5GONB

Structures of a beta-lactam bridged analogue in complex with tubulin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 169
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5gonB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5gonB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5gonB01
1W59A 3CB2A 4X1YA 5FNVA 4YJ2B 3RYIB 5IYZA 4O4JB 5LYJB 5IJ0A 4TV8A 3VPAA 4IHJA 4X20B 1FSZA 3JAKA 3JAWB 5CB4B 2VXYA 1JFFA 5LP6C 5GONA 2XKBA 3M89A 4DXDA 3RYHB 5JQGB 4HNAB 4O4LB 1RQ7A 1W5AA 5EIBC 4DRXA 4I55A 5JCOC 2XKAA 5FNVB 5LXTA 3WGMA 3ZBQA 4TV8B 4EI9A 4IHJB 3VOBA 5MN4A 4XCQA 4EB6A 4WBNA 1JFFB 4IIJA 5GONB 2VAWA 4I4TA 4DRXB 4F6RA 5MN6A 2RHLA 1TUBB 4B46A 1Z5WA 2RHOA 3WGNA 3V3TA 5JVDA 1W5BA 2R6R1 4X1KA 4YJ3A 5EYPA 4EB6B 4FFBA 2BTQA 4WBNB 4IIJB 4KWEA 4ZOLA 1OFUA 3JALB 4TUYA 4I4TB 5BMVA 4F6RB 4O2AA 1TVKB 3VOAA 5M7EA 3JATA 2Q1XA 3WGJA 5JVDB 4YJ3B 4X1YB 5EYPB 4FFBB 2BTQB 5IYZB 2VAPA 5IJ0B 5LP6A 1SA0A 5BMVB 4TUYB 3ZIDA 3JAKB 5CA1A 3JATB 3WGKA 3HKEA 5LA6A 3JARA 1FFXA 5EIBD 5JCOA 5ITZA 4I50A 4E6EA 3HKCA 4EI7A 4I55B 4TV9A 4O2BA 5CA0A 5LXTB 5JH7A 5LP6B 4O4HA 3RYFA 3HKBA 4LNUA 5KMGA 1W5EA 3UT5A 5CA1B 2GVIA 5LA6B 3JARB 3RYCA 1FFXB 5ITZB 2RHJA 1RLUA 4EI8A 4TV9B 2VAMA 3C8LA 5JH7B 3VO9A 5J2UA 3M8KA 4O4HB 4X1KB 3RYFB 4O4LA 4LNUB 5EZYA 4YJ2A 3UT5B 3N2GA 5KX5A 3R4VA 3RYCB 3WGLA 4ZOLB 5J2TA 3E22A 4X20A 4ZI7A 4O2AB 3RB8A 2BTOA 4M8IA 3N2KA 5J2UB 3JASA 5EZYB 3HKDA 3N2GB 5KX5B 4U3JA 2R751 5C8YA 5J2TB 1SA0B 3E22B 4ZI7B 5MN5A 1Z5VA 3HKEB 1W581 4ZHQA 4I50B 3N2KB 3HKCB 3JASB 5LOVA 1TUBA 1W5FA 4O2BB 3HKDB 4X1IA 5CA0B 5IJ9A 1RQ2A 4U3JB 5C8YB 4O4IA 3HKBB 5KMGB 3RYIA 4B45A 4O4JA 2Q1YA 5LYJA 4ZHQB 3JALA 3VO8A 3ZBPA 1TVKA 3JAWA 5CB4A 5LOVB 2RHHA 4U39A 5IJ9B 4X1IB 3RYHA 5JQGA 4HNAA 4O4IB
chains in the Genus database with same CATH superfamily
4YK7A 2DM6A 1PDVA 3CG6A 4EW6A 3E8GA 5KNBD 3VR4H 3U4CA 4H1WA 5H1YA 4RXUA 2D13A 4A5SA 2NV6A 3NTUA 3SYLA 5KNBH 1J42A 1YC5A 4YBRA 3Q7IA 1OFVA 1GAQA 3I2KA 4OXSA 3ZDAA 4GM0A 4F9GA 4IJMA 4X6UA 1SF9A 2AQHA 1HWYA 4G5FA 5ALRA 4EOGA 3BWMA 3SYTA 4A7PA 3RS7A 2VK8A 1TQDA 4DMMA 1B6GA 2X0RA 1ML4A 5F3DA 4P2GA 4IQ0A 4I1RA 1YR2A 1PSZA 4JQCA 3LJKA 4DV0B 1RAAA 3AI1A 1J2TA 4WFQA 1I08A 1WUTA 2FB5A 3OECA 4NVPA 3VFDA 3SJBA 5EXTA 3KYBA 4Y2RA 2RQ6A 3RASA 2AYXA 1JQ0A 5H68A 4C6HA 1L0NH 3CC4F 4F84A 4K8XA 5KWSA 5AVRA 3ZWYA 2DWUA 5C8VA 2QRHA 3Q6NA 1JTFA 2GLXA 4PSVA 3KJXA 4UMVA 2UZHA 3FUUA 2RK6A 2EBUA 4RSHA 5B55A 4BLQA 5LN1A 4QAQA 5LDDC 4DMHA 1QIKA 1AILA 2C98A 4Y18A 1JIVA 4ZT3A 2X1MA 3PPIA 4OB8A 1AM4D 4Q7JB 821PA 2FFAA 4QEZA 4UBKA 4NFSA 3GJ8A 1YVDA 3KR1A 1T0UA 2YWEA 4IGFA 5C8ZA 4EJSA 4NZMA 3BSFA 4JUAA 1QRTA 1SVOA 4LHWA 1BROA 3O2NA 4WXPA 3IO3A 3OZGA 1HE2A 3EA4A 1HYEA 5DIFA 4BFTA 3U16A 2BAGA 4P1ZA 2IDJA 1EFVA 2OZLA 3V4ZA 2Q3EA 4ZYXA 4YACA 4MGEA 4FFKA 3NIBA 5DYIA 4RK6A 2ZWOA 4AMVA 4L57A 1GARA 1MMFB 4N7JA 2FR8C 1WDMA 4B3GA 4DT1B 4GLFA 3BA8A 2JPDA 2IYTA 2WP0A 1U4OA 2XTAA 1X7YB 1DDOA 3LT1A 3VX3A 4OQPA 1NVTA 4D9JA 4K87A 1IM2A 1PJTA 2JIQA 4FM2A 1NXTA 4JI2O 2CK3D 3X44A 2CEKA 5LQJA 1C7QA 3H11A 3UOGA 3U1BA 2JLQA 5THXA 1C1DB 5FPRA 2INGX 3O4HA 4ZI5A 2XE8A 3C3YA 2YHAA 3N4YA 2XB2A 3G71F 4DLRA 5AKIA 4UEWA 2AX3A 2PXCA 3BE6A 3Q41A 4S2UA 1L5OA 2GVIA 1U3GA 3NOXA 1RP3B 1ADGA 3DFMA 3W6UA 3WLTA 5LGNA 2I8LA 5CH3A 1YR1A 2H7CA 3TQRA 4P54A 1H69A 2XMSA 2L69A 1F7VA 1ECGA 1NGSA 2FFBA 4NATA 3F7MA 3BIOA 1V1MA 3W5IA 1KK0A 1OXVA 3FNRA 5CMLA 1BDJA 1W8IA 3EZXA 3QLJA 3SOZA 3WZMA 3C7AA 2O8EB 3KHTA 1U8TA 4IDCA 1D2RA 2B5WA 3VISA 3S3XA 2ZIMA 4EEXA 5J1TB 2P9QA 1YZBA 1RZ3A 3NPMA 4V02A 1SBHA 2PO7A 3ZMUA 3HB9A 1NMYA 3KJGA 4LYGA 3IEPA 3QVXA 4KGVA 3IUQA 3VR4A 2P3OA 3LX8A 5HF9A 1ZGGA 5LNK1 1RYNA 3P3PA 1DC3A 2O2XA 3SBDA 1SKVA 2VDLB 4X7MA 2I87A 5KNBA 2PIAA 4MLCA 2B6NA 1VFPA 4A8TA 4E14A 1LBTA 2X4IA 2ZVJA 1U8EA 4TLCA 4YMIA 3UICA 4CW7A 1VQKF 1QFSA 1T13A 4G8JA 3OJOA 1ZWLA 4I36A 1JLLB 4ZOLB 2GYYA 2P2YA 4WFIA 3FTPA 4JJ8A 1KU0A 1N5IA 4E08A 5JBNA 5K0EA 4KXLA 5KSOA 3PF8A 1NOJA 1WN7A 3FSGD 3CCVF 1W49A 1TUEA 1YQQA 4OQQA 3CXUA 1H2GA 1XP8A 2VG8A 1JQKA 4Q3AA 3L02A 1ZUHA 2FP4A 2LO1A 2VWHA 2VQ3A 2GWRA 2F1JA 2W58A 2FYUH 3FAZA 4ENTA 4HNAB 1SUEA 1EN6A 3KVOA 1XL1A 2WU0A 2XA1A 2JBWA 2Z98A 2AI3A 1D7OA 4X85A 3G5AA 4PDMA 3D3JA 3NWPA 4BGEA 1L5ZA 4C2BA 2QZ4A 1NXXA 2Y77A 1GT6A 3M7MX 3I8XA 3S6JA 3UPUA 1K4YA 2X6AA 3LOPA 2KBEA 1Z33A 4KLZA 1GQQA 1AF4A 4JB8A 4L85A 4DJDC 3GJ3A 3RV4A 4E70A 2R6FA 5CXSA 3STLC 3L0OA 4JI7O 3ZRVA 5C5DA 2FHSA 3P94A 1M2HA 3LWQC 1YCDA 4Q6GA 1G20B 3G02A 3GLHB 4A23A 1Y5MA 4I14A 2GXQA 2GEVA 4L5BA 1CRZA 3DT8A 3NVKI 5ISMA 1NY5A 2H8KA 1OWOA 2X0LA 4AMYA 2IIVA 4EEQA 3LVFO 4Y7CA 3TM4A 1CQPA 5LYJB 4JI3B 4L4XA 1B0AA 1FXWA 1S5PA 3S03A 2Z9DA 1EKXA 5L7WA 5GONB 5JH7F 4BRUA 5BNWA 2IS2A 2C7GA 3RAFC 4AF6A 1WF6A 1B7GO 5CAEA 1OX4A 4G0YA 2GN9A 3U4QA 3X2FA 1AQLA 2LNDA 1MZEA 2IQQA 2NU7B 4QDXA 4LF9B 1ZSYA 1DIOB 1OHHG 4HV4A 3RRFA 1EFKA 1H2NA 2F8LA 1K3UB 1HF3A 2DT8A 1YR8A 3WJAA 4F71A 3CLVA 3RYFB 3A9UA 1GOTA 3AU8A 2ZBFA 3EGCA 4TROA 1JLHA 2XUAA 2DPXA 1MZFA 1SVIA 3L49A 1Q57A 4RQUA 3WDKA 2QQ5A 3H9GA 1HEIA 2VP5A 1KXZA 