5GONB

Structures of a beta-lactam bridged analogue in complex with tubulin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb
source organism Gallus gallus
total genus 169
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5gonB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5gonB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5gonB01
5J2TB 4TV8B 2Q1YA 5LP6A 2Q1XA 4KWEA 4I4TB 2VAWA 4X1IB 5ITZB 4I55B 4U3JA 3E22A 3JAKA 4O4JA 3M8KA 5GONB 4TV9A 5CB4B 2RHOA 5JQGA 4HNAB 4X20A 4ZI7A 3VO9A 4F6RA 4LNUA 5IYZA 5MN4A 3JASB 3R4VA 4EI8A 4ZHQA 3VOAA 2RHHA 2GVIA 2R6R1 5JCOA 3WGNA 3ZIDA 3RYIA 1TUBA 4EI7A 4YJ3B 5KX5A 4O2AB 4O4LA 4EB6B 4O4HB 4ZOLA 4M8IA 4O2BA 3HKDA 3JATA 3RYFB 3WGKA 5M7EA 2RHJA 4B45A 1W5AA 3JARA 5CA0A 1SA0A 2BTQB 4IIJB 4X1KA 1JFFA 4DRXA 3JAWB 3HKCA 1Z5VA 5BMVB 5J2TA 5LA6B 5JH7B 4U39A 5LXTB 1RQ2A 5ITZA 3HKEB 1RQ7A 3V3TA 1FFXB 4X1YB 3N2GA 5EIBC 5GONA 4WBNA 3RYCA 1FSZA 5EZYB 1W5BA 3WGLA 4E6EA 3N2KA 5EYPA 5LYJB 1OFUA 3UT5A 3JASA 5C8YB 1W581 5IJ0A 4I50A 4IHJA 3JALB 4YJ3A 4O4IB 1TVKA 4YJ2B 4EB6A 3ZBPA 4O4HA 5JVDA 5KMGB 4XCQA 4FFBB 2XKAA 3RYFA 5IJ9A 4TUYA 4TV9B 5J2UB 5JQGB 1W5FA 4ZI7B 2BTQA 4F6RB 3ZBQA 4LNUB 5IYZB 4TV8A 3RYHB 4I4TA 5BMVA 4X1IA 5LA6A 5JH7A 4I55A 5MN5A 3RYIB 1TUBB 5LXTA 3VOBA 5EIBD 1W5EA 5CB4A 3HKBB 4HNAA 4ZOLB 3C8LA 4X1YA 3HKDB 5LP6C 3CB2A 5EZYA 5LOVB 3WGMA 5FNVB 2VAMA 5CA1B 5LYJA 2XKBA 3JARB 5CA0B 4X1KB 4DRXB 3JALA 4O2AA 3M89A 1Z5WA 3WGJA 5LP6B 4O4IA 4YJ2A 4U3JB 5JCOC 5KMGA 3E22B 3JAKB 4FFBA 4O4JB 2VXYA 4X20B 3N2GB 4WBNB 5J2UA 4IIJA 3RYCB 2R751 2VAPA 4B46A 3JAWA 4ZHQB 3N2KB 5EYPB 3UT5B 3RYHA 3VPAA 5IJ0B 4I50B 3HKEA 4IHJB 5KX5B 1W59A 4O4LB 3VO8A 1FFXA 1TVKB 4O2BB 4EI9A 3HKBA 3RB8A 3JATB 5JVDB 2BTOA 4DXDA 5MN6A 5IJ9B 4TUYB 5C8YA 5LOVA 5FNVA 5CA1A 1SA0B 1RLUA 1JFFB 2RHLA 3HKCB
chains in the Genus database with same CATH superfamily
2BHSA 3FX2A 3BMCB 5A1TA 2Z2XA 1GTG1 2R6FA 2XVXA 1J0BA 1E2KA 4QOIA 3QWBA 3W8NA 2ECKA 3C98A 4AZ3A 2WLSA 3PQ8A 3CINA 3VC7A 2QMOA 2FWJA 1Z2OX 1N6NA 1UJ6A 4IINA 4HPJB 4W5WA 2A2ZA 3MOSA 1CKEA 3OE1A 1Q82H 4YP6A 4ZCMA 3PJGA 3K9SA 1Q74A 3ROXA 3HGMA 4W1RA 4S05A 5EVCA 3UTDA 2ZYWX 3GEGA 4TSFG 5B1HA 3N3BC 4PC3A 1ZNWA 4E88A 1AQUA 4W99A 3PXGA 2HSWA 5IVPA 4CF3A 1OCZC 1MD9A 4JBNA 3K0AA 4MVJF 2XAFA 2HEGA 3LUKA 1NXQA 1TJ5A 4F5ZA 1SBQA 4IF4A 4D2IA 1ZNZA 1DG1G 2ZJ3A 4MGHA 5B3JA 1QNFA 1F0KA 4CTJA 1B1AA 3NG1A 2EIKC 5LA6F 4DLPA 3BZBA 1T4CB 3C1TA 2O3TA 2QN3A 1U7PA 1CQIB 3EWNA 3V1UA 1OAAA 4Z86A 3K0AB 1GQOA 3DKRA 2VP3A 3QU9A 3TLMA 1KMMA 3LDTA 3WI7A 5ITZA 3ED1A 4U0JA 3U9TA 3LFUA 4E2ZA 1GAQA 3WIOA 4G0MA 1WOYA 4W5OA 3TZCA 1NSTA 2I4OA 1H8EA 5LQJA 1DBSA 1U7ZA 2HZBA 3F1LA 2OD9A 1BDHA 3GVCA 3SFVA 3R0VA 4CV2A 3JYCA 5DO9A 2RAPA 1QD9A 1R0ZA 2HAEA 1ZSPA 1QMGA 1K7FB 1BZKA 4UXIA 2R70A 2ZJOA 3NWOA 4PVCA 1Q7EA 2GILA 4MUKA 3VC3A 3WBBA 3HPQA 3WLEA 1VJGA 2CTWA 3ZP7A 2YVQA 3E5MA 1V4BA 4YMUA 1PF7E 3CFYA 3G6WA 3ZCTA 3PKIA 1Z56C 4MS4A 1JG6A 4F96A 4KLZA 5A05A 4D8WA 2XODA 5DNUA 3CCQV 1K9MW 1JTVA 2Q3DA 4FFVA 1PJSA 3X2SA 3BRWD 1WD7A 5B3KA 3CCMF 3UMFA 3AG6A 3FWYA 2Q2NA 1G8PA 1AKWA 2X8BA 3ZK8A 5BR8B 1ZMOA 2WM8A 4QPPA 3O73A 5A3VA 5A5FA 1G6Q1 3E8XA 4PW0A 5EE1A 2IH4A 2IE8A 2H8EA 3VPFA 3TTTA 5FBVB 3NHMA 5AI6A 5A2QM 4O2BF 2BLLA 3UAOA 4ZTBA 3ZY4A 4QXAA 2RCNA 3VFDA 1F23A 4DRZA 3F9RA 3A6ZA 2IOYA 3VKUA 3Q6IA 3NOQA 3I7TA 2M7WA 3RYHA 5KYWA 1FZTA 4YXWD 1E3JA 1LPAB 3G9ZA 4NBUA 4NYIR 4TYQA 3CZMA 3I6ZA 5TGDA 1RKUA 3PHBE 4YCAA 4WN9A 1RM4A 3ANXA 2PTGA 4X8LA 3HFJA 2GN9A 2WUWE 1SZJG 2O2EA 1VLQA 2X1MA 1XJ5A 2HLDA 1P2SA 1P1KA 1A2OA 2LCIA 1T8WA 2YCLA 3WSWA 4GX1A 3ZD7A 2UXCO 1NH2B 3HHPA 1QLWA 2QUZA 1IC6A 3G0IA 1OH5A 4NBRA 5J4HA 2RH5A 3IV9A 2GZMA 5ICFA 2PRKA 2W4MA 4V0RA 3L7AA 1E2DA 3K0KA 3FTNA 1IBMB 2WMNB 4CIDA 3FSGA 4ZT6A 5FLXN 2XOKG 3HGQA 4MUYA 1XCBA 2WM2A 3QBDA 4LYEA 3AVXA 3DMYA 1ETHA 1KTIA 3NQ41 3EMVA 4B17A 4FDTA 3T9CA 1K33A 1NF3A 3FWPA 3LOUA 3O75A 4RTLA 2B69A 5CXXA 1H3NA 2FMKA 1DBQA 5IXJA 5TMPA 4KLNA 1ZHFA 3OJWA 5K4GA 1UJ5A 4YRJA 2RGGA 4ID3A 5AUNB 4CH3A 3WV5A 4AMYA 3DGEC 4URFA 1U5BA 2HA4A 3D1JA 4ZICA 2UZHA 5I8ZA 4B3TO 4B3CA 4RGQA 4EYEA 2HD4A 3EH2A 3DE4X 1ORWA 2XAJA 1RPTA 2VF5X 3VVBA 3HO1A 2JK5C 3BH6A 3QO8A 4H7IA 3HL0A 3VPCA 3RO7A 3NAZA 4B9AA 3A1UA 5HM6A 2BH2A 4LF7O 4Q19A 1RCUA 2X22A 2C7GA 5JDCC 1ZOOA 1DHRA 5F64A 1S96A 3UCEA 1DG3A 2QN8A 2EFYA 1U5BB 4II3A 2HHLA 1SD1A 3AKEA 4V02A 1KH1A 1W52X 4JI0B 2GV9A 2CYBA 3GNQA 2VDUE 1U0HC 4IKPA 1LDMA 4JYYA 3R2JA 4MRAA 4S1VA 3KZ1E 1K3EA 4A0RA 3PF8A 3PDHA 1SUCA 5IVIA 1LK7A 4RD0A 1L5SA 3RLIA 5A03A 4AI6A 1G291 4IDEA 4CMAA 5A5GA 1LBSA 1ZJYA 3OZEA 1PWHA 3T7JA 1DIHA 2B33A 1RQNA 4FI3F 3URKA 4WK0B 1Y6GA 1UQTA 1E0AA 4ARIA 2X6BA 3WLJA 1K7DA 1FA9A 2HO4A 2WU4A 1XU9A 3P7MA 4XZ3A 3RBVA 4L2IA 4NMLA 4WWHA 4LVCA 1BRTA 2BMWA 1E6MA 4CEJA 1WDKA 3FZQA 3UAWA 1Y6XA 1GSOA 2WLLB 3PQ5A 2E75B 4P36A 4IDBA 1GA6A 2C5LA 1D1TA 5H02A 2OMEA 3CU5A 2BTEA 2FUEA 2P2NA 1RQRA 2Q8NA 3VV2A 1N34O 3K12A 4LJRA 3GDOA 3BT7A 4RM2A 4FDUA 4EEZA 2DBVO 3HZRA 3FKJA 1TVCA 4GZ6A 3H7AA 3T3DA 4FLVA 3GGPA 5ALGA 4BGIA 2HSZA 2OZLA 1D0VA 1W94A 3WGQA 3O9VA 