5GONB

Structures of a beta-lactam bridged analogue in complex with tubulin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
422
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 169
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5gonB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5gonB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5gonB01
5LP6B 4ZI7B 5GONB 3M89A 2VAMA 5EYPB 3N2KB 4LNUB 3HKCA 1RLUA 4YJ3B 5IJ0A 4X20B 4EB6A 5IJ9A 5CA0A 4DRXA 3VOAA 4F6RA 2RHJA 2Q1XA 4HNAB 4U3JA 3UT5B 1JFFB 4X1IA 3JAKA 4ZHQB 5LXTB 5J2UA 2VAWA 4YJ2A 5JQGB 3JATA 3M8KA 1W59A 4U39A 4EI7A 1TVKB 4ZOLA 3RYCA 4O2AB 1Z5VA 5LYJA 4I55A 4O4JB 4EI8A 5IJ0B 2Q1YA 4EI9A 4EB6B 2BTQA 5EZYA 5IJ9B 1FSZA 3WGKA 3ZBQA 3HKBB 3RYIB 1W5FA 5LA6A 4TUYB 4X1IB 3JAKB 5ITZA 5IYZA 1W581 2RHHA 3ZIDA 4YJ2B 2BTOA 5EIBC 4I4TA 5CB4B 5C8YA 4TV8A 1SA0A 4ZOLB 5KX5A 3RYCB 1W5EA 3VPAA 5LYJB 3JASB 4I55B 5EIBD 5JCOA 2BTQB 5JH7B 5LOVA 3JAWA 4X1KA 5CA1A 1OFUA 3RB8A 5BMVB 4X1YA 5LA6B 1RQ7A 5ITZB 4O4HA 4M8IA 3HKCB 1W5AA 3HKDA 4IIJA 4O4LA 3JARA 4FFBA 2RHLA 5C8YB 4TV8B 3JALA 3RYHA 1SA0B 3E22A 5CA0B 4DRXB 4XCQA 3VO8A 4IHJA 4I50A 5FNVA 4F6RB 4U3JB 4O4IA 5J2UB 5LOVB 3CB2A 4X1KB 5CA1B 5KMGA 5JCOC 1TUBA 3JATB 4X1YB 5LP6A 4O2BA 5JVDA 5M7EA 3R4VA 2XKAA 5EYPA 4LNUA 3HKDB 4O4LB 3WGLA 4FFBB 4TV9A 3JALB 3RYHB 4X20A 1FFXA 5EZYB 4KWEA 4IHJB 5FNVB 1W5BA 2VAPA 2GVIA 4O4IB 3UT5A 3WGJA 1JFFA 5IYZB 3VO9A 4DXDA 5JQGA 4I4TB 2VXYA 4O2BB 5JVDB 3C8LA 3WGMA 1TVKA 5KX5B 4O2AA 3HKEA 5LP6C 2R751 4WBNA 4O4JA 4TV9B 3RYFA 4E6EA 3ZBPA 4B45A 3V3TA 5J2TA 3N2GA 1FFXB 5MN6A 2R6R1 3JAWB 3HKBA 3RYIA 4ZI7A 5GONA 4TUYA 4O4HB 3N2KA 1Z5WA 2XKBA 4IIJB 3JARB 4YJ3A 5CB4A 4B46A 3E22B 5MN5A 3HKEB 4WBNB 3JASA 4I50B 1RQ2A 3RYFB 2RHOA 3VOBA 5MN4A 4HNAA 5J2TB 3N2GB 3WGNA 4ZHQA 5LXTA 5JH7A 5KMGB 1TUBB 5BMVA
chains in the Genus database with same CATH superfamily
5BOSB 2AF3C 1M6EX 2GTSA 3A37A 3CC8A 2P9EA 3B6KA 3ELCA 1E66A 1MAUA 2Q2OA 4H08A 3WBFA 2HU7A 4NG5A 5A4JA 2ZBFA 1XZFA 1OZ0A 3ANTA 4N6NA 4TRNA 4QJ3A 2RAPA 3DKVA 2BTQA 3CCQV 2VH2A 3EULA 1L8XA 5J23A 3PEUA 5L53A 1F0YA 3SYAA 1YDMA 4BQFA 4BWGA 2CWDA 1Y80A 3SPXA 3R3SA 3THXA 1UL1X 4KVZA 5T41A 1GQFA 4BZWA 1Q43A 3EWSA 3N2EA 3H65A 3GLUA 3G7SA 5GONF 4N76A 2UXCB 1C4XA 5I9BA 5ALQA 1NYTA 4FLZA 1GZ3A 4W63A 1JGTA 3HJGA 4ACBA 3LBYA 5FA5A 2CLKB 3L18A 3U48A 4UHDA 4W9NC 3O8RA 4ARBA 2BCEA 4AWAA 4WNCA 4K6MA 1DF5A 4K86A 3BK1A 3VDRA 5EIHA 3DC6A 4NYMR 4BE9A 2YXPX 5SZHB 2D13A 1GLVA 3O74A 3FYSA 2EIKB 2KI5A 4S05A 1XAHA 4BEBA 1DU4A 1YB2A 4ZHWA 1XL1A 2CE4A 2FSHA 2PLNA 3JS5A 5IJZA 3J7AR 2WIGA 1XP5A 4DR1O 1GN4A 1VP9A 4CZ2A 3Q8KA 4XD2A 2ZR2A 4O2AB 4XVRA 4RQTA 3VKHA 1G4YB 2B98A 2J45A 4L8VA 4M54A 3S40A 1WIWA 2A9RA 2BZSA 4GKKB 3AWIA 4L2IB 3O4VA 4DUYB 3OIDA 1SXIA 3OF5A 1LR1A 4O6VA 3AEQA 2GXUA 3JQAB 2MOKA 1QVRA 3AM1A 4EG7A 1O8CA 1E8MA 3DDZX 3I04A 3QTCA 2QNBA 3NWBA 4X94A 4DUGD 4AMZA 4L27A 2XE7A 1HE4A 3ELYA 3RWRD 3JCUZ 2QP4A 2WHPB 1T8UA 1L1FA 5AJTA 3P4YA 1ZONA 1TM2A 1RKBA 4TTAA 4D56A 1A8IA 1M0WA 3ZDDA 4LJ6A 1Q84A 3Q12A 2RARA 1DHTA 1F1JA 3EXAA 2SCUA 5FADA 1NW8A 2OCLA 2WLIB 4P7BA 1A5ZA 3LSUA 2A8YA 4XDKA 4GI3A 3CF4G 2D8MA 3TRDA 2YZGA 4MVJH 4MX8A 4IY1A 4NS1A 3KZNA 4RLHA 5CD1A 3N2LA 3TR5A 1A50B 3FUTA 4MWZA 1Q17A 3KRTA 4DPMA 4M88A 1X52A 2AHYA 2IDJA 1ONOA 3WJ1A 3CNOA 3ND9A 4H7FA 2WB4A 3VO9A 3R9WA 3S3TA 5TR9A 2QJRA 3E48A 2QNIA 2OGWA 2X23A 3ZWKA 1NY5A 3DFFA 4CQMB 1DO0A 5F1KA 4BNMA 4YRLA 3NATA 4JBYA 3C3DA 3QVKA 2RJOA 5J5AA 2QD1A 2QBYB 5L3SB 2P77A 3K94A 1RQ2A 1B3BA 2IDMA 3U7QB 1PP4A 2YJGA 3OAAD 1GTG1 5B7QA 4FLTA 3E9YA 1YS7A 2QENA 3I01A 4X65O 2X76A 3PA6A 1YJQA 2R97A 2FK8A 2LBTA 1QYXA 1K06A 1IE3A 3Q7SA 4IDGA 3LLMA 5KTRA 4PICA 4MR8A 2ADQB 3X2QC 1N5RA 1XKLA 1Q82H 4FDVA 4J6EA 4JQOA 4C01A 3CUWA 1NKDA 4LY9A 1SKQA 3ZO8A 3IELA 2V7QA 3FYDA 3KS9A 3GLGA 3T1YO 2PQ6A 5HE8A 2FUKA 4NBSA 1Q7CA 3G0OA 3TL3A 1L5KA 2JNBA 4A6DA 1H5QA 2IYWA 2GETA 3GP5A 3WJQA 4BGEA 1T5SA 3KHUA 2H3EA 4WBNB 4DILA 1NE2A 2CL5A 1CU1A 1CQWA 1HEIA 2NO4A 1L5WA 2AN1A 4FT2A 4KSYA 1BA3A 3AIKA 1MV5A 2DHRA 1KDYA 1OCCC 5K4AA 2CH7A 2V7WA 1OVMA 3RUPA 3NUQA 5IC5A 3Q6MA 1D1TA 3G0BA 3EY4A 3OZRA 4R2HA 3UFXA 6GPBA 3W2FA 2H94A 2D0OB 1PD0A 4F11A 1ZIYA 3ECAA 2W71A 1X7PA 2QG9A 4A2PA 4RQAA 3LPCA 2JAQA 1E2QA 1K98A 1ZOIA 2E82A 3TAUA 1SG0A 3MHPA 3QRWA 3ST7A 3DYVA 5CLHA 1I5RA 1Q7EA 2B6NA 2FR8C 2QEQA 4IJ5A 4YBRA 2YDXA 4CL8A 2XYHA 2TRSB 2GVIA 2WJ6A 3A1SA 3VAAA 5A0FA 3BTOA 3BJZA 1DAEA 1LRKA 2JIRA 4DMKA 4GP6A 4PZ9A 1WUYA 1IM5A 1OTXA 2JRIA 2UYGA 1U9IC 3GGJA 1VK3A 4QNMA 2WF5A 3QU5A 2JAWA 1XLTA 3SR3A 3O2JA 3P2IA 3SEAA 1XVVA 1E4OA 3BA9A 2Z9DA 5H5NA 2BDUA 2EILB 3VQWA 3HBLA 2XGJA 4Y2XA 3FI0A 2RHJA 5EZ5A 2CL0X 2QZ4A 1YQXA 4DCSA 3C87A 1YI1A 3DXXA 1FQJA 3H0CA 1JHZA 4CI9A 3SJQC 2IL1A 2H65A 3JPYA 4HUQB 1R3KC 4H1HA 1U0RA 3WYFA 2IYYA 4TMFA 3VHLB 4BMVA 4N3BA 2F9ZC 5C18A 3EFOA 1ZDMA 4IEFB 1YQ9A 3SXUA 4UHFA 3CH4B 1WMSA 2CJFA 4PYQA 1EXDA 3ROFA 1P31A 1KYVA 4QTYA 1S0VA 2PN1A 1S3IA 3T38A 2F6RA 3TMAA 5DT2A 1Z9BA 3O7MA 4UPVA 4C1NA 4L73A 3FRIA 1AK9A 3CSXA 4DA6A 2JD0A 3DHVA 5JHGB 4NJMA 4CFSA 1IOVA 