4FA 2WP0A 4QT0A 2BEWB 4W1RA 3MWEB 1OVGA 1WDTA 3EZXA 2OZLA 2O4UX 2UKDA 5A4KA 2WT8A 4N8SA 3PJSK 3HWRA 3RPEA 1ORQC 2LP7A 1FDTA 3QU2A 1UPAA 4MITA 3AVWA 3COPA 3E15A 4DEVA 3GW8A 4O33A 4OQQA 4OBXA 4JJIA 2BJWA 2VF4X 1Q1GA 3PWKA 4NATA 1W5AA 2BEUA 3AILA 3KVNA 2R87A 4OXNA 2QLLA 2ZNJA 2QUBA 3SWWA 5GW7A 1FFHA 2QQFA 3AY7A 2VEOA 1N25A 1PLJA 1C3XA 2VI5A 4KN5A 4MLCA 1ENYA 4MI9A 3RFXA 4ADSG 1D5NA 1F2TB 3Q11A 5COQA 5FA5A 1L8OA 5IABA 3IUPA 1XJQA 1NHGA 4IH9A 2J0SA 3STYA 2FN3A 1EA5A 2RGXA 2JFFA 1PQYA 1MB9A 4PF1A 5LBTA 4CMEA 3VHXA 3PIIA 1TM4E 1RM4A 4AJOA 4YDHB 3L6BA 1QE5A 4FB4A 1M3SA 3OHSX 1PEDA 3I23A 1DARA 1U2DC 3HDQA 5WRFA 2PUDA 3ZE0B 2R7LA 2MYUA 1UBOS 5F35A 1X2EA 4YRTA 1H4VB 3BZUA 3KXLA 4JA0A 4MV3A 3TOCA 1QM5A 3VJLA 2CHEA 3O2NA 3CCMV 2FWPA 3H75A 3ZE1B 3GC6A 4H4DA 4DG8A 4D9NA 1QNMA 1OI3A 1KAOA 3ZLBA 1OT3A 2WAAA 4GLLA 4QIHA 1A5AB 2YXEA 1MDFA 2EAUA 2I2AA 5AW4A 1E9RA 2VJOA 1T0IA 2JJ2D 1BX3A 3HFJA 5K99A 4ZV4A 1DAKA 4QFDA 4X7BA 5BNZA 2DR3A 3E9NA 4G41A 5DM1A 4NC9A 3CVUA 5B3SC 3C70A 4MGEA 4ZK6A 5BYKA 4MVWA 2REBA 1RYFA 4PXYA 4QL3A 5JWRA 3FOZA 4B3XA 1CE8A 2AMYA 3AEKA 1R27A 4ZAWA 5KQGA 1CNFA 3ULKA 4A0GA 1OAOA 1RM5A 2PYZA 2MDTA 3SN6A 1RPZA 3S5JA 1FJXA 3TE6A 3IBSA 1I6LA 3QOFA 3Q10A 4O4LF 3RRMA 2EJRA 4BQFA 2NTEA 1AVMA 1EHYA 2NVOA 5ED0A 4CI0B 1V7QA 1TYCA 5DN9A 1T29A 4MQBA 3P71T 3SYQA 4EFNA 1FFBA 3V7EA 3GJQA 4K6CA 4UBNA 5H0IA 3CWCA 1GADO 3H1GA 3QEJA 4EYEA 2YJNA 2JRLA 1Z0ZA 1I5RA 2OLEA 1H2NA 3G2QA 1X7PA 3F96A 3MQ4A 1N2GA 4LZWA 5AI4A 2PSHA 4PLTA 1GZDA 5AJZA 5KSPA 4AG3A 3KWLA 2GASA 3HJHA 4GSYA 3TLCA 3SSAA 2XB6A 4CMKA 3J7AC 2J7PA 3H1LH 4P7JA 3KSBC 4GL2A 3V4DA 4BQEA 1LGYA 1RTKA 4OQMA 4WY2A 1KE1A 1XZHA 4C0QC 5CBPB 1JVMA 3BA9A 1JHVA 3HYRA 3I8SA 5E4YA 4YJGB 4AJKA 1R5OA 1M2FA 4JAVC 3W8NA 4HRYA 4K8XA 1V6CA 3PICA 1AHNA 1JIJA 1KPGA 3KJHA 1IJFA 5B36A 2I71A 2P35A 4MCHA 3A6KA 4EY5A 4MVJA 3OJEA 5LR6A 2G1KA 2X0DA 1H9CA 3L73H 1EUQA 2VXYA 1RWMA 3LOUA 1UBLS 5D1NA 5L6MB 3VZSA 5BSHA 1V8DA 2QVXX 1CS0B 3U7JA 4DBVO 3QW2A 1G20A 2IU4A 4F93B 4UC0A 2FZWA 2H17A 4WKPA 3UWOA 1CUAA 3K1JA 3T5CA 2JIZD 1TQ4A 3HM9A 1SA0A 3MWDB 3ZCQA 2WSYB 4G37A 2I2FA 1DSSG 4HGNA 1OWMA 2CT8A 6REQA 1AM4D 2W58A 2EGGA 1M56B 1NLYA 5FBQB 1XXHA 4GMHA 3PFBA 3O2JA 5KNDA 3HVIA 1Q6HA 1RVDA 1TC1A 4L50A 1TA8A 1Q82W 4Q15A 3GI1A 2JJ1A 1N1DA 2OP1A 4QJ5A 1Z75A 1XYGA 3GD7A 3NHPA 1KDRA 5AHXA 4RJTA 3NNNA 1DIBA 3ICPA 1M67A 4TWAA 4GL4A 3MAQA 1OWNA 2DYSB 3BS4A 2HHCA 4YMLA 1E6KA 2PSSA 1CJTC 4HH3C 4US1R 2WWFA 3OBIA 3ZQUA 4Z1MA 4JYMA 2ISSD 3URKA 3W7VA 3UAGA 2JJ1D 2VTBB 5CT6A 2H1WA 2JLXA 2QN2A 2Q3CA 1YGYA 1QDLB 2BEVB 3F3KA 5FPPA 4B1FA 1U5BB 4F92B 2XKKA 1PV1A 5JDIC 1GTJ1 4HR7A 3KFXA 4DY4A 1SXPA 2ZBGA 1RKUA 2PZFA 3HPQA 4QGFA 4A1FA 4F9EA 4B5CA 1E20A 2C61A 3FG9A 4BV2A 1Y4AE 1G5QA 5CHEA 4TS3A 3N7TA 5J2UB 2IJJA 1EJ2A 2QTFA 4GPIB 4ND6A 2PX4A 3V9AA 4BMOB 3PGXA 2PDAA 4QUJA 1G6HA 2P9CA 2HPZA 4PC7A 3ZWKA 1LB1B 1KP2A 1DWQA 4DCJA 4BFXA 16PKA 3WYAA 4WKNA 2BKEA 2Q21A 3WY9A 3AERB 4EUEA 5JSFA 1TKRA 3AC0A 1PS9A 3LIIA 1SY7A 2VAXA 2UYOA 2X86A 5IAKA 2GRJA 2Q3DA 5CYOA 3R7WB 3WWEA 1NL3A 5GTDA 1DGQA 5EIBD 1EAMA 7ADHA 4B7XA 4BEBA 5IJWA 2AW9A 4TKZA 2DBYA 3EGXB 1O5IA 2Q45A 4ZZ3A 3F6SA 4RPJA 2BFOA 5ESDA 3LXMA 3LWRC 1I0HA 2ABWA 3G9XA 4HO1X 4X6UA 3X1DA 4M55A 3CG4A 3AVQA 4QLBA 1DHRA 1F38A 2IYAA 1H8ED 2DN9A 4JOBA 4RS4A 2HR1A 1QU3A 4ANFA 4NDNE 1WRBA 4B44A 4RZXA 3D2LA 5CM8B 3WRXC 1V6AA 3FPIA 1K9MW 3PR2B 2UZIR 3PE3A 3S3TA 3CCJV 1SU6A 2A9VA 1YK0A 4Z4HA 4KR2A 5EE1A 4CKBA 1X19A 1GG2A 2AFVA 3VJMA 5HY1A 4BVAA 2VBIA 2OR3A 3DFUA 5AW7A 1U9JA 4KE6A 3RSLA 2KWIA 2WDZA 5CITA 1NU6A 4E7OA 4URZR 1J9ZA 3BJZA 4MUFA 5A1JA 3WA7A 4HXEB 3G0OA 1VQPV 4XX0B 2E55A 2AJBA 4GCZA 3EJ6A 4NYJQ 1GGNA 1ZGBA 3RS5A 4NCJA 3H1FA 3GWGA 4JC5A 3F49S 1H2XA 1T3TA 5IH3A 4MVJG 4WCVA 1JQBA 2PQMA 5I8ZA 4TKVA 1XN1A 1CIVA 1F3LA 1NI5A 2YMQA 4FJCC 3OJOA 1GUZA 2DMXA 1WMBA 2APJA 4LOLA 5ETJA 2CUNA 3ZNNA 1R0SA 2NO6A 1D0IA 2PZSA 5FFFA 2ZT9B 1DCFA 2H0QA 3MWKA 4R16A 3TFOA 1NJIH 4OTZA 1GL3A 1XTTA 2JFVA 2WNIA 3RYIB 3FETA 2VQFO 1H6DA 4GXQA 3KKZA 4Y9RA 5LJLA 1P39A 2JGLA 5DRYA 3ILXA 4MW9A 1YR7A 4NONA 3RHFA 4NLLA 3IQXA 4JMLA 4OQPA 1A9RA 2IQIA 13PKA 2HUPA 3G5LA 1Q86H 4P4UA 4IIJF 4K46A 3HXTA 5FEMA 3T1OA 4EPWA 3HA7A 4KBYA 1Q0RA 2GETA 1SEVA 1ZY2A 2I9KA 1WMFA 2JG3A 1F8XA 4RTMA 4GXRA 3LP6A 3IESA 3TB6A 5KC8A 1V48A 4I0WB 4N6OA 3R7FA 2GBGA 3T38A 1U1CA 4Q4CA 2I1LA 3AM4A 5L3QA 3N8IA 4PLHA 4PLFA 1QHEA 5EN4A 2RCYA 1TZ2A 1V8ZA 4A0QA 4BFZA 