5EC8A 1BQEA 1ZN9A 2KM1A 5DTQA 5KYNA 3P9QA 1P75A 2CHTA 1G2PA 2I3ZA 3TD5A 3ZJ4A 4O4JB 4NBSA 2VUIB 3SS9X 1J1IA 2VXYA 4AUMA 1WSAA 1L7QA 4P4UA 3D2LA 5CYPA 3QVGB 3AF1A 3LWVC 3NBYC 2G9ZA 1A9OA 2AN4A 2XMCA 2DETA 1QTNA 3AYXB 1FLVA 5B1HA 1KY3A 1XZHA 1NBIA 4H6XA 2GHYA 3PFIA 1W46A 4UOEA 1PU2A 2VYND 4PVDA 2R6DA 3QMMA 1POWA 2JFBA 4HNHA 1T9GR 2WPDA 2HF2A 1P4JA 1T2EA 2NMUA 1J97A 2D1FA 5ADVA 3K0KA 1NP6A 1XDGA 4ZVRA 5EQDA 1PTKA 3G82C 2J1LA 3DA8A 1KPGA 5ALQA 3A1DA 1W3EX 1XROA 2AN1A 2ZROA 1Y4AE 1XVLA 4RLHA 2HDNB 1BXGA 4CMEC 3PNPA 1YIOA 1LSSA 1JALA 1CE8A 5FLXN 1N2BA 5FADA 1T1GA 1YVWA 4JQZA 5NULA 1MQAA 3OT5A 4M7RA 2CK3G 2GXAA 3FSGA 3MWYW 2W4IA 3B2EA 3JR7A 4G84A 1QIJA 4AY3A 1JXQA 5EB0A 2XVZA 1W2HA 3HBAA 4RPGA 2Q5ZA 3HZHA 4C30A 2CF6A 3U3ZA 3E5MA 3KRTA 4WBXC 2R8EA 3MUOA 3W7XA 3TXYA 4XFJA 1W5TA 4J0DA 2IH3C 2VPPA 2OPHA 2ZT8A 4GWKA 4TYNA 2A9OA 4ND4A 2OORA 4OXRA 5FOVA 4ARBA 1JV2B 3QX3A 3DCNA 3AINA 4JLSA 1R9GA 1NBWB 1X77A 4Y6LA 4IUBS 5CFMA 2ZCJA 3RVRA 3WMRA 1BQ3A 1DDGA 5TC4A 3N53A 2GCNA 2X6CA 2ZIOA 3B5IA 3E9QA 1QIHA 3TDNA 4GECA 4K1LA 3RW0A 3TKLA 3KALA 1JNXX 2BGTA 3WLKX 4LYDA 1JR3D 5ENVA 3B1FA 3EZFA 2WLKA 1ADCA 4C6TA 2QVLA 2B34A 4MB0A 4ZDJA 1ZONA 3MJFA 2QI9C 4IJKA 2E5FA 2QTAA 3L3BA 2AHZA 4BKRA 3BG5A 3FVWA 1XRPA 2ODAA 2X19A 4B2IA 5JCJD 2RD2A 2VKTA 4WA8A 5FPYA 4Y0NA 1PV2A 2YBEA 3KJZA 3CTMA 4PINA 2O59A 4AUEA 3WKDA 4DC9A 1WJZA 4FOOA 3SCZA 3KL2A 1YJWV 3BORA 3NG1A 2BGRA 1I7SB 2WLJA 4DLTA 3QE9Y 2H6EA 3H2HA 4DS3A 1U94A 1T8UA 4Z9BA 2RNBA 1WXWA 5JO9A 1L1FA 1KTIA 5AVQA 2IY8A 1I14A 4ZQEA 3NVIB 3TMKA 5A7HA 5HY0A 2J08A 1XEWY 3I55F 1T3TA 5DE3A 4CWAA 2H29A 1WU8A 5TVGA 2YEVB 1V5WA 2VOJA 1AA6A 4IIJB 1K2WA 2VJNA 2VJOA 5CDTA 4QXPA 3O93A 1Z39A 3PNOA 4YC7A 1QAQA 2O8VA 1UPAA 3EGIA 1YAJA 3SU8A 1EWVA 3PEFA 3TNFA 3L8YA 1XILA 3HJBA 1V3TA 2VK2A 2VYNA 1V8PA 2AQIA 5KDOA 1DU4A 2WA3A 2FWNA 2VPYA 3CNHA 4ZDIA 2ZUDA 3KJFA 5CFNA 5CITA 3HJUA 3VA7A 1U9CA 2PUTA 1XMOB 1KDOA 2ZR3A 2RGNC 2YOHA 5BVGB 1K6XA 2NVOA 1KMNA 1RYZA 3TD6A 2CXHA 1Q0HA 3KE1A 4PF1A 3R3XA 3RJ5A 1EM8B 4Q1BA 2AQ8A 3N0VA 1BW9A 4BWYA 1YI2F 5L95A 5EGSA 4KO4S 4R2WA 2QDKA 3R74A 3ZCPA 1V54B 3N0TA 4DR6O 1LNZA 1OX6A 4RACA 5EEGA 1EAMA 2Z6UA 3L41A 1M6VA 3M3PA 2VS0A 1UM8A 3L8HA 5IT4A 4RV9A 2WTEA 3L7IA 4FHCA 4CH6A 1VH8A 3R0JA 2GPWA 1MNQA 4IEFB 2M2IA 2R7AA 3P32A 5IYBO 1GTVA 4MV9A 4MTGA 4LV8B 3WICA 1MO3A 1PX0A 3MTIA 5BWMA 4X00A 2A86A 4ZAFA 1IN1A 3SZ3A 5F7ZA 1GYRA 3T54A 1HORA 3W04A 3WV5A 5EQFA 2BEVB 4YMHA 2DXIA 3MD0A 3VSDA 4JITA 1O8BA 5IY5C 2ORWA 4RHTA 1X14A 5L53A 1EG7A 4XIGS 1V9CA 1QE5A 2XVAA 2JZNA 3V1KA 1WP8A 4UNNA 3ZKWB 5JAQA 1JR3A 1JIXA 1L7PA 1N5OX 2CVZA 3KELA 2QNBA 4IINA 2IYPA 3C39A 2OCPA 4COOA 3CX3A 2AEEA 4B7UA 1ZCBA 1N7JA 3DMNA 5EWJB 3PGMA 4EQ6B 3IBFA 2G1JA 3QITA 3UUGA 5IZCA 2IUSA 4C7OB 1IN7A 1RLGA 1F1JA 4N5DA 4AULA 2DYRC 4L15A 4XDJA 4Y1FA 3AG1C 1K63A 3BXEA 2HRBA 1XKQA 4KAXA 3WISA 2IS4A 4GOMD 2R3SA 3CSUA 5JQGB 2XD4A 2R44A 2HBYA 3S1AB 3GMIA 1WP9A 4DQKA 2EOAA 1X1BA 1RYFA 3ENQA 3UFXB 2PKRA 3UAWA 4EG7A 1OE0A 4PZPA 1D1SA 3IUPA 3H1FA 1KKMA 4RNCA 2DBQA 2A1TR 3AG4B 2BMDA 4XCXA 1IUNA 2IGBA 3FZNA 3ITKA 5DN6D 1PFWA 3GZ4A 5M29A 2EIJB 1TTHA 5A3RA 4QUDA 3OY7A 5J58A 1RC8A 2JAXA 2XMBA 4MRPA 5I9IA 5JNLA 1JUDA 1ZJYA 2VPTA 5FPSA 4ZVQA 2O5VA 3EVEA 4HD8A 4PLTA 5JQWA 2P9BA 5AXAA 4FJ0A 5KDDA 3CCRF 1MQ9A 3L7NA 3T7RA 5CPBA 3DW3X 1Q3TA 2H0QA 2IUUA 4D92A 1GN3A 1IBKB 2O2EA 1DP4A 1G1AA 2A0WA 3P97A 4KLNA 1J0AA 1Q14A 4MUKA 2ZI6A 4DDVA 1DAPA 2JGDB 2FF5A 3MCAB 1Q50A 2BI4A 1EXNA 3L6BA 5KVVA 1OFGA 1LJLA 1RRKA 3B2NA 3D1LA 4HLNA 1OF1A 4WF9V 3EC2A 3KEQA 5AKYA 1BKDR 4K8ZA 1R0WA 4PO8A 3JQQA 4EY4A 1GZ3A 3WKBA 1CY4A 4H17A 3AP1A 2ZZMA 3FFBA 3RC9A 4S1NA 4DIOA 3KZMA 5E6UB 4RSMA 1XQ6A 1YNSA 4BLWA 2QQ0A 1K5PA 2VDOB 4Q7QA 3CYQA 2QKCA 5LDGA 5K9ZA 1P1JA 2CLMB 2OQRA 2P2ZA 3O8QB 3VNVA 3B9BA 4TV9A 1V5IA 1RDFA 1T5LA 3BMQB 3GDFA 3K6RA 3PC4A 3F8WA 3JX9A 1BWPA 4X24A 3FMVA 5ERXA 3FVQA 1MVLA 4A91A 3E83A 1T5TA 4MQBA 2W6PA 3UMCA 1F2DA 4OMCA 1I5OA 3ANMA 3ZX6A 3D4IA 1OI7A 3BEOA 1EIWA 4BT6A 1I5YA 3RKRA 5LOVB 3IGAC 4QBTA 5E6SA 5HZKA 3JSXA 5L3QB 3EX7C 1R0RE 4OJMX 1YQXA 1D3AA 3PS9A 5TMEA 3V4FA 2ZYAA 5ILGA 1NN5A 3AKEA 1XZCA 2ERXA 3JZFA 4P80A 4Q39A 1X8XA 4LDRA 1J7HA 3UK0A 2OLKA 3ZN2A 3QWFA 3JWGA 4M87A 5F4BA 3A8TA 3PQ6A 5KYGA 4NFHA 5DSTA 1QGOA 4ODIA 1O6GA 4PI2A 4W9NC 4D9BA 2GEFA 4IL6Z 2PUWA 2JFWA 1R3DA 2GBPA 3OU7A 5M04A 2EJRA 2ZBEA 4YRSA 1XOIA 4ESOA 3T3GA 2QEXF 2PCJA 3L1UA 4YVFA 4Y6GB 3GFOA 6REQA 4U7HA 4U2BA 5FDFA 2P9HA 4G24A 4CV0A 1E9AA 2I3BA 5CA0B 2NO0A 4JYAO 4P0PB 5GIPC 4QGAA 1GILA 3ICOA 1YA4A 1FMLA 1N92A 1L5QA 2ZWVA 5T6BA 2RHWA 2HG5C 4HVLA 2V9CA 1U2DC 5SYAA 3GCXA 1I4DD 3J7TA 3E9ZA 2HI0A 3ESCA 2IHUA 5FPPA 3KKMA 4M1KA 4FXPA 1VCIA 1E2UA 1XCBA 3OPYA 4XLLA 1PJ3A 2EHJA 3FI9A 3HA3A 2OBXA 4MWBA 2BVNA 3PR1A 4FFVA 3C6QA 5DN6A 4BWFB 2DX7A 4E3ZA 3KKEA 4S1VA 1EX6A 3AW9A 3JAMM 3ZQ6A 1H0HA 4R54A 2AXQA 3OPYI 2ZYIA 1V3VA 2X7HA 2HJFC 1PJQA 3P5BA 1VGVA 2CEAA 4DCNA 1M8PA 4R6ZA 4PNPA 3LYBA 2Q45A 4N4AA 3F49S 1QB8A 2B25A 3P9IA 4Q1EA 5KUMA 4V0ME 1N3LA 1B04A 5HKKA 1GQFA 1QHYA 3MXOA 4LF4B 4QLBA 2ZS7A 