5AESA 2JANA 3BDAA 4A6PA 1PT7A 3ILYA 5I9SA 4LP8A 3OJLA 1RXYA 1JEDA 2Q6VA 4LSWA 2IIPA 5GANK 4PSAA 1TCCA 2ZODA 1VA4A 2WLMA 4ZZ1A 1XSEA 1TVMA 3I4CA 3O9ZA 1ZGHA 2RHDA 4KOEC 4YV0A 1GK9A 1ZAYA 4QXAA 5IT5A 4EX6A 4J0JA 2VTBB 1YDEA 1U7XA 2FDXA 4D8YA 4Q3EA 3ILVA 2IE8A 3NIDB 4N8EA 3U39A 1SBZA 1BJRE 1XZDA 1YJCA 1CT9A 2OGTA 2WC1A 4UU1A 3FNQA 1PU2A 2R8YA 1K1EA 2XB2A 5CURA 4HDQB 1QORA 1YZVA 3NHMA 2F8MA 5TT0A 2OXTA 4H2DA 5LP6C 1FUIA 4QTZA 3WLJA 2ZREA 3DTVB 3H0EA 1IULA 3MWDB 1T91A 2TECE 5HIIA 3DOJA 3ESZA 4TQUS 4PAQA 3K9SA 5HK8A 1KY5A 4I5GA 4OFWA 4G5OA 3TZEA 5A2QM 3U26A 2FR1A 2OV1A 1BOFA 2WWVD 1G17A 4GEGA 4ZOBA 1Z8NA 4F0JA 3ZJVA 4W8GA 2X6QA 3P7MA 4QO7A 1AC5A 4FFSA 1GMGA 4RV4A 3QIAA 4DCGA 2PKYX 1E3EA 2VJYA 1GYQA 3A4NA 2DSNA 4EJMA 5HK9A 2GZHA 3ETQA 4L0DA 4CKBA 2AE1A 2OMEA 2OR3A 5T4FA 4R01A 1VPTA 4M9QA 4QOHA 2G67A 2ZNJA 5EB0A 2HIHA 4ERNA 2PANA 5A7HA 4PWYA 2VSQA 3TSWA 1AQUA 4ZIRB 2WDZA 9LDBA 4UM5A 5HVNA 3DOOA 4RSRA 2E76B 1EBOA 2GK3A 3NVKI 1T9AA 1JG2A 3BWBA 1MJGM 4ZYVA 3ZY6A 3FPCA 3QTYA 4ROTA 4DPKA 4GOXA 3MHTA 3JQ9C 4S0XA 4LXGA 4EFKA 4CLRB 5HFLA 2WWIA 3QE3A 3CN7A 1VQ8V 4PLYA 2VUTA 4QPJC 4X84A 4D9KA 4EG6A 3AERB 3FUCA 1H8EG 4JLUA 4C7OB 3G7UA 1EFUA 2XY4A 2NT4A 4OQQA 5T8KA 2NZUG 4ARZA 3NHKA 2IXEA 3PFFA 1MPTA 4P4TA 4UZFA 4F6RB 2J9ZB 2CD7A 1JHPA 1H5UA 1DEOA 1JJBA 4PZEA 1A9XA 1DC6A 2JIQA 3GJZA 4LQLA 1WSWA 3A4VA 4B5LA 3QIVA 3MWEB 5K1ZA 3FCUB 2NIPA 4CM8B 4I1PA 1XQXA 4R0MA 1QHGA 1J8VA 5J40A 1DPGA 2O2YA 3NIGB 1QBGA 5H3LA 2ZR3A 4G9EA 2VYVD 3FBTA 3NTOA 3QE0A 4HP8A 2YXYA 1GPKA 3CG4A 2B9ZA 4CS4A 4B7KA 1Y1KE 5CG2A 1SVUA 3RIGA 3I45A 4V0MA 1X14A 2G17A 4I3FA 5TS2A 4MQBA 3HCNA 5GGYA 4D8WA 5IASA 3DMYA 4AY4A 1FPQA 5EVCA 2PVPA 3FYTA 1R5JA 1N25A 5B1EA 2PS0A 2BHNA 2ZBQA 3ZTTA 1GAWA 5HUJA 1GADO 3CRZA 3QE2A 3WMGA 1T5HX 4UXHA 4W9NA 4WERA 5C93A 3H5LA 4CDNA 1KI9A 1TM4E 3HXMA 4JLVA 4YJGB 4PLCA 3O73A 2E87A 3L7OA 4X66B 4EY4A 4GL2A 3MQ2A 5HXUA 3ZHRA 5KYXB 1FP4B 4PZAA 4QVGA 5HFJA 3UN1A 3CH6A 3STVA 2WLLA 1APBA 3R5KA 1Y6JA 4B45A 3ESXA 3QFRA 2VDWB 1E3JA 1BQ0A 4IF6A 3QBEA 1E63A 3X1KA 2A0KA 1W48A 4B71A 1GYPA 3PC7A 3IP3A 3EDMA 1FYEA 1C41A 2QXUA 2B4RO 1TEVA 4AURA 1U3VA 4JC8A 2I4RA 2CFTA 2A0LA 2NUPB 5JSZA 4AY2A 3OI7A 3P2KA 3VTFA 3FZNA 5FI0B 4EMSA 1FA9A 3ZHUA 3REQA 5JLAA 4HNQA 5M29A 5ALTA 5SV2A 1XMIA 1S5LZ 5JAPA 4FEGA 1NQXA 4CM9A 5KUKA 4BRZA 4X3LA 3IT1A 3EHBB 3ZQKA 4UV9A 1G8KA 1TJNA 3CX4A 1XF9A 3WGLA 1Y6XA 3JALB 3QLTA 3HY3A 3OSUA 1CLIA 4DG9A 3D0RA 3LD9A 1GM5A 3L0PA 3UHPA 3EIEA 5EC8A 3S3XA 2ZW9A 5K2MA 1HNNA 2RGNC 4JLWA 3NBUA 3Q9UA 1D4FA 3T1VA 5HE9A 4G56A 1H2FA 3AHEA 1DKOA 3OOWA 2OTJF 5LPNA 2OCBA 4YRCA 3EEBA 2FOLA 1JHXA 4DQLA 4JIGA 1BQ4A 5CYOA 3LQQA 2HZBA 2K7ZA 1UXGA 3W8NA 2ONZA 2VP3A 3U7IA 5KTKA 3S1AB 3S28A 2QSAA 3DV9A 2QWXA 3PHLA 3JVDA 3K0HA 1W34A 4DR4O 2YHIB 1VQNF 1QYIA 4BUZA 1QX4A 3SC4A 4X90A 3WKAA 4JCOA 2ITDC 2V98A 2QYOA 1NVVQ 1SZXA 4QUDA 5IBRA 4OHUA 1WQ4A 4OXSA 4HZUB 1EG7A 3Q9NA 4K9MA 3AHDA 2GZLA 2NTYC 1PJ4A 3AOGA 3E3MA 3KU1A 4KE7A 3CCSV 1E2KA 3NALA 2FEMA 4TWRA 3N2KA 1E96A 3TRIA 4AZSA 3UO8B 3KR2A 1QYVA 1VGVA 2FN4A 5H4HA 4ZO7A 2DKOA 421PA 3W2TA 2EGGA 2I5PO 2J0SA 1XJWA 3CKKA 4U7TB 2REQA 3VHXB 5LR6A 1TD1A 5F12A 4IJKA 4DV3B 2GK6A 4FILA 5K0EA 4CIDA 2K2QB 1RWPA 1ZGZA 2NU8A 2QPOA 1L7BA 2PO7A 4YI3A 1YNSA 4BYGA 4NBUA 4DCMA 1HPLA 4FBLA 3EQ7A 1JAIA 1LZKA 1P1BA 4TVSA 4RK5A 3CZQA 2X4LA 4FFBB 5LXTF 1JUDA 1P33A 1QX3A 4A2CA 3B53X 3U0OA 3H5OA 1YBAA 3BRWD 3ZQ6A 1NVPB 1TZBA 2EJTA 4ONEA 2IP2A 3VNQA 4ZIBA 1FCJA 2X5XA 1PGJA 1BS3A 2DP4E 3KQVA 1TEHA 5D51S 3U31A 5CBPB 4KREA 3FHOA 3AM5A 5GONB 5CHEA 3RRMA 2Z2IA 1B23P 3OAAG 3OZSA 2JZNA 1CDEA 2HIGA 4U39A 1OAAA 1GGMA 1RYDA 5H8WA 3WP0A 1U43A 1JDNA 4OXIA 4DGSA 1LUVA 2RAVA 3ON5A 1Z8FA 4MWEA 4CLOA 2CHTA 3PDHA 3LOQA 1RBYA 5EZSA 4HN2A 2HN9A 2AZMA 4BJ1A 3E7PA 1IBRA 1P6QA 3WNCA 3I52A 4NICA 3IIMA 4EJ2A 3ABKB 3K35A 5CLLA 4TV9A 3K2XA 1T1EA 4W7IA 3WC4A 1T36B 2HJVA 1QR8A 1V5IA 5FPHA 2ZPAA 4CFYA 4LCUC 4P9PA 4XYBA 3MB8A 3P2OA 4BNLA 2YHSA 4C0JA 2KTVA 5HY0A 2G1AA 4MUHA 1CQIA 1PJQA 3GHHA 1XVIA 3QNEA 3SJCC 3KG2A 3EVTA 4RZ3A 1E1DA 1UJ2A 1W4BA 1E99A 2W6NA 4G07A 4MYTA 1ECLA 5C1BA 2FF5A 2IJHA 5KNBA 4HAZA 4OI0A 1IEVA 2QN7A 2R79A 4QPPA 4IXDA 3PQ2A 4RABA 3P9PA 4ALNA 2ZM5A 2BZ1A 5SYAA 1WXDA 1QH0A 1Q0LA 3E9DA 3MAGA 3O2QB 4LYYA 2C5LA 3IIEA 2QG4A 3I5DA 1J1IA 2VF4X 4RGVA 4DDUA 4U9IS 3JCZA 1Y1SA 4B81A 1F4NA 1H2SB 4PHZA 2PWZA 4L4YA 5JCZA 3M7MX 4JENA 5IS2A 4JYCA 3JZMA 2CFRA 4L8GA 5HTKA 3L02A 5T7BA 4TL8A 4QSMA 4RLQA 3MA0A 3IPYA 1KFCB 4PXYA 4NH4A 3TIXB 3JVUA 2QL6A 1ZH8A 3K9HA 1BVYF 3RSQA 1GITA 2IX3A 1O4WA 2P6YA 4ZQCB 3CH5A 3W8FA 4TKUB 3K0GA 4HJXA 3E3LA 3HKCA 3S0HA 3K9LA 1RIFA 121PA 1XTRA 1FNDA 1SVNA 4DV2O 4KITB 1VE5A 3LUJA 1M1ZA 2PA0A 3ZJ5A 3M3DA 3DDOA 4JDUA 5L51A 4UUQA 2WRZA 1BDMA 4A0RA 1Z2AA 3Q10A 2JFWA 1J8DA 5DYTA 4G4ZA 1WBBA 3AIIA 3GGDA 4Z8XA 1W52X 3JQ7B 2DUMA 4ZAXA 3BIJA 4O2AF 4F2DA 5JS7A 3EPRA 3BFKA 4HX9A 1IV4A 3I0MA 3WPWA 2IFTA 1LY1A 5KOHA 5LP6A 2Y1CA 4LRUA 4LZLA 2HJGA 1M0EA 4TMVA 1E8DA 2FB9A 3OIYA 4UU0A 2O8CA 1BFKA 2R1VB 4OK5A 1NUAA 5I9IA 4MI3A 2B78A 1NTRA 1V95A 4OVKA 3W77A 2JLCA 