5GONB

Structures of a beta-lactam bridged analogue in complex with tubulin
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent Antitumor Activities and Structure Basis of the Chiral beta-Lactam Bridged Analogue of Combretastatin A-4 Binding to Tubulin.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 169
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5gonB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5gonB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5gonB01
5JH7B 3HKBB 3HKDB 3JARB 3UT5A 5JCOA 5IJ0B 3RYFA 1TUBB 4I55B 4I4TB 2RHOA 4O2BB 3E22A 4DRXB 3ZIDA 4IIJA 4M8IA 5GONA 4O4JA 1FFXA 5CA0B 1TVKA 4ZI7A 4WBNB 3HKEA 5CA1A 4DXDA 3JAKA 5LA6B 3N2GB 3VOBA 5LP6C 4HNAA 4EB6A 3JAWA 3VOAA 3RYIA 4F6RA 4EB6B 5ITZB 1W5AA 4X1KB 5LA6A 4FFBA 4O4HB 4YJ3A 3N2KB 4TV8A 3RYHA 4XCQA 3JASB 5LYJA 3JATB 5LOVA 2XKAA 4TV9A 2BTOA 4O4JB 2VAWA 3HKCA 4IIJB 2RHJA 4EI7A 4DRXA 4O2BA 5IJ0A 5LOVB 5EZYB 3JASA 2VAPA 5KMGA 3WGKA 4TV8B 4FFBB 4O4HA 3RYHB 3CB2A 5JVDB 5EZYA 2BTQB 4O4LB 3VO8A 4HNAB 3V3TA 3JALA 5EYPA 5BMVB 5IJ9A 1JFFB 3M8KA 3ZBPA 4TV9B 3HKEB 4O4IA 4KWEA 1TVKB 4EI9A 3JATA 3WGMA 1FFXB 5CA0A 2GVIA 1W5EA 4YJ3B 5JCOC 5BMVA 5EYPB 1OFUA 4E6EA 3JALB 4X1KA 4I4TA 4F6RB 4O4LA 3RYFB 5ITZA 2VXYA 3JAWB 3JARA 3HKDA 3UT5B 3RB8A 4I50A 4LNUA 5FNVB 5JVDA 3M89A 3JAKB 2RHLA 4EI8A 5KMGB 4ZHQA 5C8YA 4WBNA 2RHHA 5LXTB 5LP6A 4B45A 5GONB 4X20B 4IHJA 2Q1YA 3HKCB 5MN6A 1SA0B 1SA0A 2XKBA 4YJ2B 3RYCB 3WGLA 5LXTA 1W5FA 5LYJB 5J2UB 2R751 5MN4A 5MN5A 5C8YB 2R6R1 3N2KA 4ZOLA 1FSZA 4X1YB 1RQ2A 5IYZA 4TUYA 4X1IA 5EIBD 3WGNA 3RYIB 4I50B 4LNUB 5FNVA 2VAMA 4O2AA 4U3JB 1RLUA 4B46A 3VO9A 5EIBC 3N2GA 5J2TA 4X1YA 3VPAA 1Z5WA 5CB4A 1Z5VA 4ZOLB 5KX5B 5CA1B 3WGJA 4ZI7B 4U39A 1RQ7A 5J2UA 5JQGB 5JQGA 3R4VA 4O4IB 3ZBQA 5KX5A 3RYCA 4YJ2A 5CB4B 3C8LA 5M7EA 1JFFA 5IJ9B 3E22B 4IHJB 4X20A 5J2TB 1TUBA 4I55A 5LP6B 1W59A 1W5BA 4O2AB 4U3JA 2BTQA 1W581 3HKBA 5JH7A 4ZHQB 4TUYB 4X1IB 5IYZB 2Q1XA
chains in the Genus database with same CATH superfamily