2HF2A 1CSEE 1ZTEA 3RROA 3L7OA 4I7ZB 2KGWA 3OD5A 4ABYA 2J3HA 3CNHA 2PWPA 3UQZA 2ATXA 4BNFA 4QREA 2JDIG 5KTKA 1QSGA 1EHCA 4LFAB 1N8RH 2Y66A 1OU0A 1TYZA 1E3SA 3MGBA 1JDUA 3ZWCA 3C8LA 2QZPA 3VPGA 3EZ6A 2DJVA 3GLQA 4YIHA 2RGXA 2G67A 2XUZA 3CYOA 1IL0A 4JEHA 4HDSA 1M0EA 3C5EA 5I5EA 1TKRA 2K2QB 1ZESA 2GXQA 3BWBA 1Z07A 3I30X 4DZTA 4PO9A 4G4JA 4H16A 1FMFA 2D2XA 1P0PA 1WOMA 3DFUA 3QMWA 1VLHA 4D96A 3W5HA 1AR1B 2ZTSA 1TDJA 1C81A 4BY9E 3LGAA 2WLTA 3AEQA 4UVEA 4QASA 1V8OA 1RXVA 2M1ZA 4Y1EA 4ZPXA 4X66O 4PC6A 5IAJA 2IUTA 4HDSB 1P7PA 2IYRA 2PRJA 4BGEA 1G2IA 3FDIA 2PN1A 2FPUA 4LWSB 5CNKA 1JHUA 2HGSA 5L4NA 1YHZA 2J9YB 3IP6A 3KD2A 3WAJA 5K8IA 4O1HA 2BMFA 1V4NA 2NO4A 3AVYA 3W7XA 4JT9A 4E2WA 3D2LA 1ICEA 2BKLA 4OYYA 5AVJA 1UOPA 2IIPA 4EB3A 3A6DA 1BCRB 1YMUA 3C87A 3CH5A 1IQPA 3N8HA 3I6IA 2FZEA 2X0IA 1N78A 1RS0A 1XHXA 4U6NA 1YHQV 1FRFS 4XE5A 1XALA 2D1QA 4UUQA 1FW8A 3FY4A 3NKLA 3DEJA 2RHMA 2X0EA 3W1EA 1M8PA 1MP0A 3DBIA 3FPLA 3K9WA 4F3NA 1U3WA 2QP9X 3ZNQA 1HDCA 3EVCA 3HJNA 4I3GA 4DNXA 4UE2A 1MC5A 2CK3A 2IGTA 4FYIA 1NBIA 1SQ5A 1LVGA 5ANRB 1S77D 3DMHA 4B4KA 3TGWA 1FFGA 2D3OW 4DFDA 4JI5B 3JASA 5LMNO 4DMHA 2D3WA 2FZKA 2OB2A 3O65A 1LS6A 4QPKA 4QLOA 4XJVA 4XGRA 3HJRA 5ICMA 5L3GA 1WQ3A 5J5AA 3CX7A 2QD4A 4AJOA 3OESA 2IPMA 5EHNA 4D5GA 3ZI7A 1Y7IA 2C78A 3TJMA 4PQYA 3MG9A 2B35A 5ERGB 4M9QA 5FOWA 5J2TF 5G4VC 4NF2A 2VDLB 4AUMA 3GF4A 3DF7A 5DSXA 1GH6A 3HB5X 4LGMA 1OXBB 1IN6A 2JZCA 1UPGA 1Z2EA 4RCZA 1E1RA 4B31A 4C4OA 3EBPA 3LNNA 1YR7A 1UPAA 2XCRB 3MT7A 2VAWA 1H2AS 1X59A 5EC8A 4LNUA 3B60A 1HY3A 3R3HA 2IBSA 4YJ3B 2D2EA 4AP5A 1XJCA 4N23A 1B0AA 2J9XB 1GUZA 1G8SA 2CE2X 3ZWXA 3GLVA 2F1RA 1AI4A 3QHDA 2P9EA 3MS4A 3MJTA 5KUTA 3PQFA 4JSTA 1TXGA 3EGDA 1DUIA 4RIIA 2I66A 3NORA 5CA0F 5EIXA 4PJ0Z 3QFCA 5BSHA 3O93A 3E9CA 2UUOA 1JJAA 1VYTA 4CF7A 1JKIA 1K2WA 3ESAA 1UWCA 3GFPA 3URMA 4LNUB 1MX5A 1VARA 3A10A 1FFWA 1Q0QA 2BGKA 4DMRA 4FMCF 3UJDA 1TMKA 1A9XB 5DU2A 1E3LA 2R2AA 4MTOA 1ESMA 1A71A 1YJNF 4OLAA 1QAOA 3QPDA 4J4TA 2WP0A 2LJ2A 1C9KA 3PCXA 3LVFO 1C8VB 4BXOB 3IDAA 3WJPA 4DCUA 1QBZA 2G77B 1G42A 2RHGB 4MP3A 4J7ZA 2MYUA 4LC9A 2UYPA 4X85A 5IWAB 4E5YA 3QMVA 1VL8A 4R7TA 2MSLA 4C2BA 1KZ7B 1GQSA 5LVAA 3LBHA 1I4LD 3DLCA 1SUWA 4NMHA 3DO6A 5HEKA 3KR9A 1KVUA 3H2IA 3AV0B 3OY2A 1PNOA 4GGPA 3O85A 3GDHA 3E1YA 1SELA 2CXNA 5A0TA 2A4KA 5DOZA 2PANA 1Z5NA 3R5JA 3TB4A 4C03A 4D44A 2CYAA 3NHRA 4XEUA 3JS5A 4QGAA 2OHVA 3IBTA 4XR9A 2IS2A 1WO8A 4D9HA 3WNCA 1DC3A 1VHQA 2IAFA 4E30A 2G9VA 2NGRA 3W9UA 1EDDA 4RACA 1EVLA 1Y80A 2QMHA 2WHQA 3QBEA 4FLTA 1CDDA 2CV0A 2AWOA 2P1ZA 3VR0A 1JZQA 3V7UA 1HETA 1R6TA 3Q7EA 4BMXA 3RIEA 5KJ6A 4QG7A 1W40A 1Z2PX 4RS4A 3O21A 3KL4A 1N33B 3FGZA 5TF0A 4B7CA 3R4VA 4KPFC 3Q0IA 5E7QA 1UC5B 4CCAA 5DLDA 4CQMB 2O8DA 1Z26A 3IEPA 4XWOA 1Q19A 2P5OA 4ILKA 1VHTA 3DV2A 4M1TA 3DMGA 1U7XA 4EMSA 1VIYA 2FXVA 3KJFA 4M55A 5BXQC 5B4TA 1HV8A 2XB8A 1AHPA 3OEEA 3KU4A 3NC1C 3WQSB 2VBCA 1PZFA 1Z2NX 4HVLA 2CV1A 4OHOA 16PKA 1E9DA 2IIBA 1NR1A 3KTOA 3HZHA 5C2JB 1QFJA 1J21A 1B0PA 1ZIOA 4DLUA 3PFFA 2CV2A 3KJIA 5D1NA 2PKYX 5DNEA 1O3YA 1JKMA 1NX6A 5BYAA 4Z7JA 2QKYA 4MJLA 4YJDA 1RRPA 1THZA 1MTOA 2ZJYA 1BC5A 4OMUA 5TF4A 5TSDA 5DCYA 3PKJA 2Z08A 4LMRA 3LXXA 3S2EA 4L9SA 4EY7A 5CRIA 1POXA 3Q3CA 2AXPA 5D3MA 2V6FA 3P9QA 1JJOA 4PANA 2Z5LA 1W8DA 2OIGA 1GTVA 3RT3C 1GCGA 3DE1X 5LFAA 4L4XA 4MHOA 4I0WB 1JWBB 3MGCA 1SA0A 1JEQA 1HC7A 4PA4A 4W1QA 2YHBA 1JIKA 2IHBA 3NYWA 3HU2A 3ZDAA 1DIRA 3WJ2A 3A3KA 4NXNB 2AMYA 4LF5B 2QROA 4TUYA 2IYVA 1X0XA 1N5OX 3D8UA 3AT1A 2EGUA 2OD7A 4FHGA 3CR7A 1P7ZA 2Z5VA 1WZCA 1F1BA 1QO0A 3CX8A 3C7CB 5JRZA 4HHEA 3ZDQA 1JEQB 2QJTA 1RRFA 4EPVA 2RBGA 1GM9A 1SOUA 1GL9B 2RE8A 1KMNA 1TEHA 1TKCA 5H6QA 4INJA 1WP8A 4R9SA 3FYCA 4TUYB 1XG5A 1EM6A 2UU9O 4RD3A 2OXRA 4IUYA 2HHCA 2AX3A 1KRWA 1IM2A 2B6NA 2JI7A 2V74B 4FYVA 3EF0A 4MROA 4PLGA 1EZJA 1SXPA 1GZDA 2FF7A 3ORSA 1P0IA 2UYCA 4BT5A 4NKGB 3Q40A 5DW0A 1ENPA 3EDCA 1XXLA 2CJYA 4B6EA 3LY9A 3CRCA 4MA5A 4A2WA 2Q7OE 2ZCUA 3LXUX 4ZMRA 3L5KA 2BSKA 5HFNA 4LDRA 4Y2PA 3ZS9A 1DDOA 4U6SA 4EY4A 4U2CA 3ZGZA 3DLAA 2JH3A 5TXGA 4BJ3A 4G4ZA 4C0AC 3L43A 1M1KH 3KE9A 2EXXA 1DLIA 1BE8A 2UAGA 4V0ME 4G0UA 4JI1B 3IMCA 3V8PA 2ZWIA 3JVEA 4ILEA 1NKSA 2X19A 1A8QA 1LTHR 2R6CA 5FHQA 4NYKA 4BPBA 2PTHA 5B30A 1D6SA 3QOXA 4ZVLA 1W25A 2XCIA 1Q50A 2UYOA 1VQ4V 2BMVA 3GEBA 4E08A 3KV3O 1VXRA 3ZP4A 1TF5A 2QM0A 3GEEA 2FW6A 4MLPA 5ALEA 1PF5A 3RS7A 3KOYA 3TQOA 5IU6A 3FHLA 2GRAA 5KYVA 2KS6A 5BQ3A 3F90A 2ZPAA 3CRRA 2BFAA 2MU1A 1S8OA 3HBMA 1XCPA 3CPJB 4XUDA 4EVRA 3K4HA 3DFKA 1P1HA 2N0SA 2EU8A 3D6FA 2Q2OA 2Y6VA 1JDSA 3TLGB 1IJKA 1DC5A 4G23A 3LHFA 2LBTA 4LK3A 1D4FA 1WXWA 2PX5A 4DEXA 4AKIA 1GDDA 4RJTA 5IXYA 1CUCA 1QJ4A 4J2TA 2NAPA 2GBFA 1DAKA 3EYWA 4M21A 2GM9A 2JGNA 5EJ8A 4LRSB 4LYHA 4XDGA 2J08A 2H16A 4M0KA 1RYFA 4DDKA 1GA4A 2M9MA 3PEEA 2IRWA 4MI1A 2I3GA 3M89A 3NGMA 3KCNA 2ZUVA 3R0XA 1UADA 4GBGA 4KITB 2VEOA 2YZKA 3FLEA 4GKVA 3ASZA 1PK8A 1HR0O 1LPNA 2PBZA 5ARDA 3CJTA 2M6KA 2WNIA 2EINC 2G4VA 1GZ3A 1IHYA 4C7OA 4CEIB 5H16A 4RCYA 4BE7B 2CLHB 2ZWMA 1UBRS 4BLPA 1E2PA 4XFKA 2HQOA 3UXYA 1FE8A 2PX2A 1H05A 4NH4A 4YRDA 3OOWA 