5BSEA 3VNUA 5LHGA 1V9SA 4OKNA 1QGUA 5TQVA 5DGHA 4GUNA 4GPBA 4L6AA 2Q7DA 3IP9A 1RNLA 4TV8F 3K30A 2ODTX 3HDJA 5LQUA 13PKA 3RRYA 3GUZA 1RM5A 3LWNA 2Z4TA 1LPNA 1Q90D 3LE8A 4AI8A 3GLGE 1YHNA 4DO2A 4IZHA 1SMKA 3WTBA 1IV1A 2A0WA 3G7NA 5FOXA 2FL4A 5C37A 3EUAA 3BCCH 1HQDA 1ODTC 3WNDA 2WF7A 4Q9IA 4AY6A 4I9GA 4DWOA 1O6GA 1C9MA 5DTEA 4WY8A 3D3KA 3U7GA 3IBYA 4PYMA 1D0SA 4P2BA 4FLUA 3JTMA 4MB0A 4M6WB 2WR8A 2P7HA 1FLDA 2ECQA 4RUKA 4YFVA 3CX5F 4KX3A 1D2RA 1XRSB 3S8YA 3GO4A 4X20A 5EE0A 2Q4OA 4Y9UA 1OT5A 4BXOA 2JAHA 5I9MA 2QXTA 1XRQA 3AZPA 3LPLA 5HKLA 5TPWA 4NBLA 2HXSA 3JQ9A 3BGSA 3G59A 2HA3A 2HHAA 1OOEA 2I80A 2MU1A 4JB8A 4B33A 4WLEA 2OWOA 1VECA 3OW2U 2QAJA 4QPJA 1E7YA 3U3XA 2Q2WA 5L3FA 2XUZA 4U6NA 2ZKLA 1V2HE 1MGPA 3I04M 3WB2A 1CQJB 4BE7B 3V2UA 5FX2A 2GHQA 1F60A 5K0ZA 4ZGWA 3F7VC 5AJVB 1YFKA 2G25A 5K8JB 2W8BA 1XF1A 4D97A 4QUHA 3A9RA 2KBFA 3LO5A 5IVHA 2CNWA 4COKA 1T34A 4J4TA 4ER5A 3RVQA 3W3AA 2WA3A 3OCWA 3LXMA 4MIYA 4B43A 3ROEA 3OY7A 2ZQ5A 3K8ZA 2EOAA 2IBZH 4ZEWA 4Y2QA 3S7ZA 2BJHA 1LI4A 4HD8A 1Q0QA 3LFHA 1TLTA 1ZD8A 4UFZA 3I2IA 1QAOA 4H9GA 1WM1A 5HS4A 1SIWA 1OFGA 2VWGA 2QI2A 1KTIA 5CX4A 1RXEA 1K9MH 3WOVA 2CXXA 4EY8A 4PTYA 1XZIA 1VMDA 2H59A 2UYKA 3CLRD 5AM5A 1YDGA 1FNJA 2Y0EA 1MO2A 3EVCA 5DM70 3GIWA 3OHSX 3AEKA 4TT8A 4DBVO 3H4VA 2PZSA 4Y6GB 2IYAA 3LBAA 4GRIA 5JQGB 1WHSA 3UC9A 1G66A 3WA7A 3I2HA 1NM5C 4EUHA 4OYLA 3PD7A 3UB4A 1KYIA 5A2QA 1WXIA 2IAFA 1KY3A 5TJHA 4Z1MA 4K6GA 3OLZA 3JYNA 5J5VA 4Y6OA 1BMTA 3ANSA 2DWPA 1G9XA 3ZD9A 1Z7GA 2ZR7A 3CSUA 4HC4A 3WFIA 2PD4A 2R9VA 2AYYA 1YZHA 3OZXA 1Y6GA 2GO1A 4G0XA 4HDCA 2CCKA 4RQUA 2F8SA 3X1MA 1U65A 4JP2A 3OFVA 3FFWA 4DPLA 4YT5A 3C6BA 1AI5A 4MV6A 3PUHA 1PAUA 4BZPA 2AZXA 1RWWA 5IC6A 2MSNA 1VFNA 3H97A 2HYDA 2MK3A 2P8JA 5E2BA 2D5BA 1Z2OX 1YHZA 2VO1A 1CY2A 7GPBA 1NF3A 4GXNA 1BVUA 4AY3A 2IBMA 2VUSA 1BE6A 4CCYA 3PNLA 1Q6UA 3M81A 1MJGA 5FF9A 3QUTA 3HNPA 2OBXA 4RJTA 1M74A 3BULA 5AH0A 2V54A 1JYEA 3ZIDA 4IQGA 2BTOA 4FX2A 4PWZA 1HOXA 4AZ0B 4GPAA 3KQPA 1YB1A 2I6SA 4WEQA 2IWHA 3QA3E 4W6ZA 4II3A 4LHVA 1RYHA 4QXQA 3TD9A 2YZ7A 1Y4MA 1H6CA 2AG6A 1E5QA 1Z18A 1J00A 2CZCA 4EVQA 1I3OA 2RGNA 3FGOA 3OZGA 1E1QG 2IHVA 5DMXA 2UUAB 1J7JA 1N6PA 3LAWA 3ZCVA 1KQGA 5HXAA 1JXQA 3U1BA 1JEQA 2G83A 1DRKA 1S2DA 4G0OA 3N3BC 2V7QD 1N3YA 4IFIA 2WSSA 4WXEA 4HLUA 3KAPA 1BU8A 3OUFA 2IWRA 3W8RA 3ND5A 3DZKA 2IS1A 3G89A 1MRNA 2ZYUX 4GLBA 6REQB 3UK0A 3VPDA 1U2RA 3EEQA 1T2NA 4CI0B 3W34A 3S06A 1MABB 4XFKA 1GFSA 3PGXA 2FPMA 1ABBA 4PVDA 2IKSA 2VOJA 2XIQA 1XNRO 1KXJA 1ZIDA 2GTHA 1L3CA 3OEEG 1QRTA 5FPOA 5JCOC 4R2JA 1KWKA 4OGGA 2FMTA 3K9NA 1SEVA 4RQFA 4DV0O 4RV5A 1DBFA 2OM2A 3UKJA 1OZHA 2RG1A 3L5KA 4KIUA 2P2NA 4OXRA 4OXNA 2NZ8A 1A9RA 3RSZA 1ZAUA 4TZTA 4AMBA 1UOOA 1EHCA 3FNFA 3CLSC 4JEIA 1FY2A 1CR4A 1L3BA 4E0BA 3EPJA 3PP8A 2BKXA 2XXAB 5CFQA 1EFHA 1QFYA 5A6SB 2O3UA 1FFBA 3DE3X 4Z4FA 1SU6A 5BRNA 3F3KA 4M55A 3GUHA 1T0IA 3DOIA 4HFNA 1I10A 4HYTA 5FL7G 3BERA 4B6SA 3GH3A 3L8ZA 2B33A 2C5SA 2AI1A 3JSXA 4QEDA 4HAIA 4YCLA 5JEEA 3GNLA 1GPDG 1HYGA 1CHDA 1CY8A 3P0EA 1QDEA 4E32A 3VAZA 2DUNA 4AMYA 3R4CA 5LLTA 4LVNA 3B2QA 1VYTA 4N21A 1JIJA 3E82A 3THRA 3DOHA 3B8EA 3LCCA 3U3ZA 2IUFA 5IM4F 2ZK7A 2EBWA 1U99A 4C29A 4IDAA 5TX7A 1KPIA 1IXMA 4I55F 4C22A 1JEJA 1USVA 3WWEA 1VEWA 4UD2A 2QWNB 1RJWA 3U09A 1G6Q1 4DIDA 3AOEC 5FR2A 1G5FA 1T3TA 4Q66C 1XP8A 4AQYB 1R74A 5E6RA 2NO1A 4R1UA 2HMTA 5KHHA 1K86A 1TJ3A 4GR4A 4M98A 1WWKA 4GSKA 3JU3A 4AS1A 4JR2A 3LCRA 4YUWA 3LKZA 5AXCA 3EPLA 4Z1OA 1JIQA 2CV2A 3PKJA 2EBHX 1FAFA 4KI0A 4LF6O 3DD1A 5HF5A 2CVLA 4JAVC 3JARA 1YS9A 4PR3A 5FTWA 4W5NA 3W7WA 4L0CA 2YI9A 3ABRB 5ELXA 2RHCA 1XBTA 1JI0A 3U4GA 3PPVA 5IF3A 3NR7A 4NBRA 6Q21A 4XDLA 1G7SA 4N5LA 3RTEA 1RXCA 2QUAA 3SJCA 1JHYA 1M6NA 1YUNA 4EJFA 4MT8A 1BGVA 1KPGA 2B25A 5DU2A 4R5HA 4YJHB 2MYPA 2HF9A 1KVTA 1WRBA 4AX8A 1YJWV 4LZWA 1ZA2A 4TTQA 2ADMA 1G38A 2X3FA 2N42A 3VV2A 1UJ6A 2JAUA 3JXEA 5LWQA 1Z5ZA 4EGQA 3QYPA 2G70A 3O8DA 5BYBA 1MD9A 3PXAA 1ZLXA 3EGVA 1L7RA 2JGJA 2QTBA 3JQDA 3QSGA 1OQAA 2Q2NA 1Y6RA 2Y2VA 1LUAA 2B30A 3IDOA 3EYAA 1U7OA 4UM9D 4WFJA 2ZUWA 3H5NA 1W25A 3AHJA 5B37A 1E77A 1IZYA 2WM8A 1VQPF 1MW8X 1XTJA 2O8FB 1Z4IA 4GIBA 1NRIA 4KGXA 3D8NA 3ZD7A 2WG0A 3MG9A 4FI3C 4YACA 1E92A 2BFEA 2W0SA 3NT4A 1Z34A 1ZUWA 3ET5A 1E0DA 1I80A 2WTXA 2HV9A 3IEMA 4B3RO 5DSZA 3VOTA 1EIZA 4EYGA 3PF8A 2RKOA 2F43A 4RIEA 4C6TA 3JWEA 2C2GA 3KLNA 1LLUA 3V1KA 1M2WA 3USES 1BE8A 1VBKA 3OD5A 3O1HB 5ICGA 2D3TA 4XE5A 4JJ6A 1JOYA 1TJ4A 2HU5A 4YNBA 2RJ3A 4DG5A 3LP5A 4F71A 5IVIA 1S72F 1VIMA 4Z7JA 1E6KA 3CW9A 3MGKA 1L7NA 3TLXA 3PGLA 4JI8B 1II8A 4HFMA 3QBJA 2BT4A 1T3SA 4IHAA 3AGQA 4ARVA 1YI0A 3FKSG 2OMKA 3TWOA 3HL0A 3NI2A 4ZMBA 5FLXN 1MAHA 1EK0A 1FRNA 4ZT3A 3CVJA 3I8SA 1WUHS 2P0YA 5IHPA 1KFKB 5ALHA 3A6PC 4GW3A 1KJQA 1KQOA 1FUKA 2ZWOA 4NVPA 2H48A 3V4OA 3GVXA 4J7ZA 2DETA 2YXBA 1KFJB 1DE0A 4LY0A 5EHZA 2G0NA 4EB6A 1SQXH 1G2IA 4QTXA 4YAFA 3SKYA 5CEEA 5EIEA 4MO9A 1QIMA 1ZS9A 4FWBA 4PSVA 2HA4A 5LXTB 1UBFA 2ONYA 1OJHA 2A4KA 3S03A 3ZU6A 5JNRA 3OTHA 4MR7A 5EKUA 1ZWKA 2GSDA 1P4HA 2GZSA 3DOCA 3ETHA 3NWJA 4A92A 2FEPA 4MIKA 4G28B 1P0MA 1NNSA 5KUMA 