4ZAFA 1VMEA 3ZH9B 4KFMA 2LKCA 4EUHA 4XIIA 2HDWA 3BDVA 3N86A 2ZRIA 4CM6A 2FPIA 2BSXA 1AKNA 1QRDA 1MG0A 4QAJA 3LP5A 4QGHA 4ACAA 4BNMA 1W35A 1VHJA 4CW7A 1ZWKA 4GE3A 3IEKA 3QU7A 2HPZA 1H2YA 1J6UA 4ARAA 4QDOA 4TWAA 2DE0X 1BL8A 3CBQA 4NR1A 2ZI7A 1Z45A 1NBMA 5DYWA 4D4IA 1F4MA 2QM4A 3GCXA 3I76A 4J2OA 4ZVVA 5A62A 2GEBA 2RH4A 2V97A 3C41J 4B32A 3SC2A 5JZ9A 5LGNA 4J0HA 3DM5A 3V32A 1SHTX 4LRUA 4OIFA 2ZODA 2HVYD 2ZAMA 2Z8ZA 4DV5B 1E4EB 1W29A 4NWOB 1JFVA 5G40A 4ER5A 2BAGA 3S2YA 2HWWA 1EGMB 4J41A 2RJOA 4JBLA 3OW2U 1LPPA 3DVAB 2ZDIC 2GESA 3VDXA 3H1TA 3ZW7A 5JNTA 4RS3A 3MCAA 2EWWA 2D6FA 5J58A 3BMCB 4URYR 3EXHB 1U0SY 2XZLA 3MTDA 4M1ZA 2HU2A 5JBQA 4TQUS 2AZ0A 2Q3CA 2R6ZA 3LPMA 1E63A 1QRAA 4S1PA 3TZKA 3ZUPA 4CMJA 1VG8A 3WAJA 3OQPA 4HVCA 1DAGA 4C4ZA 2NZ2A 1BXZA 2I7DA 2ORVA 2GPYA 2QQEA 3IMPA 3RWRD 4L8WB 5KTSA 3T9AA 3MJFA 4LY3A 5K0LA 4DLWA 3DBHA 4YO7A 2H1SA 4B3MO 3IFSA 3TLKA 3D2CA 1YBAA 1D2GA 2OTLV 4N0DA 3V8MA 2L6LA 1E3SA 3CCSV 4LAFA 2DOSA 1LJ8A 1ZS9A 2Z30A 4GVXA 1Y9ZA 4GGMX 4ZOEA 4OPAA 4QSHA 3PFFA 4CM1A 3O9ZA 1KAGA 2SBTA 3NWJA 5B12A 2LBTA 1N92A 5K0ZA 1QVVA 1E9RA 1I9GA 2JIPA 2FZLA 2OQRA 1JKFA 3O2NA 2EKPA 1UMDA 4B3IA 3EEOA 1P2VA 4MPTA 3HZOA 4YAFA 4LJ8A 3ZH2A 2G82A 4WLUA 4JC0A 3A4NA 4FK5C 2RKOA 4GBED 5JJIA 2J67A 5I3CA 3LSUA 3N2LA 4E31A 3PQ5A 4FR2A 4ZN6A 2DWCA 2O8DA 1IZ3A 3C3WA 1R3IC 2CWJA 3EUEA 3IUPA 4KO8A 4B79A 1QD9A 3MEQA 2P4QA 1NRIA 2Y68A 3LYLA 5CD9A 4G65A 2DB3A 4M3NA 4GYKA 1FTGA 3BHMA 4PZDA 4Q03A 4F9GA 1QONA 1RHMA 4X1YB 3QPCA 4MINA 2ZRDA 4RESA 2WVGA 3ZDBA 1E98A 2C8LA 1MT0A 4L2IB 1SY7A 3CXUA 2IHVA 2NN3C 2AD1A 3DB2A 4RZSA 4PG4A 4ZU1X 1AI4A 3DZFA 4RK0A 5J2TA 2QRNA 1MNQA 2V98A 3CD6V 1D2HA 2PMWB 2II6A 4PYIA 1EZVH 1I1HA 4IG4A 4GBJA 4JKIA 2C95A 4MYSA 3UJPA 4EKIA 2GZ2A 1R0YA 1Q83A 2YJGA 3L79A 3U9TA 5I7VA 3U7QB 1YRYE 3HA5A 1L7PA 1B8VA 3FTNA 3FD5A 2HADA 1RM0A 2JH8A 5EEGA 5EQTA 3V2GA 1XK6A 4C0KA 1NF3A 1M34B 3IQHX 2UYKA 1SZJG 4UMFA 3RS5A 2FG5A 5DIFA 2I6RA 4BO0A 2DF8A 3G9ZA 4I99A 