1Q7CA 2GAIA 1GN3A 3WRYC 2KB0A 1AROP 1RLGA 1U3DA 2H2HA 2F67A 2AEEA 1LJUA 4JTDB 5HTKA 5K0ZA 2R47A 1GU0A 1JIVA 4C7OB 1EN6A 1EK2A 4RK4A 3VO2A 3VJLA 2C7QA 4OQPA 2VFAA 5K09A 1XI1A 4DB2A 1LTKA 2I1LA 3P2EA 2QM7A 1EX7A 4A10A 3VAYA 3KTDA 1VMEA 3KEQA 2CTQA 3TD3A 1Z9BA 4GF5A 1ZGZA 3LL4A 1PX2A 2H3OA 5IJZA 4GZRB 3OMIB 3SS8A 1RE0A 3SOPA 1Z0FA 3L06A 2HDOA 3GEHA 1O57A 3EVBA 2C8VA 1ZH8A 4D43A 1XPRA 3DUFA 2JCXA 3ZZMA 4YAJA 4JT4A 3OCYA 4HDKB 3K06A 4ZIRA 5AJZA 1B6RA 2J6HA 1GVNB 2PVCA 4R81A 4K9RA 1XA0A 3FB5C 2EF0A 2QRPA 4G0OA 1VE7A 3CISA 4EZBA 5F78A 4QNHB 3AUKA 4F4CA 4TWRA 1XUQA 2Y0EA 1SQ0A 2WICA 4X93A 3PPVA 4RMIA 2B0JA 3MYRA 4FILA 4V0QA 5HY4A 5C4IA 4LZLA 2BFWA 3B1JA 1TRKA 1OZAA 2D13A 2LDXA 3OQOA 2ZUBA 1XJWA 2ZT9B 1L5WA 3PXEA 1APBA 5L3CA 2R00A 1WB4A 5THXA 1WZNA 4HC4A 2ZVYA 4W9NA 4YBRA 3JCUZ 4EFBA 4C22A 5DP2A 4ZAGA 1KZHA 1F0PA 5EN4A 2ZSFA 2FG7C 2OQIA 3NRCA 5JJKA 2C57A 5T7BA 2W5UA 4BRZA 4BC0A 4XFDA 1TZCA 4O2AF 1ATZA 1E18A 1S89A 1YRQA 5JPIA 4RPKA 1IIRA 1WULS 4JY7A 2IEBA 1NT4A 3QJYA 2EEZA 4UCFA 3JSNA 2BR5A 4YCCA 3NUGA 2IYWA 2XNDD 4YAKA 1T8YA 1T1JA 3EIEA 3MA0A 1DMRA 3Q4HA 3QVLA 5JJNB 5LL6P 4UCUA 3I3FA 3EG9A 2BHTA 1LQUA 5C3MA 3FHOA 2B99A 3QG1A 2W98A 3NHZA 3OTHA 3KZMA 4EIWA 4A03A 5FAXA 1X80A 5EQTA 4DK1A 2QVXX 5H83A 3ZV3A 2ZRDA 2H2DA 3U4AA 3OU7A 3HKBA 3U16A 1OHHA 1CQZA 2GETA 1WMSA 2XKKA 3ZLVA 5JZOA 4YONB 1UOOA 3V4LA 3CVUA 3KT8A 1GPJA 2DPXA 4LH7A 3FMOB 4MP6A 5SYAA 5JFTA 2GD1O 2POQX 3ILXA 3J7AU 1X80B 2QD3A 1Z6GA 2O48X 5DHUA 1N3LA 4QVGA 1T9AA 1ZCAA 3GMIA 3VYSC 3THYB 4RXUA 4ERNA 3FUTA 1PJCA 3G1WA 2IHNA 1B6QA 5EINA 1IZ3A 4EOGA 2I6SA 2HRUA 4LVUA 4D3DA 4R1NA 4N82A 2WPDA 1RC0A 3M9WA 2QR3A 3AERA 4KLRA 3SK0A 5DTJA 5NULA 3X44A 4JOBA 4GRIA 4QDJA 3K9GA 4HNRA 3RRFA 2J85A 2O23A 4AXXA 2ZD9A 2OBMA 1VGVA 3I5XA 2COEA 5JWHA 3ADCA 3A6EA 2EQAA 4MYCA 1LCIA 2QVLA 1W41A 4P92A 5FH9A 4DBZA 4ZZ1A 5I48A 1L9KA 1ZD2P 4HUQA 3L0CA 3PLAC 4QJIA 3SHFA 3DW3X 1NIPA 3EZFA 1JZSA 4BP1A 4ZXPA 3EFHA 2HRCA 1GITA 1SQQH 5DM2A 2JIZG 2IYNA 3VTAA 2OG1A 2WWWA 5AIBA 3ZEDA 2PBFA 5BMVB 1BFUA 1LPOA 1DAIA 1Y4ZA 2YHAA 2CNNA 4Z1MD 1EEXB 1ZICA 4R7GA 1WW3A 2AZTA 5CBHA 2JLBA 1DXYA 1ZH6A 1BYUA 2QE7G 1FS0G 2BJHA 3H0KA 3O9ZA 4OSPA 2ZUEA 4L5YA 3VOBA 4NTXA 1FCJA 4YCJA 2VF2A 1K5GA 1PJ8A 4WECA 3RLFA 2QUHA 2R0QC 4BFCA 5K3EA 1Y9AA 1V7CA 4NESA 4ZO8A 4EHHA 3E9DA 1DRVA 2OLKA 5J4VA 3D2BA 3CE9A 5B2FA 2WF7A 1BCSA 3H1LH 4YREA 1P1JA 3WLTA 1VM6A 3I2KA 3AOEC 5ELLA 1WDTA 1XZCA 1G8JA 4H17A 4GOJA 4Q3DA 2R6R1 3L1IA 2JS7A 5FL3A 1GPWB 4KV7A 1JEOA 5JZBA 4EFEA 4KJXA 2I6XA 1S1CA 4C6TB 1MB2A 3EODA 1FP7A 3WLFA 1KZYC 4CJXA 3BMXA 2I4LA 1BCSB 2WWRA 1PR0A 1O96B 2CH7A 2X6RA 2MTBA 2PNFA 3G2OA 2JGDB 1KHTA 1T6YA 1WUJS 5FPKA 2APJA 4YAUA 2EW8A 5KYGA 3KZVA 2A3RA 4K6MA 2FLWA 4WE3A 5G1OA 3V9PA 3VR4H 4UNRA 3FNEA 5J5CA 1E0SA 3P45A 2CH7B 1CNFA 2NV6A 1HMYA 2NUPA 4PSKA 2J8ZA 3B85A 1L4YA 4ZREA 1MNAA 1XZNA 4L5BA 3A9VA 3NUQA 2A0YA 5C9ZA 4JS0A 1MAAA 2GSDA 5C80A 1ZSVA 1NI3A 2YV2A 1VMGA 1BKYA 1QLHA 2Q5LA 1LX7A 3EUWA 3VISA 1KDVA 3RVJA 5I8WA 3BK1A 4BMOB 2NUPB 1QZ3A 2JVKA 1M2JA 4N0QA 1NVDA 1GVHA 3DXXA 2BE7A 5JVDA 5JTUA 3PYLA 4QUBA 3ENNA 1E4OA 1K4MA 1ZGHA 3KCYA 3FTDA 3ABSB 3AJRA 1O97C 4MZDA 5DSTA 1KZGB 3DMTC 2JGMA 3RKSA 2HT6A 2ZT5A 2W2LA 5H2FZ 4RDXA 5JCOC 3OQNA 2PYZA 1YQEA 2FEKA 1EUYA 5JSKA 2ZJ6A 4CKBA 4OQXA 2IUSA 3D7NA 4G1MB 5JVDB 4KR7A 5D01A 3ZHBA 4HFMA 2W48A 3GGJA 5HE8A 4W5RA 4ICIA 1FYJA 1HF3A 1MXFA 4TRJA 2JJ1D 4CE6A 2NSJA 3LK6A 4E51A 4ANFA 1SC3A 2WJHA 2JI6A 2PJZA 2AQ8A 1ND5A 5HY0A 3I42A 3H86A 4OQFA 2Y0IA 1N0NA 4QYWA 4FLXA 2IG8A 3D2CA 5F7OA 1GOTA 4RK0A 5LP6F 2AQHA 3QI7A 3R3JA 3NUZA 2PKWA 1A98A 5C5EA 2C07A 1QHHA 1PGNA 2N42A 2BOCC 1BSMA 2CLOB 2R6AA 4OXIA 1U8ZA 2UUBB 1OE0A 1C9MA 3A1NA 2AGVA 2E6KA 4Q82A 4HAXA 3HUEA 3P0JA 4GM0A 1RXUA 2IA5A 1BQZA 3KEOA 3NCTA 3K35A 5JE8A 1QIFA 3GLKA 3C3DA 2VTEA 1QHHB 3ST7A 3D6HA 5HWSA 3EFBA 3GLFA 4JQYA 4Q3BA 4DR7O 2X3YA 1B6TA 3ESDA 4X8AA 5JNUA 3LHKA 2X5KO 3L7LA 2CXPA 4LTMA 5AK3A 5B3LA 4B40A 4MEBA 3N28A 1NLZA 1EPUA 1BTOA 1T5SA 3LRXA 5E38A 1KBHA 3NHLA 5GQSA 2ZVDA 2UZ3A 2C4KA 1NVTA 4OPMA 1U2SA 3NYIA 4YRQA 1ARZA 1Z82A 3A70A 2O3RA 3D1LA 3GLFB 3FMGA 3K14A 1P39A 4MUFA 3E5NA 2F17A 2BN4A 2EEPA 3IRVA 4X00A 4I6JA 4UZEA 5DHQA 4MRNA 4GKJO 2WAOA 2OT5A 4YJ2A 4KUGA 4A9AA 4LSWA 3T0FA 2NU8A 1ZI8A 3HCEA 4CV0A 2OGWA 2H1SA 4GMHA 1TPZA 4DR6B 3PPXA 3ZQUA 2ZBGA 4OK6A 2QTMA 1UZNA 5I7AA 4L9AA 1W0JA 4Y7CA 5DIZA 5LOVA 4BNTA 5DNAA 3O4VA 2YFHA 4Y1GA 4FFDA 3V42A 1WQ1R 2WU3A 1ZD3A 2ORVA 4J1QA 4MP8A 2BMEA 5AI4A 5CNJA 3N4ZA 2I1WA 4WK4B 3GXBA 4RVGA 1EM1A 1VIBA 1GQQA 1EYZA 1U0NA 4JI6B 4M7OA 4EY5A 1DMSA 2XUFA 4MQUA 3E20B 4HDRA 4LJ4A 1ZVKA 4DHEA 3CPQA 3ESCA 2FRXA 5KNDA 1GNRA 4YT5A 1SXIA 1U9IC 4A23A 3AUFA 4KWTA 4JJ6A 3L7NA 4RLFA 1EX6A 3TS1A 2Y0CA 3ZBTA 1N6OA 1OI4A 2HU8A 1EFVA 1UP4A 2PTMA 3JY6A 1YJAA 1ZCZA 3EVKA 3BGVA 4Y9DA 4IUCS 5TT0A 2VDMB 4DSNA 4EYQA 5AI8A 2EIHA 1Z0UA 3PHJA 4FMTA 3GP3A 4P22A 1RXIA 2XAQA 2Z0AA 2H5IA 1QVFF 3IE0A 3IDQA 3WL6A 3GEPA 3EJWA 2DYRC 3WMWA 5B36A 3NO4A 5MN4A 3EZLA 2AK3A 5ESXA 1KECA 3O8QA 2HA3A 3LWVC 3KJNA 4P3PA 4I9QA 1H6CA 2V9CA 1ZGJA 