4PLFA 3LNCA 1W46A 3ZZTA 5EHIA 3WLHA 3Q3GE 1YCFA 1OFUX 1UOEA 1KK1A 2GJAA 4XM0A 4HAOA 1E0AA 5CNMA 4CETA 4LXYA 2H1FA 3AG3B 1RPJA 5LU9A 4F7DA 4LI0A 3AQIA 4M83A 1K68A 3N3AC 4ND1A 4RADA 3JVHA 3NRJA 1M8PA 3GLQA 4GX0A 1NPYA 2VT6A 3M34A 3PXXA 4EG3A 2AMJA 3K57A 4EX7A 3UJ3X 2C9CA 2FP4A 2WSMA 2GNPA 2HGSA 2O8DA 3G2IA 4U0JA 1NOKA 4PFQA 5F76A 1OX4B 1QAQA 4YRNA 1R9JA 1MQSA 1AB3A 4EEKA 4H3HB 3ZD6A 1N6OA 4BPRA 5FHQA 4XTRA 3LT0A 4OBWA 3VI3B 3FAZA 5K4HA 3S44A 1BKYA 4KKVA 1O4VA 1WXXA 1A9SA 3M83A 4ZRMA 4CM1A 2ZRNA 1YXBA 3LQ2A 3M4ZA 5DI3A 4RY0A 2B61A 3QSYA 3LFOA 2E4YA 2V6GA 1J33A 4X62O 4N3CA 3TQQA 1OAKA 3QUBA 1I30A 2UUCB 1QCCA 2QTWB 3BCSA 2NZVG 2C2KA 1MQAA 4A0QA 5FI5A 2ZUEA 3KVVA 2C7OA 3IAHA 3C1UA 4L07A 2BTUA 5AHWA 2HPVA 1T5OA 3DMFA 4Q3DA 1YVEI 4EW3A 3KETA 1TMYA 2ZSDA 3EF1A 4F85A 3E8MA 1NM5A 1QLNA 5BQ5A 4HWRA 3UXMA 2QQEA 2R8BA 3R5SA 3WGVA 4M2LA 2X2PA 5I7AA 4X92A 3OQHA 1YBHA 5EWMB 1IG0A 5ALFA 4BTLA 4E07A 1P9OA 1GX1A 3QJYA 5F1PA 1XAJA 3U37A 1KEUA 4J7XA 1PR2A 2PR2A 2C4KA 5CMLA 2EKLA 2PMKA 4WZBE 3QY9A 4CF7A 5JWRA 1E3TA 4L7VA 1UAYA 4LHXA 2IOFA 4EKWA 1ATZA 2E4AA 2XVAA 3GAAA 2UXBB 4KSBA 2B7BA 4R1OA 4L5BA 3V1YA 4WPGA 2BEUA 4Z3OA 4P3KA 1WPGA 4YAJA 2DLDA 2ZWPA 2IODA 2ZATA 2Y2UA 1THZA 1T9KA 5A62A 1PJ2A 3I2YX 3IUNA 2B99A 5EGNA 3GD5A 2JLYA 1NJ6A 4PYKA 3A9UA 4CCWA 2HNKA 3RU7A 4EKYA 2RH9B 4ECAA 1NW7A 5A71A 5IEJA 5FPPA 1GCAA 3TLAA 3IERA 1L5QA 3E61A 4KR2A 3SOZA 3DP9A 2VHZA 3NIFB 4EPTA 1YA8A 1I7LA 2P62A 4MEJA 5LKRA 3ZRWA 2O1WA 4OHMA 3H18A 4GE3A 5HFAA 3QBDA 1KMCA 1H3EA 1U11A 1VFPA 4TV8B 4JOCA 3IR5A 3L4JA 2K2WA 3VPBA 4D3ZA 2PGJA 2HMWA 4B4UA 3KPJA 5HY2A 1X7GA 1QGED 1Z26A 3DBVO 4B5CA 1YQNA 4JEUA 3O8OA 2PZLA 4JIMA 5B1BC 2JAXA 2BHTA 5SYMA 1W88A 2X14A 3Q5DA 4OTZA 4MULA 3TB4A 4M9CA 3EXIB 3UF0A 4JVSB 2XSZD 2YHBA 1N4DA 3L7IA 1P1KA 4JITA 1FNBA 3FG9A 2HQ1A 4AZTA 2C4HA 5JJ5A 2E55A 1F8GA 3QPAA 4MVJI 3JQGB 4NSNA 3OCYA 4MW3A 2AG8A 4K5QA 2V7XA 1L4GA 2WWHA 4D9CA 5EJ9A 3P20A 1TM1E 1TKRA 3CVWA 3P9NA 2AC2A 1C3OB 3UMSA 4V0QA 3TXYA 3BCRA 2DBRA 3O8NA 3H1TA 1R00A 3E5MA 4D7SA 1JIIA 2P2YA 5CDTA 3A0RB 5L3GA 5AHOA 5JCOA 3UFBA 3SDZA 5C8DA 3EF3A 3T4XA 1FUYB 5CVEA 1ADFA 5HKKD 4K8OA 4UHKA 3BMCA 1RYFA 3EIWA 4XWTA 4IJVA 1L4HA 1PNKA 5L3EA 4NYJQ 2GZ1A 2HKOA 3D2BA 3H8SA 3FTNA 4XDHA 1HR0B 3NYIA 1MEJA 5I45A 3JV7A 1RHKA 2PGIA 3VNVA 4YRBA 5BVHB 2ZJFA 4BEVA 4ESOA 2ZZNA 2V7QG 4WCFB 1R15A 2WMYA 1ZX1A 2CUKA 2V9PA 1K8ZB 1O6CA 1YKFA 3IEPA 4TMYA 4DLWA 2WSYB 3MXOA 1V37A 3HNOA 5CDGA 1TX4B 3AG6A 4QULA 2BAGA 5BV1A 3I0ZA 1DHRA 3H3FA 1X80B 1RJGA 1DFHA 3MWFA 5G0SA 2PSSA 4IS2A 4PX9A 1KZ4A 1PQUA 1RLTA 4HGQA 2C5HA 2XCSB 1HE1C 821PA 1OBVA 2UYQA 2Q62A 4KVAA 4BT4A 3NDRA 2XZLA 1V96A 4LXTA 4D6PA 3RFTA 3DLPX 5KIAA 2I3DA 4YQFA 4OX9B 4N5MA 4NZYA 4TSRA 4UB6Z 4GE0A 1R2QA 4Y67A 4TVOA 3TKLA 2J30A 1GZ7A 3EFEA 3ZDEA 3LDAA 4Z49A 1YQQA 3IBFA 3ZHQA 2FPIB 3OM1A 3AOEA 4WSOA 4CKXA 2PYIA 3PVZA 5L3VA 3QV1A 3DMGA 4W4TA 5DK6A 1XEXB 2GAFA 5B3KA 4D1YA 1U8ZA 1JRLA 3O26A 1E89A 2QVGA 1D2NA 2FPPA 2XWPA 4EY5A 2O0JA 2F7SA 3R76A 4MGZR 3UHFA 2ZYHA 4FR2A 2AJBA 2O05A 2YUTA 3F97A 1GO0A 3NHUA 4U3JA 4DDHA 3CCEV 1YVDA 3HQ4O 5AW8A 2XI4A 4KFMA 1NP7A 3R6LA 3PUYA 1W6UA 1L5HB 4NJEA 4Q21A 3ZW7A 3P3PA 2D2EA 4JAVA 1W581 2OILA 4E51A 4IIXA 3CWQA 4KQEA 1CJBA 2RGWA 2A5GA 4Y7CA 3MJDA 1KKMA 1AV6A 3ZH2A 2QN2A 4L3OA 221PA 1I3NA 1YI8A 1OE0A 3SOPA 5JC8A 3MTIA 2WPDD 2G9RA 3URKA 1YDXA 4UAJA 4DCJA 2XUOA 4FLYA 3SR4A 4DWWA 2REOA 1SH7A 3D4BA 1IVSA 4RL6A 4RXUA 3CV3A 2HAEA 4NLLA 2X1MA 1I0LA 2PUGA 2AR0A 2R86A 2WT4A 4PRYA 4KV7A 2PUCA 2IGTA 3KAJA 1Y81A 4OGLA 3UT6A 4LC0A 3RYFB 4L15A 1LBQA 3K70C 3AUJB 3I58A 2DMRA 2CDYA 3AU9A 1Y67A 2QZSA 4CC5A 4P7FA 2BSKA 4BW9A 3HA2A 5T3YA 1F8UA 5BVGA 3ICWA 1US6A 1BMQA 4ZK2A 5JJLA 2OYQA 2PRYA 3G2QA 2VT7A 2FGYA 2JB9A 4NOMA 1P39A 2Y76A 3QU7A 2CYBA 1G3MA 2YICA 1NT4A 4RH3A 4CH4A 1M6VB 1YZUA 5JMOA 1OWOA 5JQGF 2I4IA 3L82B 5KUTA 1PEDA 1COMA 1EHIA 2HG5C 4LBZA 3G3EA 1A9QA 1FEZA 2FLVA 3BMQB 3WNVA 2J5KA 1HL7A 3KXIA 2H8KA 1QRSA 3FTFA 4D96A 3MF4A 4KO3S 4A3SA 4R2LA 2JRLA 2WA2A 2JIBA 3P32A 4LDAA 4XYMA 2QWPB 1FSSA 3KVNA 1NX6A 1JWAB 3KVOA 2WMDA 5ES4B 3BSYA 5JJCA 3TG2A 1XPUA 3MMPA 1ZH4A 4B7UA 2CJXA 1GO2A 4M46A 3WB0A 2Q3BA 3HBAA 3NPMA 3FMOB 2QR5A 4IUBS 1HQCA 2WUEA 2C98A 5FO0A 4PZUA 4DDKA 4OPAA 4X9QA 2AEMA 5IYDO 2N46A 4NAVA 3O4JA 2GN2A 3UG6A 4EO9A 3IKEA 1NZ6A 5IMBA 4B4KA 4TLLB 4I7EA 4GDFA 3ULKA 3K5HA 3DBLA 2DM6A 2JJYA 3ZZNA 1VLHA 2GN6A 2AFHB 4IRMA 2BGTA 1NVDA 1TI7A 3W3AD 3UUFA 2JJ1D 3I37X 4XUGB 2Z1EA 4EHFA 1TU4A 2W0FC 2UVQA 3BWCA 1TT7A 2GVNA 4UCFA 5D84A 1VLMA 4I9WA 1S01A 2Z08A 2XITA 3A6GA 4UVEA 3RVZA 1YJNV 3PSAA 1ORRA 3IKJA 2RNBA 4BTVA 4MVJF 1ODJA 3OPVA 5GQSA 4REOA 1U7WA 4M38A 4C7BA 2LRHA 2UZ4A 1L6IA 3BB1A 2NNLD 3HU2A 1HTTA 1B2RA 1VSQA 2AL7A 3GEPA 3LSSA 1IHPA 4NQ3A 1CJSA 4EDFA 2G4VA 3RYCB 4QICA 4I55B 2NXJA 1EN4A 4KAFA 1E1YA 3K06A 2JJ2A 1QIEA 1BW9A 3TB6A 2ZYTX 5TRTA 2QTSA 1P74A 3I6MA 4NB5A 4H7HA 2ZR8A 3D01A 1LBHA 4BN5A 1QLWA 3FBWA 1IOWA 1BC5A 2CXNA 4CQLB 4IMRA 4PLGA 5TARA 3QHPA 4DAEA 3EBOA 1F8YA 4IIGA 3IILA 5EAZA 4GLFA 5DW3A 1UC8A 3Q8XB 1FJGB 1N34O 5TV2A 4LRYA 