4M55A 2D3TA 2ZKIA 5ALTA 6GPBA 3U4HA 2WM8A 2HPAA 3HHPA 5MN4A 1HKHA 1I7LA 1YQGA 3L74H 4M1ZA 3UG7A 1G3IA 3MUNA 3W34A 1AZLA 2AHOA 5C4MA 4BAUA 4JBIA 2RGWA 4DWWA 5J4LA 5DCUA 1RWXA 5B3SC 3W6NA 3D4BA 4DZRA 5IJ0B 5EAZA 4QVGA 5BR7A 3KKNA 5EJ8A 1LCIA 4XYBA 3ZMTA 3ASUA 2GF9A 4FLXA 2QA4V 3CLRD 4AJHA 4DDHA 4JLAA 2IZ1A 2NO7A 1E2NA 4UVCA 4HAWA 3T5PA 1TAQA 2V1UA 2Q5OA 4WFHA 1OFHA 1OZGA 1B6RA 1N2OA 2F8MA 5ALFA 5B8FA 1QHHB 1ZHOA 4MW6A 3UPDA 5DP2A 3TBKA 2VQ6A 2FFRA 2WWRA 3C7TA 5B2ZA 4C29A 2WILA 4Q1AA 4RL6A 4GPBA 1V11B 1MR3F 1WS6A 3KOMA 3PGLA 4PI0A 2YRFA 1OW3B 2GETA 3EIEA 4AXBA 2R1TB 1JHVA 4K46A 3I45A 4I8IA 2VA9A 5DN6G 1J24A 1A5AB 2KI5A 4R51A 2ADFA 3AI7A 1CJCA 2ADQB 1CCWA 4R9VA 5IM5A 5TQ0A 2FN9A 1HFKA 4X8LA 1SZTA 3UW1A 3JD1A 4RTKA 5INTA 4GAEA 2TYSB 3DGEA 3VZRA 4QYIA 4EI8A 4YGXB 2CJYA 2XEDA 4GSKA 4F3KA 1RXCA 4M1TA 4TXNA 5CLLA 2UYOA 6NULA 4BLUA 3ADKA 1UPGA 3LE8A 4XDKA 3FCSB 1TMKA 1DOHA 1SB8A 3BJEA 3B70A 3TZEA 1SXJE 1KD1H 4LE2A 2P11A 4PYLA 2FEMA 2VDVE 3K1YA 4IIEA 1IOVA 3KETA 4ZQBA 4A3SA 1QGUB 2EYUA 1Y66A 1B14A 4FP9A 2G8NA 1HDJA 4WI1A 3G4SV 3MTAA 4RTOA 1DQZA 1PBNA 3FDIA 1J5PA 4TZZA 2KE5A 3IS3A 4PR0A 3VYUB 4N48A 1JHYA 5LL6P 2BEJA 1NLFA 3D59A 3V8MA 2DBZA 2O7RA 4K6MA 4MUFA 3WG7C 1H2BA 1S72V 3ORHA 2QXTA 1ULAA 1NQ5A 1FMCA 2M98A 4DUYB 4D44A 3WIVA 4PE5B 4QVKA 1D5WA 5IEJA 4KFCA 2PS0A 5JE8A 1VQVA 1LLFA 5JD4A 5CHYA 3PI6A 1ZXXA 4M0EA 1Z5OA 3ZJUA 2ZTHA 2GHQA 3OLZA 5EZ6B 1FIUA 1GPMA 4IXNA 4NZ9A 1KEEA 5E9QA 4XGQA 3UA3A 4OQFA 2OV2A 3FHCB 2SKEA 2GDSA 3MMSA 1Y8RA 3L8EA 2JHCA 9MHTA 1G8KA 2F62A 3SIPA 3C85A 5WRFA 4QASA 3TEMA 2EFDB 4FVTA 2RJ3A 3T3MB 4TRNA 4XSGA 3KLNA 2BP7B 1N6NA 1SKYB 3G2KA 1X8KA 5LNK6 4P32A 1E61A 3QNEA 4KFRA 3QLVC 1FZTA 3QBVA 4FQ5A 1USIA 2O8DB 5KTNA 1V4BA 5JHHB 4XWAA 2GSMB 2FWMX 1L4LA 3SXUA 1ZCZA 1JG7A 1QRDA 4UBNA 4JX9A 3S40A 2YXHA 4KRFA 3LDTA 2NSDA 3LWZA 2PZEA 5ILQA 2X2EA 2C5SA 2JIOA 1ZNXA 1XTQA 1Z0IA 4BPRA 1MJNA 3BABA 4CKEB 2IPXA 2HZBA 4H27A 2J6HA 3U5TA 4M49A 2PUBA 3F7OA 3DOCA 2A7XA 4Z3OA 5F5XA 1KQSF 5KOYA 4YAFA 3MINA 2B1JA 6PFKA 3C3JA 1SBIA 4PQEA 3TDKA 1MGOA 3LFUA 4IWNA 3H9UA 1U9YA 3WSWA 3A6JA 3T3PB 3GB7C 1UBEA 3AFIA 3IJ4A 3WY9A 2ZQYA 1NW6A 4HDSA 2O2ZA 2WT8A 4TYYA 3S06A 4HLDA 1G8MA 4FR5A 3GWOA 5I7FA 1CS0A 3ETDA 3KQOA 6ABPA 5B5SA 4CCWA 3ZJ5A 2B21A 4HO1X 3WGJA 3L82B 1PFUA 4DQXA 4CF5A 5KJFA 1TA9A 4BQNA 4CDNA 1LBEA 3KJKA 5LA6A 3OWXA 4NEHB 1EESA 4BBPA 4ZVTA 3OEYA 4H59A 3HCPA 2PQ6A 2CDRA 3RW9A 3ND8A 1DZIA 4QICA 1SUCA 2PTHA 1N5RA 4PVCA 3PICA 4Y2UA 3IP7A 5BQFA 1ZGJA 3ILYA 4V03A 3M4XA 3GAZA 1DOAA 5BXZA 3AB3A 4NOMA 2C97A 5DBHX 2DYSB 2A4KA 1XXLA 4J6FA 5D87A 4OGQB 3FR8A 3OF3A 1Z37A 3PUWA 3QF4B 2XXAB 1EFPA 2GJSA 3GFFA 2VDJA 4MYRA 3MK31 4RAOA 1FMTA 4X5OA 4OYRA 2W2KB 4RL4A 4Y2HA 1GTZA 1R8JA 3C6XA 2PYIA 3WI7A 2PF4E 1NN1A 1D4FA 1R15A 1DMSA 3K1JA 1Y9EA 3N39C 1B8OA 3PHBE 4ND7A 3K5IA 4X1YB 3TLGB 2BJHA 1G8HA 3CYFA 3DT6A 4ZAXA 1WP7A 3HKCA 3ETLA 5JJBA 3GT0A 4ZANA 2DP4E 4P33A 4D3XA 2ZYRA 3CXCU 1D9ZA 2PUHA 4UZEA 4JL6A 3T4PA 2GA8A 4N54A 4C21A 3IL2A 5KSZA 4JASA 4BMOB 1KC8W 6YASA 2DPGA 1E2LA 2UV8A 3KM0A 4MVJE 3G1WA 2ONJA 4Q7KA 5T4EA 2YJTD 4BMCA 4LJ8A 3MYRA 1P2UA 2OUKA 3I6IA 1CZNA 1CT9A 3PQDA 3TVYA 5CEEA 2R2AA 3L18A 1NV8A 4BO6A 4E5VA 1OLUA 5JJIA 1XK7A 2IZZA 3BB3A 3D8TA 4OGKA 5DULA 4RMNA 1LPNA 8OHMA 2RHLA 5DNVA 2WFMA 2Q5FA 3A4LA 1DKNA 5LU8A 5H02A 1T8RA 5J5VA 4D6TH 1NVBA 3IAM1 1UMBA 2Z6VA 2JGNA 2QU8A 2F4VB 2QR5A 3CUTA 5ICFA 1EINA 2BH2A 4TV8F 2CDNA 1E4VA 4JH0A 1XDDA 1H1LB 1W4BA 4CM8A 2VWKA 2CXSA 1ZXBA 1BS3A 1NLZA 5H3LA 4MVQA 5A4MS 4P86A 2FZLA 3EY4A 4E7PA 4K6FA 2PKYX 3MBOA 1XQVA 4MV0A 2GVZC 1HOXA 4YCJA 1CK2A 1JQDA 1JXOA 2OC4A 1AZTA 5HQJA 3OCCA 3M34A 4DJ5X 5FFMA 5KSYA 1WBJB 3MM4A 1W36C 4RLFA 1TRHA 4B45A 2BFDB 3EXG2 1YV9A 4A6DA 2Q7GA 1L0LH 1BA2A 2H2GA 2ODTX 4KZKA 1LLUA 1LLQA 3WJ1A 1EK6A 1E3JA 1V8DA 2P2SA 2HF9A 3OCWA 4OP3A 4PHTA 1JHPA 3X1KA 4ZOBA 4C82A 4NQZA 2W7TA 3NIGB 2OENG 3FW1A 2RSLA 2CBGA 3F0EA 1S8NA 1ZM7A 1T4BA 1Z16A 3FB4A 1JCHA 2F3PA 1JRLA 2XAAA 4BWGA 1E1QG 2QAIA 1CJUC 4BVGA 1ZR4A 2QNRA 2P6JA 4X65B 2HA2A 1H65A 1L8AA 3GCDA 3I9NA 2I2BA 1GN9A 1FOEB 4IIXA 5FPKA 1JHMA 2ZVQX 1T5HX 3I5XA 3S2FA 5CVEA 3EVNA 4NBKA 5I7WA 1SXHA 2IUTA 2GDJA 4R6WA 4ZZ1A 1VF6A 4FGWA 2PHNA 5T67A 3RU9A 5IKXA 5LC1A 3W6OA 1J70A 4IZOA 2XQFA 4FOPA 1RSOB 5ALXA 1G291 4TKVA 4KQIA 1VZ2A 1ORHA 2ZB4A 4BWAA 2PT7A 1BMFD 2ZRAA 1LBQA 3K9NA 5E1AC 1V9SA 4BX3A 1XMSA 2P79A 3Q15C 4DREA 4LOLA 4BB5A 4KQKA 2P2DA 2XUKA 3GYQA 4IDAA 3JQ7A 3O9MA 4A5UB 1W6UA 1OH7A 3ONVA 5AHWA 2ZBGA 4Q9NA 1L4BA 1RWMA 5HPYB 4PO9A 5EE1A 4DV2O 2O54A 3NC0C 5LBQA 1GU1A 3OUTA 1S2IA 4EA6A 3EFHA 5AUPB 5AUOB 3GF4A 3WADA 4DR2B 5BUSA 3T5CA 2F3SA 1Q95A 3V34A 5KAFZ 4F5DA 2FG7C 1BCCH 1JEYA 1K68A 1Y8QB 3HZRA 3O3CA 2HWYA 4FR2A 3ROTA 4HAXA 1S1CA 2VJMA 5GJBA 4GMDA 3UOAB 5A9GA 1YFJA 1YVRA 2BCEA 2QAJA 4IKEA 1FU4A 1D03A 3D2AA 3QEBZ 4DSAA 3WGVA 3JD2A 1BHQ1 4EWLA 2VK4A 4C01A 1I2DA 1VA5A 1Q91A 5HKLA 2Y1KA 4LZAA 1DI0A 2DT4A 2HH9A 3TL3A 1ANKA 2W9XA 3V7YA 4YAEA 4F9TA 3CH5A 5HTKA 2NQTA 5CW2A 2ZYWX 2E75B 4LOKA 3AJ8A 4LE1A 3K6KA 2XH8A 3SLGA 1ZD2P 3B3JA 5L3EA 3L72H 