3N8IA 1XD8A 1Y8RA 2NO1A 4PYMA 2WB2A 2MYTA 4Z4EA 4DMKA 3BORA 3C3PA 4LJ4A 4DLUA 3BMQA 4O63O 2C8JA 3IVRA 1D4AA 5IKOA 3RJ9A 1L4FA 4MKIA 4IGFA 3EIEA 5CJJA 1YJXA 4MUFA 4QPPA 1ESNA 1NU1H 1K89A 5CA1A 1KFCB 1MORA 4Z0TA 1GEGA 1R7RA 2I4OA 1CFZA 2OENG 3U31A 3IEIA 2UZ1B 3FNGA 5K8IA 3WWZA 3P2OA 2G9NA 2PFGA 2QN9A 2LP4Y 1VTKA 4XYEA 1JIIA 5D3ZA 2P5TB 4MS2A 2HLDD 2AXPA 5LKAA 3IKTA 1BEEA 2B4YA 1U31A 2IE8A 4MJLA 4MPPA 1SCIA 2WMYA 5FOSA 4YMTA 4TGLA 4YPOA 1X7WA 3R8FA 1GAJA 5G1OA 5LYJA 2B4QA 2IOFK 1JYEA 4WOBA 3CUEF 1Y1RA 1WUIS 4ASUD 5FIUA 5E0KB 3TKLA 1SMKA 4RQFA 1QH1B 4ADSG 4C2TA 2OLJA 1CRPA 4QJ5A 2AUNA 2BGTA 3E15A 3NBQA 3ABLC 3QTLA 1QANA 3IVGA 4G1VA 3L6UA 2CH7B 4EA7A 2XI4A 1ECFA 1MB4A 1NSTA 2VHYA 1NKVA 3K0KA 4RSMA 1R6TA 4FQ8A 3COVA 3ZQKA 4X45A 4BX3A 1U8CB 1IYZA 4WT7A 4EJ0A 3SIPA 4QDZA 5DGCA 5CITA 3K3PA 5CDFA 5KUKA 3FNHA 1Q81H 4OOEA 1NT2B 1GGKA 2MW2B 2I1VB 2OGSA 2A9RA 3GUUA 4G2NA 2BW0A 5FWXB 1Y4MA 1PW7A 4YJ2F 3RT3C 2AN4A 3ICXA 4BY9D 1OLUB 2XAAA 1DBSA 2IP4A 3OOWA 3ZLBA 1AV6A 1GM8A 4DIKA 4MWBA 3VMFA 1PBNA 1QB7A 4AWBA 3LNMB 3NBKA 5EWMB 5DTIA 1T0HB 1K7SN 1SPBS 3RTBA 3ZWBA 3CNBA 4NSNA 3TEJA 4DNPA 4CDRA 2Q50A 5LM3A 1AVTA 3OQIB 4D92A 8MHTA 1TPZA 2EZ8A 1E1KA 5B1OA 4C7VA 4LDJA 5UKDA 4XB6B 1ULTA 4LHSA 4UUAA 4XZ3A 3EYAA 1DG9A 3UQ8A 1NUQA 2J3KA 1Y8ZA 1F0YA 2BWJA 4BLUA 2RDMA 4ETWA 5CT4A 3TFOA 3C3TA 2JHGA 4J75A 4GYJA 2HSEA 2Q1YA 3I2YX 3D54D 3BB4A 3I2IA 4EYEA 4R6XA 5F3DA 5FBZA 2ES4A 5JFOA 5JWRA 8ADHA 3PFIA 2AH5A 1Q0HA 1FNCA 1VL1A 1DBRA 2WT9A 2UV8A 3GT3A 4O25A 4R0VA 3PUHA 1NBMG 1ZYUA 3KYCB 3WLFA 4CFYA 4AMZA 1QAQA 3V2HA 1R1DA 3EGDA 4NK4A 3JQAB 3WNQA 3MLEA 5LB2A 5IN5A 3TRKA 2OIGA 3DL7A 3ORSA 3THWB 5HP4A 3H1IH 3O8QB 1FXKA 4NOJA 3ZGYA 1V16B 3IAXA 6ABPA 1MSDA 4UXHA 3K5PA 4R01A 5KYUA 3A1EA 2OV4A 5BV1A 4AYTA 4CT5A 3OT4A 1KO8A 5EKTA 1FRQA 3AKEA 3CC4V 2WFMA 3AR6A 2HGZA 2WFAA 4CT0A 3H2ZA 4G67A 1VK3A 1BGXT 1H2XA 2X8BA 1ZD2P 1QOQB 2A1TS 3G8AA 4ND7A 4PHFA 3RVSA 2BMJA 4ZVSA 3O73A 1XZPA 2XEDA 3TEMA 3K9HA 2EFCB 3AYZB 3RTEA 