1ZUD1 1EVLA 4HRXA 3M5PA 4LGVA 4H0FA 4RHAA 1V1JA 1TAUA 2IOFK 2QU8A 2NO0A 2QTGA 2W8BC 3F49S 3NYWA 3ZXYA 4DT1B 3IB6A 3DT9A 3VR1A 1GTOA 3L8MA 4ZDKA 2GCPA 3LXUX 4X8AA 3RK0A 1CDOA 2WVHA 3ELBA 4BJ5A 1I01A 1AURA 2O0HA 1Z3CA 3OFNA 1KY2A 3ZN2A 1LX7A 4RTOA 2XE6A 5C7OO 3REFA 3LDCA 5JI2E 5I5EA 3ROMA 2HVJC 2BHRA 4ZZ2A 1NXVA 2QPTA 3SIWA 2I54A 4MGYR 2E3CA 2PMWB 4KYIB 1HLGA 3GWKC 4BFSA 2FTKE 4NHOA 4YIPA 1IM2A 2HEIA 3HGMA 5HBGA 1OYWA 1HNXB 4JYAO 2GKGA 3ANYB 3MCQA 3O8BA 1YC5A 2IYQA 3CMCO 2RG7A 3GLHB 4DIMA 5DNEA 4EECA 2H4YA 2ZDIC 1RRMA 1H4SA 4JN6B 2ZZKA 1E5DA 4NTXA 3TUIC 2PL5A 4O4LF 1LKZA 5GP1A 1A2OA 3EZYA 3OMWA 3N0RA 5E9QA 3CC2F 3MJSA 4OKSA 1Q91A 1Z83A 1WCIB 4NAHA 5CT9A 1EJ2A 5JO9A 1OCZB 3ESDA 1V7CA 2Z3YA 5DPMA 4TLEA 3LP6A 2C57A 2V1DA 3K6SB 4LX8A 2QVXX 1NWCA 1E1QD 2JGFA 1X42A 1TCVA 4XUEA 1SD5A 1EFTA 3RE1A 5EMKA 4YJ3F 3VDNB 2Q7EA 3ETLA 1PGQA 4HMOA 1KDTA 3VBCA 1GPAA 2P68A 1Z28A 4LH7A 1QU3A 2IUTA 5CFMA 4E5KA 1X7ZA 1JVBA 2V3WA 1DKMA 3A2FA 5FV4A 5A4MS 3QVLA 4HNSA 3G8BA 4LCJA 3KZMA 1G8FA 1N0IA 5DEOA 1QB7A 5FTNA 3HJHA 2NZYA 4JI6B 3MS4A 2P1RA 2F4VB 5DECA 2UYYA 4UARA 1XK6A 2UYNB 1EUYA 2DSTA 4R2KA 1TUGA 4FJ0A 4V0KA 3MJRA 1FFWA 2O2HA 3OEED 1FNCA 5JAQA 2WA1A 1GPWB 3LO8A 4HQRA 1E69A 2NN3C 2WZCA 1SOVA 1HDCA 3T2MA 2WSLA 1CFZA 1ODIA 3C16C 1VYUA 1Y63A 2LGQA 4JUCA 2OYSA 2OPBA 2NGRA 5BWOA 4GBJA 1OLOA 3RSHA 2Z9BA 4R2XA 2ARKA 3EEIA 4H0CA 2OBMA 4YJ2F 4AJKA 2LDXA 4Z0HO 2HP0A 4F4IA 3UJAA 1FRZA 4HLUC 1W8DA 3ZXUB 3T95A 4AZWA 4ZYZA 4ML3A 2GEFA 5LCXA 2IBTA 3IGFA 2IPMA 1CVIA 4QGSA 2Q6TA 4MIOA 1M75A 5CAEB 4ETMA 4EQZA 2WSIA 3PU6A 4CMAA 4R6ZA 4LV5B 3AHCA 5FL7D 4Z3DA 4LFBO 1SVSA 2HYIC 1RAIA 3T7CA 3MCUA 3DO6A 3C9UA 4OP1A 4XCXA 5BOVA 4WCDA 1FW8A 1FFDA 1PE0A 4FR5A 1D2DA 5JSFA 4P3NA 3N4YA 3N59A 2GN4A 1TU0A 1FTNA 1DXQA 3OQOA 1WLEA 1IV3A 5C51B 3VR0A 4DAOA 2C3UA 3SXJA 4HWGA 4W99A 3C3XA 4ZQBA 5D86A 5B64A 3CCLF 1VQ4F 3V6LA 3FSRA 1MT0A 5BSVA 1PI3A 4WI1A 1W44A 2HSGA 2Q4TA 3SQLA 3EPKA 2FQWA 5HILA 1C3LA 1HLFA 1YZBA 3SF8B 4ZI5A 4Z9XA 4BMNA 1JH9A 1UXIA 3OF3A 3E03A 3O1JC 3AVWA 3CCUF 3BT7A 4FJ2A 1HDOA 3FNHA 4K9RA 5BSMA 2XODA 1H1TA 5AM3A 4N4AA 3STZC 1VQ9V 2FZCA 2ORED 1O87A 2Q9UA 1T4CA 2XUQA 1S2MA 4ARSA 1U97A 4J1NA 2X8WA 1KEVA 4N3GA 3N2YA 1U3DA 4QQNA 1SXJA 1W73A 2J7KA 2LBPA 3TLEA 1S8FA 2KW5A 3ENNA 1BVRA 4FMDF 3FYEB 1M7GA 1ZD2P 5ADHA 3QHDA 2WJJA 5JXIA 5A3JA 3LLVA 4WL0A 4PZDA 1VM6A 3VU0A 4PLWA 1F8FA 1IXZA 1E0JA 1GP2A 4R1MA 4E13A 3GLIB 1KNJA 3QXHA 2R3SA 1R73A 2MMCA 3ROXA 1OCOC 4BFTA 3ZGXA 2EIMB 3B1XA 4Q1EA 1AS3A 1KORA 4IXNA 4YCDA 1RAFA 4WK0B 3AETB 5IZCC 3ABMB 3G9ZA 4IOLA 3ET4A 3UK2A 1ZQ1A 2H6EA 2WFMA 5KHGA 4FT4A 3COYA 4XJVA 1FFYA 5EJ6A 3N2GB 3FBGA 2E6UX 3QI7A 2Q27A 4I5DA 1PZGA 3QE9Y 1ADYA 2C4UA 3PICA 2W8ZA 1CRWG 3SZOA 4HJRA 1R16A 4M1EA 1JLRA 4BX2A 3C70A 2QG6A 3JQ8B 1LPOA 1KIFA 1EJ6A 1BCRB 5B53A 5EIBC 3EVZA 3PEWA 4TM7A 3ZZMA 4J3FA 2PJRA 4U7DA 2WZBA 4KYUA 4PV1B 3ETDA 4LJ8A 4M9ZA 4LISA 2D1TA 2YV5A 2RN9A 2JVIA 2H8CA 2JKZA 5KBYA 1RYBA 3AH8A 1STOA 3MK31 2JI6A 1SQGA 2FZGA 4IW3B 2GARA 4KVFA 4TL9A 3RLIA 2LWIA 1PR6A 5DYGA 1RM3A 5DEIA 2Z3ZA 4JXJA 4P6VF 1YB4A 1K3FA 4KQKA 1FS0G 1RWBA 2V6IA 2ZYVX 5C8YF 1ULTA 1NU1H 3JQRA 3B78A 4MCHA 4MKHA 1POXA 1ISHA 3EQ8A 3ZU4A 2I6GA 3GPCA 1I24A 4DCUA 5EK0A 1KYQA 1RQLA 5IN4A 4HAMA 3ZDZB 1X3LA 3KSMA 5FTLA 2ZUFA 4I4TF 2WIBA 3IDSA 3FKSD 1F2VA 2ZRIA 3W1EA 3QE4A 3SHVA 3Q4GA 3E4DA 2VQ6A 2W2KA 3VV3A 3X3HA 5CB6A 1MXFA 4XQCA 4IOMA 5LNK6 5K3BA 4JTDB 3HU3A 2JJMA 2FGJA 2OAGA 5GOZA 3N2NA 3TI7A 4RO0A 3O92A 2HQSC 4DB2A 2WPDG 4PGGA 2OPHA 1SXGA 2DJVA 2VS0A 4LYAA 2QSUA 3RASA 3SMVA 5J2TA 4R7TA 2N04A 1QAHA 4EZIA 4AX4A 3SPJA 3DS8A 3L7KA 3OJEA 3NETA 2Z1DA 2E85A 3HY6A 2FNAA 4A36A 4AYXA 2DVMA 1K97A 2EKBA 5CA0A 1NXPA 2IEZA 1UM9B 3WV5A 3EZ9A 1WSDA 3TUJC 4C4TA 4BWFB 1ECFA 1Y8QB 2X7JA 2VS1A 1YDFA 4ZC8A 4D8UA 3DBIA 2C5FA 3REGA 3R9XA 3VR4D 3OTOO 4J76A 4MUFA 3GRPA 3G2KA 4ZVSA 2H08A 3B6ZA 1VBNA 3TD4A 4QLAA 5L7WA 1GN8A 4OU4A 2E18A 3IMKA 1KMHB 1TW2A 2QJ1A 3D1VA 3HCDA 4EO4A 5K09A 3G1WA 2AWNA 4XWGA 1O03A 1VG0B 2YXLA 4UAGA 5K9ZA 4MQEA 2R6R1 4ND2A 2LNDA 4Z0PA 4DM4A 4KMRA 2Q9AA 4EUFA 3FWYA 3VJKA 3VO1A 3N0VA 2C8VA 2OO3A 4M0DA 3QYJA 4B7EA 5DP1A 3WGUA 4L9AA 1IJEA 2OQRA 2ZSEA 3BD6A 3FLEA 3OPYB 2GDSA 3JVIA 5JWPA 3CRW1 2HI0A 3O6VA 3KHTA 1S8NA 3AR7A 4FW9A 1S4QA 3P52A 2O2GA 5B3SB 4KFTA 2DECA 4XIFA 2XMQA 3MBOA 1C0IA 4WGFA 3K0SA 2Z43A 4ZRDA 4HDAA 3IAS6 1MZFA 2JJ1G 4BMSA 1Z4PX 1KNXA 1L1QA 5C7YA 1KJYA 5AW6A 4H4EA 1B73A 2WP0A 2ZUCA 1VQOF 1R3UA 4I0XB 2W42A 3QMWA 3V8PA 1BRTA 3DEFA 4UBLA 3FPIA 1KYZA 3CUTA 4YP0A 2YJ5A 1ECJA 4DMLA 2SECE 3R0IA 3HB1A 3IX7A 3UAGA 3HWUA 2I29A 1G5IA 2IU6A 5EHXA 2G5GX 3EDYA 4UKDA 3FKQA 1FXVA 2GYVA 4G63A 5KPJA 5CJJA 4GF5A 1GSAA 1R0RE 2JF0A 2P27A 2UKDA 1SG9A 2HJRA 1Z4QA 3H5TA 1FBNA 4ZT6A 3ETCA 1PX2A 4EVSA 2HRZA 2I1VB 1L4EA 2R6HA 5BSFA 1U28C 4WCEV 1KVSA 2YDYA 3EXFB 2AEJA 2XF2A 3EC2A 1B0PA 2Q8QA 4IDHA 2Q9LA 4F97A 3OQMA 3NEPX 3WWDA 2XB6A 4Z1MG 1LH0A 3KIPA 3S2UA 4QARA 2ZDIA 1F2UB 4ZREA 4EGFA 1BE3H 1CUIA 3CHYA 5JANA 4Q19A 3VDXA 1YOVB 2JI4A 3I6QA 2DWCA 3W0LB 1P5ZB 3G68A 1F6DA 4M99A 2ZBVA 5CW2A 4I5FA 