2FOLA 5JTTA 1EX1A 1KQFA 4BFWA 4HRVA 3S70A 5I3ZA 2QUIA 2CYAA 3HO8A 3S2GA 2KJQA 4AKEA 1QC5A 4MP8A 2ZJ1A 4YROA 4CLEA 4RUFA 1PGPA 2ODWA 4PSAA 5L6LB 3CRRA 1AU9A 3N0VA 1F8FA 1Z4MA 3DCNA 4DR7B 1E99A 1KZ6A 1X7OA 3EZGA 3QF4B 3I39X 4J1NA 3WLJA 2Q41A 4NBUA 1IV4A 2CB9A 2RIPA 3AR3A 5IKXA 1KMQA 4F46A 1ML4A 2WDPA 3NC4A 2HNBA 2I33A 2C2XA 4DR3O 4MKRA 5K3CA 3TNDA 2CY0A 1GL7A 1SC1A 1KAMA 1LBIA 1Y7TA 4X89A 1O97D 1Z7BA 2OL4A 4JJAA 3UCXA 3R76A 2NNLD 4RV4A 2PYDA 1R3DA 2RK3A 2XNSA 3KFLA 3R2JA 4NBRA 4XCXA 2ZKLA 4EJSB 1Z0JA 4A9AA 5DGCA 2GSDA 4GR5A 2QJWA 3C87A 3FB7C 3ITKA 1T0UA 3PCRB 5CDYA 1YZFA 3ONWA 3ABMC 4ND1A 4DNOA 2YHIB 1W7AA 1MPTA 3R0PA 2IPLA 3ESBA 4YECA 3CR7A 1KJIA 5IAJA 4X20B 1MC4A 2W71A 4PG6A 4JI1B 5B55A 2XGJA 1W4AA 1TLLA 1QBZA 2W2KA 3PU6A 2SKDA 3CZ9A 1ODIA 1MJNA 3QLTA 3VC1A 3FTNA 2YHAA 1L4FA 5TS2A 3EUFA 3U62A 2PKEA 1TEVA 4LRTB 4KOEC 4UNRA 5ITZA 3REOA 4WEOA 4AZ0B 2Q0AA 3WR5A 3V32A 5JECA 4KB5A 4LRYA 2JIMA 1XGKA 2WU0A 3BXXA 3K72B 4R1PA 5ADWA 4FNGA 3DULA 1D2AA 3VV2A 4D4IA 4DEXA 1BJKA 1TYBE 5GADl 4MTOA 3I6QA 2WTUA 1GTRA 1SQQH 4O1MA 3G0HA 2ZIMA 4JYZA 2KLBA 2KBFA 3BMCB 4LVNA 3T54A 3WIOA 1RQ2A 1X7YB 3KXDA 4EHNA 2E4XA 2BE7A 3L7JA 4WF9V 1LUAA 4JEIA 1ZYUA 2QRZA 3KNZA 3SQOA 4FB5A 2FPIA 4A2CA 3VNRA 3E8BA 2VXCA 4AL4A 3QKIA 4JUFA 1GTSA 5FADA 4IRMA 3UOWA 4Q47A 5FNZA 4OFZA 3K8YA 3L9DA 3I76A 2YJZA 3D3EA 1FDUA 3DAOA 3EUEA 5AR1A 4DN6A 1AKNA 1SBCA 1U2DA 1YAJA 1ZXXA 4L74A 4A5SA 3K4HA 4RWUA 1VP3A 3MHHC 2CW5A 4DV1B 1RTTA 2E5LO 4FXOA 4IQ0A 3I3SR 4X3PA 2R6JA 3B60A 3IQWA 2GFQA 3QELA 3WL7A 1U0BB 2PM8A 4J0IA 4QU9A 4RNCA 1ULUA 3NT5A 4ZFNA 3TW8B 4EVRA 3J81M 1S8OA 2VPWA 4JLOA 1EGHA 5LMNB 1OWPA 2XQIA 3NVKE 4LDZA 4OHUA 4W82A 2I54A 3I5YA 4DR1O 5J58A 3CCSF 2QD5A 1JHUA 2ZBRA 4LZJA 4NABA 1ADCA 3GJYA 3MMZA 4JF3A 2XAHA 2HEGA 5EZ5A 3SS8A 4YV2A 5BW5A 5IXSA 4IO0A 4MLDA 5ALOA 4QDZA 4IUCS 2MYNA 1PS8A 3QI2A 1RJWA 3HB5X 5CNKA 2WY2D 5LDHA 3OFVA 4O3MA 3UWMA 4YAGA 5IANA 1ND6A 4K0RA 4L9WA 2M6RA 2WOOA 2N42A 5F4BA 4BNHA 3UOAB 1ZVVA 3CCFA 5IE9A 2P9GA 3FMGA 2Q5IA 2JBHA 3COJA 5KBYA 2ZXWB 4XTRA 3UT5A 5A4FS 2E5LB 4TQDA 1VPLA 3O75A 1CEXA 3OMWA 3QNMA 2KSDA 2D5IA 4Q1VA 5CD1A 1OC2A 3FCXA 3DW1X 2UXDB 1MO3A 5L3CA 3LW7A 5AO9A 4KITB 4TSKA 1EVZA 2CVQA 2LGWA 1LV7A 4JP1A 2E87A 1G5FA 1U8AA 2WKPA 4URYR 1DWUA 5B1OA 3L18A 1N1MA 2E7ZA 5K0FA 3GAAA 4NZMA 5EMKA 3U3KA 2QIOA 3REGA 1VIBA 2I80A 2R44A 4JENA 1YL7A 4PN3A 1RZVA 3N76A 3VPHA 2B8TA 2YBEA 1CX9B 1DQSA 1IFXA 1SHZA 2QTCA 3BMNB 1AO3A 1J9EA 1RM3A 1V1MB 1Y1SA 1YS9A 3BKWA 1NVFA 4LCEA 4FOPA 4RV9A 1RC0A 4DWWA 2ONZA 4LMBA 3W06A 3TL6A 1U1FA 3ZC3A 3ZPXA 5L3SA 2ZZMA 2D3TA 1TJNA 3E18A 3N86A 1PWZA 3PX7A 2BE3A 1OXBB 2IKSA 3B36A 3H3XA 4UVCA 4GNKA 4B80A 2XV1A 4JGSA 1QQTA 1TIKA 3E3OA 2QRMA 4KSCA 2F93B 5JD4A 5EAZA 3F5MA 5LUAA 2XMRA 5HXAA 5JE8A 1BXRB 1NSFA 1L4HA 1KRHA 3F7VC 2C5GA 3H1PA 2UXDO 2ZZNA 3EFBA 4CT0A 2AG1A 1Z39A 3JU3A 5EIAA 4EW3A 5EWMA 1VL8A 1NIJA 3D7MA 1DT5A 4DOMA 2V9CA 3ERCA 4F86A 3V1TC 1PNKA 1H1LA 1P2FA 4LYGA 2IELA 3K79A 3DT8A 4MO9A 4IMJB 1BD3A 1JX6A 1E1DA 4WBNA 1BZKA 1JFVA 1BCSB 1QHYA 2HLHA 3GPIA 4RJIA 5DNWA 4F1WA 1IPAA 1KMMA 1K66A 2Q6LA 1TU0A 5DM0A 5BR8B 3KOXA 3CKLA 3GWOA 3EXIA 2CYBA 1R00A 5KCMA 1UUFA 1U4NA 2YFHA 2YH2A 3DVAB 1XRLA 3F98A 3QKTA 4CU5A 5IFLA 2HP8A 2BCEA 2AS0A 4E2LA 2E74B 4WFHA 5GGXA 1FPMA 2QZPA 1WP4A 2P0AA 3P0JA 1O95C 1YR8A 2J9FB 3JQGA 4M0EA 1R9GA 3U3DA 4YCNA 2GBPA 2C4WA 3FD9A 2W2TA 3K9WA 3MHTA 3BRWD 5DMXA 4JP5A 3K0DA 2H5JA 5IU6A 5B5SA 1OLUB 4H1WA 3QVLA 3ZQ4A 3ZDBA 2O8DA 1M74A 3MSXA 5KWEA 3C43A 1GT91 1POXA 9ABPA 4P58A 1DWOA 2O48X 3REFA 3R44A 1FSSA 2V7QG 1QR2A 3ADBA 4CTNA 4HNSA 5JJIA 4E14A 1QYVA 1E8MA 1E18A 3CMAF 2QENA 2ZYAA 1DAEA 3QJYA 1JKJB 1XILA 2OCPA 4DV3O 2OXRA 1ZUNB 4FFWA 5IYZB 3PQ5A 4R84A 1W1UA 5E38A 2ZVZA 1B0UA 2HFKA 1K89A 2GRUA 2NADA 5BRJA 2XCOA 1B42A 2HHHO 2O2DA 3FKSD 2BSXA 2IIPA 4FEYA 5FPQA 3BZWA 1MN6A 5F2VO 1FJ2A 1PJLA 1L5ZA 1PJ2A 2CJWA 3BL5A 4M9XA 4CH5A 4OA5A 2Y48A 2AEFA 3LLCA 2ZJBA 3MJDA 4FYWA 2J3LA 4IV0A 4DCMA 3KB8A 5JY6A 1VG1A 4RKQA 5J1TB 3D54D 3PNQA 5JC8A 1FE8A 1RI1A 2IOQA 2R11A 1BMFA 3VJRA 5KOHA 4OFBA 2XPCA 3BWMA 1GRQA 4IH4A 1DZIA 5GTHZ 1PZFA 1VDZA 5LFAA 3Q8LA 1WUKS 1EDBA 2DWPA 4P33A 3K09A 2PUCA 1U0SY 5TISZ 1AHHA 3CGWA 1DKUA 1CD5A 3LU1A 1PZHA 1FDIA 2CLDX 2OFOA 2UVPA 2YX1A 1AKUA 3OCYA 3HY6A 1IY9A 2ZI3A 5A6VA 4OXSA 3MAAC 3F5SA 4HN4B 1X25A 2GYVA 2C31A 5FA8A 4R3UC 1N5IA 1XTKA 1PK9A 1VG0B 1KNKA 5EBWC 3CU5A 4JV5O 3DE0X 3KQTA 4CRWB 1NE2A 