1DKNA 1FU7A 1K6EA 3QWFA 1PKEA 1SIOA 3FUVA 2W6OA 4KH0A 1GZ7A 4OXKA 3RKRA 4CLDA 3TFWA 1VF6C 4KG7A 2ZIAA 2V8BA 1OFIA 3UUGA 5DWQA 1MHTA 2PIAA 1ZPDA 1PD0A 1YJ9F 3PZBA 4MW1A 1PLLA 3PC4A 3R6GA 2C8JA 1PGJA 4P3XA 1IX9A 3PUJA 1NMXA 4EKYA 5DGTA 1Z0DA 4R8CA 3GPIA 1QFSA 1WL8A 1ZM7A 4UULA 3RVMA 1BWSA 3K0EA 5E9AA 2EKZA 1MIOA 1WV0A 2VNHA 4V39A 2Y4NA 5EZYF 3WOHA 1BGXT 1GKIA 1S5JA 5ENDA 3GIDA 4EUNA 3NIGB 5AVRA 1KNXA 4LRXA 3PX2A 3BMCA 2OTLV 4ETIA 2YDYA 5AI0A 3K31A 2VPPA 2ZRAA 4ZCTA 2Q7HA 1U1CA 2ZNJA 4BWFB 1TTTA 2V7BA 3GELA 3LG2A 4YRZA 2EZTA 3PQ3A 1L5YA 3SDZA 2ADQB 3B9PA 4YCBA 2YW9A 1G9XA 4P93A 4DG5A 3HJUA 4AM8A 4Q0MA 2Q5EA 2EWCA 5JZVA 2PI4A 1QU9A 5DN6D 4BRWA 4G5XA 4IGIA 2XWJI 4UXHA 3M5CA 1TYAE 3WMRA 2V4DA 1G4UR 3OCZA 2L42A 2ISCA 2OTJV 5ED0A 1JHPA 4NARA 3A6LA 1ADYA 3LQ4A 3SZLA 2NTVA 3PYXA 4LC0A 3SZRA 2ORYA 1YJBA 3EF3A 4U7PB 2HFJA 4MWSA 2C4HA 4S1PA 1JLMA 3PGXA 1MOZA 2FUNB 2B5WA 1L4EA 4K3VA 5FF9A 1NUSA 2N74A 2O2IA 3H1AA 2P40A 3OAAD 3T1YB 5B1OA 3NDBB 3KDSE 4FFWA 2VDOB 4RZ3A 5KHLB 1NP6A 5T57A 5H0IA 4PWZA 2FI1A 3GH3A 3IV6A 4NEGA 2FETA 2X0DA 3WXBA 2O3JA 2ATVA 1T4CA 2C5HA 4ZYTA 4UQPA 3GA7A 2GJ4A 4K9QA 3N0TA 1CQIA 5EGSA 2QR4A 1TA4A 1V9PA 2A59A 4Q7MB 1M76A 4ZHVA 4EEQA 3WRWA 2PXXA 3IAYA 5DTMA 3A31A 2FFRA 1AI6A 2P6OA 1XBIA 2ZIVB 4I81A 2RGRA 7YASA 2ONZA 4BPRA 5IAGA 4MKGA 3WSTA 2C20A 3GVXA 3HC7A 1G3IA 1YZYA 1KJQA 3IE1A 3MJ4A 4IHQA 4MR8B 4Y9RA 1U3FA 3HU3A 4ZI5A 3JD3A 2QLNA 1M6HA 4PSDA 1DFGA 2ZROA 1X1QA 4ERXA 4PPQA 2RHOA 2LBWA 2EW1A 3EC1A 3EXHC 2P4QA 5JAHA 1B23P 4E03A 4YXWG 3V34A 1C1DB 4QHTA 3PFIA 5FWXA 2P62A 1P0CA 5L3ZA 2EFCB 2OP1A 3HY6A 1Z0ZA 5KQGA 1GUDA 5FR1A 1E20A 4NH0A 4JASA 3CUKA 4B47A 3H1EA 2BGMA 2WJWA 2JF0A 1E96A 2NWQA 1YO6A 2OCXA 1G5IA 4I1SA 1SQGA 2ZZMA 3UO2A 1XL0A 2RKBA 4FXPA 4NICA 2P6PA 1XEXA 2QTSA 1ZY2A 1E3DA 5FWXB 2XUIA 3LXMA 3X2EA 3JWEA 3DHWC 4NOMA 2EKQA 1VGRA 2RB4A 5GZ3A 1Z4LA 3WL8A 1T3TA 3O83A 2YHSA 3HLKA 5JAUA 3K0GA 3ELWA 4Q1DA 1JVBA 4JASB 4JDUA 4F4JA 4BLUA 2YDEA 1KFJB 4PVDA 4ENSA 2P6MA 3NEYA 2BEKA 1JH8A 1K4KA 2BCJQ 4LCBA 5F3RA 2G5PA 1D2CA 1NONA 2LW1A 1XEXB 2C4NA 2ZTMA 3WGZA 1A7UA 4DEVA 4W7IA 4UOEA 1DEKA 1JA8A 2IC5A 4QELA 1SAYA 1SCDA 2IIVA 1KERA 1A32A 3ROTA 3BKXA 4U8GA 4D9JA 2A0KA 1NZJA 2OBLA 2H4ZA 2Q3JA 1U7TA 1EFKA 2Q6KA 1J70A 5HGXA 4TMFA 2QXYA 2D06A 3H1PA 4LWPA 1NVPD 3ONWA 4I4TA 5CVCA 3T54A 1M2VA 5AO9A 5EIAA 4K6OA 1NNLA 1FDWA 2Q6TA 1ZFNA 3IGAC 1ZL8B 5J4YA 1K9SA 1SFRA 4HNVA 1F8XA 1QQTA 1T91A 2EP8A 4HDAA 3WYNA 2OFOA 1YIAA 2C5GA 3MB5A 1SG9A 4DVGA 4A16A 1SULA 2RIPA 4HK4A 2WV7A 4QOFA 5CJJA 1ZJ5A 1R4ZA 1RACA 5FWYA 4I4TB 1QAHA 1H3EA 2FG6C 2VZ0A 1M2VB 2CC2A 2AH5A 2O7SA 5DJ5A 2VCHA 5I01A 1AHNA 1SK9A 4YP1A 3TI9A 4PQFA 1XZMA 4ZGWA 1IWOA 1R4MB 4C4AA 1ISRA 1GCOA 2LE0A 1R3JC 1YC2A 4RZUA 3PNOA 2F1HA 5LMZA 4UVIA 1R6AA 5FWYB 4KYVA 4HSEA 3SYQA 5A6SB 5LB4A 2QP4A 2FUCA 2H63A 1N1DA 1BVRA 1LBQA 4WKPA 2GVZC 2Z95A 4ZKEA 1J0AA 3TE7A 2BSAA 4AP6A 2PF4E 5EP1A 1SMKA 1IJBA 4PR0A 3WGUA 3ESQA 4OGFA 1K8AW 1GPBA 1HZJA 2FOXA 3ENQA 4UOZA 4OPHA 4DA7A 1PVVA 4RD6A 5IT4A 5CDHA 4PDLA 2BYTA 1BNCA 1ONBA 3N5CA 2I9KA 4UVDA 2IL1A 5JQWA 3HU5A 4YT2A 4XDHA 1TEXA 5ADHA 4X64B 3RTAA 4QYTA 1QKJA 5HUJA 4CIXA 2BM9A 4ASUD 4HWRA 4I9UA 1ENOA 3ICVA 4QXOA 1U2DC 2IEIA 1PZHA 2QTVA 4TS4A 3OM3B 2VT2A 4UM8B 1SHZA 4X61A 1LSUA 2FN4A 2FSVA 3M7MX 3FOAA 4HO1X 4EBFA 3JQFC 4P3KA 3TECE 4J0GA 1K9MH 4Z4FA 1CZHA 3A27A 5AM3A 2DN9A 2CKDA 2QTVB 4YGYA 1TM1E 1DCMA 4K6HA 5BWOA 2HSJA 5AVSA 4BVLA 3DDWA 1QCYA 3JU3A 4JWKA 4IS2A 1VP9A 3ESXA 3ER6A 5EKTA 2L17A 1MPXA 1JTEA 1JA1A 3HCBA 3AQIA 4OVKA 2DMRA 5K3FA 1NQAO 2F43A 2BFNA 3WL3A 3S40A 3IR6A 2A78A 1UXOA 3OC6A 1QE3A 2WLLA 4NK4A 3D6MA 2X13A 2VHZA 2Y1GA 3BFPA 3DZIA 621PA 2P8SA 4C1BA 1V54B 2WVHA 3FXAA 1DQNA 4NCAA 5CLQA 2XE7A 3VRHA 4TWBA 2HPZA 3PPWA 4BHTA 4Q1CA 2IXEA 1G7RA 4MW2A 5K3FB 2F43B 2IZ5A 3AKZA 5HY2A 2NM0A 1XNRB 1W5BA 2HV9A 3E1KA 1S3IA 4M6WB 5ELMA 3L04A 3FTFA 3HLYA 3ODPA 4O29A 4DV7O 4YI3A 4I9NA 4D4LA 2VNJA 2GBIA 4AJ2A 4Y9SA 1WSDA 1Q6HA 3C39A 3RRJA 1DJOA 3DFMA 3HAXD 4Y1FA 1JQ5A 3ZD6A 1WUYA 3BGDA 1FJXA 3BL6A 1LGYA 3E4CA 3HSKA 3R0JA 1V11A 5ICCA 1KMHA 4XQ0A 1TE2A 5I7VA 2VYQA 1QR9A 2EWVA 3AU9A 3ZWOA 2H4YA 5LWHA 3S0HA 1IPAA 1STOA 2XIQA 2DJ5A 1TK3A 1TQ2A 4ENRA 4DV2B 2ODWA 4QATA 1WVGA 3ONVA 5AKJA 4G1VA 3OCJA 4Z9FA 3KQWA 3I56V 5AFSA 2IYZA 3U62A 4FUQA 1U4OA 1TMOA 2ZAIA 3RGGA 3B6EA 1V11B 5M7EA 2W4IA 3AFOA 1KMHB 2XMCA 3B48A 4X65O 3EB9A 5EKUA 3BGIA 3T38A 1MGOA 3G6BA 2MSDB 1SVLA 2VDVE 1CJTC 2GMWA 3HXKA 4CW7A 5IJ9A 1VP7A 1FXSA 1A9PA 1BD4A 3P0EA 1CG6A 3OOJA 5KNCH 4Q7EA 4JI3O 3ZNOA 4DLXA 1S0UA 3LF2A 4LWSA 2ZRMA 3AK1A 2YWCA 2NP6A 2WVAA 13PKA 3VSCA 4E2YA 4XTCS 3OCUA 1XMOB 1FUIA 1E3WB 2HKIA 4UHBA 1FP1D 5IJ9B 3E48A 2Z1FA 1GQ2A 3CWQA 4DR1O 1X7YA 1XLTA 3ASOB 2ZJ4A 1L5KA 1P9RA 3OPQA 1AZLA 1BCRA 4KXLA 1MEEA 1FDVA 2C94A 1SVUA 4D56A 4IGKA 1BHAA 3CZQA 3MAGA 3LFTA 2VOJA 2VTKA 1QYDA 3MCVA 3QVOA 4YV2A 4A4DA 1W1IA 4DCMA 3H2ZA 4U2EA 3BGOS 3IPYA 4QNMA 4EMTA 1A95A 2C8LA 4NDZA 4H1VA 2FGYA 3GGGA 1Q0RA 4LF8B 1ZXXA 1X7YB 1AKNA 4OHXA 1ZONA 2G83A 3C6XA 3AVUA 4CI9A 1M2EA 3QKIA 5KUMA 2PS0A 5CG2A 