4EUFA 1VF6C 1XELA 2VTEA 4LK3A 3HDVA 2MOKA 3N0VA 4JZYA 2ZRJA 4B9AA 4XGRA 4UM9B 2GSDA 4ID9A 4NMXB 1UPFA 5AHWA 1OX5A 4LF4B 3O92A 3U44B 3HXTA 5IN4A 4GL4A 3OZ7A 3B1FA 5SYNA 3HKDB 521PA 1GRNA 5JT1A 3K30A 4BLRA 2HIHA 1WCIB 3EVDA 1CFJA 1MHPA 1AKEA 1H8HD 1I6WA 4I9GA 4KWIA 2V7EA 5DO9A 1Q11A 2YX1A 4C6TA 4DV4O 2IG8A 4HRAA 3RV3A 2EIMC 2OM6A 1TZJA 2DP4E 2QZPA 4MP3A 1I1QB 5A6SB 1SHJA 3CVOA 3CUTA 1MDBA 3CR3C 5AJTA 1YIAA 5KAPA 2HBYA 2RBKA 3WK5A 1C1XB 3FDFA 3FETA 3PC7A 4UV8A 5DK4A 1PEDA 1UZUA 3DXRA 1YZKA 2AHRA 4OREX 1E7YA 4LP8A 5AWFC 3NI2A 5HRCA 1FDOA 1QO0D 1DQPA 1AA6A 3Q1LA 2WWFA 1XRGA 2VHCA 1CV2A 5TDHA 1P9LA 3U80A 2XZDA 2PSHA 3RSFA 2Q9AA 3B60A 3R7DA 3TXYA 3O9OA 1MV8A 3I8SA 1O0BA 1BRTA 5C1OA 2GTPA 1B8UA 2QRQA 2X4IA 5DNYB 2WAYA 3ZV5A 4XM1A 1TQHA 1UMCB 4Q39A 1QBGA 4H17A 5CRIA 4DA9A 2XUQA 3TIXB 3LO8A 4IICA 3JASA 1Q5OA 5KMGA 2RCYA 2W0MA 3H4MA 3IVMA 4ZI2A 1ORRA 3JSLA 1AD2A 2JBWA 5IKXA 1Z18A 3C3KA 2FZ4A 2DSNA 3WK7A 3CE2A 1UZNA 3LSYA 3UPUA 2ZBPA 1EN6A 3ANMA 1IB6A 1FS4A 1UADA 3WLPA 2JJ2D 3GROA 3PEFA 3HXMA 2FJPA 4FOPA 4PR0A 2QMOA 4OQQA 4Y6QA 5EKDA 3AGKA 2OGZA 1ZTEA 3PF9A 1UC4B 1FYVA 3MIIA 4MIYA 1W75A 2H8KA 2ZT5A 3ZWVA 1ZHOA 2C4TA 2DR0A 2W2KA 3EW9A 3F8SA 3HBNA 5FYQA 2Z9DA 3R9IA 4LG1A 2IOYA 3LT1A 1WCIA 1X38A 1YFZA 2C2XA 1V2GA 3PHJA 3RQSA 3ER8A 4RV9A 2PSJA 3I5YA 1N2JA 1GNSA 4HLQB 3NMUF 4X44A 2WUDA 3JD4A 3F5WC 4BT4A 5T6MA 4MW4A 3WYDA 4TYWA 3HTXA 4K6KA 5BVHA 4KHZA 3F9RA 5CLFA 4X65O 2A5JA 1PFKA 3CWCA 5FBLB 1V54B 2GR9A 1GUYA 1SUAA 4BU1A 4F56A 5BWCA 4FM1A 1T8YA 1VE5A 1Y5MA 4L9WA 1GT6A 2XEXA 5K8TA 3FDIA 4MA5A 1ZH6A 1L5FA 2R6HA 3GI1A 3IQZA 3HWSA 4LE1A 4OXQA 3R7NA 4E21A 4YX9A 5MGNA 5LQNA 4KQHA 3M34A 4POOA 4WNIA 4DA4A 1US6A 2WHXA 4IRXA 1HE3A 3CLTC 1GXSB 2XITA 2VDWA 2ZQZA 5CW2A 1LRJA 5DLYA 5IAEA 5ICCA 2JVDA 4CCWA 2QLBA 2V9CA 1NTOA 3B38A 4QDTA 3IJEB 1FSSA 3TLJA 1VL2A 3NHYA 2IHYA 3DWGA 1W52X 3LS2A 4KO4S 4R69A 3FVQA 1U96A 1ODEA 2FZVA 4RMNA 1K3FA 2ZYWX 4B5CA 1T0KB 1PR2A 2YFHA 4XJTA 2FC3A 1LZKA 4PPQA 3ET4A 1S9DA 