3ENZA 3LJKA 2RHHA 4MS4B 4QXAA 5IARA 4BX2A 4EHLA 3PXEA 3RV3A 2G67A 4MUJA 2IDJA 4PAQA 1VJDA 3PG5A 4FR5A 4S12A 1FB5A 2PMKA 4BDTA 3LC1O 1JR2A 1YBHA 4GM1A 3IEIA 4A8TA 3EGIA 4KVFA 4MW2A 121PA 4XUCA 4PC6A 3SMQA 3BD7A 3WYBA 5HRAA 3QX7A 2Q7DA 1XWIA 1LRKA 1AXGA 4GOJA 4TOIA 1KZGB 4NZPA 1N0JA 3W5HA 1E0KA 1IZ8A 2P5SA 3O31A 2XX3A 4CTKA 1Q90D 2W00A 5CLHA 2G9ZA 1OPRA 3KU1A 1TUEA 4HAWA 4R8VA 2TYSB 1LLQA 1MH1A 2ZIXA 2I99A 3PD0A 3U5ZB 1SBNE 1D1TA 4V0NA 1XZJA 1C9NA 3DOEA 1O5OA 1FUYB 4JP2A 3L5KA 5FOXA 1MGOA 1NJ1A 1X7WB 1NW4A 3FFMA 2H1FA 4PG5A 5IDVA 1MEJA 2CMHA 2XF8A 1OX4B 3OURA 4QGAA 3EHBB 2GZMA 1QYIA 1ECLA 2VBCA 5T41A 1FNMA 2VUTA 1GAEO 1XQXA 2WKRA 3CSSA 2P06A 1NU8A 3GBVA 2WIAA 4AO7A 3LIPA 3OQMA 3R20A 1WSWA 4GEKA 4X84A 1UZAA 3BSSA 4MKZA 3G2OA 2VZ0A 4QUEA 4TQGA 4AW9A 1MA1A 1AGYA 1JHXA 1GU0A 2C2KA 4P4SA 1V16A 4QG3A 3Q8XB 4F06A 1E66A 3E2MA 3HCFA 4BC1A 1Q22A 3TZKA 3VTKA 5AVOA 3LLMA 2O4CA 2J3EA 3VC2A 1A27A 2FX3A 3D36C 1SKYB 4I9UA 3DDOA 3EULA 5BXQC 2PPLA 1ULTA 3OZVA 1QS0A 1QV9A 4ZT5A 4CLDA 4DA7A 4FM1A 2IYLD 4E13A 4C6TB 4B74A 2G76A 3ELUA 1N4AA 1T9HA 3P7MA 4D9EA 4BR6A 4ZDJA 4U7DA 1PT8A 8MHTA 5DGDA 3LLVA 1TQ2A 4ESEA 4R2KA 4E2WA 1BXGB 1A8QA 2BZ0A 3GEPA 1QSGA 1TVEA 1X1BA 2XNDD 1X2BA 4M7OA 5H4HA 3ZHXA 5FPKA 1TUIA 4GH5A 2GEVA 4B9AA 2H85A 3WLFA 4BNYA 4E3ZA 4ZJZA 2W2MA 4HWKA 1HO3A 5IPFA 3UMVA 4IZIA 2PI5A 1C0PA 3IBGA 2B8WA 3FX7A 4KK3A 1M66A 2HGSA 3GA5A 2RHTA 1YRLA 4UARA 2NZXA 3L6DA 5ALPA 1IBRA 3PNOA 2G83A 2AE2A 2ZIEA 4IDQA 1H2KA 1DBFA 3I3FA 1QWSA 3UYLA 3BULA 5C31A 4JX8A 4RPLA 4LFAO 2JA1A 2BBTA 5F1PA 3HJFA 4KAFA 1NWHA 2JCYA 3OWHA 2ZDIC 2FWJA 4I81A 4ZK7A 2C5FA 1YRHA 3LWNA 4PDRA 2ZYUX 1P6QA 5HKAA 1D1PA 1F2UA 7AT1A 2Q50A 2UUCB 3QXJA 1B3QA 1P5RA 2CJFA 2OD9A 4FX5A 3DDNA 1EFPB 3DMGA 1L7EA 2CTWA 1RXEA 3VH4A 1OWOA 1WB5A 3OM0A 2HD4A 3JW8A 4PAGA 3RSHA 5FPOA 1REQA 1RXUA 2QTWB 2JAPA 4I55F 4TL9A 3CP1A 5KSYA 4QPPA 1PZGA 3O21A 4Y1RA 1ADGA 3CPQA 1HZZA 2E82A 3TD2A 4DQVA 5KAFZ 3SDLA 3UTDA 4F71A 3DCJA 2D4HA 1TKBA 4JBLA 4PNEA 3NAMA 5DF1A 2ZWMA 2AG5A 3EVBA 3LDUA 3LZ6A 5BYJA 1KI9A 1RCFA 4L3VA 4XSVA 5FAKA 4G0MA 4S2UA 2BPOA 2J0UB 4ZHQB 2Z56A 2A0KA 4FOLA 1W4CA 4GKAA 4PSUA 4G0UA 1HFKA 4HX5A 4KUGA 5B7PA 4I4TB 2ZWIA 5A9GA 3VU1A 4KMOA 1NUPA 1QGDA 1X1TA 1YFKA 2IU0A 3TTVA 4AWXA 2AFHE 4M83A 3MELA 5L3QB 5C8YF 4K6KA 3UXHA 1GU7A 1VLMA 2NM0A 3M83A 2B36A 4GKBA 2PIAA 2X3FA 5FTWA 4YRIA 4WADA 1ZPDA 3ISTA 4ARZA 2LJ2A 3DB1A 5DYIA 1XDUA 3ZBPA 1Y76A 3E9YA 4JT4A 3KOYA 3KCYA 2CL7X 4D45A 2GXUA 4YAJA 2H00A 3A3OA 3AP1A 4GYCB 1GPKA 4PVDA 4N5HX 5TSDA 3D8HA 1N5OX 5CDGA 1EU1A 4ZQHA 2V7UA 1NLUA 1KZ7B 5IAOA 2B82A 3M6FA 4FZJA 2OGUA 4G1FA 5DIZA 2QSYA 4MAAA 5F2NA 5KHIA 2NNWB 4GE0A 4CHGA 3HR4A 2EDCA 3HWX1 4LSZA 1QJCA 2DYRC 1VECA 1RM1B 4QREA 4PHCA 1ZUQA 5KNLA 3U9TA 3JZAA 4G56A 1S2IA 5MN5A 2YXNA 4P7BA 4U0KA 4BFLA 3V1YA 2CNOA 2D1RA 4L6CA 4ZI5A 2F1IA 1BL8A 2IYSA 1YONA 3EW7A 2G7MC 3FTDA 4HH4A 4MWDA 3WJPA 4QBKA 1GTL1 2M98A 3A6JA 1KI6A 5JXHA 3QU7A 3IIIA 5I9SA 2ZE8A 2Q6TA 1VQ1A 2DEUA 2IL1A 5L3GA 4QPDA 221PA 4P34A 1V5EA 4B87A 1SBTA 2XXJA 4W8OA 3TQCA 2HRRA 1QDUA 3H0EA 5I3CA 1NDUA 1ZITA 2HL6A 3DL7A 4QFBA 1JT9A 3SBXA 5KX5F 3QYPA 2ZRPA 2WLKA 1ES9A 3A9RA 4GM4A 4MQ6A 2HJDA 1WF3A 2XDYA 4OKSA 4QWWA 3SNHA 5B3SB 5IVIA 2RGNA 4MXDA 2G9NA 1LVUA 1V2GA 2F8MA 2X7HA 1UM9B 1R3IC 2X5JO 5DCYA 4ER6A 2FV8A 4BIUA 2PD6A 2JNBA 2WSSD 4OLJA 1GTOA 5FPRA 4N40A 2RGDA 3W7TA 1GQRA 2G72A 4MYHA 3IKEA 2HJVA 3LT5A 4PCVA 3JQBC 3L7LA 1EB8A 1X9GA 1J20A 1JL3A 1SZQA 4L8YA 2Q5FA 4DBLC 3OLZA 6AT1A 1ORHA 3PITA 1T6YA 3EGOA 4X8LA 2ONJA 2VLIA 2OCYC 1YRBA 3EBLA 3GZJA 2ZJ2A 1MQAA 1OLSB 3H5LA 3GNQA 5HQTA 3QO7A 1R6UA 3C8UA 2F9LA 1AK1A 1WEHA 3T41A 5KUKA 4RIGA 1H2SB 4X60A 4YLYA 2B6NA 5KSZA 5B1BB 4K9LA 5EQTA 2ZDGA 3U3RA 1J2RA 4C29A 1S3IA 1NURA 2HKOA 1ULHA 3C7DB 5DK4A 2AVNA 1WB8A 2AOTB 4EPTA 3QKRB 1PJ8A 5KVCA 3AINA 3CXUA 3HKCB 1K9MH 1GU1A 1TMKA 1VSVA 5EJ6A 1ZRMA 3DC5A 4N6GA 3SHFA 5JJLA 5K8UA 5HUJA 4JBWA 1IOVA 3HCOA 4EMUA 1T9GS 1IXYA 4RQUA 4G1CA 2W6IG 3JSAA 2QTLA 3BB1A 3W4IA 5CDFE 1YZHA 3GFBA 3CE2A 3K4QA 1OLOA 2IXEA 3ML1A 4HYYA 4MLZA 5U9CA 1AV6A 5EEGA 1KK2A 1XL4A 2Y66A 1R0XA 1VMDA 4TZTA 5ILGA 1YCIA 3ROXA 3WLLA 5IUNC 2H2AA 2P4EA 2VS0A 1Q1ZA 1USWA 2GSWA 2ZSEA 1ZOOA 2QMUA 4HEA6 4Z0TA 3TAUA 2BMDA 2VF8A 4KV7A 3W05A 1DVRA 3NM5A 4CS3A 3K9AA 1NJ2A 3BWVA 3M2TA 3TNJA 1BEUB 4J4BA 1C7JA 1XRSB 2I4LA 3K6RA 3C98A 3DPUA 3PXBA 5J2TF 4I66A 2EILC 3RTDA 2ID7A 2B78A 1DXQA 2Q8PA 4A27A 3HVUA 2XDWA 2QI2A 