2I62A 3CMEF 4ND1A 1XZEA 4EMSA 5TXGA 1F0YA 4HXYA 2J0QA 4B6PA 4U1RA 4UCXA 1MU0A 1XCOA 3PHJA 4OUDB 1J0EA 2OTJF 2C7VA 5ALYA 1JWBB 4CVNA 3RAJA 3FFMA 3I32A 4GYCB 5AW0A 1KI2A 3ZHTA 1V37A 1XMVA 3A1EA 4NKRA 2ONCA 1BZYA 4F7WA 4WLOA 3HVIA 5KNCD 1T0JB 3OKPA 4WK0B 2QVBA 3DZHA 1BEZA 4Q7EA 4L9AA 4IY1A 3W7SA 3QXJA 1E2KA 5KNCH 3T06B 2WSLA 2PNJA 2I6XA 4ICGA 3C97A 1HMPA 3IEQA 1GG5A 3FWKA 3OBYA 1OWNA 3GC6A 4CMGA 2I29A 4D25A 3AFHA 3CPHA 2WVGA 3VQWA 4CBCA 1Z07A 1JNYA 3AKZA 5K3AA 4WBNA 7ABPA 3ZK9A 1PG2A 5FQOA 4NIMA 2JBAB 3FXAA 2WICA 1VBNA 5IWAO 4IVPA 3ENWA 3K0BA 3G7NA 5DMHA 4PWYA 1VIVA 3I58A 4D9HA 2FPLA 4WN3A 2MSEB 3CN9A 1DT5A 3RPEA 1AQUA 4H7EA 3HV2A 1DBVO 1VQOF 1YIJF 3IFSA 4XIJA 3F0FA 1FVFA 1M6HA 3MTQA 1RIFA 4CQLB 1ZD1A 4IZIA 1P5HA 1C4WA 1DIHA 2CE7A 1E89A 2ZJZA 1EZVH 1K3FA 2V1DA 4CZZA 4HDOB 2GHTA 4CM4B 1JU3A 1P7BA 3CIOA 1GXSA 4CHGA 3CGGA 3WQRA 3RRJA 1L1RA 1BMFA 1HURA 4UEKA 1Z45A 3NVMB 1B26A 3JZIA 4ZAVA 5MGBA 1XMQO 1K6JA 3U0OA 2EARA 2Q4OA 2ZSJA 1SUAA 1GIAA 4MGKR 4L0MA 1OHHD 1QU7A 5IHXA 3TZQA 3O4VA 2FYTA 4HNQA 3F5DA 1Z08A 1JKXA 3FFAA 1IBCA 3HRKA 2G4LA 3VI4B 1QVGU 5ICGA 3BQNB 1VCNA 5G02A 2O57A 4C8GA 4KHPB 2MQEA 1FXKC 4PAQA 4DOMA 2M7WA 3E18A 1XAGA 1ZUNB 4Y2SA 4HWOA 1Q1AA 4JJGA 1BEEA 3AR3A 1QJCA 4JYPA 4HEQA 4HL6A 2XE4A 3X1JA 5JW6A 4R7CA 4S1PA 3BX1A 1YUNA 3GRZA 3QVWA 3HDYA 3KDPA 5J1SB 1CR6A 3CH6A 3GHYA 1QHSA 3WE7A 3H5RA 3WRWA 3LI2A 4UVGA 3VVBA 2UZ4A 2CVOA 2EAUA 1RE1A 3GVCA 1Y8CA 5CJ2A 5JZ9A 5H3CA 4E6EA 1DC4A 2P5OA 2HWWA 4G1VA 2NV0A 1RLMA 1NVGA 1VQ6V 1HKUA 3P2JA 2PX5A 3ZRWB 1ZXLA 4X1KB 1H2YA 2ASEA 2CMDA 1ODIA 6AT1A 2JGKA 3DL7A 1BMFG 3RC8A 4MWDA 2Z58A 2XASA 2VNIA 5TEWA 4D3ZA 3VYTC 2JGMA 3FYCA 5B3KA 3AWDA 2XGGA 5TPWB 2X3YA 5KOIA 5KNCA 3TIIA 4ZI3A 3Q3HA 5SZIA 2H4XA 3RO7A 3OCZA 5DRYA 4WACA 1QVWA 4NEGA 3U7HB 3JQGA 5B3JC 3OM9A 3FX2A 3NTVA 4PR3A 1W5BA 4YJ3A 3A9CA 3W6ZA 3K70B 1ENVA 2BBWA 1U8FO 4FZ1A 3OOEA 3E7XA 5DXAA 1OYVA 4DSZA 4ADSG 1R6NA 1JMYA 4OOEA 1JQAA 2CTWA 5G40A 2EBHX 4LJ6A 3W5JA 5GJVC 2KKWA 2QZ9A 1FSPA 4GXNA 2YS7A 1H85A 2DTEA 4H60A 2C5HA 3QNMA 3CR7A 4IOKA 4XVUA 2VUUA 4A03A 3D31A 3T5TA 1U2ZA 3E9DA 3JQ6A 1QO9A 2ZSHA 4TRRA 1R5NA 2W8BC 3L92A 1H2SB 2BR3A 2BFEB 2OYSA 1MPTA 3L6CA 5KLVH 3ENZA 1M1NB 1GZHB 2JAOA 3ZIAG 1S76D 5F51A 5EMKA 1KC1A 4HSGA 4FX5A 1YQEA 1WPGA 4G9GA 4QJBA 3WQBA 3KKLA 1BN7A 2CLCX 4M53A 4CKBA 5BN4B 4FFPA 2HIGA 4L2IA 5H6RA 1ISJA 4YYZA 5T64A 5TGDA 4I4TB 2HU8A 5I7OA 1YZGA 4D1YA 3HJCA 1K7FB 4QPPA 4ZZ0A 1W94A 1YRHA 3SD7A 2NLOA 2ETNA 1JJBA 2WU4A 4C43A 5KJ6A 2P4UA 4R4JA 2UUOA 4PA9A 4P4LA 4NLLA 1FFYA 1OHHA 3E5HA 4YUZA 4R71A 1GGKA 1FP6A 3D3NA 3BH6A 2PKEA 2GEKA 4KQJA 1Y3CE 2OGTA 1X42A 2FE4A 1Y6JA 4EMBA 4MVXA 2Y27A 4WCEV 3DYVA 5C18A 4RO2A 4TLAA 1O5IA 1XL0A 3HM9A 2V4DA 1EGMB 1GKIA 4EKNB 1IHDA 1CB0A 1VDMA 1PL8A 4QDTA 4OHRA 2BKAA 5ES3A 3G0IA 1C30A 2ZB8A 1GLGA 1YFKA 3HY6A 4FCCA 3Q8MA 5CH8A 2IUFA 3G49A 1QE3A 1TCUA 4PONA 3LRXA 1K06A 3VJRA 4C1NA 2QRKA 3W7UA 1LVGA 3CKMA 3KR2A 1TLLA 5AW8A 3QEKA 3C9TA 3SZMA 5ALHA 4JB0A 1N25A 3WLRA 2J6BA 2L2QA 9GPBA 2KTVA 5TR9A 3VRHA 2E49A 5KJ1A 1T8SA 4OAPA 4ZXPA 3C74A 5G2OA 3NHMA 1UI9A 4EVRA 4QYTA 2NVUA 4RXMA 4P38A 2ZS8A 2HPZA 3AETB 2ZNJA 4HN4B 1ZM2A 1ADFA 1JLKA 1H2AS 3IC5A 4XE5A 1DFGA 5A6SA 1OX5A 4OX9Y 3EZLA 3DUWA 3FYUB 2QBYA 2H9YA 3GT7A 5F5LA 1C0IA 3WLSA 2CK3A 5JANA 3EIHA 1SQPH 4CPDA 2PSFA 1E2BA 4RK1A 4EELA 4RZXA 5CN0A 3TLYA 3BMOA 4GI3A 1L9KA 3TTSA 1MO4A 4K8RB 5TX7A 3PJEA 5D3MB 2Z8ZA 3AILA 2PGLA 3N2IA 5CIQA 2D1SA 2FN8A 2QTRA 4LNUB 1G66A 3KFXA 5HCNA 2BFMA 3KQPA 3WWZA 1DSSG 3F47A 1EXMA 1H2XA 1E4EB 3OQIB 1SA0B 1AKMA 2Z6QA 1VYUA 3IAYA 2P0YA 3I9KA 1Y6GA 7REQA 4O4IA 2EJUA 4S0XA 2YN4A 1Z2DA 1IQPA 3BREA 3WBFA 2Q3MA 4XJSA 3U2QA 1U7UA 1XRJA 4BLVA 4MMZB 4JL8A 4ID9A 2YVAA 2RHGB 2IH4A 2H4YA 2JZOA 1I2BA 5EOVA 3HL0A 3L7LA 3PXGA 3VNRA 3ANSA 2PLAA 2Z4RA 5AJTA 4J42A 1UXIA 2LFSA 3DOHA 4WXMA 3ED1A 5BMVB 3KT6A 1E8DA 4WY8A 4I50A 2ZR2A 3PGKA 2VNAA 1M1YB 2C7RA 3ZCXA 4BFVA 3HB0A 4FHZA 2BHLA 1LUVA 1US8B 1YQ9A 1BJKA 2C78A 4YO8A 1JPXA 2ZUSA 5ESDA 3OX3A 1U5BA 5EZSA 2OY0A 1SC3A 4IHKA 4YJFB 4AS3A 3MAJA 3VO8A 2QTWB 2ARHA 2QG4A 2LBWA 4TS4A 4L07A 3IKMB 3H1KH 4JI8B 1YBMA 3Q9UA 4BCCA 3T38A 5IWCA 4I8DA 4ZVPA 1KF0A 1TI7A 2VBCA 1KZ7B 5HHTA 4JAVC 2TMGA 3VZPA 3TRHA 3LTEA 1RYYA 2R1ZA 3HSYA 5HNKA 4KYIB 2IW5A 1OIXA 2A0LA 1PJZA 5CYOA 4OHOA 4PCVA 1T4CA 1L8OA 3AERA 3LCJA 4DIDA 3LIPA 1SXGA 4CQMB 3KSRA 3PBKA 2M6KA 4PBTA 3WX0A 4BVQA 3WO1A 3CKLA 5B37A 3K71B 5HGXA 3C8LA 3I9MA 3CXHF 4MR9B 3ENVA 1G8PA 4UMDA 2EFEB 4CH3A 1VQNV 4Q0MA 3SFTA 5HQ3B 4LI0A 3O47A 2I2FA 3I2IA 4BIUA 3ZWPA 1OB2A 1C2YA 3JYPA 3CZ9A 4YT5A 5HFLA 3LBFA 1IBLO 2JVIA 5I7UA 3JVDA 3SIRA 4QXAA 3W2TA 1NQTA 2FG6C 3SHFA 1J7JA 2ZM6B 1WZIA 3EBPA 5IBPA 4BT5A 1PVVA 3CF0A 3CBGA 1K5DA 1VB3A 1E6MA 3GZNA 1HW7A 3DC5A 1ZCJA 1WMDA 5FPOA 1MJFA 2VOEA 1HDOA 3WGTA 2Z09A 1LI5A 3T9EA 3BHPA 3ELDA 3D8RA 2EFHB 4C4YA 4OQDA 1VQLF 1MIOA 2P2NA 4GKBA 3OZIA 2UXNA 1EHIA 2FR8A 3PRYA 2QJ1A 3X1MA 2GPBA 1U99A 4J4TA 1A9YA 1GUYA 3FNEA 1GK9A 1RTTA 4CI9A 4ZV7A 3N86A 4G0XA 3TAHA 2DWEC 5LB2A 3FHJA 4DW1A 4KBFA 3OCXA 4CN8A 4HDMA 4R41A 