1KQ3A 1P77A 4K8XA 1N8TA 2VH5R 4PZEA 5M2QA 2TMKA 4Q9JA 3W6ZA 1L7RA 3QWAA 3B2EA 4EX6A 2EIKC 4ZVNA 3OX2A 4Q1BA 5KQRA 1II0A 3T06B 1DJPA 3VNUA 1SC1A 2PFSA 5BV2P 3IP5A 2YMPA 4F2HA 4YMGA 4Z99A 1W4RA 2GJAA 1R4MA 4I81A 4NL4H 1PYDA 2NVOA 2DN9A 2HIGA 3G1UA 2DTXA 5AM5A 5L3RA 5CXQA 1DFGA 1YDMA 2TMGA 2KTVA 1TVMA 1DLBA 1VPTA 3A6LA 3HV0A 1OCZC 6GPBA 4RULA 4D26A 2DBRA 3KYBA 3PUJA 1Z4LA 1UIMA 4UHCA 5K3FA 2XUZA 3CVJA 4YXWA 3ZHSA 4PIMA 4FNAA 4LZJA 3UKJA 3P8ZA 1W73A 4S2UA 5A3SA 3IMFA 4K9OA 1OWNA 2IYTA 4OPMA 5EMNA 2IQQA 2EZPA 1OFHA 5T4BA 4HNAA 2PUVA 3KM0A 3OECA 3D8UA 3O1IC 3ZEAA 4YUWA 3S03A 2X0LA 1NFRA 3MFQA 1OAAA 4XQGA 2A79B 4MLPA 1U40A 1K3UB 1R15A 3DE6X 5F76A 5LA6A 4DMCA 4CLEA 2H00A 2BSQA 2WLIB 1CD5A 5AXAA 2C94A 2QIOA 2O5CA 1S1CA 5F35A 3MCZA 1WB7A 3KCXA 2KLHA 1IZYA 3NDBB 5BY1A 2K5UA 1T10A 4W7HA 1DC8A 1S0UA 4BY9E 1M2JA 3I56V 1BS1A 2WTUA 4GT1A 1UAGA 2JCYA 5JZOA 2IUTA 3D54A 4II2A 1JHPA 3QMPA 3ABSB 4ZCMA 2AKAB 3OCJA 4L73A 3GVCA 2O19A 2NU8A 4N39A 2O3UA 4UB8Z 2L0XA 4WUVA 1UXOA 1R8XA 5AJHA 1I2MA 4YASA 1KMIY 3G71F 1PR3A 1G2QA 4YP1A 5FLKA 1BU5A 3U81A 4RSGA 1MOSA 2F8SA 3C48A 1N0WA 3FCUB 4HN2A 2FSGA 4D3DA 5IASA 1O03A 2C9BA 1IOWA 1JALA 5B3SC 2BL4A 2FWAA 2FWIA 1O5OA 1XRLA 4FU0A 3V9PA 4IYIA 1FK8A 4GC5A 1R9MA 4BWYA 4HDMA 2CLKB 4OQEA 4BBPA 1WHTA 1CUZA 2NVUA 1P4RA 4BASA 5A5GA 2Q5IA 3FYUB 3JD3A 3KTAA 4EA9A 4MAMA 1FLNA 4POAA 1DCFA 1RZ3A 4W1RA 1EBFA 1RABA 5H83A 1T1IA 1UZAA 2CLHB 3ZWPA 5KYWA 1XSEA 1E5VA 3P9KA 4AF6A 2F3TA 4Q3CA 3ZIAD 5GV7A 4P32A 3VUFA 5FNVB 3IOBA 4W4LA 1IURA 4M9CA 4NYJQ 5CDHA 4LZZA 1U5CA 4DXWA 2BMAA 5CT8A 2YN0A 3A3OA 1UMKA 3B7WA 4I2NA 4PGMA 5COBA 3GGCA 1VMAA 2ITDC 1BXKA 2WTMA 2JGLA 1PVDA 2IEIA 3AGPA 4LXXA 5CP8A 3LUGA 5FB3A 4JTDB 2X0JA 2XTMA 1X1EA 1J25A 3PXUA 3MMNA 1XMSA 2ATEA 3O4GA 1DXOA 2QL5A 4QBFA 5FJJA 3RWBA 2O2YA 5CB0A 4AD8A 2JASA 3LBFA 4K7JA 5CYFA 4B6RA 1TI7A 4H6WA 3I9MA 3JQ6A 1KK1A 4JJ6A 1T13A 1G7TA 2QZJA 2XCIA 4G5SA 3HY3A 4P7GA 4TS3A 5K0JA 4ODIA 3K71B 1UQRA 3PG5A 4YRRA 2G4VA 3ORHA 