3B8EA 3H04A 3E7PA 2RBEA 2ZSBA 1IY2A 1K4MA 2IZZA 1W57A 4I3FA 4Q1FA 1TK9A 2GI4A 3LHIA 1YBAA 3BA1A 3K71B 3V1LA 3FCCA 2W0FC 3R41A 3CN7A 1H5QA 4TKMA 3T95A 4H9GA 3BE8A 2JHAA 1JU9A 2OZVA 3ZW7A 3G7SA 1MABB 4ZXFA 1M2HA 4EF6A 1RM0A 4QDOA 2QM8A 3FPKA 1SVWA 4K9MA 3KT6A 2WFZA 4GF5A 1NH2B 3KTDA 4B47A 1GZSA 3NRBA 3H11B 1ETHA 2FPPB 1YB2A 2QTNA 4KQCA 4PCUA 2YXZA 3OX3A 4TWRA 4C0JA 2AQKA 3WV4A 1KC3A 1XZIA 3GFPA 2IJIA 3DBLB 4S1VA 3RE1A 3RVZA 4RMIA 1ILWA 1MXHA 4MTFA 1NVEA 2D59A 3HE3A 3KD2A 1KY3A 3CUWA 3NBZC 1IHUA 1B04A 1AGNA 1JWLA 1EFRA 4QOIA 4LOHA 1F4MA 3KQLA 3KQMA 2GN9A 4UQOA 2UYYA 2K4MA 2ZYRA 4R1MA 2HHLA 1QQ7A 2OCBA 3KLNA 2G1PA 2YDEA 2ZIAA 1EX6A 2WWHA 3HL0A 2Y6VA 3IT0A 4Z9BA 3K9NA 1H69A 4N0QA 3DOUA 2R9IA 2OECA 4P4NA 1N6LA 4B85A 3RYFA 5GIOE 2OM6A 2GZLA 5IVHA 3AKCA 4N7MA 1P7YA 2IBSA 3VOAA 4S04A 4ZKIA 2GPSA 3AKDA 1VHQA 2GT1A 1KDPA 1ACJA 3GBPA 3H5RA 4OSEA 2CVPA 4F9TA 1DELA 5JYDA 4INZA 4OJKA 2PGDA 1E7WA 5TJHA 2NVBA 1SXJE 3D1VA 3OT7A 2X2EA 5CBKA 4LXGA 4RF5A 1DJPA 1MD9A 1KY2A 4EHDA 2A7QA 3V8RA 2JAWA 3ZMZA 2MYTA 2UAGA 4FYMA 1IZYA 1MAAA 2O2GA 5EHZA 3SYKA 4U0JA 3D9QX 3SFZA 3H97A 3FLBA 3OT4A 3NHJA 3TJRA 1I7DA 4JI5O 1GOTA 2BSKA 1W94A 2FN7A 4DLAA 4CTMA 1G1AA 2OCCB 1B3BA 3N7AA 1E7YA 2NNUA 3VGPA 1H6CA 1I2MA 4ICIA 5CH8A 2AK2A 4RPIA 3SJBA 3UH0A 1ZEJA 3EF3A 2H29A 4XYLA 1HQCA 4JAVA 1ZD5A 2H7VA 2BKXA 1HNZB 5T8KA 5K01A 1HP8A 4JU8A 5CFNA 1CPYA 4AI8A 4ER3A 1PZNA 1U9IC 1E5LA 1U63A 1P4JA 1Z8FA 1N57A 5K5EA 3GFOA 3NPMA 4MUIA 1E3WA 1EUDB 1O6FA 4F9GA 2X5NA 5KIAA 4I3HA 1FTYA 2R7AA 4CF3A 4ZVSA 4MQEA 5T4HA 4YXWA 4LJSA 1JQAA 2YVQA 1IRXA 1GPUA 4D7AA 2C58A 1WABA 5MGNA 5JSZB 5AD1A 4BQNA 1CUSA 1GILA 3IT1A 4NEHB 3W5VA 5KVVA 1Y37A 5FWAA 1XAIA 2OCGA 2CWDA 5TQJA 4XGNA 3WJAA 3AEZA 1IBKO 3NONA 4LY6A 5FBHA 4DLKA 4NECA 4MR7B 4EG1A 1MC5A 1MX3A 4ZHSA 2BFDA 1RXIA 3CZ5A 1V5WA 2R1TB 1XCOA 1UJ6A 4LW8A 4U9UA 1F60A 3H2SA 4XM0A 2G0AA 1BROA 4RDHA 4F3TA 2GBOA 4I0XA 1W73A 5KVQA 4KL8S 3OUFA 2OYCA 3SDZA 5ES4B 4W5TA 1MZVA 3E7WA 5TF0A 2ATIA 3A9TA 2GNPA 1M6VB 3OIDA 3P0IA 3ZEAA 4CMGA 2LVBA 4TLCA 3GLHE 4ZYYA 3QYAA 5H4GA 5JAUA 4JBXA 4HNVA 1G4YB 2ZJ3A 4PINA 3VAZA 2GJ8A 1P2BA 1JG4A 1XNGA 2WZBA 4FOOA 5ALTA 1R6NA 1A9XB 1K8XB 2VHEA 4WY5A 3IMGA 2QTPA 2BFPA 4OX9O 2D7JA 5EP2A 2G6BA 4AZWA 3GB9A 1PJBA 2Z83A 1J0DA 2DE0X 3U37A 1ECGA 4GYKA 4L4ZA 3RHZA 5IDWA 4NQZA 4LJ4A 2ZU0C 4XM1A 2GM3A 3I83A 5DO9A 2WWVD 2X76A 4BJ5A 1AN0A 4WXMA 1K6EA 3DEZA 4KFRA 1QR6A 1GRCA 3PL5A 3CF6R 4PANA 2IEIA 5AOBA 5ELMA 5HM6A 2RGRA 7MHTA 2VNJA 4TVBA 3U48A 4F3YA 8ADHA 2W6MA 4G0YA 1Q15A 5LOVB 5EHQA 1YKFA 5DI3A 4WX2B 1KQPA 1NZDA 4P4TA 1SCQA 5H02A 1M1UA 3IPCA 2F95B 1U97A 2JNWA 3DD5A 4FINA 1H2YA 3CB4A 2VR1A 1V1RA 2W93A 3NAQA 5KOJA 2PS0A 2ZI6A 3QVGB 4BGVA 3DAPA 3JQ8B 1EFCA 3I1FA 2ZR0A 4OQXA 5IAAA 1QGED 1Y98A 1NFQA 1A8PA 3Q40A 3STHA 2RDCA 1DQRA 1ODEA 3VNVA 3GJ7A 2Y4TA 2PQ0A 1I3LA 3N6XA 1ADBA 4KWIA 4ROSA 4H0LB 1A7UA 3FTPA 4JX9A 2YWHA 3GK3A 4L5CA 4NF2A 5B1DA 2C99A 2EEPA 2GYUA 3H7IA 4KI7A 1VMAA 2YJ4A 3DMPA 1KD1W 1FNBA 4NRDA 3TD5A 3MRTA 5DZSA 2A9PA 2VP5A 2AMVA 1MO6A 2QPTA 5EO3A 2M6KA 1WVMA 3SSNA 3D36A 1KZ4A 4MV1A 2CMGA 4NZOA 5LXTF 3FGZA 2VZLA 2O8CA 2R65A 3GUHA 1SG0A 4HNAA 1VSUA 2NSJA 5JZ9A 2EC5A 3H8JA 1EM1A 3GDGA 4EG7A 1SU8A 2I2WA 4LYFA 2LKDA 3ZRWB 4KYUA 4NYMR 5G41A 5GIOC 2IHNA 1H2LA 1HC7A 3DHYA 3U9LA 1X87A 1Y4SA 4D8XA 1GGFA 3PRKE 2GUZA 4U39A 1D2CA 4P4LA 5CJPA 1WP7A 4ZYTA 3LDHA 3WGQA 1F1JA 2PGJA 3CW8X 1N5LA 1OHHA 1Z2EA 1Y6QA 2WKWA 3EC1A 4P36A 5C3MA 3KUXA 1UBCA 5EESA 2ZWAA 4NMMA 2X0EA 1ZU5A 3NJ4A 3M70A 2FJPA 4RA9A 2H6EA 5HMMA 3VSEA 4BDSA 2BEVA 2EIXA 1K7FB 5FV4A 1UXKA 2VUIB 2HM7A 3AWDA 3QM1A 5AJHA 1P2SA 4KQ9A 3ASNC 4UB8Z 2D1SA 1COWA 1KNJA 2J07A 3Q7QA 3QVUA 1JDBC 4OSOA 5K6AA 1AMNA 1VPWA 2FAXA 2QT0A 2G1JA 4MK4A 4Q00A 2VA8A 5DNCA 4DRYA 3OZIA 3ADDA 2GLTA 2Q0OC 1Y76B 4BP8A 1E9EA 3OPNA 1GTG1 1KJ8A 4C2TA 5JAHA 4G23A 2GVDC 4K81B 3GRRA 1OIVA 4IVRA 5CH3A 1VDMA 1M5RA 3GFGA 2GN6A 1KMHA 1M0WA 3PJGA 3U3JA 5JV5A 4DAEA 1KI3A 3ZUPA 2HCFA 5AIBA 3ADCA 5T4FA 4TT8A 3PFGA 1GAWA 4H59A 4DSUA 1L7BA 4I4TF 4K9QA 3L8HA 3LO5A 4C78A 3T5GA 1HDXA 1Z26A 2PL5A 1DIRA 2I34A 3L7IA 3ZWCA 3A0RA 1XZLA 2OKGA 1LKZA 1VI6A 2NU7A 1OV9A 2D3WA 3LQYA 3KX2A 1I8TA 3QLEA 4FCTA 3I01A 1P72A 4CV1A 5C7OO 3ASZA 3RIMA 1TGYA 3JAMM 2XQKA 5KTOA 2H51A 1Q6ZA 4Y1EA 4C7JA 3SYAA 1YCHA 4NR1A 1AF7A 2YJ5A 4NXMO 3BF8A 3ND7A 2ASVA 4GOKA 1SHKA 1AJEA 2W2NA 3GH3A 4WN9A 1YOVA 4G25A 2XRYA 2LKCA 4QATA 4QQRA 3QHAA 2NU9A 3B8MA 