5IG2A 3NYQA 2B8WA 4NZNA 3OW2F 2B9EA 2J6IA 1ZSNA 1E3TA 4JR2A 4H6PA 1AS0A 3NTLA 4NJMA 5T8KC 3G80A 1E9EA 1MH9A 4LF5O 2IZ6A 2L18A 2O4CA 1EUDA 3ISVA 1I9CA 1M66A 4BNLA 4OHVA 4NJEB 1BEUB 2VTEA 2HCTA 4LJRA 2Q1TA 1M1KH 3UMGA 1A04A 1XNJA 3UB4A 3B4SA 1C81A 4G4VA 2NU9A 4RFSB 3T7SA 2WIAA 2HSDA 3C7CB 5EKSA 2G7MC 2A9HA 5B4UA 5LZ2A 5GY7A 4R3UC 3CEJA 5JFOA 4KPYA 4Y98A 4GX0A 3S3TA 3RS3A 1QHEA 2OXRA 1IOWA 2FWRA 1JW9B 3MB5A 3MG9A 4HQRA 3CEIA 4GXQA 1Z15A 4OSEA 3QHPA 4D0GA 4ZI7A 2RKWA 3PTLA 2WSSG 3NHZA 3ZV6A 5CDFA 4LG1A 4M0FA 4H08A 2NU8B 3KTAA 4GPD1 2YMPA 4U6SA 3MJDA 3GBSA 1LRLA 4NMMA 1NI3A 2WQ6A 2Q5HA 2WR8A 2FW7A 4L5JA 1N3YA 1XPJA 4NXMB 2PZMA 2N05A 5AVMA 3C3BA 3AM5A 2AN5A 4DO2A 1U2PA 3JVEA 3CE2A 3ABKC 3PUZA 4G37A 1T6XA 5HIKA 4QQKA 1H4VB 1I5EA 1P2VA 1H9CA 3Q11A 1GFSA 1ZJWA 5I9TA 3ZCVA 5C8DA 3MIIA 1WP4A 1NW8A 1QQCA 4P4TA 4U7DA 2H54A 4WZAE 4KW7A 1QOPB 4U5QA 1E6UA 3NYIA 1NH2B 1YJ8A 3G17A 5CX1A 1V26A 3IBYA 2UYKA 1KO4A 1T3HA 5C32A 3UXEA 5DCLA 3W2HA 1OT3A 5JZMA 4LZOA 3HRIA 1QR9A 2XDAA 1V8FA 1KJ9A 2BWJA 2OWEA 1AQYA 4X0EA 3D0OA 2C4MA 3CINA 4Z86A 3RDPA 4R81A 4AQYB 1DAGA 5AW7A 3EGXB 2ECKA 1E63A 3DDHA 2HCJB 1A88A 1JBKA 2WKSA 2JI6A 4XPZA 1SUSA 4XGRA 4KC0A 3NFRA 1ZFNA 1X1TA 4Z0NA 1K6IA 2AWOA 1L3CA 3LUPA 1YJ5A 5C4IA 1VF7A 4I2NA 4C4RA 2D2FA 4GLJA 2YXDA 4GP7A 3OM1A 4D56A 4MRMB 5M34A 1CWUA 4HYQA 3LCMA 1X15A 4E5NA 1TYCA 4Z9XA 3UV3A 2GB4A 3GAMA 3PFWO 4LR3A 3IAM6 1TEVA 3DMPA 5IAAA 4LDNA 2YYEA 1NATA 3T1QA 1RJDA 4DLWA 4UKDA 4Q4CA 4WHMA 3P2EA 1NL3A 1ZCFA 1SETA 5JCJA 4R98A 3THOA 3O03A 1XD2B 4FSHA 4Q1CA 2GK7A 4RADA 4WXEA 2BSQA 4BV2A 1CDEA 1QIFA 2HHJA 4EPXA 1UPCA 4U2DA 1TK9A 5EERA 4Y67A 3ZK7A 1ZJ6A 3JD3A 4Q3EA 4FI3F 1N4CA 2NUPB 3DKPA 1R6KA 4ZIRA 4AJIA 2QMUA 1D6SA 4UM9B 3A9TA 2BFCB 1TJ4A 1UBNA 3AXSA 4IS3A 3MHSC 4FGSA 1V4VA 4P30A 2B6HA 3AGPA 2Y4NA 3A4TA 2HRDA 2F9MA 3IHTA 3HCNA 3TD4A 1JHQA 4XVQA 5D86A 1YR9A 5EESA 1F51A 2YXBA 3RJMA 4DW8A 3I2HA 1PJSA 2YJZA 1G18A 1EU1A 2ZSIA 4AS2A 4FGKA 1K08A 3ZZMA 1CUBA 2LP4Y 1HTTA 2IYAA 3QEMB 2YWHA 5C31A 2P6PA 1BVYF 3FDJA 5JSHA 4TTPA 5EPOA 1PEAA 1COMA 3L7KA 5KX5A 2QX7A 4JODA 3E22A 4QQ8A 2XUPA 1JJAA 5IDJA 2H9IA 1XHFA 3IEVA 2QRLA 1HI9A 4NYJR 3V9AA 2EXXA 1YASA 4IW3B 2EWMA 4Q3CA 4M60A 3OHMA 2NYRA 3CRAA 3RS5A 4M7PA 3LDAA 2OZVA 5I9NA 3LLSA 1P84F 4DCVA 3MGCA 1REQA 1YS1X 4QULA 2Q6IA 1OFTA 1S9HA 5I51A 1Y6QA 3CW2A 3WGZA 1PTJC 3SG0A 4CEJA 1FJGO 4OHMA 3ABMC 1LR1A 3PWZA 5DOZA 4BO3A 3LSUA 1X7XB 1XDCA 1NASA 3M84A 4KWIA 1HDCA 1YU9A 3NWEA 3WMFA 1BCRB 1GVHA 1JLMA 4UM5A 1WM1A 1XJQA 2CNNA 5BORA 2J0SA 1HR0B 4FNMA 3JWHA 2JK0A 4MW2A 5EFZA 5HXAA 1YRBA 4HOYA 2B4YA 2AZ2A 2OCIA 5IC6A 2JVJA 5K1ZA 1ST2A 2GM3A 1UKYA 3PD7A 3D8HA 3I9V1 3ACBA 3ZY4A 2V3CC 1CP3A 1YTFB 2B4QA 4HAYA 4PHCA 5JEEA 3NHYA 2IDKA 3BXOA 1JS1X 1R6BX 4WFFA 5CCBA 3GV0A 1Z75A 1OCOB 2CLIB 1ONNA 1J33A 1WXQA 4AY6A 4C0QC 4WBNF 1SHJA 2YZMA 1A32A 1K8AW 3A10A 5JZSA 4MEAA 5DLEA 4DYHA 5AW1A 1LFDB 2H8EA 1FBTA 4ND2A 1TQ4A 2VF5X 3ERNA 4BKMA 4D3SA 3BMNA 3L8DA 3IR9A 1JJVA 1E4OA 2Y3IA 3TX2A 2B1IA 4EMUA 3D2BA 4E22A 1R3UA 1CUJA 2QX9A 4ZQHA 2VHUA 4GLLA 5IT9N 4PPYA 4NZPA 1S4MA 2GPJA 1R0XA 2YVKA 1FFXA 4Y2TA 5AVWA 2LJ2A 4OFBA 1ZHFA 3WYNA 1RBYA 4HGNA 5K51A 1A98A 5DHFA 4JBHA 3RARA 2W5UA 1CEXA 2JCYA 3VM6A 4IJVA 2ZT7A 1MSWD 2XMZA 1TJYA 2CNWD 1DC6A 1KVSA 2JIPA 5ICSA 3N3BC 2LGWA 1K7XB 3N6XA 4DHEA 2QY6A 1MW9X 4MOWA 3CYPB 3BYQA 1Y33E 4MYHA 1G5FA 1BHBA 4XB2A 4WK4B 5K8LA 3KKZA 4ER7A 5I7HA 4GOND 2A9QA 3PQ4A 1OCZB 1ZNWA 2IIPA 3BCUA 4JI1B 4K9DA 3ZVKA 1FLDA 4IF6A 4PICA 1UEXC 3HXKA 1HTBA 2O3TA 4JI3O 1O3YA 3OPQA 5LWHA 4OTZA 1GFIA 1PEKE 2YV5A 4ZPXA 4L73A 1G21A 2WNIA 2YMMA 4GKKO 3FR7A 4K5QA 3W9YA 1YQDA 5DDIP 3OBIA 1RXYA 1V0JA 2PD6A 3LC7O 1EX1A 3H4TA 3OZEA 4MQFA 3R4CA 2FHPA 3DDSA 1G64A 5B7NA 5FUXA 1FVXA 1XLVA 3PIRA 1T6NA 3KCYA 3CS3A 1KA9H 1A7JA 3GZTB 4D9IA 4PNEA 2M6SA 1GUZA 3KLPX 3KOUA 4DPLA 1W4RA 4B84A 4PWTA 3MHPA 2XT0A 4C22A 4LZPA 2X2PA 5COBA 1K8XB 2F7SA 3T7JA 3NM4A 3Q0IA 4HFJA 2JIZD 5EXSA 4Y2QA 1Q11A 5DX1A 4V1CB 5HP7A 1WCWA 3N2KB 2BM1A 3ABLC 4BKQA 5BO5A 3O31A 4G3XA 2MR6A 3FB8C 2R7MA 1UPXA 1Q7TA 2C7PA 5DASA 3NGXA 3MOSA 1RQ7A 4YHHO 1P8AA 1V43A 1UOQA 2PLFA 2BPOA 2ZIWB 5HTOA 5FTLA 4CLOB 3OZCA 3QHDA 1E3IA 4LMAA 1X7ZA 3VU3A 1I51A 3FSJX 2P6YA 3JQPA 5D6NA 4EEZA 3SYPA 4OHZA 2XNSA 1ZBQA 1SBNE 4PGHA 4EVQA 1X1AA 2NNUA 2V6BA 1ESZA 1OSNA 4KR9A 2FSVC 3ABSB 1CF4A 4PDVA 2WHPA 3GGJA 2ZE5A 3BEHA 2QSUA 1WD5A 1LUWA 1L5SA 1MLDA 4LOIA 3H7IA 1MPXA 3TLKA 2XIQA 4YJ3F 2PGIA 4YAJA 1JSRA 4IUYA 1GYPA 2ZSDA 2GM5A 4DLZA 2Q3BA 3C5WP 4XM2A 4PXYA 3V7EA 3SF0A 4KQ1A 3B1WA 1A9SA 4PIVA 2UXXA 2YINC 1JA1A 2BMVA 2UZ3A 3EGVA 1DV1A 1KKUA 3K15A 2IU4A 3Q5EA 4XLTA 3BB1A 2Q5CA 3I64A 5FJIA 2HHHB 4P7GA 3PE4A 1IHOA 3PQFA 3FLBA 2CLOB 2HDWA 3E53A 5ALWA 1KI6A 3WIBA 3EEQA 1DGSA 2LRHA 2WUEA 1A5SB 2LW7A 1U63A 2PRIA 2DPHA 3M6FA 2CV1A 2I8AA 1YFLA 4YRIA 2PDAA 4OK6A 2DHDA 2YZKA 4D9NA 1ZX3A 4ZAZA 1YU6A 5CCEA 3FN4A 4IDQA 6ADHA 3CKYA 3A3PA 3R3JA 2CNWA 2H31A 1PUJA 1ZI8A 4CGZA 2PAAA 1K86A 3R8CA 2HJWA 4DHWA 4ZO4A 3AL0C 5DGHA 3C5CA 3KUUA 4FWTA 2RC6A 2LW1A 4NQRA 4ZMRA 2AOTA 3DM5A 1N2CB 4NYMR 