2DAPA 1NBEA 3U39A 3SICE 3Q72A 2JLCA 2JK1A 2Q3DA 1FNKA 3KJKA 3LKDA 4IL6Z 1GZDA 3G1WA 3TSAA 5J4KA 3V1YA 4BVLA 2P2ZA 4R1MA 4ZXPA 1Z63A 2WALA 2GK6A 2R86A 1CE8B 1RI3A 5JAQA 1NC3A 2IDJA 3EARA 1RRVA 4LE2A 1IG3A 1KU9A 2PRYA 3UW3A 1XI2A 2WV7A 3JV7A 5JAUA 3FOCA 5HQTA 4ER6A 3SX2A 2YXDA 4I2VA 1XX6A 4S2EA 4E46A 1H47A 3CO0S 4F72A 2A5YB 3RC9A 1DV2A 1F2VA 2OCAA 5BV0A 1DEHA 2G3YA 3QK7A 4Y67A 4M98A 2XBMA 4W5HA 2HS4A 5DTQA 3UHJA 1CLIA 1K8YB 2PU7A 1F8FA 4C3ZA 2QKYA 1DO8A 5LDGA 1Q6UA 4MVJI 4ALIA 4CCSA 4UMEA 1TADA 3IEQA 1SVKA 2HDOA 3FTQA 1EFPB 1DKMA 3FHJA 2NO7A 4RPKA 5DNAA 2JEXA 1D9XA 1AZTA 1XTKA 2NO9A 3ORYA 2R8OA 4QLOA 4C7BA 1C7QA 1SCUB 1VB5A 5JJ5A 1YDFA 1YH3A 2PPVA 3EQ8A 2Q3EA 1AUQA 1OOEA 3R5FA 2MR6A 3WLHA 1MO4A 2H7YA 4Q9KA 1OYYA 4WOCA 4YMSA 3N58A 4MW5A 1ZMOA 4PGFA 5KKAA 5TNXA 3T7KA 3WC4A 4BWFB 2B4KA 2P41A 4WLEA 5AXDA 4DR2O 4N3AA 4BLSA 1YVEI 2XHZA 2P65A 3AK4A 1LI7A 4M1WA 1UQTA 3UK0A 1YI1A 4HXFB 2WT4A 3K0GA 3EDQA 1E2EA 5B66Z 2ZXWC 1M93A 1BFDA 4L76A 3B36A 1RWXA 4N5NA 1H65A 1OH8A 3THYB 1X25A 4B0PA 1R5BA 3SZMA 4NTXA 1RYEA 5EUMA 1XRQA 4BTVA 1E8DA 2PY6A 1E4EA 1PP4A 4JI5B 1LLQA 1OU0A 1LDNA 2FQ1A 2Y1CA 4X8AA 3K2BA 3PDWA 4LDNA 1G19A 2E5WA 3LWPC 3ROGA 4XWAA 3OCXA 4IUDS 4QXOA 3K09A 4BZZA 4EP1A 3AHFA 1DK1A 2QG4A 3FI0A 1IZ7A 3SIXA 1O95A 1Q90D 1NP3A 1QQCA 3E9NA 1NW6A 1ZHFA 2EAUA 3PUXA 4Q82A 2OD7A 1OF1A 1XRRA 3C3DA 3MOGA 3SHFA 4O02B 3PR1A 3R9WA 2GVIA 3MQWA 3B2EE 3ZS8C 3KEQA 4LNAA 4MGIR 3QKRB 1EWVA 1SOAA 2YBDA 3F6SA 2VF5X 4R8RA 4GLXA 2FPIB 3O8DA 4R5HA 1K9MH 2XNJA 5G41A 5GINC 2B4TO 4W63A 5JHHB 2QDKA 2YQZA 3L4SO 4KMSA 2HT1A 3HFJA 1V54C 1NQAO 3G59A 1F7YA 3I37X 4J91A 2D3OW 1DKOA 3BIJA 4G84A 2YINC 3LWQC 3EFEA 4J42A 3OCVA 2F9ZC 3HJWC 3E23A 2GI4A 2B8JA 4ZQEA 4WBNA 3ZWKA 4L4XA 4RTJA 3EXG2 1KDPA 4M60A 1T34A 2QUIA 1EX9A 1F48A 1GTL1 1EINA 3FZGA 3LMEA 1GDDA 1VHQA 5TJHA 4URFA 1FYWA 3UXEA 4IYHA 3D6NB 3WKDA 4GGPA 1BSVA 1ZLZA 4FFRA 4J1TC 1ZICA 3RC8A 3KJNA 1P80A 1S8AA 5J4LA 3UGJA 1FP1D 4J16C 5CAEB 3KZMA 1FRNA 4H1WA 3WOVA 