1RLGA 3INNA 2WFMA 2JIBA 4K9DA 1VLVA 1SN7A 2OBNA 3QK7A 1DJNA 1HTTA 2EVWX 4FYIA 3CUUA 1CVLA 1JJIA 2CVLA 4MJ3A 2CXRA 3C7AA 4CM5A 5AI0A 2NU6B 3KJZA 4FZ1A 2EJWA 2MWMA 4G1MB 4I19A 4US2R 1C0IA 4G4VA 1NJGA 1XVVA 1SD5A 1Y7PA 4XOUA 3NOXA 3LLUA 3E0XA 2B83A 1J23A 2GF2A 4IIDA 4Q82A 4TZ0A 4L5YA 4PHZA 1KAQA 2HYDA 4XX0A 3DVRX 2Z1MA 3P9YA 4YP1A 3AG2B 1USUA 1BYIA 1HWYA 1YIAA 4XVRA 1GKLA 4BZWA 2QX9A 3P96A 2RMKA 5JNWA 3FDZA 3Q98A 2H4JA 4E2YA 8GPBA 1PR2A 4BXOA 4L75A 5FTLA 5CYFA 1WCIA 3BZBA 2NTVA 5E2AA 3GLKA 2QPOA 4GAEA 3TLYA 2C3MA 4RHCA 3LDEA 4YHHO 1DT3A 3QVSA 4YB8A 1JIKA 5CIQA 2FSIA 1QVFF 1QHHA 1SHJA 4OHZA 1JB9A 5JS2A 4F2WA 3BIFA 1W581 4YAIA 2PTHA 1RLIA 2V58A 5GVRA 3VI6A 5BT9A 5FORA 4LC0A 3RRBA 4AMBA 3KT0A 4OXKA 5JRDS 1Q0LA 1SUDA 2Z1DA 3LQFA 4DQUA 2V7PA 4Y6PA 4TZ6A 1WDWB 4I5GA 4XKJA 1MEOA 3OUSA 4LGCA 3MS7A 4A0HA 3S2FA 2YJ3A 1OKKD 4JJKA 5FXMA 2XCRB 4F4FA 5IT4A 5A5EA 3VKUA 4YUYA 3QFCA 3JTMA 1S8NA 4HD8A 4R1TA 1PUIA 4FHGA 1QUEA 2GFHA 4QGHA 1YJNV 2A59A 2EZ9A 5TY0A 3R0ZA 3LXXA 2WU8A 2VQSA 1R0LA 3O3MB 3PGLA 1CWUA 3OFSA 2G08A 3SHOA 3ZOZA 2NP7A 1PX0A 2RI1A 2ZI9A 4Y30A 4R1SA 4BNIA 4PIPA 4R3NA 4HT3B 3AHJA 1LLDA 5K0CA 2O1XA 3C39A 3PDWA 4M22A 1E2GA 1QB8A 1N2CE 2CUGA 3KQSA 3MJCA 4ALKA 3BL6A 3C5HA 3ELBA 3B5JA 3OQJA 1TZBA 3DBOB 5BW4A 1YVPA 1X7DA 5HNKA 3X2FA 3LDTA 5JS1A 1JEJA 1G5IA 4BNWA 4XIGS 5HGJA 1EQUA 1C0KA 3P4EA 2XI4A 3G0DA 3OECA 4DDUA 2DG2A 2WG0A 4Q5IA 3GA0A 4IIYA 4PXSA 4RVHA 3W4JA 1UJ4A 4RZHA 5LIRA 4A4DA 5B57C 4ZPXA 3FM9A 3MJFA 5EP4A 2B99A 5GJCA 2O3QA 2QV0A 4Z1MD 4WOCA 3UO3A 3QKRA 1R0CA 2C59A 3M5DA 4UTOA 1L5MA 1NVVR 2WLLA 2W2LD 1DIGA 3BEDA 3L8MA 3BCRA 5GMOA 3UO2A 4I9GA 4OIMA 2XCTB 2BR5A 3MILA 1MQ8B 3L0SA 2FMLA 1O9GA 3F5FA 2QD3A 3FTCA 1CS0A 1EE1A 1FOEB 3E4CA 3ZZMA 3EPHA 1IIRA 4QPJC 3W8DA 2H2HA 3FI9A 1JH9A 1DCKA 4HKTA 5KWJA 4A10A 4MIYA 3ZQJA 3TETA 3AVUA 3UK1A 4X94A 3WNZA 1W29A 2ACEA 4RPHA 5FHRA 3ODPA 1ZIPA 4AQYO 2JGNA 4MVJD 3UHOA 1XK6A 1SAYA 4DUPA 3UFXB 2R1VB 3K6KA 3B6KA 2ECPA 2HLNA 3KOUA 1VRCA 4MW8A 3IILA 4MGZR 1C4WA 4NS1A 3ZUGA 1UKEA 3R5FA 3PVSA 4YH1A 1NR5A 4XRGA 1XO1A 5FKJA 1IZZA 1HMYA 3ELWA 1QBKC 3OU2A 4D4JA 3G67A 2H9IA 1L9KA 2VJYA 3AB3A 3CVWA 1IN5A 3NKVA 3QWHA 4CZZA 2SICE 2TSYB 2CXTA 4CCYA 1L7RA 3ZJVA 4GGOA 4UZFA 4PELA 3X1MA 3S7ZA 1TTHA 2EZ8A 4B9EA 3FWNA 4RD6A 2XYPA 1U40A 5J4YA 3LYAA 3CH4B 5AKGA 1VQMF 1NWCA 3SBDA 2WP8J 4FDMA 3TLAA 2HU8A 3EG9A 5K4AA 2VHWA 1M54A 3GJ0A 1XTRA 3B13B 3SPJA 4OGGA 1Z6YA 3ESRA 2OB1A 2G5GX 4GGPA 4DS3A 4IL6Z 3DUWA 3GZ4A 4HQKA 4OHVA 3S4YA 1S02A 5FUMA 1XVTA 1KYWA 5A4JA 1VF6A 2WHEA 5KYVA 3NHWA 1TQ8A 2YN4A 3DR5A 1OE0A 2XE4A 3JYPA 1MG0A 4YRFA 3OU7A 4YX9A 3I58A 3IH5A 3K04A 3PGMA 4TTJA 5AKXA 3LTNC 1V54B 4CM9A 1BH2A 2JIRA 2AYZA 4PYLA 3WWDA 3LDAA 5EC2C 2JFZA 4ZIBA 2RH4A 1QIGA 2DPGA 4Y1FA 1BSVA 3I12A 1U0TA 3IKMB 2WLMA 3ISJA 3IX7A 3K2EA 4HXFB 4JASB 4KXLA 4NU6A 1PUXA 4C4XA 2CK3G 1MAWA 4JI8B 2GQ0A 2JGFA 2DPLA 3A14A 3E05A 4X64B 4KN9S 1ISSA 5E9AA 1ATIA 3TOSA 1GSIA 3UJAA 3RGGA 2XZTA 2J3QA 2Z08A 3PQ7A 1WJZA 3LSQA 1EG7A 2Q9BA 1P5HA 2W22A 3AU9A 3DFZA 4GI2A 4LDRA 2JK0A 4KVZA 4PHHA 4QFCA 3J80A 4TZKA 4NOLA 4B09A 3S1LA 3CE6A 1SELA 1JE0A 2IEYA 2Q3LA 4UHKA 3JR7A 2CBXA 1DC6A 1NLFA 5G1NA 2XDQA 3WB0A 5BV1A 3BVOA 2GX6A 4Z0PA 1YFJA 3N2LA 4KN8A 3CCMF 5JJNB 2IUTA 1QIJA 3CSUA 4LCBA 1M1YE 3TGLA 2AN3A 4RZSA 3F4LA 4MYCA 4UM7A 4RK0A 4TL8A 1R3JC 2BVNA 2CFSA 1U3FA 5H9WA 1C7IA 1EH5A 2QK4A 3PEUA 4M1MA 3ABSB 1W30A 4IUBS 1DBPA 2HEIA 3ABUA 3MXOA 1JVSA 5AJVB 5H7XA 1K9VF 4D5EA 5K09A 1NXTA 1XPRA 1B8UA 3NS7A 1A9YA 4RA9B 4AY2A 2P9YA 3F2IA 1L5LA 4UD6A 5FWYB 3F67A 1QX3A 5L3SB 3M6AA 1SWVA 2KTUA 4ASUA 1J06A 1ZZGA 3JWIA 1RR6A 1ND5A 1OX4A 3OJLA 4LIPD 4DABA 721PA 5C8ZA 4J1TC 1RFYA 3DYIA 3KCNA 4R51A 4UCTA 1R6AA 1NMQA 1VL2A 1P81A 2I1VB 2ONYA 3C97A 3CG0A 5EYPA 2OD7A 3ONVA 5DCWA 3T99A 5LA6F 2KPOA 1CY4A 1W6UA 2B5WA 2DMRA 2B1GA 2JLAA 3P2KA 3P9QA 3PXDA 4KZPA 3VVCA 2JEYA 4EB3A 3KP1A 3M6XA 5AW1A 3JARA 1T6ZA 2QTVB 1NRXA 3ZGZA 1GTMA 4HBNA 4X9XA 5I4IA 2I3DA 2H7CA 4B5LA 1V4VA 4FK8A 4X90A 1BAPA 4XYGA 1YULA 5T3YA 3GA7A 2I4RA 4FBMA 1SCKA 1YL6A 2CMDA 3AG1C 2ZBPA 4G5GA 4RMGA 5JBQA 3NK6A 1DP4A 1FS5A 5GZ3A 2E4YA 3KSDO 5JSYA 4W9MC 3FLMA 4D9MA 2YJ6A 2XB8A 4FBLA 4MGYR 2MYPA 1RAHA 4WH0A 4C6TA 4IWNA 5I5GA 4Z2YA 2I8CA 4FGJA 3TLGB 4E4RA 4N5IX 1ZAUA 5FI0B 1L4UA 2FUCA 2ZRAA 1P75A 2EBHX 4WNYA 1BMDA 3RCBA 1DAPA 1Z7GA 3GMIA 1K5QA 5EZQA 5BN1A 5IW8A 3T3OA 3W3AA 1IXRC 1JBKA 3IC9A 2N0SA 1XMJA 1LQUA 1XF1A 2XJ9A 