5TC4A 4U5QA 1D5AA 3UH0A 1F9AA 1GKLA 1NXQA 4A2QA 2AZ2A 4KJZA 1TD9A 3AVTA 3L6OO 1QMGA 1M8KA 4MQFB 5IKOA 1XN4A 3SE7A 1SA0A 3GP3A 2NR5A 5FV7A 1L1EA 2DWEC 2H54A 2IDKA 3R5JA 3CJTA 3TUZC 2GFIA 3EZ2A 5IPFA 2FV8A 3KQWA 4UTZA 4ASUA 1BKDR 3KKEA 1RAHA 4KLAA 5EE9A 2FWAA 3CLKA 4B0PA 2HQOA 1DEKA 4D74A 4UTRA 1IXKA 2JDIA 1E6CA 4XIIA 2I4NA 3DXYA 4RKYA 3DXRB 3J80N 4MW5A 2RGDA 5ALOA 3Q88A 3PCRB 5IVKA 1GGEA 1EVEA 1PGPA 4XGQA 5BT9A 3L74H 5LA6F 1JLLB 3CLSD 1REQA 1MB4A 1V8PA 1SUIA 4CKEA 1JYSA 4PBTA 1FFHA 4RLFA 3RV3A 1ECGA 2EW8A 1IH8A 2XKKA 2O59A 4QD3A 4IMJB 3SHTA 1Q0UA 5D5PA 4OPHA 1VXRA 3I5YA 5T6BA 3D6FA 2WSSG 4BV2A 4TUYB 1KOFA 3IVXA 3IXLA 3S68A 5G1NA 3HADA 4RY2A 1B26A 4BAYA 2FKAA 1T3HA 5LOVA 1ZMOA 2F00A 4BCDA 5E7IA 2NWQA 4PGFA 1LLCA 1W55A 5HXZA 4D4MA 1US8B 1WXWA 3PRYA 1QJCA 4PYJA 5BYJA 5F77A 2J67A 4GMKA 3G71V 3NXKA 1FLNA 3MTGA 4B3SB 3DEKA 3VKWA 3CNEA 5KKCA 4FDLA 4J3JA 4BT5A 1EZZA 4BV9A 4HYQA 1PT9A 3ZZ1A 5JALA 3L1UA 4C7UA 3UOAB 1EP2B 1IV2A 4CGYA 4QNHB 3U44B 4FS8A 1D1SA 2IHBA 3NG1A 3T8YA 4U2KA 4S1WA 1SRRA 4NK4A 3G2MA 4JT9A 3FD9A 3AG7A 1B8OA 5A5VA 2FPRA 1SURA 4GQAA 1SUSA 4LMRA 4O2BF 4NXMO 5LDHA 5IE9A 2F59A 2ILVA 3DWEX 4JI4B 3EW9A 2QX4A 4AKGA 4G2TA 1Z2GA 3KC2A 1IIRA 4EFLA 1GPUA 4F6CA 2BGKA 3IESA 1KH2A 5AMXA 1HNWO 4LE0A 4QU0A 2O2JA 3VVCA 3VR6A 2QD4A 3NHAA 1GNSA 3RTGA 1GG8A 4OBXA 3B5IA 3BHPA 1O7JA 1PP9H 5K0FA 2WU0A 4MLDA 2KG7A 1GM7A 3CB4A 3BB3A 4HZ3A 4NL4H 2Q6IA 1W0JA 4E3ZA 1Q15A 3U5TA 2O3JA 1W7AA 2YIBA 2VRWA 3A4TA 1J99A 1MH1A 7AT1A 3SYKA 4ZYYA 2DKFA 1WB8A 5HJEA 4Q7KA 4EABA 3IP6A 1ZTEA 1NG1A 4FEYA 3HH8A 5JU6A 3ETEA 1OI7A 4MUJA 1E0KA 3NT2A 3VYTC 3PHIA 4BT6A 4BDSA 2VZ8A 3GJXC 1XRGA 1L7PA 1O96A 1PUJA 1EUDA 1B41A 4FHDA 3C90A 4E1BA 1YS2X 4IJWA 1SZCA 3IC7A 4V0ME 2B4KA 3EJ6A 2LQTA 3QFFA 4DM3A 3A6DA 4CM7A 3QA9A 4LDPA 1MAVA 3A1EA 2BR3A 4O4LB 2QTNA 2PZBA 1JXMA 5IZCA 3T1OA 5HBRA 2QYHA 4E22A 5EQTA 2VJPA 1BL8A 1EN6A 2DPHA 1HX7A 3PNYA 3L73H 1BHJA 4G01B 4KHPO 4NQZA 2ZM6B 4RAQA 1ZIPA 1OXXK 3ZKAA 1XAIA 3T52A 4C4OA 4DLAA 2IYSA 3F6YA 1W1WA 4R71A 1T0AA 1ESEA 4YJ3B 4TS4A 1U9ZA 1H4VB 1LEHA 4PC1A 3QHQA 2HHCA 4G5HA 1U2ZA 2XOEA 3JZFA 4RFVA 4I6EA 1Z3IX 4HDKB 1G0OA 1V5EA 5D3MA 6CHYA 1EDOA 2A78A 3N5KA 5CFOA 2QRGA 3BIFA 4Q20A 2VA9A 4G89A 1NOIA 3H8WA 1BDHA 1I4WA 4OEHA 2CBXA 3WGZA 1SXPA 1RLJA 1FDTA 1ZNXA 3RS4A 4NU6A 2FQQA 1ESDA 1RQXA 3C14C 5DM2A 2QRPA 3RYHA 1WHTA 2JAOA 4P54A 1KEZA 4C21A 3OZTA 5ADVA 1W8IA 2YN4A 1IUPA 4PO1A 1CWUA 5KOJB 2JFXA 2A9FA 3OW2F 1NKSA 1QH1B 3QVVA 3G02A 2XZDA 4HVTA 2VH1A 1CG6A 3GRYA 4CC6A 2Y05A 2ZIUB 4HQKA 8ADHA 2A9KA 2ZJ8A 5G0UA 3IBTA 3L7YA 2Q29A 4UNQA 3E7WA 2WM3A 3FBAA 2C3MA 2E37A 3AVYA 1Y74A 1AGPA 5KOIA 1HE3A 2F43G 2CMDA 1LD3A 2BDTA 4EI8A 1KU6A 3ZCPA 4YJ2B 1U0GA 4KUEA 4XARA 4AO6A 5CM9C 1B06A 1J9ZA 1FDVA 1UZNA 4NDNE 2RMKA 1CEYA 2HQSA 1N3LA 1N33B 1JJ7A 1AQ6A 4KYTA 2QZ9A 4EJSC 1PS9A 2XX3A 1NMSA 1MRZA 3ML0A 1UJNA 4IDDA 4G26A 3D2LA 3WQHA 4Q9LA 3CVUA 2IQIA 2H8EA 4FYMA 2JJ2D 3CE2A 3TOZA 3ZJYA 1N7GA 3WLPA 3GDFA 1GKYA 3DE6X 3NK6A 3FAVB 4DDWA 2DWUA 1P4JA 1QGYA 3STHA 1GLGA 5CB4A 2GRUA 3HS3A 2HTEA 1X9IA 3ZMTA 2ECPA 5AM0A 3EODA 3PHJA 2PSEA 4REQA 5CA1F 2PL1A 1ITZA 5ENDA 2V6MA 3TD2A 3DEZA 3LW7A 1SCDA 1JBKA 4TRMA 2JFVA 4NECA 3E9ZA 4JYYA 1S5JA 2C2OA 2VP2A 2LW1A 4QDZA 2PMDA 1I3CA 2BLNA 4FZ5A 5GADl 2DEUA 2G3YA 1IQRA 4H7KA 2C9YA 4BATA 2ZE5A 1I2AA 1S3SA 4FGZA 1YR9A 3KEGA 2X2EA 3I9NA 1VKHA 2BM1A 5J3JA 4E2XA 5EJFA 5DP2A 4EITA 4N9WA 1RCUA 4KIFA 4FMDB 1PWEA 5AUNB 3PPYA 2C84A 4UVCA 4HNUA 4F45A 5TMDA 3N07A 4L5IA 3BIXA 2M6YA 4GGPA 2FFBA 4P5PA 5BNIA 3OP1A 3TGUH 4DR2B 2QIOA 3OPYI 2ZSJA 4FYKA 1I6WA 1RBQA 1SIBE 3NZEA 1SHUX 2Q3EA 3BSFA 2ENUA 2QTTA 5F2VO 3UMRA 2EGHA 4JJZA 4V1CB 1N2XA 4ZHYB 2PNJA 1CF9A 3AR3A 1NWHA 3DE2X 2CLMB 4IHQA 3V7QA 2PBFA 1KRWA 3KUKA 5A3RA 2OCIA 1P6XA 1FU4A 1QAMA 3K1JA 1T2DA 3J81k 1XEWY 3AUAA 4MV9A 1A3CA 2EF0A 4IDBA 2Y92A 2JGEA 4ZN6A 2HCFA 4XTCS 3UGJA 1IX9A 4YUYA 2QKYA 2C2HA 1KO1A 5TQ2A 1K6MA 3V1MA 1CCWA 1EE2A 4JCCA 2VEDA 2JLQA 3TAXA 4YO8A 1IUNA 4NMHA 4JJKA 4NU0A 1PNLA 5EHNA 4Q1BA 3ZRSA 4KW7A 2V97A 1AN9A 1U28A 1QSGA 3SYLA 5B58C 2R8ZA 3QPBA 1NMEA 2PUSA 3K1AB 1WA8B 1Z35A 4BUJA 1JPJA 3OPMA 2ZIEA 1VE7A 4E5YA 3DFZA 3AG1B 1G8GA 4PGMA 1VQ5F 5K3FB 4CF3A 4CM9D 1AUQA 1I5XA 5C8YB 2JEYA 3WGQA 3Q4HA 4M4SA 4ESVA 5KSWB 5JSQA 3KDAA 3LL4A 2DWOA 4WKPA 1MO3A 3JATB 2PNFA 4UUMA 5CGZA 3I23A 4KP4A 1R0WA 1I1NA 1I9CA 3VJMA 3VSDA 4ROSA 1BQ3A 2C7BA 5BV8A 4I4TB 1ENZA 2BWJA 1IEXA 3HKEA 4CLXA 3FSGA 1RDFA 1DF4A 5B1AB 1FBTA 4J0EA 1KAMA 5E8RA 4Q4CA 2ZB2A 4RKWA 4KIGA 4M86A 1Y48E 3AI2A 2XTJA 4RD2A 3IODA 3S8EA 2P1DA 1W0CA 5CH5A 4PZPA 5CLFA 1SUEA 1QTIA 3EZXA 3FPLA 1HC7A 3WDMA 3DNFA 4TX1A 5U9CA 3R0PA 4R84A 1MB0A 4NYIQ 5IP5A 3CRCA 4JS0A 4Q3OA 4RPIA 4FD2A 3MCVA 4R9SA 3SIXA 3DZ8A 4LWZA 4EW1A 4JT4A 4WLOA 1KBQA 3FDIA 4LDRA 3FMFA 2CLFB 4BNKA 1GCGA 1JQJC 3WV4A 4ZI7F 1Y4AE 3FF4A 1IHDA 4Q9JA 1XHOA 3KT3A 1NFRA 621PA 2K87A 3TINA 4WGGA 4EH1A 4F92B 3BFJA 4A8JB 4HEA6 1MUUA 5CU7A 1EWQA 2DCMA 4BMZA 1NMQA 2HMAA 4IX9A 4H27A 4QYWA 4MWSA 3MBKA 4MJXA 1XD2B 3U1TA 2OCXA 4GMFA 2WU1A 3LU1A 1RPOA 3U7HB 1IJKA 4R1QA 2G1JA 