1ILEA 4J03A 3KHSA 3MXOA 2RB5A 3LD9A 3MW8A 3DE5X 4UBKA 3MGCA 1VA4A 1L8LA 1X6VA 1QAHA 1JXAA 1AK1A 1NRXA 1JG1A 3GO4A 3N3AC 4J0EA 5YASA 1RA4A 1QVZA 1EZ4A 2QPOA 1ZW6A 5E6SB 2O2EA 3W90A 3L1IA 5FTMA 1SWWA 4K0KB 2AOTA 1T3HA 2CJWA 3E7DA 4HDCA 3E2IA 5FI5A 4CCYB 5LIRA 7MHTA 3THXB 3E86A 2J07A 3A14A 4GBMA 4DLAA 1KVTA 1OFIA 5A4KA 4MB2A 3EEQA 2RIPA 4FWBA 4MDEA 2R4QA 1JHZA 2A35A 2YQ4A 3LG2A 5B1BB 3V7QA 2QG6A 3FB5C 1J8YF 1XD9A 1PM9A 2QVBA 1KAOA 2IBMA 5I9SA 1TT7A 1VQOF 3OE7A 5F9HA 1IN4A 3CYOA 3EVFA 3KWFA 4YQEA 1OD6A 3R5JA 2RI0A 4O59O 4R7ZA 1U3LA 1RPJA 4ZYXA 1G6KA 2WILA 3UAGA 5T4EA 4IIBA 3J81A 2PKYX 3LRPA 3VYTB 3WB2A 1HDYA 2FCAA 5E6RA 1VEWA 4IIJA 3B53X 4DWJA 5BR1A 3PDHA 4KN9S 1IEVA 5A5EA 2B9VA 2F3UA 2GYUA 3DF9A 3IPRA 2PXHA 4N0MA 3W2FA 4A1FA 4JVMA 2B3TA 1A5BB 4I4TF 4LRTB 4AX4A 4C7JA 1GPLA 3KBBA 3BICA 1BS2A 5BV8A 2FMFA 1PLKA 2BKUA 4MPDA 4Q7QA 3GLFB 1ELOA 1W46A 1MABG 3NRJA 3SF8B 3WGYA 4WZAA 1SXIA 5LZ8A 2NO4A 3O8RA 1SVMA 4O2AF 3QG5A 3ZKAA 5F7OA 1H9CA 1JR3D 1ZVKA 2WP8J 3KB8A 3JWEA 2QE7G 3I30X 2WIJA 1TC2A 2BCJQ 3GRVA 1VGQA 2OBNA 3PXCX 4HWSA 3U3KA 5KUTA 2WLKA 1BKDR 3MRXA 3P9NA 4O4IF 5CNMA 3VSCA 3WGTA 5HJEA 4C0HA 4BVGA 4XTRA 1XEWX 2IBTA 3BL6A 4FM0A 1GU0A 3HLTA 3W3AA 1ZJ6A 2R2GA 2XVXA 2YUTA 4MIKA 5IJ0A 1A2BA 3X1MA 3X3HA 3A8TA 3LP8A 3FB4A 4QGPA 4TV8B 3ZOPA 2NOAA 4MUHA 3REOA 1E1NA 4KUEA 4ITRC 5ADVA 1Z6XA 4RTNA 2GJ9A 3JYHA 2IU4A 4L08A 2BCCH 1EM8B 1UXKA 1XCGB 2WHPB 3AFIA 3EIUA 1UOOA 3K4PA 4NQZA 4AJOA 4F04A 3IO3A 5FWNA 2WAMA 5I9NA 1KSFX 1M6VA 3C6BA 3CQ9A 2C61A 3TG8A 1WKVA 2B0JA 5A6SA 2JGKA 4XA8A 3T41A 4PO8A 1IV4A 2D5AA 2ABWA 4TS1A 2QTTA 3U4DA 4B6FA 4EJMA 2BM8A 1LS1A 3MT8A 4FHEA 5L53A 2OP0A 3Q7IA 5CT6A 2J9ZB 1Z2EA 3QIVA 5DI9A 5HDBB 3RVDA 4DABA 1AUPA 1P73A 1QR2A 2OSVA 5E7JA 3UH1A 2WU0A 3STHA 1JU4A 4LE0A 1HDGO 1FUUA 2A0XA 3C9RA 1T2VA 4MTXA 4D99A 1KIMA 5IHPA 4HEJA 3U1TA 2I2XB 3BA6A 1BCCH 3DH0A 2WF5A 3BH6A 3STTA 3F8TA 2OAQ1 4FR0A 4OMFG 5BT8A 3IQDB 1D0IA 2BSAA 3I4CA 1V55B 2ZT9B 2SECE 1BA2A 2ASEA 3A9TA 4PWTA 