3A9WA 3I1JA 3K8QA 3QOYA 5DGHA 2JCGA 2KSQA 4Q1AA 5CB4F 1PWXA 1XLTA 2R1ZA 3DMTA 3E2PA 1TT5B 4BEWA 2DTDA 2XMBA 2Z6QA 2IHZA 1E6WA 4A3SA 2AZXA 1DCTA 4Q66C 5JVDA 1M57C 4H7HA 1XE3A 2PGNA 4CTJA 4IILA 3HO1A 1ZNYA 4ZYXA 2I91A 2ITDC 1QYRA 3I4LA 4ED9A 5LZ9A 2DYRB 4MGKR 1BDBA 5BSFA 3DAHA 1JI3A 2DFLA 1SUSA 1SVLA 2QR5A 1WMAA 2J5BA 3KLOA 4PZDA 3R7SA 5AFSA 1KO5A 5JQGB 3OLQA 3JZFA 3VZBA 3PP8A 1JA8A 3G71V 1NQVA 4LTMA 3ZYZA 4E07A 3ZP7A 3F0DA 1Q0ZA 3DVSX 3HLYA 4GUAA 3BFPA 2BFBB 3RAGA 4X97A 3RVKA 3EH2A 2IIVA 4B7AA 1L1RA 4RO0A 4KP4A 2X4GA 3UJBA 3AUJB 4H35A 4MCJA 2FXIA 3AEQB 2QZSA 3RS9A 4IXDA 3R8XA 1V1JA 5GOTA 1VQVA 3DHNA 3V1KA 4ZJPA 4Y2TA 1V5IA 8OHMA 3VDNB 1E0JA 1XFDA 3PXXA 2ZKIA 3C48A 3O90A 4C7VA 5CBHA 4OHOA 1BWSA 2X58A 2J87A 3DAGA 3HCEA 3PUZA 4YP0A 4A1OA 4AIRA 3EXFB 2ZXEA 2JATA 5HILA 4N41A 2D1QA 3LBHA 4LZOA 3VTIC 1KFBB 4L4UA 3NB0A 3WWOA 4L2IB 4X1KB 1HSZA 1LS1A 4JAAA 1ZRHA 3PB3A 2CDRA 1KYOF 2ANBA 1P91A 4NS4A 4QUKA 3RU2A 1K5PA 2PRIA 2BAGA 2P8JA 3VAYA 1Z7EA 2WTMA 2GCIA 1COZA 2NZWA 2XEXA 4IGFA 4IL5A 5ALMA 3MWLA 2EF0A 2OAGA 3SLRA 2JDIG 1SUAA 4J7AA 4OXYA 1CR4A 3GD5A 4QBHA 4BX8A 5G0SA 4ZMSA 5FUQA 4J1SA 4GVXA 1SGWA 3T7IA 2PO5A 2WLTA 1O95D 4E5YA 3WJ2A 3S3XA 3R77A 4G89A 1U7HA 1KNQA 1SOWA 3G5MA 4LI0A 3U1TA 4E5NA 1DKNA 4OEHA 1WPGA 2ID8A 3EG9B 3H9BA 5BUZA 1HDGO 1MTOA 3CONA 3IEWA 2XBLA 3R23A 1I9CA 4KXMA 2CMFA 1PFYA 2B1JA 4MB2A 4N01A 3TIFA 4UV8A 3WDSA 3U4QA 1FRVA 2WW8A 3I2YX 4BMYA 3PA6A 1EMDA 2O7RA 2AD1A 3UPDA 1R9NA 4IOLA 3JYCA 2REQA 3D4OA 2KGWA 2J67A 3QF4A 1JSCA 3WQSB 5F5NA 3QVOA 2QQEA 3IJPA 1LLCA 3NYIA 5I7HA 5CVDA 3T5MA 4DK1A 2NP6A 2CLHB 4J2HA 4QNRA 4TXJA 4KGVA 2VL7A 3CCUV 2ZSHA 5DWVA 2P1ZA 2F43G 5IDXA 4EHFA 1M34A 2QY9A 4O5AA 3G6WA 5AK6A 1W47A 3OM1A 4QTYA 3O4IA 5E3JA 2JI4A 4M86A 4RPKA 3UNXA 4ER7A 2JPDA 4XJXA 3QUWA 4G5RA 2GGSA 4PEVA 1F14A 1PNQA 1ZA1A 4Z8YA 4BGDA 3V4RA 2Y9MB 4XSHA 5HP4A 3OOSA 2D6FA 4ACBA 3ZDYB 4LXUA 4ZJUA 3TRKA 1JHAA 1FFDA 3MVEA 2WWTA 3DTTA 4KO2S 4YAFA 4LDQA 1RI5A 1EFHA 3RYHB 1JN0A 1YV9A 1C50A 2X5XA 2VVTA 3F9RA 2VHVA 4LRWA 4NNJA 1S5JA 1QVGU 1Z12A 1R4NA 4L6AA 4C1BA 5EKTA 1V5GA 2NTNA 4HLDA 4PDLA 3AF1A 3CIOA 4IP0A 2V7VA 1F4VA 3K9CA 3PKZA 2I29A 4I8DA 3VVLA 1S3GA 1J8MF 1GRRA 5LGTA 3X1JA 2FRDA 3ZV6A 2BDTA 4H13B 1B41A 2ZB8A 4RDCA 1OILA 5A5VA 5FT9A 4JL5A 1L5QA 1UXIA 5LB2A 3FRJA 1ULAA 1XRJA 3FYSA 3T06B 1IEQA 3S0WA 5DWDA 1NDHA 5F1YA 2I8LA 1P73A 5ED4A 1C29B 4MW6A 1VJRA 4NCIA 1S7GA 4IHJA 4OQ4A 4R8SA 1JWAB 1XI2A 3M6MD 3OC0A 1MIOA 2QNRA 3CCUF 3KU4A 1D6JA 2KMLA 3BRWA 3UM9A 1FJHA 2CDCA 1PSZA 4JFAA 5EUMA 3FD5A 1O89A 4IIXA 5ADHA 3RGWS 2IYRA 4NV3A 3K9HA 2EIJC 1DRUA 1R66A 1SPBS 1MU0A 3A58B 2SCUA 3AEXA 2IDZA 3AXSA 1RWPA 2PBLA 3BBPA 4P3NA 4YRCA 4DSNA 4EGQA 3R0XA 5B3JC 1WHTA 2WJVA 3FJ1A 2C7OA 1QV6A 2JLSA 4YUVA 1JMKC 3DDUA 1OJLA 4Y0AA 2XEDA 3RFFA 2J6BA 3CWZA 4RO2A 3PNKA 5LHGA 3RC8A 2IX3A 3HDYA 3FPJA 2JLQA 1GYRA 1U8UA 5ALGA 4LOKA 1PAUA 1GTZA 2BI4A 4M88A 4WECA 3VBCA 4IIBA 4RF3A 3L1JA 3BFVA 1N8RH 3CO5A 3O8OB 3OM8A 3BK7A 4KH0A 1DC4A 2AJLI 3ICXA 4KKVA 2WIJA 3CRAA 3K59A 1U1IA 1GNTA 1OHHD 2PRZA 3AR4A 1LF0A 1NBHA 3ILSA 3AETB 3K9QO 4X63A 3IMKA 3JATB 1ADYA 3LLSA 4WJLA 2EXXA 2C04A 4UPDA 4XIYA 821PA 2XNJA 4Q3KA 2BMFA 3UA3A 1UC8A 2ICAA 4JLSA 1ZLZA 1XQ6A 1OAOC 3Q2OA 5AKHA 1SQXH 1VPVA 1QFMA 1XDCA 1JT2A 3CCBA 5AK5A 2BP7A 1I0LA 1WXXA 2ZE6A 1N0NA 3Q15C 4ID3A 4Z99A 1GN9A 4MV4A 2VDRB 2HK6A 1XAJA 1WZCA 4B84A 4C14A 4LR3A 3T7AA 1B7GO 1DZ3A 1G8AA 1UP7A 5U4XA 3BWXA 1OMOA 4EOGA 1WDKA 3I55F 3E9ZA 3L1HA 3P0HA 5EVCA 3BA8A 4B3FX 1JHDA 5EXSA 4EZIA 4GXNA 1XMOO 4G0VA 2VAMA 1RXSA 2Z04A 4RF4A 3L41A 3SK0A 3PSHA 3FGOA 4D0NA 3V8PA 7MDHA 2CZQA 3D2AA 1Q7YH 3IQFA 2OAQ1 1UFKA 4I8XA 1AC5A 3KKYA 3RRXA 4ESHA 1ABBA 2W6JG 1IEXA 3VO2A 1ELOA 2VRCD 4H60A 1VBKA 4TTVA 5K2MA 4HDMB 2EX3A 1K3TA 4OJQA 3WGGA 4C07A 4MKFA 3I72A 4YO7A 5B7QA 2DP4E 3NUZA 4P3YA 1PU2A 1QPZA 4HAUA 1CIJA 2OSVA 4RSHA 2XYGA 4C81A 3H18A 4WN3A 3WADA 1SK9A 4K28A 4I9HA 4B6RA 5LDGA 4A23A 4BY9E 1QIEA 2JARA 1N9ZA 3AV0B 4KRGA 1QK4A 1LV8A 3QXCA 4XLLA 4G1EB 4G0QA 2FWIA 1HNWO 1P9NA 1QZ3A 3C8ZA 5F2OA 2X0NA 1SWWA 1YB4A 5TMEA 4DDVA 2M6YA 1NXQA 4M4SA 2BGWA 1OJHA 5ELLA 3QTYA 3P2MA 1E61A 4WOKA 1C8BA 5KNDD 3B7PA 4HXGA 4WESA 1ISMA 4RM2A 2WT9A 4YS6A 5AESA 2Q8QA 5ENZA 1Q3KA 4DM7A 2CVHA 4J9ZB 3EY4A 5JR3A 2FWNA 3I6IA 5TQ0B 1COWG 2P5TB 3BQMB 3VR4A 5CN0A 2DJ5A 1QRRA 1HLPA 4YJ2F 1PWYE 2R6HA 4KOAA 5E1DA 1PD3A 1Q7CA 1VIMA 2OBBA 2V4DA 1F9AA 2DUNA 3EHEA 4Q4AB 3V8NA 1KY5A 