3QYPA 1CXZB 2CGNA 1E1QD 2CLKB 3B20A 4AN4A 2XAQA 3BFKA 1PDOA 2OWOA 3CO5A 4GX1A 3IBCA 3PP8A 4QU8A 3BXHA 3MAQA 4FLVA 2XBMA 3TZBA 3CEMA 3FOZA 1WOYA 4GLXA 1IB6A 4AICA 3BEDA 4IKOA 5DN9A 2DWDC 1XL4A 5A1JA 1YJ9V 2DKFA 3OZUA 3WNVA 2R00C 1LSUA 1OPRA 1NZ6A 1RQPA 3AVQA 3QOXA 4F6LA 3Q7PA 1HZJA 3HSSA 1QCYA 1FNBA 3DLIA 3T5BA 1X7WB 1UP7A 5BW4A 3DP7A 2O7NA 2YJ4A 1M83A 4Y7DA 3C70A 4H31A 3VAAA 1A97A 4A0QA 3CCUV 3VCZA 1XTIA 2VQFB 4B5KA 1PK9A 1LDEA 3ZZUA 4ETNA 4WVLA 3L7OA 2V03A 1Y3FE 1L6IA 3WK8A 4Q9AA 1FRZA 3E8BA 4GE0A 4I66A 2WLTA 4P7KA 2ZB2A 2M9MA 3FWPA 4NHOA 1NY6A 2Y1GA 2NUAA 2XCIA 5H82A 2WWTA 2VBFA 3O9OA 3A7EA 4R2HA 4LQCA 1ZH4A 1CJVC 1FXWF 1IQRA 1PQYA 4B7KA 3DLPX 1JWLA 3JY6A 2X3UA 1UK8A 4BNXA 4UXHA 3VPGA 4PGGA 3KUCA 3FYIB 1SQ5A 5FR1A 3TEFA 3K0SA 1WNSA 3U3DA 1FB5A 4HWGA 4JU8A 2EG5A 5B2EA 5EXPA 2IYYA 4IFIA 1KKDA 5EBWC 1F5SA 3QVUA 4RV4A 3A6LA 4Y6QA 4TTSA 3LUHA 3SYAA 3EQZA 3EXIB 5HY1A 2WG2A 4ES6A 4WCFC 2J33A 1BL8A 2QLMA 4E2LA 4CMIA 1D07A 1L5YA 4UVIA 1EWQA 5FKJA 4MWSA 3FWNA 5ER9A 4YJHB 2R6CA 1TQ6A 3A9WA 4NB5A 2WTAA 1NR7A 2LGQA 4XD2A 3U7JA 4DY4A 2CE2X 4IWXA 3ETQA 3H86A 3ZHXA 3ZK8A 4P9NA 1NN3A 3ABUA 1GZ5A 4F38A 1NNSA 1DQPA 3K58A 4IDDA 4KG7A 4HH1A 4B31A 4O4IF 4ZI2A 4GI2A 2OBLA 1RI3A 2JIZG 1KJQA 2Z5GA 3X2QB 3ED5A 2G9UA 1EK2A 2L82A 3UWOA 2GBIA 4Q15A 4UE2A 2FH5B 1KPHA 4BJ6A 5H7XA 2CGOA 3IIIA 1NXPA 3AF2A 4IOMA 2NM0A 2VP2A 2ZYTX 4FDAA 3SVTA 1VQ9V 3DLBA 2P6OA 4GZ6A 1TT7A 2R47A 3RUFA 2IEYA 2Y1CA 1IYZA 2F8TA 1JHAA 2B35A 3QOWA 1Y37A 3OUFA 1QH8A 5LU9A 2MMGA 2XJ4A 5K6TA 2JLYA 4F3CA 4I50F 2EIXA 2FEAA 1D2DA 2D5CA 3K1ZA 1Y4DE 1JECA 4X6YA 1HMYA 3HVUA 3A06A 3W3AD 4O2RA 1XI1A 3ZOKA 4DCGA 4RCYA 2QMZA 2PI4A 1XBIA 5DCVA 5A06A 4DK1A 1E6EA 1SOAA 3DEHA 4B3FX 3W3AH 3KQKA 2IODA 2ZDIC 4HGYA 2QRPA 3H87A 4LX8A 1E1QA 3MS4A 3DQZA 1XO1A 3AU9A 4LDZA 2XQGA 4YJDA 7YASA 4QUAA 4F46A 1L1QA 3ETCA 2AIFA 1GWNA 1J8DA 4LCJA 4Y9TA 1KAGA 5M3BA 1OBVA 3HR8A 2R11A 5LCXA 4DYDA 4CFYA 3VV3A 2QWNB 2NTJA 1AK2A 1AQJA 1Q7EA 2V55B 4XFKA 3K1TA 4MW8A 1SQXH 2J4FA 5CNMA 5K3CA 3F3MA 3S0WA 2G6TA 3UK2A 4GGPA 1JQEA 4LRXA 1M54A 1RWPA 3IP8A 2IEGA 1P7PA 1UR5A 3WP0A 4N5MA 4MHSA 2HEGA 3QXGA 1MA1A 1DIRA 4RSRA 3UWDA 1TM4E 3SX4A 2ZIZA 5T57A 2I2AA 5BVHB 4JK3A 4B81A 1WTCA 3BDAA 4HN9A 1U0SY 1QG2A 2YIDA 5GV8A 2GESA 1ZYUA 5JG7A 3MUEA 2ZUWA 5CH5A 2G1KA 3PFBA 2RK4A 4A8PA 3I23A 3EW9A 2C2WA 2Z0AA 4WESB 2X6TA 2PH1A 2A5FA 3ZGXA 1O9GA 5J9PC 1DPGA 4RHFA 1NIJA 1P49A 2Z8YA 3M1YA 5FP0A 2C7OA 1ZD4A 1Z82A 3MLBA 4FBMA 1TT5A 4Q9JA 4ZAGA 5L4NA 4BLSA 4CF3A 2JGIA 1U8YA 1ZOIA 1X4TA 5DEDA 1ZW6A 3ML1A 4XGIA 2RB9A 3RE1A 2TRSB 3GJ7A 3VO2A 3AUJB 3IRVA 1GKLA 5IE9A 1VPTA 3GJ5A 3K6SB 2AI1A 1MEEA 1E9BA 3W5BA 1YEWA 4JLDA 1L5MA 2CNLA 4ON9A 5K4HA 2PRKA 3BICA 2X1VA 5JSFA 5DM4A 2VT6A 4FLYA 3G2HA 1D6JA 2VH1A 2ACKA 3IQZA 1ZAUA 4EAAA 3FCXA 1OBOA 4NWOB 4L5CA 2QP9X 1K88A 4YDSA 5A0VA 1AGNA 1JY8A 3D0RA 2J85A 4J4BA 4JP8A 5IFKA 2E6KA 4DILA 4UZSA 1J20A 2E37A 3EPHA 1PD1A 1GADO 1S8OA 5DNYB 3AP3A 4QQFA 1G9XA 4QYXA 5T7BA 3E81A 1P9RA 1U7DA 2O52A 3N2GB 2DFTA 1D0VA 3CZAA 2Z3YA 3GGCA 2Q4PA 3B60A 4K40A 2LCQA 3K0TA 3AK2A 3LC2O 3T4ZA 5CK5A 2H85A 4Y0AA 4O59O 5FBZA 3ZVMA 4Q4DA 2ENUA 3LT0A 4H35A 1P5JA 1XTVA 3AI3A 2FGKA 1UXJA 3ML0A 3EZ2A 4MB2A 1E3SA 1N7HA 4HATA 2CMGA 3WMGA 1XTSA 5DM70 3QLUA 3L4SO 1ORTA 1VHLA 4C8IA 2IPAB 2OV3A 3CVWA 3R44A 3DMFA 4PDLA 1K4DC 2XD9A 2IXFA 4ZI7F 4YCAA 4MR8A 3KQUA 4X7PA 1T24A 3LHIA 4QU5A 3W3AA 1K9MH 3UT5A 1L3IA 4X41A 4S35A 4I08A 4N0MA 5C52B 3L0ZA 4CS3A 5CBHA 4B6FA 3F7YC 2ZWMA 1ZL0A 4DR4B 2G5PA 4B33A 3UT6A 3EFEA 1YOVA 1RIIA 1TFUA 1M34A 4JXJA 1D1PA 2ZJBA 5C1PA 3TUIC 3ZIAD 1MB0A 3C24A 2O2CA 3T1YO 2HWUA 3DHNA 4ZARA 3E8SA 2DFLA 3RH0A 5EWMA 4NE9A 5KB3A 1RQNA 4M2LA 2GFHA 1Z6TA 3MT7A 2NVWA 4JVSB 1A9PA 4DRXB 3OZ7A 3E61A 2QZSA 5ESWA 3I37X 3D6FA 3MMNA 4DXWA 4DF3A 3ASOB 2HP3A 2WG1A 3BT7A 4J94A 2RN9A 5JZVA 3L1JA 1XFDA 2BY4A 1PL6A 4TXMA 3UJNA 5H2FZ 3LO8A 1E7QA 3HWSA 1YRAA 1NP3A 2IEZA 3VSAA 1GJRA 3DTTA 1U8UA 1L5WA 4EUKA 2AUMA 4INOA 1XLWA 5DLDA 1GCUA 4ARIA 4C4OA 3OT1B 2O2SA 4RYDA 2I4MA 5LB4A 2CLFB 2FA9A 2HADA 2R5NA 2V45A 2C5GA 3B8MA 2PBLA 1WPBA 2O07A 3HUFA 4DSNA 1KJIA 1N6OA 3H16A 1BFKA 1EHCA 4QFBA 1MJGA 5TF0A 1XEXA 2FQQA 3N59A 1NOKA 3ZE0B 4LCBA 2XI4A 1W36D 2QG6A 3AHIA 5EYPA 3CF6R 1SXQA 4B47A 1BYIA 4AWAA 3Q7SA 3WFJA 1Y7PA 4WH0A 2OVFA 4COKA 2ZJ0A 5G1NA 3T5DA 5BQ5A 3TS1A 3W3ZB 1U3VA 2XHZA 1OJLA 1I1NA 3M6XA 1UBOS 2C83A 2ZT9B 2QTSA 1OR8A 4MQ5A 5EJEA 4AMUA 2UXBB 5EA2A 3SYCA 1RYDA 1JDPA 2Q3JA 1Z83A 4G5QA 1F06A 3SQLA 2C8VA 3FFQA 2P1DA 5BW6B 1M2EA 5FBVB 2FSGA 1VSQA 2I8CA 3K2BA 1QUEA 5EE3A 4EDFA 2X4DA 5DI9A 1V16B 3H8JA 1M5UA 1UP4A 3K0FA 4EI2A 3H0EA 2ZK7A 1KJWA 1N34B 3VNQA 3NK6A 4WZBE 5AK5A 4RUEA 1MF7A 2NXCA 4RS3A 2H5EA 2H08A 2K1SA 1QG4A 1XPRA 4GFDA 2AI2A 3CTPA 2VF8A 1JFFA 4XZ3A 1GG9A 3VGPA 4G9EA 2BCJQ 1QU3A 2PZKA 1H4TA 4AQDA 3AEZA 1N2ZA 4FLWA 2WQZA 3VNAA 1KGSA 2IE8A 1C4XA 3I92A 3CPWF 2CZGA 4F2DA 5KX5F 3NW9A 1A4RA 3KTDA 1UXKA 4JLMA 3CC8A 4OYYA 1SU6A 3G6BA 4Y2GA 5T41A 2XGOA 1ZVQA 1YCGA 4XQEA 5F21A 4PXSA 3INTA 3H1BA 1BYUA 3H04A 3VHXB 2X15A 2GKGA 3GQBA 1Q7YH 