2AQIA 4EY6A 2OXFA 1E3QA 2VF2A 4MQMA 4XDZA 4IJQA 5DZSA 4X00A 4LNUB 2X2OA 4GCZA 2WJVA 3JPWA 1MAAA 3UT5B 1JDVA 1GSHA 5FO1A 4LDJA 1Q7GA 1JLHA 2Q8NA 3CHXA 1XALA 3FRHA 4IVRA 5BNTA 1FC0A 2QQ5A 2Z8YA 1YF3A 4RTJA 3EA5A 2OGUA 3ZBHA 5DLEA 1X92A 4XAQA 1H69A 1M7BA 3EQ9A 1JL3A 2VBFA 1XZAA 1I2MA 3L0ZA 3ZVMA 5B6IA 2WYVA 4O2RA 3HYRA 1M1KH 3NORA 3KX2A 1A04A 4V0SA 4K03A 1P4SA 1ZXXA 3BYZA 4NE7A 4DIEA 2D7DA 1KYOF 2HNAA 3MGGA 3FNBA 3R7WB 4PE5B 2QOEA 3LSTA 1YJ9F 5TXGA 4W5HA 1ZR4A 3O5AA 2AW3A 5IFLA 3FYHA 3FPGA 3PGA1 5JZBA 4AYTA 2LGWA 1GCUA 3L6UA 2H1WA 3AHHA 2W6OA 2D0IA 1ZUQA 4TS1A 5F73A 1OU4A 1DTSA 1XCGB 4YPVA 4YCNA 4YJFA 3WHPA 4JGGA 3UUGA 1OMOA 1VQKF 2A7XA 4B2YA 3BY6A 4B3TO 3M3PA 2JJ8A 4PC7A 5KX5A 5KVQA 4BKOA 2AZ0A 2F93B 4AAYA 2WBLC 2PFSA 4R68A 3AUTA 5ITZB 4NBVA 4R98A 1A69A 1G291 3AI1A 3HWRA 5TQ0B 3OA0A 4LWQA 4GOJA 3JQ6A 1R4MB 4XW2A 2PKRA 1F1BA 5ALUA 3CUSA 3CPSA 3IEKA 1LBSA 3G4SV 2YH2A 3GPDG 3MJFA 3S2SA 1URPA 4GI5A 3ZNQA 2RGAA 3PIDA 4RANA 2WIAA 1KEEA 3M5CA 2W70A 2OWEA 4JI0O 3L7MA 1KVQA 3L93A 4G5GA 3WNZA 3DW1X 1NF2A 2Z6VA 1ABFA 3K70D 2F1IA 3SU8A 5KNBD 1W2BU 1M1YB 3OMNB 4G86A 1ZVMA 2PI4A 3IGAC 4WECA 4BBAA 5FIUA 5K6AC 3BWEA 3CA8A 3HA7A 1SXJC 5H70A 2GV9A 3D5TA 5EIOA 4XJTA 3GA7A 2O6HA 2QJTA 5BWCA 2H1CA 4R2IA 3VTZA 1BFUA 4IX1A 1MQ8B 1Q82W 3SSAA 3ABSB 4CMEA 3T80A 3KQSA 2P6JA 4MKFA 2E1PA 5JZOA 3SIVA 4YA6A 3O3CA 1N0WA 1W35A 2SKEA 2ZAGA 5BR8O 3JYLA 2RGGA 1CB7A 2VYNA 3G5LA 5E6SA 3ZDBA 1A2BA 2YUIA 2D62A 4XRRA 3GHYA 5KO2A 2OOKA 1NN3A 4EUEA 1F9EA 1BCSA 2QTRA 3IR9A 4N0MA 4TZ6A 2XHZA 2HU8A 4FM9A 1U9YA 1FDUA 4IINA 3FXAA 1KMMA 4IDEA 1JAXA 4F9TA 5KJ1A 4ZVOA 1T2AA 1WMBA 4N1AA 2WYHA 3COSA 4RTLA 6NULA 1XZEA 2EL9A 1BKSB 3EGXB 4NJOA 1B7GO 2D00A 2FSGA 1ZISA 4E2WA 3KYCB 2ES4A 4JBHA 3DOUA 2XVMA 1N6NA 3SC3A 1A77A 2PXCA 4UXNA 1Y8CA 2AJLI 4Z7QB 1NXXA 1KMNA 4ZANA 1GD1O 4LFCO 5LA6B 1WXGA 4N54A 4F5WA 1GRCA 2FDCA 2UAGA 5KJCA 2CL7X 4MI6A 2NZ2A 4AWXA 1DCTA 2YC4C 3LT5A 4N03A 2GEJA 4F9EA 1CUHA 1Z2NX 3EVGA 1SC9A 2ZB7A 1N5MA 2XB8A 1W29A 2X0KA 4F12A 1C8VB 1AQNA 4BECA 1RPRA 3ZDRA 1IN1A 1EZ1A 1ISRA 3KUDA 1QCZA 4BS9A 1GDTA 3IUJA 5C4MA 5AI9A 5EBMC 1Y7PA 3DHWC 4P0TA 4X7RA 3B9BA 5FLYA 3WBJA 4BZQA 4LV8B 2XTMA 2I8LA 2GXAA 3R40A 3HV0A 1J6UA 3B3JA 3GJSA 5EYPB 1KSFX 4RE5A 1I33A 1H6AA 2OY0A 5BY2A 3D3JA 4D4KA 1GGHA 2EDCA 3N87A 2Y0BA 4Y2PA 3DZHA 1NXTA 3K03A 3C39A 4QUKA 1Z6ZA 1V3VA 3L0IB 3V2GA 1RC0A 4EJSA 4GNRA 4JODA 2D2IA 4RX1A 5A1JA 3I56V 3ZY5A 5HX7A 4MUKA 3WL5A 3DT6A 1S2IA 3GC6A 2AMYA 2JVJA 3SYPA 1G64A 3Q7TA 5P8WA 4BIMA 3UCSC 4EWLA 4H1WA 1CS0A 4OHBA 4EGSA 3EXHA 2JHFA 3LQYA 2CXUA 2FPGB 4ZDJA 4O2BB 1PZMA 1QP4A 4V3BA 4KBYA 1E4EA 2UVDA 3E2MA 5KTPA 4RGBA 3HPQA 3REOA 4BZXA 2H18A 1G98A 3RC7A 4KDCA 2E4VA 3QU4A 1D6MA 3K5WA 3IEWA 3U60B 3DM5A 5SY6A 3LKBA 4LAFA 5IKXA 3OLYA 3FNRA 3MCAA 1GU0A 5I8ZA 5FJ4C 3B7WA 3NBZC 3W3ZB 1KD1W 2CNWD 3WSTA 3ZX4A 3EGCA 4FDTA 1I5OA 1X70A 4M7PA 3U61B 4ER6A 3EPPA 1PFGA 4LWPA 5HA5A 4W5OA 3WIUA 2BE7A 2SBTA 2IYNA 1HNZB 3W78A 2XGGA 3ZZ0A 4UXIA 4TUYF 4YRSA 3JD2A 4EEXA 4NFLA 4HN9A 3PE3A 4EZBA 4YHHB 2CK3A 4IIUA 4JGSA 5F23A 1RM1B 2JJ2G 1M8GA 2VATA 3GLFB 2WP8J 2AXNA 3ZI0A 3AINA 1TL7C 1IY8A 3UJHA 4R6WA 1RSZA 3FOEC 5NLLA 2XUIA 3OX2A 3SEZA 3T4EA 5FBWB 1G16A 3IUBA 5H2FZ 3VOBA 2G1KA 2CHQA 1D6SA 3AJ9A 4FFWA 1VRVA 4URWR 3DUWA 1Y5LA 3D7LA 5C9ZA 1DBSA 4ZCIA 1ZOSA 3OKFA 1ONSA 4I1SA 2NQ2C 3RPEA 1ISFA 1W1IA 4C4WC 2O2XA 4JFRA 2OTLF 1FLVA 2OENG 4N18A 3MW8A 3UB2A 3BJIC 3JQBC 4J0QA 2B2CA 4BW0B 4DCTA 4G4JA 4Z1MD 3ER6A 4TRRA 3OT4A 1Y42X 1UMDB 3KE1A 5GAPK 4Q48A 5EC2C 1OIWA 3KKOA 1UJBA 5DBEX 1GIAA 5AVWA 1GO1A 3OM3B 2C1ZA 2NX2A 2AUTA 4L8WB 3OFNG 3NV9A 3C7DB 4ZT7A 1IK6A 1WAZA 2HJFC 3CZPA 4QUAA 3UA4A 4V1CI 4Q1VA 3CUEF 3MRSA 3D0KA 4ASUD 1C1XB 1GSOA 3OBIA 4YV1A 1JB9A 4JAUA 2FFHA 4C20A 1YOBA 3EIHA 4XEUA 1RBMA 4IWYA 4HNVA 4RU1A 2VHCA 4LK3A 1F2DA 3WIBA 4RZ2A 3CBGA 3AI3A 2O14A 3NH9A 4NWOB 3W5CA 5IBCA 3IUQA 4NFHA 5JDCA 4E4EA 1WKBA 4RACA 4ZVTA 1Z5GA 1TVEA 3GFRA 4WX2B 1TT5A 2JLAA 4EYQA 2Q5EA 3NWOA 4PSKA 1TGOA 1T4MA 4MS3B 1S6YA 7YASA 2JASA 3LM8A 5CX1B 5FBKA 4FYIA 1DBVO 2X7XA 1NV9A 1M54A 1RSOA 1QPZA 4OJYA 4RLSA 1ZJ6A 4D44A 3AM3A 3TZCA 3AFMA 3GEDA 1OLXA 5ALYA 1Z15A 1RTKA 1TPYA 3KXKA 3CE9A 4RSHA 1QB8A 1B6SA 1C29B 3QVXA 1LDNA 4LC9A 3DQZA 3EARA 1L4FA 1UP7A 5DULA 3WDKA 2WSSD 3ROKA 1H9CA 3IQHX 1Y5NA 3U4MA 3P19A 2A5DA 3UKMA 5AW9A 3HN2A 1ZM4A 1MJHA 3MJCA 4MKGA 1LRJA 4PX2A 3SZMA 4YDSA 1U8XX 3HDHA 1KI3A 4QBFA 2O3SA 4CNBA 4ZMSA 5I8WA 4EW2A 3BKXA 2C4MA 3EBPA 3V8RA 5CTAA 4X89A 4YMSA 3HDGA 1CERA 2OZPA 4WOCA 5AKKA 2R8PA 2ZYDA 5LQJA 3H7IA 1JR6A 1EDZA 1KNKA 3X0DA 3EG9B 5B2ZA 1MLDA 2IZ7A 5CA1B 4QDXA 5EZQA 1WUIS 3LLSA 3RAFC 2Q0OC 1SN7A 1QV7A 2F3QA 1UBUS 2XYQA 3IP8A 4ZZ0A 2GBIA 2F1MA 5LDGA 4IMPA 4CG2A 2JEZA 3HB9A 1EGMB 1ZCFA 3P9IA 1JALA 5BV2P 2D3OW 4TL7A 4KQ6A 1OUMA 4X97A 1OLSB 1JDBB 1WVGA 3G79A 4LJ7A 1AVMA 5JBIA 3MTJA 5I47A 3D0OA 2Z8ZA 1W57A 3HXTA 4BO5A 1SJ9A 3SWWA 4O0LA 4PZLA 1DRVA 2C7GA 2V0CA 5B57C 5JSHA 2RI0A 1WDKA 2QUZA 3OQBA 3BDVA 3PCXA 1JQ5A 2WVAA 4L2IA 3ZE9A 3CX3A 2D06A 2YZNA 4TOIA 3CS5A 4HGPA 4KUGA 3Q40A 3C3YA 3JQAA 