3MCUA 4DNFA 4GSLA 5EJ2A 1NZFA 4JQZA 2H3EA 4JWTA 2DR0A 3DOIA 5J5VA 3BM5A 4U7NA 1TM2A 4Z3OA 1X1DA 5T67A 1N9KA 4EKNB 5HJ7A 3Q3VA 5LMUB 4IL6Z 3WYGA 1TVMA 3GLRA 2ZQ5A 4PRZA 1OUMA 3AG1C 4RK6A 3SM9A 4PLFA 1JE1A 3CWBH 3A9SA 3WJ7A 3KIPA 2A8YA 1I3LA 2HTEA 2CDBA 3NBZC 3HY4A 3DOEA 4OD0A 2VEDA 4C6RA 3WK6A 1ID1A 3D5TA 3PUHA 1TCBA 1ZS9A 3IQEA 3UT5A 2P4EA 4C43A 3DTVD 4YJ3A 4US0R 1PT5A 1SUFA 2VJOA 1T4DA 4FJ1A 5K0NA 3O2NA 1GFIA 2IP2A 1Y8CA 2GD6A 1YDEA 4O33A 5DIFA 2XPCA 1SC1A 1ZMTA 4F3TA 2ZR0A 5FBLB 2NNLD 1H1TA 1S0VA 3ZU6A 1UIMA 2ZT7A 2VPWA 3W6ZA 4JJGA 3H5OA 4D99A 3QSYA 4FYYA 3UT5B 4BV9A 3F97A 2XCOA 1N77A 4IV8A 2I6RA 3ZHVA 4AF6A 1WBDA 5BSGA 1YQWA 3QUCA 1A9XA 1W49A 2EZOA 4LSZA 2R8YA 3MRVA 4B3JA 1SVKA 3FKSD 4G4SP 4Q00A 4BXOA 3PEUA 5CBFA 2XUJA 1OVGA 4P53A 4IXMA 1J1ZA 1SU6A 3D36C 3X1ZA 4YIOA 4RVUA 2R6JA 4F60A 3IUSA 4LVNA 2X6CA 1ST2A 4V2IA 2OQVA 3OR7C 3BX1A 2QW1A 3FYUC 5CGZA 1H7MA 1VQ8F 5L3QB 3MSXA 3X1XA 3B7PA 4UZSA 3JWJA 4EFNA 1I32A 2PUGA 5B5EZ 3I32A 1E8DA 4GOOD 2YV3A 1CB0A 3R5FA 2R25B 4AFNA 1G8MA 3LX8A 1SCJA 3SYOA 4NU8X 5TDHA 2VQEO 3OR6C 1KWKA 2QEXF 2HHHO 3KSBC 4A8TA 1EFRA 1R0RE 2H4XA 3KZNA 3SJCC 3RFVA 3DE2X 1GPAA 3KKNA 3ZK9A 1HH4A 1N2CE 3RIYA 4XJSA 3TQHA 1ZEMA 1XO1A 3GRYA 2IZ1A 2AL7A 1E2QA 2C2OA 4UMVA 3NWBA 1GUFA 4N41A 3CIFA 2XHEA 3GFSA 1E1QD 1NLMA 4DOMA 4U63A 4IJMA 1KQ3A 2TMDA 2FX2A 3UQ8A 1QTNA 1LSJA 5ALVA 4CQMA 3HCOA 5KWEA 1UZUA 3SJAC 1NJSA 5C8DA 1K9VF 4XA8A 3VVLA 4TTVA 1XQ8A 4R1UA 3CN9A 2HYDA 3HVKA 3BE4A 5E7MA 1QFMA 4GYYA 4EBBA 4UAUA 4WUTA 3AX6A 1FOEB 1HM5A 2B4AA 3X1KA 3SF0A 2HMAA 4URYR 4LNAA 3FGNA 5F1KA 3ZU3A 4KE9A 2PX4A 1WXFA 1TC1A 1WCWA 1YZVA 3M7IA 4A26A 4WMLA 4IKOA 1MGPA 5F1YA 2PXAA 4HUJA 2Q4OA 5C1BA 4WFFA 2PYLA 1OX5A 3K9AA 2YCBA 4H3SA 4HLUC 5FL7A 2P2CA 3I61A 3TPCA 4MK4A 3J80M 2Q0QA 1QR6A 3W5VA 4KR3A 2YC2C 1YZHA 2LD4A 3O74A 4IY1A 4AZVA 4UAVA 2ANBA 3B3JA 3OJCA 5JPCA 2ZQMA 3BB1A 2FPIB 1U28C 3BQ9A 5DVZA 3E9QA 1D6NA 1C7ZA 4RQUA 4XVUA 3Q1LA 1HNXO 3W6PA 3CD6F 4EY6A 1FLVA 4FJCC 3L6RA 2A9HA 2DETA 1EQAA 3INNA 3D4PA 2FSHA 2BLNA 2ADMA 2YC4C 3QVXA 1UJWB 3C3MA 2SKEA 3VR5D 2JLUA 1T2EA 5HQJA 1QWOA 2WD8A 4A8JA 5IDYA 5DMHA 1SCIA 4K6FA 5JH7F 3H5TA 3OM0A 4CG2A 1YC5A 4RVNA 1D8AA 1U31A 1ZDMA 2EBOA 4DPMA 2BONA 1B0UA 3FJ1A 2E18A 1ZI9A 3LQFA 4E6PA 2ZBDA 1TU3A 5BT9A 3TOSA 2ZT8A 4DV4O 4NV3A 4DUZO 3BRSA 4A8JB 4A5SA 1CUGA 1J2YA 1EG2A 3AIKA 1GP2A 4GZLA 1EZ1A 2Y76A 3AB3A 3HSYA 2R4QA 2JH8A 3SMQA 1NHGA 4WKOA 1BVYF 2VT3A 1DOHA 3B51X 2O3SA 4WDQA 3SKVA 2H06A 5JHGB 4INPA 4HX2A 1WZ2A 2MR5A 1I3KA 3ZXIA 1U0RA 2XZOA 5JYEA 4ZK7A 1QH8A 2KMLA 3TIGA 1G6KA 4I0XB 1TCAA 3M1LA 1MAUA 1QFXA 4OHPA 3GRCA 2ZRGA 1CCWA 3T5GA 1YULA 5E6UA 4C78A 2RKOA 3RRMA 3A6HA 2Q1YA 2NT4A 2D5BA 2JFNA 4G0PA 2WF6A 3KAKA 3HN7A 5J9PC 4GR4A 4QJBA 1IK6A 4EI7A 5HVNA 4GVXA 4FFMA 1QH8B 1I2ZA 2QV0A 5H68A 4M9ZA 2AVNA 3GY0A 1MRZA 4QU9A 5E6UB 3HZOA 3CLUD 2HPHA 1NLUA 4C0XA 4XR4A 3OMXA 4X6LA 4GKKB 5TR9A 1DWPA 2OSVA 1IZZA 4XB1A 1RKVA 1QYIA 3KSDO 3TLGA 2CXSA 1P5HA 3BOSA 2HX0A 3VHRA 1S2NA 2PWYA 1S2OA 5IASA 2A84A 4MW8A 1UBJS 2PGAA 4BGUA 5KOIA 2QZSA 2QN1A 4F3KA 4OM8A 1X86B 5EJ4A 4AG5A 5D7NA 3HRKA 2QK4A 1QIHA 4DCTA 1E7SA 4XSGA 4ZVOA 4F5WA 1XPUA 1ZK1A 2NVOA 2IXTA 4TSKA 3LC2O 2XNSA 2XQJA 5JISA 1GO0A 4MS1A 4P9PA 3SPJA 2UYGA 1H2KA 2L6LA 2JNBA 1C7QA 4QXPA 4U2KA 3IMPA 1EVEA 2Z43A 2B8WA 1OIVA 5BO5A 4BNJA 4KWCA 4UDYX 4CEIA 2O7QA 2GNPA 1VL5A 1Z6AA 3PHIA 3BH7A 1G16A 3A36A 3TD4A 4B79A 2DUJA 3K5WA 2WR8A 4MS1B 4ZYXA 1NJ8A 3WHKA 4C3ZA 4FNMA 2PIDA 1P1IA 2PUWA 4M1OA 4HAVA 2R5WA 1WSBA 4HDMB 5JWPA 1S5HC 1QDLB 2GN0A 3DKPA 5GW7A 3PI6A 2W83A 2R751 3L7DA 3ZE9A 3MPUA 5FTKA 1OCOB 2P6RA 5DCVA 4XD2A 1AUQA 1KJ8A 4CG3A 1WP4A 3KOOA 5LQCA 2AD1A 4NUTA 3ZI4A 4JYZA 3PR3A 3WC4A 3EUFA 1BKDR 3ET4A 1DF5A 4DB4A 2WUEA 4GMDA 4NHOA 3BD9A 1AP6A 4DY6A 3A1FA 4JVMA 4OHFA 1M1NB 1PZXA 4KEAA 4AW9A 3C5VA 1SC9A 1N5JA 3E18A 2VT6A 3CNQS 4KQ6A 3MDOA 4BLRA 1H8HD 1R2QA 1IY0A 3ZDEA 4PZPA 4XYLA 3KKPA 4HDKA 1WX1A 2E5LB 4C4RA 4IHJA 3GWGA 2Y1XA 3L0ZA 2FWNA 4BQPA 2ZIOA 4RY2A 2NZ8A 1CUIA 4IDFA 5B1AB 4IIUA 3R7SA 2AR9A 2AOTB 5CAEA 1JQBA 1ICIA 3SIWA 5EIWA 3SLRA 2XNDG 1EAMA 1TFRA 3WLMA 3ZVNA 5ALPA 3O4HA 3KHUA 2RSLA 3JQ6A 3ACDA 4IHJB 1GO2A 1K98A 1C9JA 4F2HA 3GXOA 4HGQA 1B73A 3FYSA 3U7EB 5IKPA 1T2AA 5KKAA 4BFLA 1H1LB 2OCCC 5BUQA 2R4UA 5CAEB 3OFND 4J4HA 4DIUA 2HWWA 3WZLA 3ZY6A 1Z4PX 1ZX1A 1ZK2A 3WGKA 1OFTA 4QFBA 4MKXA 3IMEA 3W78A 3T1TA 3K09C 1Z63A 2LDBA 2DHDA 2G8NA 3E15A 4C8EA 3ZZTA 5FUBA 2FWAA 3DO8A 4KIGA 3T9BA 4L4SA 4NCHA 4F5EA 4EELA 3OSZA 3CRMA 2BT4A 2IPNA 2KI5A 2GQ0A 4Y6QA 2BC9A 1RRCA 2FZVA 3MTBA 2EHDA 3QTTA 5HFAA 4KUMA 1YS7A 1Q1ZA 4I55A 1GM5A 3QA9A 1Y6QA 1XR3A 5AUPB 4C4ZA 2X23A 5B7PA 5GP1A 5TT1A 2X2EA 1W4CA 5DTEA 1IXMA 3D6UA 2ZPTX 1DO2A 3TAUA 4P2BA 4C08A 5F9MA 2GZHA 2JKZA 5IEJA 3CS3A 5BW8A 3T3NA 4I55B 1H0HA 2IV2X 4TVBA 3CB4A 1BGVA 2QW0X 4ZYWA 5JAPA 1EGVB 2IHKA 2WJAA 1FDUA 2WF9A 4I14A 1R74A 3I4FA 4ZANA 2GFIA 1M6WA 4Z1OA 2B36A 5CJPA 3EGEA 4MA4A 2EWMA 2E89A 3ACBA 3IDFA 4EDFA 2K7ZA 1V1JA 5KMGB 4HTFA 2YASA 1YAHA 3M4ZA 2EZPA 4CR6A 1PFVA 5GAJA 4BIUA 1OGYA 2QYTA 1ZL2A 5CDGA 4HB0A 3THYA 