3S0HA 2WAMA 2D54A 3ICCA 2ZSEA 4INAA 4KB5A 5FV4A 4TV9F 3NK7A 2FPOA 1NF9A 4P81A 2A0UA 1NW7A 2OIGA 1N1DA 4DBLE 2FPSA 3WGOA 1RPNA 1Y5IA 3ZIAA 3Q7RA 3ZWMA 3WQSB 3FWZA 4GT1A 1OCCB 5B1OA 3OPMA 3PFGA 3ZX4A 1Q82W 1MZVA 3O8LA 2ZRNA 4DR7O 3GI1A 3IB3A 4MSWC 2ZR0A 2VC2B 1XSEA 5DCWA 4E15A 2P2GA 4IEIA 3WAKA 4NS1A 2HWXA 4M9RA 3WPXA 1XTTA 3H11B 4WJLA 1YVEI 1ESEA 1B2RA 4H3SA 1P9WA 1QGZA 4KSYA 1Q0RA 2Q6TA 1C7ZA 5DISB 2AFHE 5DF1A 5BY2A 4X62O 1YCFA 1W40A 4KLAA 4UOZA 3I2GA 2YIVX 1WZCA 2JASA 3R0IA 1KI4A 1I01A 5A62A 2Q7OE 4ND3A 1H3EA 1FJ2A 3B1KA 2ZGVA 1V1MB 1PUIA 2YBDA 1C9MA 4GNKA 3TR5A 1GU0A 4HPXB 3CYOA 2HLPA 3Q8HA 5CVCA 4ND8A 1V5EA 4JB2A 5TY0A 4ALLA 4MITA 3HI6A 1FTWA 1MC5A 4DUPA 3EASA 4LYHA 2DZDA 2QTGA 2JCXA 4CHTA 4C05A 1HNXO 3O1IC 3M5CA 4FFNA 2QD4A 3PRHA 1GR1A 2EX0A 5F77A 3GDHA 1DAIA 3NANA 1ZI6A 2Q1SA 4DPKA 4MWOA 1MX1A 3DPSA 4HQFA 3I9V6 2A5DA 3KLBA 2UUAO 4WD3A 1A9TA 4AK9A 3IMPA 1YBFA 4WEQA 1KZHA 3IOYA 5DBGA 4JLVA 1XAIA 1K0UA 4UBIA 3HCRA 2QI9F 2HRUA 4LDJA 1XNQO 5JAHA 2VSYA 2EIMB 3QO5A 2P3SA 1P4SA 3CF4A 5AI0A 3OMWA 5CCXA 2NZYA 4C0HA 1L5KA 1OI3A 4YIPA 2PZAA 2GYWA 2C4NA 4IS2A 4JKYA 5HQTA 1MTOA 4D0NA 3FPKA 5LGTA 3IXQA 1Z0ZA 1UDWA 4N21A 2GPNA 4I0XB 4ZCLA 3D1JA 3FMPB 2EKZA 1BH2A 3D02A 5AW6A 1PR5A 4DQLA 2XOEA 4RV5A 5EVCA 4PN3A 3EUAA 4RJJA 3KQYA 2AFIE 3QFTA 4EY7A 4RD0A 2Z5LA 3QGMA 4M99A 1U8ZA 2PYLA 4R01A 4KXFB 2X86A 4DYLA 1L7EA 1TADA 2AXNA 4BO7A 2XODA 3C7KA 5ULLA 1TDJA 1W29A 2J67A 2QVGA 5DHRA 1X7PA 4O4HA 2WJ3A 2WF6A 1RJ9A 3HG7A 1XAHA 2FX3A 1R8YA 3GLSA 2NN4A 1VGRA 1HBJA 3DZJA 2ZE8A 3TRKA 2GN4A 3CX8A 4OQ4A 1C2TA 1LRKA 3HA5A 5FBLB 2Y67A 1YH3A 1C7IA 1W9HA 4KQCA 4PV7A 3FZEA 2ZRDA 5JAPA 3UO8B 5C93A 2GJ9A 2ZINA 2O7VA 4IXDA 1F4MA 4OQLA 2YICA 4J7JA 1N6PA 4A8JC 1ZNQO 2F43G 3N76A 1NE2A 2WFZA 4OM7A 5GIOE 3EUWA 3WIDA 4EJMA 2RDCA 1KEUA 4DCOA 3RUEA 1X9IA 4DJAA 2WSBA 5HUHA 4QFMA 3OJWA 1ZLXA 3DXXA 2D0DA 3CF4G 3U3OA 5J5CA 4DVJA 1QTQA 1JR2A 4D9FA 3SHWA 2IXGA 3U19A 4QSHA 3UWMA 4QFDA 2XR1A 3F2VA 1SS3A 4CUZA 4HZGA 3FB6C 1HQDA 3M82A 2WSSD 4JQOA 1GL7A 2YRWA 3A27A 5EZYA 4GUAA 3NIFB 2FW0A 4AJ9A 1DG9A 1QMPA 2IQIA 2AB0A 1G5PA 4I8XA 2J4CA 4RTPA 5BNTA 3R9IA 2WT9A 1KQSU 2CH7A 3G0DA 1VJRA 5JXJA 4F06A 1C4KA 2C84A 2XGSA 3ECAA 1KB9F 3MGGA 3HGMA 4C20A 4URVR 1K6EA 4XQ9A 2V74B 3KQSA 3EZ9A 2OCYC 2X5KO 5KQGA 3AESA 3IVGA 1YUMA 3L93A 2Q9LA 4OLJA 2ZTLA 1GL9B 2JIRA 3H8WA 1G2QA 3R3VA 1GCAA 2G6BA 4WNAB 3PG5A 4BP9A 2QTBA 3RVSA 4W5WA 5L4SA 5LQKA 1WZ2A 4TM8A 2CVLA 1HE4A 2PJRA 4HBNA 4L95C 4YCDA 2ICAA 1BOFA 3BC1A 2A9FA 2X9LA 2W6NA 4LZWA 4DB2A 5DNUA 1BJRE 2CZQA 2GBCA 1JFSA 2IHVA 1EXDA 1Y4UA 3SM9A 3OFVA 1SQQH 5I45A 4GKJO 5REQA 4DR5B 2PUAA 1DWPA 2HD4A 4G26A 3K8QA 5E9WA 4M8SA 2E74B 3I05A 4RF3A 1BWRA 4LZZA 1ZESA 2V8BA 4DM7A 2BRUA 3M9XA 1YTLA 4AYTA 1QFYA 2EJTA 1EK1A 2PL3A 4G8DA 1XIVA 1C7FA 1FUUA 2ID9A 4A10A 3D6HA 4K86A 3C9UA 1UWKA 4IJ5A 1DCTA 1S2MA 2XA9A 1BXGB 5HBGA 4TWRA 3KHUA 3ZWNA 4LFBO 3RVQA 1GV1A 1IDOA 2ZWIA 5AW2A 4HUQB 2ZR8A 1VP9A 3S68A 3N2EA 2NZXA 1ZU5A 3UT0A 3HJWC 3LH5A 1GTMA 4AF7A 1MP0A 1SH7A 2EG9A 3RLFA 1RRCA 5CDGA 3WQHA 3CE6A 5BT9A 3M99B 1U3CA 5KU1A 3U7QB 3F3YA 3TVDA 3ZGZA 3SC2A 3ITDA 4LTMA 2RBGA 4WLFA 3G0CA 4FCVA 4BXOB 4GOOD 2GAFA 2FPRA 2WABA 4P82A 1I80A 4ARUA 1BZKA 3ROKA 2GT1A 1JB1A 4TV8B 3CNNA 2I34A 5J43A 3AY7A 1E9SA 4BJHB 4OHYA 2C2HA 5FO0A 4ITRC 1OIWA 2UXDB 2DQ0A 3L0DA 3FBWA 4U6NA 2D7DA 3GLIE 1Y1SA 1LZKA 1LSOA 4M37A 4V38A 4N76A 1BRMA 4DNFA 4DG5A 1DNPA 3Q10A 1QFMA 3SDZA 1SCDA 2X0FA 4GGMX 4RUKA 4UCWA 2PYJA 1QTIA 1F0KA 4I6JA 3MCQA 1IX9A 4NBLA 3N9IA 1DAHA 3UXYA 1Y1QA 1R6TA 1XZDA 2P65A 1XZPA 4DRZA 1FJHA 5FBHA 5JC1A 5AJWA 1THMA 3WYEA 1GTSA 2XWJI 1A9XA 3GW8A 2WSSA 5IJ9A 5LA6F 1T36A 3GP8A 1PV0A 4GF5A 2BZ0A 3DR3A 3V2UA 2K7ZA 5IHPA 1UPUA 2XGMA 1GPH1 2Z8XA 3WBKA 3PYXA 3LVRE 1TZ2A 4MKXA 1KDTA 5IDYA 4JA2A 3VIUA 3IUSA 1NR5A 4PZDA 3RS8A 3HR4A 1JQLB 1A77A 4UMEA 5D1NA 5K3EA 3OZSA 1U43A 3ICWA 4A6XA 4D46A 3F1KA 3RUCA 3JVIA 3LOUA 1MRZA 1O9HA 3A4NA 4HDQB 1Z63A 4MYTA 3IUJA 2AVNA 2ZJ2A 3T99A 3W4KA 5TARA 2PV7A 2ZCVA 2XADA 3WK5A 1VQ8F 4YI3A 1J07A 5F1KA 4LPKA 2C2AA 1MFPA 2NN3C 4DSOA 3N7TA 3HCEA 2X5OA 2XUOA 4MWGA 3KJHA 2AT1A 1T0AA 2CNOA 4RPKA 5KOJA 2ITCC 1CQIB 4DR1B 2YQ5A 2GCGA 5B3JA 2D00A 1FW6A 2IP4A 2WVAA 3FYSA 2ZIUB 4C2TA 2D1RA 3V1MA 4CXMA 4ERNA 2X41A 4MUGA 5CLGA 1W59A 2ZUTA 3ZWCA 2QMYA 2JJ1D 5FCDA 1A95A 4CIDA 1NBAA 2GTSA 4N3BA 3ANTA 3CNEA 3PQEA 5DH9A 4Q1DA 3WTBA 3KYDB 2XDQB 4G81A 2QL5A 3GJYA 1YRWA 3SS7X 1KS2A 4L9WA 3HNOA 4QBIA 4YMSA 2H57A 4NFYA 1UBSB 3A05A 1P8JA 2WEKA 4BGDA 2IU3A 2FFHA 4HTFB 3TLEA 2W8BA 1I1HA 1XZMA 1N0WA 1G38A 2HB6A 1D5CA 1LWOA 1Q81H 3BFRA 5DRTA 3ACDA 4HFMA 2B69A 2DB3A 1Z5GA 1EBBA 1VZ3A 4XUDA 3VH3A 5T4FA 1UBGA 1QCCA 4LTDA 3RG2A 1CRLA 3FA2A 2CBZA 2ZT6A 3NBMA 1NKVA 3CD6F 5IS2A 3B36A 1QHGA 1Y5NA 2E87A 4K9LA 4RNDB 5D85A 2YI8A 1FFTB 5ADHA 1Q7RA 1ZK1A 1R74A 4MUHA 4F6CA 4D8TA 4HDKA 4A0RA 5H80A 3WHKA 2P6RA 4D45A 1FDIA 1JHXA 2YR0A 1GZ7A 4CKZA 1OGYA 3SVZA 4DPMA 5IU6A 2RHTA 2Q4RA 1HPLA 2BEWB 3O8OB 1DDIA 1E66A 1SELA 4DV0O 1VP7A 1OBCA 3OU6A 4UOQA 3EFOB 5LUBA 4AWBA 1V1RB 4JI5B 1JKJB 3OOSA 5KHLB 