1FNKA 4R8CA 1E6CA 1TZKA 1PDOA 4H7EA 4IIUA 3OX4A 4K6OA 4AP6A 3QYFA 5I7SA 4OHMA 4JBIA 4EHIA 2B4KA 1YKGA 5FNVF 4BRZA 3WGUA 1WXEA 1U65A 4BFTA 1YF2A 1IG3A 1AQYA 3C1UA 3R3HA 3R3JA 4KI0A 4QDTA 1PWEA 4PPFA 4UFOA 3U26A 4ZRDA 1X4TA 3UMYA 2FYUH 3IEMA 2VGMA 1A4IA 2YWGA 3EGEA 4OUDA 2GCNA 4F6EA 1UINA 1Q17A 1A0OA 3RK0A 3V1UA 1B8PA 3WLRA 1UP6A 4BWAA 2GTPA 1YXMA 2GD6A 4OREX 3R6WA 4FQ7A 4MRMB 3FZGA 3O0TA 5CXUA 2R0QC 1YZ3A 2V5VA 3OOEA 5EIOA 1E59A 1R0ZA 3DVLA 3OQIA 5J5AA 4MRSA 2Z4RA 4AHCA 3F9IA 4P0PB 5HJEA 1CZLA 2O1SA 1WAZA 2IFTA 3B70A 2FWRA 1P7VA 4YJ2A 3IELA 1I80A 3ZHRA 2CNKA 1E1YA 3ETCA 4QSMA 4RQBA 4B43A 4GOOD 2PU7A 3ZXXA 1E77A 4PDVA 5FR1A 1N7JA 3SZMA 4LQCA 1T1SA 5BMVB 2JZCA 3KD3A 1OLXB 3OPVA 4KIFA 1GPH1 3K0SA 2E1PA 2VJMA 3WNBA 2EATA 4HDSB 5BNTA 3JQ6A 1E2LA 1T2UA 4O8CA 5CVJA 2JH9A 5CB6A 4YJFA 3FX2A 3AWIA 4V02A 3PNBA 1ZLYA 3H8SA 3RRJA 3GVIA 3KL2A 3BTSA 5FTJA 2Q3HA 4DXDA 2K7FA 2RARA 3JTEA 4S24A 2KB0A 1AI7A 3JD2A 1H0RA 2BM1A 2JJ2A 3N0TA 4YVFA 1PTJC 3I2GA 1O4WA 3EXHC 1NKVA 4HPXB 3T61A 4BO1A 3B85A 4A15A 3CVVA 1NP6A 1U2PA 3WMRA 2HS0A 2Z1NA 3KJJA 2Z1UA 1MZFA 3TXYA 3JYOA 3EE6A 1I7FA 4EKWA 3AL3A 3WWCA 3RNOA 3EEOA 1RYHA 3HYSA 2C8JA 4W6QA 4NKRA 3VQYA 4A0SA 3ADPA 4Z51A 2F9MA 3KIZA 2PKXA 3O4FA 4DV5B 5LMNO 3ZVNA 5TX7A 3OW2F 1V11A 4NH4A 1SOMA 3WWPA 1Z45A 1YOBA 1XEWX 4Z4IA 3TSWA 3R8FA 3WS7A 4A82A 3PDIB 3Q5EA 3OP4A 3WMWA 3LF1A 4I46A 4DADA 3NCTA 4M0LA 4KUMA 4PHFA 2NYAA 3DMDA 5K1PA 1IM5A 3NFRA 2PL1A 4O5OA 1GN2A 1NV8A 2YVLA 1IV2A 1CF9A 2DH5A 4P5PA 1L4LA 3VYTC 1D2MA 3GT4A 3VOSA 3WKBA 4OOEA 2ETVA 4RORA 2I9PA 3UAXA 1MVNA 1YQXA 4XGQA 1GPYA 4DC1A 2JFHA 1OIWA 1ZO8A 2Q4EA 3C0KA 3K3PA 3IR6A 2YC4C 1V4NA 1A4UA 3ICVA 2XUHA 1MC8A 3A2NA 4RZ3A 3SYOA 1JYFA 2YNMC 3I92A 4BIMA 1YZYA 1O9BA 2YOGA 3GRYA 2K1EA 2VLBA 3TZQA 1HLDA 3CD6V 3LFTA 2QY6A 1CN7A 1K8RA 2Q28A 4L28A 3OWOA 1ZNQO 4XQCA 3ZEDA 4HJXA 2Q9AA 2WICA 2PJZA 1J42A 1EUCB 3DR3A 1IK6A 4BQIA 3GRCA 4OVKA 4ER5A 4LV6A 2N04A 4R41A 4ENTA 3NG1A 2FDCA 4NICA 3U17A 1RRGA 3LPMA 1VOTA 9LDTA 1YJWV 3UOGA 2I4TA 3TW6A 2TMDA 1WUJS 1YO6A 3Q7RA 3ZIAA 1ZLXA 4BLUA 2GPJA 3LOQA 4GMGA 5LKRA 1Y3FE 3DTUB 4KKXB 4DGSA 1PL8A 1Q20A 2J6HA 2VJBA 4U7HA 1KZHA 1ULSA 3QENA 1JF8A 1RI4A 5CYGA 2Q2QA 1SCBA 3OW2U 2CGEA 2ZULA 2Z3YA 3W2EA 4GMXA 4Q05A 3ASVA 4BCBA 1K98A 1NMSA 5BUQA 1LNZA 3I8OA 1DOAA 4FYYA 2B20A 5LWQA 1AQNA 3NI2A 4K9PA 3I9V1 4MV9A 5GINC 2QOEA 2ZYHA 4RL6A 1YNOA 1SQ6A 3QEMB 4YCAA 4ZVTA 6Q21A 1Z06A 2C3PA 2VYVA 3FIJA 3NVMB 4LWOA 4MYUA 5EG5A 3H6GA 4MV0A 3OBYA 5FR2A 1DIOB 2Q1XA 4RULA 3B7WA 1H2WA 3B48A 3S02A 5D87A 1NQ5A 3ZQKA 1K0UA 5CT4A 1I2DA 4IXTA 1ZM2A 2A0LA 1MABA 2LXNA 2HQ1A 4JLKA 1JQJC 3LDFA 1T8WA 4OPMA 2A7WA 4H18A 4R2IA 1P1HA 2GYYA 1C4KA 4KPUB 3D3WA 4RX1A 1KVRA 2JEUA 2PMFA 1WMDA 2AR9A 4A5UB 1TAHA 2FSSA 2JAHA 1PR4A 5LQUA 4ARVA 5IXYA 2B1IA 2Z98A 4X6LA 1P45A 3E2EA 3TIIA 3E22A 3HNOA 2J5KA 3Q4HA 1XDZA 1FZQA 2BRUC 3PX3A 1EZVH 1V7PC 3KV1A 4PQEA 5CG1A 1DKQA 5J2TB 2VT6A 2HC9A 2VPPA 2OGWA 4MS3B 5DBOA 1P2DA 1UZMA 2WM3A 4I8IA 1YQNA 2D2IA 3RAEC 3ZDCA 1AT1A 3HSSA 5CVUA 5GAPK 5C8DA 1BA3A 4OUDB 3ZGOA 3C3YA 3T3MB 1IHXA 5JNUA 2IE0A 4XQ9A 1KMIZ 1AB3A 1QHSA 1KBQA 1RYBA 1Z6AA 2XR1A 4P9NA 5GV8A 4DKJA 2IIQA 2W6ZA 3CLUD 3OX2A 4FD3A 3VYRB 4DA8A 2PLAA 4TVOA 3DE4X 2PMPA 2AFHA 3CUYA 3HEBA 3MXTA 4U8HA 4DILA 4EHBA 5AI6A 3CURA 4FN5A 1SHTX 1O6CA 1ST3A 1NVPB 1K4KA 1V47A 3RUDA 3WSVA 3OE7A 5MF6A 2WWWA 3J81N 3DOHA 3JQFC 4POAA 3TCUA 2C0PA 2PU5A 4I1OA 3TVDA 5EE3A 2I6SA 2ECFA 2OUKA 3MCAA 4RVFA 2ZB2A 3TZEA 4DV6B 5K3OA 2DBZA 1YF3A 4AC9A 3MCZA 1C9EA 3DO5A 5JD6A 1ZU4A 1AG9A 2QF7A 3AGKA 3D64A 1B23P 1L7QA 4JXXA 3A3PA 2A9HA 3GEHA 4U2CA 4YJFB 4C8IA 2IHJA 2R5FA 3HEAA 1JJAA 4JB8A 4R2HA 1KZYC 3WO0A 4YRKA 2Q4OA 4MB0A 4JLJA 3G79A 1GCGA 1MTZA 4O02B 2X3YA 5EJ5A 4BUZA 1J0AA 4LF6O 4FFBA 4TQFA 3AQIA 2O0HA 5LOVF 4R05A 4UVEA 2H1SA 5DSXA 4WFEA 2QSZA 5C52B 1OZHA 4EHJA 5AW9A 1EESA 4DLXA 3IFSA 2ZWOA 3UK6A 4QYMA 1VQNV 1Y82A 1XEXA 1ZWIC 2ZATA 4XQEA 2VKTA 1EP9A 1MO4A 1XHEA 4LMRA 3RFTA 5BQOA 4HV4A 2JLWA 3T7SA 1F2VA 1NXOA 5ER9A 4YAUA 4UUAA 4K0KO 2EULA 1G8YA 1RYEA 4WXPA 3LQ4A 1U1EA 3FKSG 5BT8A 4I08A 1O6GA 4BATA 2JJYA 2OY0A 5KWVA 5BV2P 1RYMA 4PG4A 3H1AA 5FLXN 2X7JA 3SF8A 1AVTA 5ALLA 4QXOA 4DMHA 1Y9AA 1J25A 4LYDA 3RR2A 4RHXA 3H05A 2ZIVB 4C7BA 1T5DX 1ISRA 3IVCA 3TXQA 4Y18A 4PU0A 4PWZA 5BMOA 5BOSA 3TAHA 5L4NA 2BH2A 3L3BA 3JPYA 4PONA 3BB4A 2D06A 2H48A 2OFXA 2YZNA 3ZJ5A 5EJ4A 3FPGA 2I6QA 4RKYA 2VYCA 4PZEA 3E8MA 2ZTMA 1RDFA 