3ORSA 1E5XA 3CCRF 2GCNA 3FCOA 1W2GA 1WSAA 5K3CA 2E7ZA 2ZVQX 3GZJA 4P86A 4BAZA 1ML3A 3FB1A 1OBCA 1AO3A 4UCUA 3AEXA 2VFAA 3GAMA 2I87A 1N5JA 1U3FA 2B4AA 3BMNB 1XJCA 4CF6A 4FYXA 1S8OA 2QE7A 2KE5A 5BMVF 3LQKA 4UCWA 2NPIA 4BQQA 4B6PA 3AUYA 3DFIA 2H9IA 1EM6A 2C31A 5FB3A 2YEVB 3ZWQA 3W5VA 3L01A 3VU3A 1DUSA 4POOA 4KQGA 1L0NH 4RV9A 5TMBA 3GLSA 3BK2A 4ZQEA 1B0ZA 5E4FA 2TMYA 2CGEA 2O3RA 3IVGA 5ALLA 3QK7A 2H2HA 3UAWA 3AYZB 3I6BA 4MPJA 3AF4A 1XZCA 4X3PA 5EP3A 1CUJA 3Q3JB 5EIBD 4QE9A 3Q72A 2AOTB 4P7JA 3ZVNA 4C06A 3E0QA 2BELA 4AL4A 1CUUA 3OZUA 4RVOA 1FX1A 3WDSA 5IWAO 3VMFB 5EERA 3TLCA 2O20A 2UUBO 1OF1A 4PTLA 2TMKA 4DTCA 3T9DA 3C1OA 1H66A 4CQMA 1UAAA 4YQEA 1DIGA 3EDQA 3ID6C 1BQZA 5L3SA 2QBYA 1MRSA 5ILQA 3DT8A 2HB6A 1IZ7A 4KUHA 3DWIA 3S4YA 2IY8A 3U7QA 4B3JA 4WNAB 1R10A 4DJAA 4B46A 5LJLA 3MT0A 5K6AA 1IEWA 3EYWA 5AW3A 4RQBA 5TNXA 3ZY4A 3CEJA 4BWYA 4QODA 4NP6A 4HG2A 1NULA 1O3YA 4FUTA 5DNWA 4UCTA 4OBBA 3GPBA 3HRIA 3KVRA 3U7JA 3LNTA 4MV0A 2JBHA 3S8MA 1SQPH 2P9YA 2G88A 3NU1A 4UDYX 3LL7A 2Y99A 3NYQA 5LMNO 1W49A 3HI6A 3UWOA 4PN3A 2IHKA 3NONA 4EB8A 1XWWA 1V3QE 2IC5A 4BLTA 2FGKA 4IRUB 1KJ8A 3GROA 2AJ8A 1GPMA 3LPNA 1X77A 4ZJZA 1YS4A 5BR1A 2ASVA 1NASA 1BX1A 4G8CA 4B6FA 3FCCA 1EX1A 3RW9A 4XPZA 4IP0A 4WBNA 2O52A 2HSWA 2XH8A 2JK5C 2C2YA 4B6GA 5LYJF 2Y48A 2Q0HA 3HCRA 1CKEA 3H1LH 2NUAB 3ICEA 3ZCSA 3A1DA 4OLJA 4ZI7B 1U5BB 1OREA 4UCOA 3FWNA 2QTHA 5LQMA 2EJUA 1Y4UA 2QTZA 3CMAF 5HOEA 2ZIXA 5LGTA 2CE7A 2VK1A 3LVFO 4D4GA 1YQWA 1B8VA 2Q1TA 3UW3A 3DO5A 3ZK9A 3VR5A 4KLRA 5I7EA 2QLFA 5CYFA 1F4MA 1T2UA 1QC5B 3QMPA 3BTVA 3L8CA 1M2VA 1G5HA 1UKEA 2C59A 4PM4A 4E3WA 1ADBA 4RAIA 5CBGA 3OUSA 4WRRA 5KSZA 2OD7A 1P8AA 2OT5A 4BBZA 3G0IA 4AYWA 1ISSA 2J6CA 1SVOA 5KCMA 4AIRA 3W79A 3DE1X 1EVQA 4MWBA 1P1HA 1UDCA 1K8YB 4HX5A 1MJ5A 3WICA 4EG1A 1IDSA 1U8FO 2NO9A 1HRKA 4J7JA 4IDNA 3SSOA 1ESNA 2O06A 3HBJA 2BFCB 3E15A 4R69A 4DV3O 5JDIA 3GRAA 1ZVJA 4PFSA 4B4WA 1I1OA 2GUWA 3DDNA 4DQDA 1M5RA 5DM6V 1HT0A 2YINC 1B1CA 1CULC 1EMDA 4PA7A 2FB5A 1QIDA 3PTZA 1N2EA 5AJWA 4HNAB 1V8OA 1Q1EA 2PLAA 4LQDA 3ZWCA 1JG3A 3RSGA 1ZM3A 4IUCS 1JA1A 4G5FA 3FFBA 2W6JA 1OU0A 1PL7A 3L8FA 2IYUA 3VAYA 1JQAA 3G8DA 2PT5A 2R48A 4OO3A 3U3MA 4BMPB 2PZFA 2HT1A 1K2VN 2FKXA 2DHEA 2YJTD 2HY7A 1V71A 2X19A 3T9BA 1SCBA 4GD3Q 3B60A 1OFVA 3ER8A 2VSYA 4GP9A 4KWTA 1P62B 1T6NA 3PUJA 2P06A 4Y6LA 3FHTA 2G9UA 1U0OC 1WNTA 5DGDA 3BWXA 1GGNA 2FWRA 4EYSA 4XYGA 3MFQA 1R9NA 4P93A 3RK4A 4XGNA 3R0ZA 2ZRJA 4P34A 4RFSB 2PCLA 3SDLA 4BNVA 2BKUA 5CCXA 1DNPA 4JV5O 3B8MA 5C81A 3I9MA 1K5PA 4UFPA 4OSOA 4EW6A 1CEEA 3AJAA 4M0MA 2DW4A 1FVHA 4NZZA 4LS3A 1FP1D 5CR9A 2YV3A 3DBOB 2VTBA 2PS9A 5CHYA 5JFTA 1QH8B 1YMUA 2JC3A 3E3AA 4B84A 2BTEA 4Q4HB 1W4CA 4QRIA 3WZLA 3RBVA 4BNYA 4R9NA 5K8VA 3Q11A 1X7XA 1MA1A 2Q4PA 4AK9A 1KYYA 2ZU6A 1Q74A 1FSFA 4BOYA 1YL7A 1VIBA 3K9BA 1AMUA 3OICA 1XFAA 2ZT9B 1P29A 2C7RA 4L3VA 3TQCA 1ONNA 3DTVA 1P19A 2OSVA 2PRZA 3MWDA 4I1UA 5BUSA 1P61B 3ZK7A 2QAGB 3GA0A 1XRNA 5DBFA 4QOEA 4OI2A 4CQJA 4QT4A 1NMXA 2Q3HA 3TLGB 3MTQA 3ZCQA 1W4ZA 2CKDA 2OBFA 3HN7A 2C4VA 3LDHA 3OY2A 2AEEA 1QZ3A 3JQBA 2J3MA 2BMVA 2QN6A 3W8EA 1ZGBA 3Q2IA 5DM4A 1W9HA 4H18A 2FPOA 4RVUA 2HW8A 1NR5A 1EX6A 3T1HO 1XA3A 2G0AA 3OKPA 4G4SO 2YIMA 5I48A 1T1IA 4O5AA 3ZV3A 3ABLC 1T0HB 1OB5A 2WWWA 1D2AA 3QTTA 1P7BA 1U04A 2Q6AA 1FYDA 2AN5A 2GUGA 1Z39A 4ZIRA 2XCTB 4EKGA 1HEUA 1N77A 2YW2A 2YS6A 3Q98A 3U3KA 1Y3FE 4DV6O 2UZ3A 5F78A 1SQBH 5ELLA 1DXYA 2Z8YM 3UAVA 4HRVA 2YSUB 3AL0C 4HWPA 4L8YA 4CLRA 3PXBA 4CF5A 3RKSA 4D0RA 4DLYA 2WUWE 1O94C 3D2CA 2FUG6 4PBRA 3I55V 2RAFA 3S2EA 4KJXA 1JG7A 1SUWA 3OETA 3EAFA 5THKA 3SLGA 5KU1A 2ESRA 3I62A 2CMKA 2HWUA 4HS9A 4UULA 1FXHA 4M1KA 1Y9EA 4K40A 3MQ4A 5HGJA 4Q01A 3B9PA 4B40A 4D02A 1WU7A 4Q3NA 1IDOA 1X8JA 2UV8A 1I3MA 1I9GA 2J7PA 1CR1A 2FP3A 2ICAA 4AWBA 4RDHA 3SS9X 1NBWB 1RW4A 2W0XA 2V9YA 1SBCA 2XOXA 3CURA 3CS3A 2VDJA 3MWEA 2AMLA 4CM8A 3NAMA 4F1KA 4YWHA 4AZ3A 3MRXA 5CG1A 2JIZA 1K8QA 4Y1GA 4U7GA 2Q4DA 2X7HA 3EE6A 3NEYA 3VC2A 3C3BA 5FL3A 2QRJA 3FOZA 1PSWA 2YRXA 3ZBPA 2RSLA 3G5AA 1JZQA 10MHA 5FWAA 3CSDA 4NNJA 2DZDA 1T0BA 1E9RA 1XHFA 4ASUG 3UHAA 3UWMA 2YWHA 4GH5A 1XELA 2FPLA 2PKCA 3G5UA 2IELA 1YVRA 4L5YA 2JDIG 2Z2YA 1H48A 5KC8A 3WHIA 1NQUA 2DYSC 1EFVB 1U3TA 2BKEA 4MRMB 2B8JA 2WINI 4EKIA 4Q4LA 2QQFA 1B00A 3DV0B 4ENQA 3VMMA 5G41A 4WY5A 4CV1A 4JUIA 3ZBQA 1IM8A 3EVAA 3ZWBA 4S2UA 4QYTA 3T3IA 4PHTA 1M9NA 3OMIB 3MT9A 4M22A 1UOPA 4R50A 1YQTA 5KTYA 2ZPUA 3IOEA 5GV7A 2VHTA 5KYXA 1M8FA 3C74A 4UUJC 1I2BA 4O29A 1M10A 2BFWA 3WQRA 2VDWA 3PGJA 1Y6QA 3W6ZA 4NCBA 2DQ0A 1ZJ5A 2C78A 5JS8A 4E21A 4KE8A 1I08A 2ZTHA 1TUIA 2RKWA 3LC0A 1OLUA 4I19A 3LDGA 1COWA 3GB9A 3ZI4A 3EMBA 5BR4A 4KRXA 3CPEA 4K3UA 1CE8B 5A0VA 2QT0A 2KX7A 1UJ4A 3UZUA 1QO0A 2YC2C 4MCAA 4FDMA 5A5DA 3ZIAA 1B93A 2QM3A 1USUA 3FD6A 1U3LA 1G4UR 1ZJWA 3DGFC 2OBYA 2BFNA 4B9AA 2OAQ1 1QIKA 1YJ5A 2QQ0A 3HR7A 2DFDA 3K9GA 3KFLA 2RK6A 3D4PA 4TN1A 1XUQA 2X13A 4KO1S 1M3SA 3L7DA 3JALA 1VBFA 3ZJTA 2XT0A 5J63A 1O8BA 1T25A 3WU2Z 1O97C 3NOVA 3L41A 5L9AA 4UTXA 3IPXA 3PNQA 4MVYA 1WV1A 1K4CC 2RH5A 4IO0A 2QN8A 2R7NA 4ERHA 5JZ9A 3PKZA 1M90W</