4NQ3A 4L4RA 2IY9A 3G8CA 4M36A 4AECA 5L3SA 4JYBA 1NP7A 1CKEA 2FEOA 1KSGA 2AR0A 2B4RO 3PDCA 4YDRA 3OG9A 4C4SA 1YITF 2JJQA 3UM9A 3QUWA 3O2JA 4ZDKA 5EC2C 5KYYA 3VO1A 2IOQA 1A4UA 3Q9NA 4ALJA 3MRSA 4KPUA 4PV1B 3OBWA 2QE7D 2BSAA 4JC5A 2NTNA 2HX1A 1Q0UA 2EP5A 2E0IA 1IY8A 2DRIA 1XA3A 5A9SA 2HJSA 3GJXC 4Q24A 1RAIA 3ORRA 4ZHSA 1FX1A 1S72F 5KTRA 2OHIA 4PPGA 3DC2A 4WQMA 1AKTA 3UJ6A 3CMCO 1KERA 4ZOCA 4FS3A 2BBTA 2IPLA 3PWKA 3PR2B 2GAJA 5FJJA 3EDMA 1Q19A 1I2AA 3LDEA 4MWZA 2WZCA 4CFSA 3GELA 2V7QD 2H3HA 5E9AA 5H3HA 1ISRA 3EA0A 3IT2A 3N1UA 2V0CA 4V0QA 1FFCA 4ZVSA 1UWLA 4DTCA 1JVNA 3DKIA 2XLCA 5B1AC 4CL0A 2EIKC 2R86A 5DWVA 2NXJA 3B7WA 3OZFA 1O6ZA 5DFAA 4QGSA 1FRVA 4NK4A 5JAIA 4YAOA 3QX7A 4F04A 4HKTA 4UCUA 4BR6A 2IZ0A 2IH2A 2C3MA 2JJ1A 1N5JA 4R2MA 1WA8B 5CB0A 4FFBB 1DHTA 1OROA 2A5JA 3ELBA 2Y71A 3P4YA 4MDYA 3H1HH 2DHCA 3L6OO 2Q1UA 1PGNA 3RWOA 2CV0A 3MA0A 3ZG6A 4QC2A 3GFBA 5TGTA 2PR2A 4JLOA 2BFFB 2HJHA 4HDNA 521PA 3MGKA 1XRRA 2QP4A 2O8FB 1NVFA 4P84A 4J0QA 1UQRA 3ZDYB 1VQPF 2B7LA 2AR9A 5EHXA 4LY0A 3IKTA 2OHJA 4PSCA 1NRJB 1WY5A 1XC7A 5CFRA 3TLXA 1VBMA 4YCLA 3Q88A 3L73H 1U9IC 4OB7A 3MTEA 5JDCC 4WAUA 5EWLB 1KOLA 3LHFA 1VMIA 4D7SA 2FUCA 3GLGB 1DWUA 3QKWA 2VATA 3ZGYA 1UBLS 4AZ0B 5THQA 1HT1E 1Z12A 4D97A 1QQBA 4W4KA 1L9XA 1H5UA 5IYDO 2DY0A 4HXFB 5M2QA 4XWKA 4ZU1X 3D43A 1ETUA 1M2VA 3W9BA 3RSLA 3QEJA 2VDPB 2WWWA 4QBGB 3IAEA 4Z54A 1YZ3A 4CMEA 1Q6HA 4PYOA 3CPQA 4QREA 4B7XA 5I47A 5E6SB 4O33A 1KU6A 5C3UA 5FLXA 4BJ3A 5JPCA 1IZ8A 5J5AA 3FSRA 3SGIA 3DEZA 2PZLA 2UZ0A 4C06A 2RGDA 1PSDA 1PJCA 2QMQA 1UKAA 2PWPA 1I2ZA 3EW7A 3Q5DA 2NSHA 4NC9A 5J4HA 1K0FA 4LWPA 4NCAA 3IBGA 5CVUA 4UCSA 2GRUA 4JAVA 2X58A 2PK3A 2J9FA 1E18A 3W8EA 2JJ1G 1C50A 4OJKA 4P4SA 3EXHB 3GRAA 3OHSX 4N7MA 1YJNV 3AZQA 2H1SA 1NF2A 4UTZA 2XQIA 3UHAA 5JYEA 5ALIA 3K8ZA 3I6BA 2P5YA 2Y76A 4YMLA 3JVVA 2JAHA 3UF0A 4LWOA 1GP2A 1EVZA 3HDQA 3Q3VA 2R6R1 2HHCA 4HNTA 2FXIA 2YZNA 1TGVA 4HWRA 2QE7A 1LBSA 2IDMA 3JQFC 1JI3A 2Z1MA 5KSWB 3RC2A 3NDJA 4GPAA 2G63A 3EISA 3ZH9B 1SXJC 4DLKA 1MT3A 1XVTA 4REOA 3VR6D 1YSCA 2PEYA 3ZYCA 3BAFA 1O0BA 2VAMA 2Y1EA 3EPJA 2VDQB 3IHKA 2R8RA 2NW6A 3GFRA 1NTMH 1J2RA 1SCNE 3F8TA 5JMTA 1IHXA 3VR6H 5F2EA 4MWEA 2QW1A 1UEJA 1XZLA 1JR4A 1PR2A 4M89A 4BMSA 3T1CA 2Z4SA 3DZCA 5BW5A 2FY8A 5B1IA 3O8DA 4FMTA 4RSGA 3QPDA 4PSDA 4MVOA 2Z83A 2QKYA 1U4SA 1CK4A 3PRKE 2YXPX 2GNOA 4YRBA 3E7PA 1J22A 2NYVA 2PUFA 3UFBA 3M6WA 2WLLA 4QPJC 4FPPA 3L0YA 1Q1BA 2V7QA 3ANLA 1OT5A 4ECAA 4LF9O 4OVKA 4QARA 2JFNA 1ROPA 4CH5A 1M8KA 2YQ4A 4L87A 2V8OA 1Z6AA 3HB3B 4MULA 4LNHA 4BQSA 4DC1A 2MSCB 3VPFA 2V6MA 5DGTA 2YUIA 3IA2A 3GVIA 3GCGA 4H7IA 2BOBC 3MBIA 3QA3E 4DJEC 4M7WA 5T8KA 1ZX1A 2PN1A 4F60A 3GLHE 5IX8A 5FORA 5I3ZA 1IUPA 3FF4A 2HMVA 1I5RA 4RVCA 4OXNA 4DR3B 4DV3B 2HSWA 4HS9A 3ZZ0A 3GYGA 5AW5A 2YN0A 4O2LA 4AY4A 3OQOA 5DM0A 1BXRB 4LRWA 2QE7G 1T5DX 3DFZA 1AV6A 3LVQE 1LH0A 3DZDA 2MR5A 3B1VA 4ZO8A 3B9QA 3AR6A 4I55A 4GZRB 2PM8A 1NRIA 2F1MA 4QECA 4M98A 3KIPA 3ZOZA 2Y1WA 3L7JA 2I4RA 3ROXA 4UNSA 2D1YA 2RGNA 5C3MA 2OMEA 3L79A 3L9DA 2IOFK 2Z3WA 1BXKA 3RHZA 1LX7A 1LW6E 2QI2A 1XXHA 2PQMA 3WLAA 1GL3A 4BY9D 4LIPD 5JSYA 2QAGC 3WYCA 1IXKA 4M1MA 4KQ6A 2FPGB 4W7HA 3VOSA 3PNQA 4DYVA 1TF5A 2XWPA 2BKLA 5JH7B 2C9ZA 3HABA 4W6QA 4K9PA 2C7BA 2WJHA 2HSJA 2JCBA 1Z34A 3OURA 5IMSA 3PQ5A 3MJTA 2V7QG 3FRIA 3C6YA 5DYYA 4ESVA 1O7JA 1DX9A 2HK6A 1MNAA 2ILVA 1CR4A 3NONA 3LWOC 1PW5A 5JJLA 2EJBA 3U61B 1CEQA 1SCUA 1BAPA 2NO5A 2XV1A 3L1VA 1DX4A 4MVYA 4ZYZA 4WLEA 4ALNA 1N8RH 1LK0A 1AROP 1JG3A 4CNQA 3VC3A 3NNNA 1IUKA 3UC5A 4JI6B 1NR1A 1QFJA 1VYHA 1FZQA 2AV6A 2ZRBA 5G53C 3FM9A 2H2DA 4V3BA 3SOPA 4J7KA 2PVPA 5AOVA 1M56C 1LKZA 2D0PB 4QTUB 4AP5A 2IZ5A 1L8QA 1RABA 4PZ9A 1MQ8B 3H1PA 3DZBA 1C1HA 5K3OA 4CMHA 2AGVA 2ZYHA 3ZXUB 1FU8A 2FRDC 2I2WA 2OFXA 1V2HE 2CUKA 5KQSA 2BFWA 4N41A 1YJBA 1RZUA 2SCUA 5DW3A 3K5OA 1E92A 4LBWA 4BEWA 5B1BC 3SYRA 3VR6A 1ADBA 3DUFA 2A67A 2WWYA 5H81A 2H9AA 3OTIA 3KQMA 2QWRB 4RQOA 4V0SA 3HBJA 3HUTA 2AJDA 1FUEA 2R0QC 3SDSA 2ZM6O 3JZDA 4JTCB 4EFMA 2W2PA 1QX4A 3KWJA 2JKYA 4MA5A 2H1OA 5DGDA 2PRSA 3EWNA 3T7TA 4O4HF 5EP4A 1E62A 1VC2A 2XVMA 2Q2WA 2XPCA 3L4KA 3C1OA 1J95A 3AHHA 5L4LA 4EPYA 3SHQA 3LCCA 4O6VA 2RCYA 4K3AA 5HJ5A 1NSYA 2GBLC 1YVPA 3DMGA 2C1ZA 4DVGA 4D6XA 1JI0A 3QSGA 3ZCSA 4L8JA 4BB0A 1GZ0A 4KXYA 2GKOA 4F4JA 2H1HA 4YJGA 5A2GA 4KXNA 1MG1A 3T41A 1SWVA 5PGMA 4JKOA 3A2FA 1TAHA 3GGSA 1RE0A 3D64A 3G6EV 3VV2A 1LTQA 1P2BA 2JIZA 4XM1A 5IF9A 3SF8A 2I7TA 4XFDA 4JVNA 2Q3DA 2XHBA 4QJIA 3K5HA 2PD3A 3QJGA 1YDWA 4FIZA 4QUKA 4EO4A 2HRQA 3VTKA 3OEHG 1CUIA 1UDCA 3SBXA 1EZZA 4G01B 2I6FA 5ALPA 2WSIA 2X4GA 1SRQA 3VPAA 3RHSA 4DXDA 5BV0A 3MNFA 5ABPA 1OBHA 2QMOA 1WQ3A 1U3FA 4D0LB 4S04A 2WIJA 4C3ZA 3ESZA 5KHIA 3TGUH 2PJUA 1W57A 4CL3A 3ZCRA 4YV1A 3IUBA 3CW9A 2W37A 2QVZX 3CRW1 4QELA 5TISZ 2VJQA 1E2JA 1T25A 2O3QA 4LYAA 5EIXA 3E9MA 5FAXA 3F5WC 1AB3A 1P2TA 1XMOO 5HX7A 1PI3A 2ZP1A 1R3LC 4RTMA 3LC1O 1G8FA 1MOZA 5B30A 3IR6A 4I1IA 5KAPA 5BSFA 3SWWA 1WHTA 1W2WB 4JFRA 3OJFA 4ZYTA 4KGDA 3R5TA 1U2RA 1C8LA 3S2GA 5AVOA 1VI5A 3IELA 4RGVA 2XCRB 4WEOA 3BRSA 3C45A 3VDRA 3KJNA <