4J0HA 5LQJA 5JS8A 3ON1A 3GDWA 4EPRA 3E20B 3EWNA 4TMKA 3TW8A 1EWKA 1E2JA 2DJVA 2WE8A 3K0FB 4RZIA 1AI4A 1PS0A 2XXAB 3M1XA 4B35A 1Y4ZA 2AB0A 1DWPA 1SCUB 3IVMA 4C30A 3LWQC 1RFLA 2ZRBA 2DQ3A 2P27A 4YRGA 1YIOA 2TRSB 4KDRA 2AT1A 3CBGA 3ZJ4A 1JDJA 2WMYA 4AZ3A 2ZRQA 1P4HA 1YKSA 3NDJA 3KYBA 4AJPA 2ZI7A 5ABPA 4Z4GA 2HNKA 1XWFA 5FFNA 2QA5A 2OP0A 1XLTC 2G1AA 1VJCA 4ZO6A 3UC5A 1SKQA 2HF2A 2O5RA 1T4BA 2H7XA 2V6MA 2ZI4A 3WGHA 1M33A 4O2AA 2OO7A 4DUGA 4JT8A 4ERHA 4MHOA 2I6TA 4EUKA 4TPKA 3FBGA 3MS4A 4PV1B 1X1CA 3ZE8A 3HBJA 1E2UA 5KREA 3SC2A 2B21A 2GERA 3F73A 3E27A 3VC3A 2DECA 1AR1B 4WE3A 3TF5A 4N3AA 4G4ZA 2R8ZA 2J85A 4I0XB 1B6GA 3OZ7A 5BXZA 3NFYA 4P92A 3FI0A 1HE8B 2ZSKA 3BFJA 1II8B 3GGGA 1N6KA 2Z5LA 1XTZA 3JYLA 3K5HA 4D56A 1DJLA 1MEEA 2EBOA 2YIVX 4L4YA 4FIZA 2Q1SA 2ATXA 3LGXA 4BBAA 4DHWA 4EJ6A 4DQDA 3MGAA 4J1QA 1G60A 4QFMA 3KZIZ 5FUVA 1BCCH 1KPIA 3JY6A 3QYJA 1J2UA 1UK6A 5HMLA 3UB3A 4KXQA 4I4CA 1DEOA 5KNBA 1Q3EA 1H42A 4TL7A 5FOWA 5IUJC 3CSXA 2Q6OA 5IYZA 2ZYWX 3IULA 1KDYA 1CXZA 4PD4F 2ZRKA 3L43A 3OJFA 5LZ5A 1UT8A 1RACA 2SECE 4E4EA 4EJSA 2RGUA 4EUFA 5KTPA 3O4HA 2DQ0A 2D54A 1KB9F 3EH1A 3SQWA 3EZ7A 1R0YA 1DS6A 1SC3A 4D26A 1U11A 3K5MA 1EX7A 4HZGA 3HCWA 4ALNA 2CF6A 1PT7A 3TBHA 1TM3E 1H8EA 2FEPA 3CC4V 1QV7A 1Z56C 1RSZA 4XOIA 1LBQA 1Z22A 3IMEA 2JAOA 3HUFA 3ORSA 1P0IA 3FROA 3MT9A 4ZP1A 3C6YA 3OZWA 4QPNA 4JWKA 3R5SA 2ZYVX 1FP1D 2R751 4HFNA 5CX4A 4DYLA 1F2DA 3ZZNA 1D03A 1JLMA 1XZFA 1ORDA 3RAJA 1J1UA 2G9VA 4LRUA 3C3KA 5A4DA 1JR4A 2AFRA 2Z9DA 3MRSA 2WJYA 3FNIA 3AF6A 5BV7A 3E3NA 4OHKA 1VHDA 3AG5A 1P0MA 3V4OA 2I7CA 4X24A 2QVGA 5AUQA 4OP2A 3QPAA 4BLPA 5FUXA 3H2IA 3VYWA 5K4HA 2QS9A 4YBZA 4FFRA 5DPMA 2BF7A 4JJEA 1LPMA 1Y66A 2IJHA 1P1JA 3CJQA 3H17A 4FCCA 4J91A 1UZLA 4K6MA 3PUWA 4OJNA 3E53A 1VP7A 2P9HA 4QTTB 4UXNA 1MV8A 2I8AA 3PUYA 2PXXA 1Z5UA 2ZXFA 4DLTA 1YZBA 2ADFA 4KC0A 1YRWA 1WB7A 2ZM5A 1ZGAA 4KXYA 3DGEC 3TMAA 4L57A 2HQOA 4RFLA 1OC4A 4HQOA 1VLHA 1B74A 1O4VA 2BONA 2PMCA 4UDXX 5EVJA 9ATCA 1Z2DA 3PEWA 4R8LA 1SG6A 1V54C 2N3ZA 4UMEA 5IJZA 1VRVA 2BFFA 4TVKA 4XJSA 4AS3A 1YZNA 1N78A 1ID8A 3P9CA 1F4NA 1HE5A 1C1YA 2PRSA 5AHOA 4WD3A 3CRW1 5EE9A 3VNAA 4JSYA 1MOPA 2V9PA 3QJGA 4H7PA 4PPGA 1PP9H 4X93A 4RLSA 5DCLA 5BOVA 5ITVA 4F3RA 3UJDA 5I7WA 2IS6A 2ZQYA 5F78A 1P8AA 4YXWD 4RK5A 3ZHYA 1A3CA 2XY4A 1W85B 2B61A 5GTIZ 4XH9B 4MO2A 1FZTA 2QORA 3DLIA 1QO7A 3SEZA 1C2YA 1UEJA 5EAIA 5AW3A 3JRXA 1RHRA 3GFRA 1SMKA 5LA6A 2V5AA 3OQIB 1PZEA 1VZ3A 4CH4A 2CW4A 1M2JA 3DKRA 3EMVA 4G63A 3KXIA 5IX8A 3PR3A 2QHXA 3W5AA 1WQ1R 2ZTHA 2QR2A 4U7JA 2XUZA 3LHFA 2IZ5A 3DMYA 2DC1A 1L5GB 1L5VA 2NIPA 3BKXA 1QNLA 2EILB 1C7QA 1Z0UA 4TQUS 1NN3A 1S0VA 3N2NA 4PFJA 3SNKA 5FLXM 3TRHA 4V3CA 3V4VB 1PNVA 1W8DA 2Y2UA 4NFLA 2G80A 2J0EA 2FPGB 4RVSA 3Q1KA 3TEMA 1DUSA 4F8JA 2QUAA 5JCOA 1GO0A 2MU1A 3FN4A 1F5NA 3S1AA 4DNQA 4Z7JA 1E4VA 5TEVA 4LCUC 1JQEA 2VJLA 2E4VA 1YH3A 1WCV1 3L84A 2GK3A 3B89A 3GROA 5BWBA 5LQCA 4LFCB 2H1RA 3RYTC 1USKA 2YWRA 1S01A 1T36B 5LC1A 2UYQA 5I7VA 1OI7A 3O1HB 1OCCB 1SKYE 1Z2GA 3PIDA 1R16A 5A7FA 2Z01A 2PMWB 2NGRA 1FP7A 1OLUA 3DDCA 4L4RA 3BCUA 3LECA 1YGPA 2YVKA 3H99A 2X7RB 4ODIA 1N4CA 2WA4A 3TUZC 4ZA2A 1M8JA 3TVYA 3ESJA 4ZI3A 1HSOA 4TV8B 2YHSA 2YRFA 3JWEA 3C9RA 4WERA 1ZOPA 4LJYA 5ALEA 3TRFA 5JXWA 1YIDA 3A2FA 2H3HA 2XBMA 4ZQGA 1L5HB 5EP3A 3W1WA 3ZLVA 1OASA 3LKDA 4RFSA 3VNUA 4DT1B 1DOZA 1RJFA 5LBIA 4CFSA 4TYQA 3U7QB 2ZBVA 4PLVA 2C9ZA 4L16A 1HETA 4RA6A 2UYPA 1BCSA 3DTNA 3GHHA 3IHWA 5HCUA 1JQKA 1UXHA 5EEHA 4BX3A 3LC2O 1KQSU 3JQPA 2JJ8A 3JVVA 1B93A 3AUAA 4D3ZA 3JVUA 3CLRD 4QOSA 1KSJA 1RZUA 1Z2AA 1SH7A 1WXWA 2NAPA 4NAHA 4X1OA 3ZVLA 4ZGGA 4HNRA 4Y1GA 4UMFA 3VPFA 3GLQA 1XFAA 1QQ6A 3IKVA 4LBVA 4DV2B 4HLUC 4LF9B 1N0IA 1TMOA 2DWUA 2FWBA 4ZJYA 1E4EA 1P1FA 4OAOA 3OPXA 3Q5GA 4LJ5A 3TECE 3HXLA 4CKXA 3PC7A 4ZD6A 2D0PB 3I9V6 1ZVKA 4CE6A 1Q1QA 4O2BB 2B9EA 4OBWA 3BUSA 3HBMA 4G9GA 3RC2A 3TS1A 3I5XA 4AD8A 1A77A 3UZUA 3UQZA 1CR2A 1IBKB 4I1IA 2DM6A 2B8EA 1GY8A 3D7SA 1KEEB 3DCYA 4IF4A 3N0RA 2FW1A 3ZVMA 1I0IA 2Q4DA 3ZU2A 4MWOA 3ZZ0A 2ZJYA 4O4HA 3RGBA 1OBFO 1Y4MA 1ZI9A 3HYNA 4PWTA 1D9ZA 2VDWB 3K09C 3TD4A 5LU8A 3DZJA 4UCXA 2C9DA 4OG2A 5CB0A 3L4BA 2H5EA 3UHPA 5FAXA 3O8DA 1EFVA 4EX6A 2ZI5A 4BO4A 2QVCA 3I9OA 1E9CA 4RKWA 4DSAA 4AG5A 1Q0UA 1ZUD1 5KYXB 4Q4JA 2WQZA 4I4IA 2D8AA 3H1JH 3EODA 2Q2OA 3HJBA 4OA8A 3LPCA 4X61A 1COWD 1A5ZA 2NZJA 4XDKA 4GR4A 2OE2A 4LF8O 3FCEA 2NQTA 3HB4X 1RPTA 5CJJA 3CF4G 4NE2A 5K3AA 2G88A 3K9LA 5LP6A 1DRWA