5AK0A 1Z6PA 4WFGA 3OX4A 4Z9AA 3KQOA 3L0SA 3I2HA 3D4IA 3OJOA 1E8NA 2OHXA 3C3BA 4Z1MG 3HVRA 1YA4A 2Y4OA 1GPH1 1TAEA 4CH4A 2HRQA 2WSSD 3N86A 2Y69B 5ULLA 1VRCA 3AEUA 2EIJB 3JQEA 2YV1A 3NVKE 1P4RA 4HTFB 1ES9A 1C4KA 1FNDA 4TKVB 1DT5A 5EZ5A 3IP5A 3HYSA 4XKJA 1D7OA 4HGYA 2B4YA 4P3OA 2QWPB 2FMUA 1N0IA 4MLDA 3D54D 3CLRD 3AEUB 3GAMA 4GDFA 4YUXA 2WTMA 3D59A 3P3PA 1T2DA 3UXEA 4N5MA 2QOEA 1N0HA 1XEQA 2JPDA 4FU0A 3O8LA 2DQ0A 3ZYCA 4B6SA 3RJTA 2H4WA 3UKJA 3BGWA 2H1VA 5HM8A 2R7LA 5BMVA 4M1KA 1RSZA 4JI0O 1FDIA 3HJTA 1B8VA 2ZDHA 4R7ZA 3LBIA 2Y0PA 1U0BB 3BXFA 2P5YA 4CIAA 4GAEA 3KQMA 1JU9A 1SKUA 4DV5B 3FOEC 1Q3EA 4O4HF 5EQFA 3ML0A 2UXBO 4HRVA 1NBOA 1A97A 4B8ZA 3RIXA 1U8CB 3SC2A 3SHTA 2NUAA 4XCVA 1J9GA 4HH0A 2LGQA 1P7GA 5EMHA 5F4BA 3G1TA 4JITA 3UA4A 3AIOA 3M4SA 5JXIA 4JOQA 4R9RA 3GJ4A 2ARHA 2ZSJA 4I5DA 3K92A 1NW6A 1K5HA 3R9KA 1I0ZA 3QXXA 1NBMD 2Z2JA 4PXAA 3W7VA 3SC2B 2XUGA 3A2LA 2PD3A 2NUAB 3UJ6A 4O2LA 3T34A 5E9QA 4LJKA 4L3VA 3QRWA 4PCUA 1R00A 4EKIA 3T1NA 2E0IA 4C6TA 4GIBA 4TQFA 2JK1A 1O96A 1XMSA 1C2TA 4H3HB 1W36D 3IQGX 4E4YA 1Q44A 2JGDA 3CYPB 1U0LA 5ICEA 1SCUB 4M0CA 1X2EA 5DF1A 4WFIA 1RM1C 1CQJA 2YXEA 3SE7A 4C14A 5DNVA 1GDHA 1VPDA 2OLEA 3VO9A 4UC0A 1QZZA 4HDCA 3D7MA 5LGUA 4LV8B 5FBKA 3RSGA 3VU8A 1K34A 3RC1A 1KY5A 3L84A 4BFWA 2YW2A 2EJUA 2F4VO 4NS1A 2Y4UA 1MJ5A 5E1DA 1C7RA 2P6JA 4R9UC 3ZQ6A 1P4GA 1CQJB 1MMFB 4WGFA 2JJ1G 1GM8A 1PJTA 5CNMA 1O6CA 4E1BA 1BSVA 4GWLA 2OCYC 2PUFA 2HMSA 4M49A 5IT9M 2JAHA 4CIBA 4UNPA 4JYCA 5EE5B 5FRDA 4Q7LA 1TTPB 1O94A 3U13A 4JZGA 3CMAF 4GLXA 4LE2A 3M6UA 5DSZA 2I91A 2JAOA 3PX7A 5EZSA 1AZSC 4B4VA 5HXZA 2QSYA 2OVBA 2PE5A 1SHLA 2LPMA 1VJ5A 3NETA 1YCFA 2QTWB 4LYDA 2FHPA 3O90A 3O4RA 4MZXA 2JL1A 4PX2A 4OB6A 3WLAA 1MT3A 2NYRA 4CF5A 3MXOA 5F5NA 1QUEA 4NKRA 4TLCA 4PFJA 1Z0KA 3Q87B 1YR1A 3F78A 1WV1A 2OR3A 3LKBA 4D4GA 3R9IA 2G82A 5CH8A 3WKEA 3KQTA 4O8CA 3FFWA 1U1GA 1XEFA 2PMCA 4M1QA 3R7BA 4H7HA 4Z0TA 5HXAA 3DVSX 2VR1A 1QLEB 1WXDA 1G5RA 1ZAUA 2QRNA 4KXNA 4MKZA 2GERA 4Q16A 2DYSC 1SXHA 4YK7A 4KL1A 1OH6A 5AW1A 5G4KB 3OZUA 2VHQA 5AKHA 1YZLA 5JCJD 3OEYA 2V4UA 3T7TA 1UJ2A 2AYZA 3P26A 5KWSA 3VR6H 3KUCA 3C3YA 4G1FA 4Z0PA 3F7TA 2UVDA 3GFVA 3TCNA 3F49S 1CVLA 1UODA 3ETHA 3JSAA 2DWQA 3HUDA 2ATEA 3L46A 1N2OA 4ROTA 4UB8Z 3SE0A 1EBFA 4WHMA 2N04A 4FM1A 3SEZA 5FPQA 2H2FA 1VIMA 3DFZA 3GJSA 5IANA 1FXHA 2FEOA 2BKVA 4OMDA 1KI6A 3KUXA 4CM1A 4J0CA 2KW5A 3L7MA 3K0HA 2HJWA 4BX9A 3MUFA 5JJEB 3HB7A 5JY6A 5LNK6 3QE0A 5IUNC 1R9GA 4BQNA 4LPSA 3P2JA 1ZRMA 4JA2A 3E9ZA 1QVWA 4LISA 4ZAXA 2AJDA 4BKUA 4JV5O 2Q62A 2ZKOA 3F5DA 3IR5A 4HQLA 1KI6B 3DP7A 4W5HA 5T3UA 2UXXA 3B36A 4MV7A 3EZ2A 4DDVA 2OBXA 3T4UA 1XT6A 3T0IA 1XROA 4EKWA 3CC7F 4PN3A 1X1TA 2O4CA 2M6RA 2PL9A 3TINA 4QWMA 3FLAA 4BNYA 4G0VA 1JB1A 4GS5A 5HFJA 4LWQA 4QXMA 3ELCA 3DOUA 5CFNA 2QR2A 1D5CA 4B35A 5KSPA 3DDOA 3L6BA 1HEYA 3COSA 4JNKA 4PIMA 2QP3A 3KSMA 5BQOA 4YAEA 3B2EA 4U00A 4UU1A 1JHRA 2HNBA 4UFOA 3G68A 3HEAA 3I62A 1VQMF 1EVKA 1I4OA 3GLIA 2CVZA 3FJYA 3O4JA 3W7UA 4G37A 4HSGA 1Y9EA 3TXAA 4DBVO 1JECA 4QYSA 4FKBA 3AYZB 3EEIA 1QIJA 2PO5A 3DLTA 1L8AA 3IQHX 3LQKA 1J1IA 2BVNA 3G0GA 3EGXB 4X7RA 1TIKA 1SY7A 3AP3A 4XARA 4MLCA 1ZK0A 4M1WA 1AV7A 3GLIB 2Z2YA 2RHCA 2PMPA 3FSEA 3CE6A 3B9QA 1V4VA 2H1CA 2NVBA 4XJXA 5IULC 2C0QA 2XT6A 2BGNA 2VWHA 3GBSA 3TTYA 1X1SA 1PL7A 2RHWA 3DKKA 4HDNB 2P2GA 4MVXA 2JEZA 3BIXA 1PNVA 3RFRA 1IDOA 3SGLA 4B3HA 3THRA 2RQ6A 3ZRXA 1EI9A 4OU5A 1BMDA 3OVMA 3EBLA 3ASVA 1W5EA 2CL0X 5AM2A 5E4FA 2C3YA 3IVMA 4KAFA 1KC8W 3JSLA 4ZHSA 2QM8A 4YB8A 4KO2S 4O8ZA 4Z7QB 1SCKA 4KQIA 1UQUA 2KB1A 4G88A 3F4LA 1N2GA 4CM9A 3RVKA 1Y8QA 1Z28A 3CKYA 1SGWA 5DN6G 1LZKA 5JWRA 3FVTA 2GXUA 3OKCA 3EEFA 3L9DA 2HCJB 1WXXA 3AKYA 4HNUA 2WF8A 4RSGA 3OFVA 3ONFA 1ND6A 1O4VA 4EW3A 3VNUA 5LIPA 1G8HA 1K4CC 2Q46A 4WKGA 3RYTC 4D46A 1H4TA 1MVOA 2XB4A 3FFQA 1E9SA 3HACA 4WZAE 4WBNA 4XD7D 4F9EA 3ZY2A 1S72V 1A2BA 3VH4A 1Y8QB 3A25A 5HUHA 4JJ8A 4B7ZA 3PGJA 3OAAG 2H0QA 4V38A 2ZE5A 2GESA 1VZ2A 3A4LA 4N54A 1E58A 3UWSA 4QG3A 1VBFA 4LF4B 1DXOA 1QAMA 5LL6Y 2I7CA 4DCJA 1H66A 4WBNB 1HL7A 4M76B 1NRWA 4HQRA 1SRYA 2H2IA 4FLZA 3BK2A 3ETCA 4Q3NA 4MV5A 4HEHA 4TQAA 2GZAA 2DM6A 1NBEA 3A26A 1NW4A 4RTPA 1IHDA 1GTZA 1Z7WA 4FVTA 1JTFA 4DLTA 4EYKA 2P35A 4YBZA 5AR1A 1V5WA 3OZBA 3S03A 1JJIA 4U5QA 2YUIA 4LR3A 1XTPA 1GQFA 3OTIA 4DXWA 5FPYA 1A77A 3LRTA 2F64A 3QLJA 4LF5O 4PO1A 4Y2HA 2A14A 5GM2A 1VE6A 2H1LA 2A6PA 1FFCA 1Q8RA 3OCVA 2QZJA 3UMRA 4S1OA 3ZBQA 3G2NA 1YITV 4RC9A 4ROSA 3H1KH 2XB2A 3O1IC 4BUZA 1ZD8A 3DM5A 2RGWA 2REXB 3N4YA 4Q3EA 2XXJA 4YRFA 3IVAA 2QR5A 5FLEX 1GLVA 4O4JB 3I55V 4WFEA 3EPLA 2YS8A 2GTIA 3SQOA 4ZCQA 2ZUUA 1JPUA 3DBHA 2ENUA 3QOFA 1OFGA 3NBKA 3Q0EA 4I08A 2HJ9A 3MIZA 5KBYA 1UBFA 4MUXA 2D1YA 3TQQA 4OHKA 3MWEB 4MO2A 3ZQ4A 5FPOA 3AG2B 2DP4E 4UTOA 2VXCA 4Z54A 4M8IA 4JKIA 4MR8A 5HWEA 5I9TA 2FZGA 1SC4A 2HMTA 3H4IA 4MRPA 1FD9A 1RM5A 2ONYA 3DBHB 1KQSF 2HMUA 2WSIA 3WFIA 3X2QC 1YHYA 3ES9A 1JDPA 2QTPA 3FNFA 1Y3HA 3IKMB 4E1AA 4JI1O 1H8ED 1CP3A 2JJMA 3CCRV 1C1DA 1XQXA 3PUVA 1E66A 1HPLA 2RK6A 4PHHA 3GLTA 2OOSA 1VQ7F 5HS6A 1WB8A 3KZOA 1ACMA 2QJ1A 1LLCA 4Z9YA 3OT7A 4QUAA 1SIBE 4WCDA 4A0QA 3VHLB 3SIPA 2BSXA 1P72A 1T2VA 3CLTD 1P60A 4NAVA 3EUEA 4O1MA 3DJYA 4RPHA 2ZODA 1SQXH 4A6EA 3G79A 1L7NA 1RLMA 3A9RA 5A4FS 3U11A 3B53X 3CR8A 2CHGA 1X8JA 1JG3A 2FSPA 1OBHA 3MJCA 5LQNA 2W42A 4YY3O 4RKYA 4C0BA 5AW8A 3SIUA 1ZCBA 1RYDA 4X1KA 1QUFA 2QA4V 1NT2B 3AR3A 4DQXA 3G2LA 4MB0A 3DL0A 4O6VA 1B74A 3BC1A 1A5ZA 2Y8EA 2YWRA 3GGSA 1X7PA 2ZIEA 2PS9A 1BGYH 3ZTWA 4J6EA 721PA 4L9RA 4QHYA 3KEGA 1T1EA 3OZIA 3C1UA 3SHQA 2XGMA 3NPAA 1FFSA 4OJYA 2IYTA 3GUZA 3ORQA 3WQBA 4UNNA 3JQ9C 4G89A 4X1KB 3ZWMA 1KH3A 1UL1X 3D4LA 2CLCX 4RVSA 3K1JA 4JXXA 1F7UA 2F8TA 1VJTA 1UANA 1QO9A 3OM8A 3OPMA 2ZYRA 4NTZA 5BN4B 1FNJA 3S55A 4L0MA 2DB3A 4JVNA 1BFDA 4LEIA 1ZL8A 2V98A 5CDFA 3IKTA 3BPZA 1D2DA 3FDZA 2HLDD 3ESJA 1NRJB 4BFVA 2Q9AA 1GU1A 3K2EA 1XVUA 2OV3A 1Y76A 3GH1A 3T9AA 1QV7A 2CE4A 1F7YA 3K8YA 3SYPA 2FQ1A 5CX4A 2UXDB 3FTPA 3V3KA 3O38A 4RE5A 5I4IA 1R6NA 2YS6A 4N7MA 5FOSA 3EWSA 4D79A 2CDCA 1KQGA 2ZLBA 2ZR3A 1XQ1A 4ASUG 3FSGD 3FDZB 3H6HA 5FD8A 1IY8A 2ZSAA 3G2IA 1EB9A 1JVNA 1N92A 2V3VA 3HWWA 5KVSA 1E62A 1R4MA 4P34A 2ZBUA 5FPPA 2GEBA 3U19A 1Y76B 3MC1A 5KC8A 3PUWA 4XBFA 4G5SA 1BHO1 3WZ2A 3D1VA 4JYAB 4N3CA 2IPAB 2LFRA 3LSUA 5A6SA 3U4GA 5B7NA 4MDHA 2BKAA 4M4SA 1VIVA 1ZN7A 1IHXA 4C4WC 4MWZA 3VVMA 2IZOA 4DEYA 2KG7B 2PX3A 1F20A 2B8NA 1WPBA 2NSHA 2G6BA 1NN1A 1A5SB 3VPXA 1HDYA 5JECA 3NONA 3VZPA 4W7SA 1UAYA 1PNLA 3ILVA 4DTCA 2OSBA 3T3MB 4QYIA 4DNQA 1KPHA 4BKRA 1F3OA 4LYJA 3LKZA 2W0FC 1KK0A 2UZ4A 3V5NA 1FEZA 1JQJC 5DBGA 1V7ZA 1YOVA 5FOQA 1T15A 2IV3A 1MJFA 2FW1A 2AN3A 4XM1A 2D54A 4ZYYA 1B93A 3LHIA 4XQCA 4LWZA 3WAGA 4QYIB 2X42A 4X20B 5ALXA 3X1WA 4F6CA 2XEXA 2DHEA 1TO2E 2O2DA 4Q9AA 5C81A 1XAIA 2FDRA 3JWIA 4EYGA 2WU8A 1YOVB 2JCYA 1U7OA 1WRBA 2QSZA 1BS9A 3PSHA 4C30A 1E3QA 1YJQA 2RKWA 2EJ7A 3JR3A 2Q5HA 4EVSA 3IALA 6ADHA 2D8AA 1RT9A 2GVNA 3NDRA 4RA9A 1FU4A 2HIAA 2IUEA 2RIRA 4GQBA 1GZSA 3S2UA 3VDMA 5EIEA 2OUIA 1TEZA 1NDQA 4CL8A 4W1SA 3HR7A 4BATA 1VQ6F 4AMZA 2HIMA 3OLXA 3VV3A 4NZNA 5K51A 4X94A 2QG6A 5E1AC 1T6XA 2PR7A 2IUYA 3OU2A 3UM7A 4FFPA 3NRJA 4KPGA 4RA9B 4DUYO 4AILC 1OU4A 4M6WA 4G1UC 1Y66A 1IDN1 4P2GA 2MK3A 1DTWA 5TMDA 1ECFA 2BE3A 2VPZA 2ORWA 3H04A 4BZXA 1C9EA 2RGUA 1EINA 3LT4A 4GECA 2H2GA 1U4SA 3EGVA 1RNLA 1I2AA 3FVQA 3JQ7B 3VKHA 4DA0A 1C0EA 3N39C 3BAAA 4Y67A 2XJ4A 4JFRA 3B09A 1HYBA 4K9MA 2J9RA 4YRSA 4U7HA 3MCAB 1KQPA 1T0HB 4WNIA 2YV5A 1DTWB 1E1MA 1KAQA 3L7CA 3BZWA 2G7MC 2I2CA 2VRCA 3LPAA 3LUJA 4ER6A 3U26A 4EFMA 2ZZKA 1NFQA 1VSTA 4L4ZA 3FDXA 1E77A 3MW8A 2XYGA 4JJAA 4TTAA 2LCFA 3GDWA 4J1SA 4BVHA 2WINI 4FN5A 5AW0A 3U0ZA 3BSYA 1IIBA 4MWBA 1F8YA 3V8BA 2C04A 3CCLF 4LFBO 3F7MA 2HW8A 4G8DA 3QQ5A 4IL5A 2B61A 2D1RA 3ND8A 2K1SA 3Q7QA 3DHEA 3F0TA 4M89A 3PU6A 2QLJA 5FKJA 5K0LA 4M2LA 3HS3A 3KJHA 3HV0A 1SVNA 3C3JA 3GUVA 3RUPA 1TU0A 2V5VA 1PYGA 2VNKA 3CVOA 2JJ2A 1ML4A 4FOLA 4D3FA 5E95A 1DVRA 2ZR9A 2HUPA 3ZLBA 5KNLA 1W0KA 4QYXA 2UUAO 1E3WA 4IH1A 1EG7A 3JAMM 4HL6A 2PA0A 3DB1A 4GC5A 2B4TO 1GGVA 4IWXA 3I58A 2OHWA 2ZDIA 2PGXA 1FDOA 4LZNA 2PBLA 5A5DA 4MW7A 2ZB3A 4I5IA 3FD9A 3I01M 3BK7A 3M4JA 2PD4A 3FRHA 3GEIA 3A1WA 3P32A 4L95C 2VAXA 3DLBA 4PV7A 3TPZA 2YQ5A 2PO7A 4HJRA 3AO0B 5IFLA 3MMZA 5CIQA 1I80A 2YQZA 4HWSA 4Q3AA 4G5OA 3PITA 1JNXX 2JGIA 3BQNB 4YALA 3IBSA 3GP8A 3S4YA 2ZYDA 2OBNA 4C05A 2R85A 3SMVA 4NJOA 4Z8YA 3WG9A 4JT8A 4YQYA 2A88A 3M8KA 1VMAA 3VJKA 4R2KA 4BO5A 1G60A 5M34A 2PUBA 2CK3D 2CL7X 1IBRA 3U4QB 3RV4A 2C9DA 3HDYA 3NVDA 1TJ4A 1OYOA 4CC5A 2PI5A 1KQFA 1WCV1 4A7PA 1D07A 3FKSG 2UUCO 3AJEA 5DK4A 3GT0A 4X3PA 2MYPA 5JJLA 4Z51A 2C42A 3VJMA 2DFVA 2QL7A 3RC2A 4ECAA 3RVRA 4EW1A 2GPAA 4R8KA 2D4AA 3IAM1 2AI1A 4QLAA 1F4LA 2W8ZA 1KEWA 4B7XA 1E1RD 2PJRA 1QTIA 1P3DA 4OFWA 5CD1A 2A0LA 4OMFG 4PYIA 1V9SA 4QU8A 4WQMA 4GLFA 3CEAA 2WDPA 3GR6A 3UMBA 1XL4A 3RUCA 2FPSA 5KLVH 5BNTA 2RDMA 1P61B 4D7SA 5I9LA 3HJAA 4ZI2A 3AVWA 1QYRA 4AO6A 3I52A 3OKAA 4YI5A 4E15A 5JAIA 3Q9SA 2RJOA 1BROA 3G9TA 3P5SA 2B1QA 4TT3D 1P2FA 1N2EA 5FLXA 1WPQA 3OONA 1G18A 3DVRX 4D7AA 4EDHA 4D0NA 5LLTA 4J41A 3LA8A 2AKYA 3BY6A 1YE8A 2WKWA 4AWXA 4ZEOA 4HVTA 4K2AA 8LDHA 2AIZP 1E1QG 2ZAYA 5EHZA 3LZDA 4BNMA 1KAEA 2QU7A 1T5EA 2J0VA 3ZN1A 3A0HZ 2ONJA 3G3EA 1YI2V 1N32B 2L35A 3H0CA 2QDOA 4LCKA 2FPWA 3P27A 2F93B 2DLCX 4PAWA 5L3QA 3ZGVA 4PG4A 1WCYA 2I4IA 2AXQA 2LVBA 2OHFA 2X1LA 4RTMA 4DDWA 1KZ6A 4D6YA 5M3BA 4WDRA 3TQTA 4NZPA 5D5QA 4MTGA 2ES4A 3OZTA 1P0FA 2QGFA 3OHPA 1XNHA 5CIWA 4DV0B 3CUEF 3L4BC 4R98A 3LMEA 5FXMA 2FR8A 4L78A 5A0FA 1EDOA 1AR5A 2DHCA 3TG8A 3MINA 2R1TA 1X7OA 2C95A 4CS2A 1JIJA 3QFSA 3JQPA 3QX7A 1DWOA 4B62A 2VSYA 4OAQA 4R69A 2WHYA 4RZHA 2C2ZA 4BMDA 1B4DA 3DSQA 4AROA 1XNJA 4WCFA 3F5SA 4IDDA 3CC8A 1TJNA 4MPTA 3NTOA 1FTYA 3BHMA 3VHQA 2FFHA 3MUNA 4LXGA 3MINB 2R1TB 2I7VA 3EMDA 4P84A 3L6OO 2RD2A 5FFMA 1A9TA 2QN2A 4E94A 1QC5B 3ROMA 3UJ9A 4LRYA 5LXTF 2JFOA 1FK8A 4OOFA 4WCFB 1XTKA 3AG4C 3UG7A 3CPWF 1H2WA 3R8FA 4LDQA 2EIMC 5DBIA 2O1SA 1PS0A 2D2IA 1IBKO 4PLTA 3FWZA 4OX9O 3IUMA 2X2PA 5THKA 3OEED 3RFUA 3H6KA 3ZJ5A 2CDYA 2E76B 2H1WA 2HVYD 3KPYA 1MC4A 5A62A 3H2BA 1G7TA 2OFPA 3SN6A 3M83A 1PLKA 2WD7A 2OYRA 4US1R 4IT5A 2RONA 4MPRA 3FPJA 1VB5A 1FUUA 3EVZA 1GUYA 1OZ0A 3HU1A 1VSVA 1PG5A 3LCVB 3CG4A 2FLKA 3C7AA 3OUFA 3DFFA 4MSUA 1QGOA 4DR6O 2HY7A 1KP2A 4QX6A 4J4BA 3C8UA 4M53A 2FVYA 4PX3A 2ESRA 2FPIA 2XCUA 3ZZ1A 2FMFA 1IOVA 3ODGA 4G4XA 1NVWQ 3CH7A 3QUTA 5JJIA 1CYDA 3VKVA 1PDWA 3IAS1 2WD7B 2SCUB 3M3HA 1Q3TA 5AP9A 4IMPA 2WQZA 4D25A 3OFKA 4D9FA 2ZNIA 1SQPH 2RH4A 1UKAA 5G3ZA 1DF4A 2BHLA 1KQNA 4WY5A 3TJZA 3N58A 1XX6A 1JDBB 2P65A 1JEAA 4DLKA 4E2XA 5KTNA 4EKEA 4GPD1 4BZPA 2LTAA 1ZKDA 6YASA 3V80A 1V5EA 1MB4A 5KOHB 4WADA 1MEOA 1D1QA 1QO0D 4UM9D 5JD3A 2C0PA 1RPAA 1HNWO 4QBHA 2PYJA 2V97A 1GAXA 3PEFA 1WXQA 1R66A 4PINA 2B0CA 5E2AA 4XVQA 3TDKA 1AQNA 2E82A 2BGWA 4F4LA 3SC3A 5I9BA 2ZIFA 1IQRA 5AUOB 4J9VA 1WXHA 3IP9A 4DV1O 1R8XA 3ECSA 1P8JA 1R0LA 2Y1KA 1UBGA 4I0XA 3B12A 4L8VA 4L16A 2F1OA 3V46A 1OAOC 4JOSA 1Z2DA 2PZEA 1PTJC 4H59A 1OCEA 3E89A 4J76A 1JHZA 3EDOA 4FBMA 2JEYA 1RKQA 2CUKA 3TFQA 4K35A 1HL3A 5F23A 2C7PA 4W82A 4YRKA 2BY4A 2G80A 3TNYA 1NV9A 4C0SA 3RVSA 2FW7A 2Q8PA 4K88A 1KI9A 2XCTB 2IFTA 5FULA 2GX6A 2QJOA 3ZE1B 3UO8B 1C3XA 3HDTA 2GEVA 4H1WA 4OJQA 3T3HA 3KHNA 2Q5QA 4RK5A 1PR6A 3CWZA 2K9PA 5JZ9A 3W7SA 2ADFA 1EBOA 2QRHA 3L6EA 4DSAA 2F1MA 4D3YA 2H94A 1V8PA 3B6JA 4BB5A 1U8TA 1MCZA 1DFHA 1MFZA 2RGAA 3G4SV 3OOEA 1BA3A 2ENWA 3EPKA 4E4RA 1EESA 3KX2A 1AGXA 2OXIA 4BAUA 2VRNA 5EC2C 4Q1EA 5CYGA 1CDZA 5D85A 4QJ5A 2GNAA 1NXOA 1XDGA 3KCXA 4CM6A 1CT9A 2QUAA 4X9XA 3HEMA 4ZMSA 2JBHA 2WTAA 1Q7YW 1PSDA 2GGSA 4Q5IA 1GGFA 3EJ6A 3LL7A 1K6IA 4HFNA 2FQXA 3IUJA 4LYYA 2IPXA 3NHYA 1K8YB 3OQ6A 3HK2A 4LDNA 4BQEA 3UMJA 1CP9A 1H8HG 4UHJA 2J3MA 4RD4A 4IJUA 2MW2B 3C9TA 4N5IX 2F3TA 3AIMA 4H3KB 2J45A 1XFDA 3PQ6A 1Z16A 3QY9A 4L74A 4B6OA 4EF6A 4IGFA 2ODEA 1H0KA 4HWGA 3QF7A 3L40A 3WX0A 3NDPA 2ZWPA 2O7VA 4HDMA 5D3QA 1XQ6A 4RD2A 4L28A 2O5CA 1Q21A 1OT5A 4FGJA 5KSWB 4NX2A 1KIAA 1N36B 4IQ4A 2R44A 3RADC 1PEKE 4CUJA 3W7BA 3T95A 4BWYA 3BHIA 1CIVA 2DWEC 3P9YA 1TTHA 4OI1A 2NSLA 1N2CB 3O1HB 1NM5A 2B25A 1LBIA 3OFNG 1MVLA 4TLLB 3FMPB 1PM9A 4ZV9A 2FHSA 1M1NA 1ZC3A 3JPWA 4WZ6A 1LFDB 1RZUA 1P29A 3MMXA 3VYRB 5IS2A 4NU0A 3EZGA 3WWPA 4N48A 4GC9A 4HVAA 3OQJA 1M1UA 1KI7A 1HZZA 5JNVA 2QYSA 2E4UA 2VH2A 3KLPX 4WY8A 4NV0A 2AOTA 1KIMA 4BNLA 1RMTA 4JHLA 2FG5A 3LC7O 4L76A 2HPVA 2BZ0A 3R23A 4HMOA 2ZM6B 5IVHA 3GJXC 2AUMA 2RCVA 1UT5A 4W4TA 2YHUA 1SOVA 4CKXA 3MGAA 5ICGA 3CT4A 3L0PA 3R3SA 5IKEA 2A7QA 1IAVA 4CGZA 2WIJA 4EZEA 3ZXSA 2CCJA 1H1LA 4ZQIA 3NVMB 1JBEA 4RVCA 2YH2A 1ZXLA 2YZNA 1D2NA 1NMSA 2E3CA 3DO5A 5IK2A 5AKGA 1KDOA 3VNSA 3DTTA 3QE3A 3WOVA 4B6GA 4JH0A 2B1RA 1F51E 1N5DA 3B82A 2XW6A 2XMGA 2IXBA 4JB3A 2JI8A 2UZIR 1G4HA 2IYUA 3N6VA 3G89A 3SSMA 5EKSA 1VKZA 2LCAA 3D01A 2AZ4A 1XQ9A 4QIHA 3KVRA 3I5DA 4MJ3A 3SZOA 1FS5A 2WG0A 3WRXA 4EWLA 4KRGA 4PTLA 1N6RA 3TVYA 4BGVA 4EA7A 3VSDA 4OREX 4PD4F 4RL6A 5BR8O 2V4MA 2PG3A 3QLEA 5KI6A 1VJRA 1C3LA 3RWOA 3R6WA 1M2OA 2WSSG 2F8LA 2VK4A 3OZWA 4PIVA 1OXMA 3WU2Z 2NADA 3J81N 3P10A 4DDUA 5GIPC 5ALRA 2C2AA 3A9WA 2Z04A 3PC3A 1K6XA 5KYXA 1RRMA 4TRNA 1W2GA 2ZJ0A 4NZOA 4UW9A 1JSRA 2WZDA 1PNKA 3T5PA 2VG8A 1M2OB 3QXSA 2V55B 2FPRA 2G09A 4R2LA 1L5MA 4MS3A 1M0SA 4PLVA 1Z68A 5IYBO 3QXGA 1BXKA 4KR6A 2HQSC 1U4NA 2Z57A 4FBLA 3K6JA 1WPGA 5KMGA 4AS3A 1Z38A 4DUGA 5KYXB 1OHHD 4IIJA 1M54A 5KB3A 4CFYA 4WFJA 1KKLA 1MO6A 5YASA 4KPYA 3OSUA 2NR5A 4DDMA 3F2VA 4Q93A 3P2IA 4NCNA 5GTIZ 2WAMA 4MS3B 4G0XA 1J07A 4EG4A 4B8WA 3UMVA 4IRXA 4A2CA 4EW2A 4TWZA 1IBMO 3CLUC 4V0MA 1BJTA 2XRMA 3DC2A 3OT4A 4Y0AA 5L40A 4OKNA 4IIJB 4TKVA 1XVVA 1I94B 4PG6A 4LN1A 1FSZA 2WPDD 4N9QA 3RHZA 4EM6A 1R3LC 1FPMA 3KUDA 3H16A 2F95B 2XNJA 3ABMB 4DLBA 4R8MA 3C7DB 2PHZA 5DNWA 3SXUA 3NTQA 2HU2A 5CTAA 1ECPA 4F45A 2OCAA 4JP3A 4Q7KA 1HYEA 1ZJWA 3HJHA 3LCJA 3MQ2A 3AF5A 2X9GA 2JGFA 1UWKA 3P19A 3HEBA 2GN2A 1QF7A 2B2XA 1NBMG 5BSFA 3APOA 3G59A 1P7YA 4KNYA 1A8HA 4KRXA 3ADDA 2PMDA 1JHXA 1P1BA 1YVPA 4YYZA 1JLKA 2WIDA 3SXUB 4YMTA 2Z6QA 2VSFA 3AZPA 4L6IA 2OZPA 3PNKA 1G2QA 3MHTA 3U40A 2Q49A 3TQFA 1DAHA 3UPUA 1J0CA 4OG2A 1D1SA 3DONA 4IIVA 3I4CA 5FYQA 5TS3A 5HKBA 2OKCA 2IH1C 5FA8A 1NAIA 1GMGA 1M5UA 1IJEA 2F2TA 2P91A 4HEA1 1NR7A 1NPDA 4FZJA 1M2NA 2EOAA 1INLA 4BCBA 2V65A 3SR3A 1UBHS 2CLSA 4UD6A 4F9TA 4GL4A 3WGMA 1TI7A 3W5AA 3L6DA 1XZ8A 3I9NA 3KAJA 1DAGA 2AR0A 1DXHA 4QRHA 1YVWA 5AT1A 1ZW6A 4B7UA 1JEJA 2IXFA 4RKRA 2LNDA 1L8QA 3AHFA 1W4BA 2MCFA 3LVQE 5JXHA 2C9CA 2NZUG 4ZALA 1B2LA 2WOOA 3IIMA 5HRCA 3IHTA 2OBFA 1C80A 1LUAA 2XE6A 2B78A 5BN1A 4ZJZA 4BC1A 1SCUA 2CB9A 1Y74B 4D3XA 4O4IF 4XWTA 4YT8A 5JAMA 1XNRO 1W4AA 1OFUX 2ZAGA 4REQA 3F5QA 3UMSA 3OMAB 2AN1A 5C18A 3DVQX 1ZRSA 4PS1A 1SHJA 3OM1A 1N3YA 1B00A 4Q66C 2B98A 1PNRA 1RHKA 2V4ZA 4LSGA 1C9DB 3T4ZA 4G26A 2J46A 1JR4A 2L82A 2QUKA 1SESA 4LJ8A 2CDAA 3G9QA 5B7GA 1FSSA 5CM9C 1R37A 2NN4A 4O4LF 5CB6A 2C99A 1FUKA 2XWBF 3K2BA 1HEUA 2CXUA 1ZM2A 3NATA 4REQB 3LT1A 4MMXB 4QC2A 1BE6A 5FI5A 3I3OA 2P6YA 1VQNV 2FZLA 4IZOA 3QVUA 2FE4A 1H2YA 4J6FA 1MW9X 3R9WA 1DC7A 2F8MA 4EHLA 1UBUS 4F12A 2XD9A 2Q9LA 3KQUA 4LCJA 4TV9A 2BAGA 4M83A 3PKZA 3LP5A 4LFAO 2W8BC 5FV4A 4MDYA 1AS3A 1J06A 2A1UB 1RHRA 2OP0A 3UAGA 4FMDB 2W6IA 1YXMA 1MJHA 1FKAO 2R62A