1H2AS 1OT3A 3HBMA 1IEQA 3LLUA 3LQKA 3OCWA 3Q6NA 1P6UA 2XYVA 2PSFA 5E2IA 2PYJA 1OZAA 5EKSA 3ZEIA 2VWJA 1DXQA 2CUNA 2Z08A 1LX6A 3ITDA 4FHDA 4ZVQA 1VJRA 2H4HA 4N0PA 2AN1A 3BCSA 3EX7C 1SNYA 3EOBI 2R751 5BMVF 2D5LA 3Q4HB 1TM4E 2PX5A 4KMOA 4LYDA 4Q19A 3U4MA 4JJ7A 5I9LA 2MR5A 4L4RA 4S1WA 3BXGA 1U4OA 1AE1A 2OWEA 4CL0A 2G9QA 3THRA 4KR6A 2JDIG 5LBTA 4FN5A 4D1YA 1SCBA 3LHDA 5L3QB 5KHKA 1XMQO 1ULZA 1X80A 2LIVA 1FP6A 2C3PA 5KX5B 3B40A 3K0FA 3Q98A 1GVHA 3PGLA 4JENA 4OH1A 2I3GA 1GARA 1XVLA 4GI3A 5DM4A 5FPHA 3WSVA 1VG0B 3EPHA 2PKWA 3KLMX 4A0QA 2FTKA 3RVJA 4S3MA 1XJCA 4JLOA 2GEFA 1U8AA 1YJWF 2FPPB 1X0XA 1JIQA 4GMFA 1E79D 1HFEL 2J8ZA 3GRFA 5JNUA 2VEOA 4DLTA 4FDVA 4TYPA 2NADA 4QU8A 3GNQA 1Z15A 2XTNA 5IUKC 1XILA 3IUQA 2FW8A 1QKKA 2XUFA 2AFIE 4CEIA 4PBRA 3AVTA 1QG6A 1J2UA 1E7WA 3TRIA 4ND6A 1T6ZA 4RHCA 1EFLA 4U7JA 3ZCUA 2EATA 1VYUA 2G4CA 3IV7A 1V1RA 1YJ9F 1XTQA 3JYNA 5IC6A 4XTCS 3HKEA 1B6SA 1VLJA 3RIHA 4Q6BA 1N9ZA 3VR4A 2Q5JA 1VQPV 2GCNA 2WJYA 2Y92A 1E58A 4RACA 2CMHA 4Y2SA 4BKPA 4I7ZB 1Q82W 2YIMA 3GLQA 1PD3A 4YI5A 5B8FA 2B69A 3IOMA 3NOQA 5C80A 5HQ3B 1DPFA 2HF8A 3EF3A 3ZGLA 1C81A 3EGOA 3EAGA 4D0LB 2AFIA 2G38A 4TVKA 5I45A 3RW0A 1JPUA 2FOXA 2W2OA 2X0EA 2ZWMA 1LB1B 4JASA 3B6JA 1L7EA 1RKQA 3BL5A 1ZRMA 1WE2A 5CMLA 2IYYA 1Y48E 3MWGA 1WX1A 1HYHA 2I62A 2QL7A 4Y9DA 1O6CA 1F2UB 3MRSA 4LY9A 1FS5A 4R8VA 1YS1X 2BM1A 3TZEA 1LBIA 2I6XA 3LC1O 5DIZA 1CYDA 1JE0A 1EGVB 1MV5A 1IJFA 2QM3A 3CRNA 1AN0A 3R75A 2Z09A 1ZWIC 4MPRA 3ASZA 2X5KO 4ARVA 2JAHA 4N5MA 3SM3A 5GINE 4X66B 1ZUNA 4JEMA 1Q43A 4DS3A 4J7JA 2BJVA 2JKZA 3CUUA 1ZR2A 3KQQA 1H4VB 3GK3A 3T5AA 3U1BA 4OA5A 1TVKB 1RWWA 4GUAA 2AD5A 3WL7A 1F4LA 2PGJA 2CNLA 3GB9A 1X7WB 2BZSA 2DPGA 1PJ2A 2I1QA 4IO1A 3WXMA 1GOTA 1F3OA 2VP3A 3FSJX 2EFDB 2I67A 2XXAB 3KLBA 2YXYA 4BNUA 4B87A 4UASA 5A4AA 3IVAA 4GPIB 3TOCA 1GFSA 5A4JA 1GPYA 3VHRA 3ZWDA 1NDUA 1RAFA 5SICE 1VQ5F 3DW1X 2ZATA 3L02A 1QJCA 1Z8DA 1XNJA 3C85A 3N0RA 1FYEA 1Q7CA 3D8BA 1S77D 3I4FA 1YO6A 2QA5A 1UPAA 3RYCB 1W47A 2QUAA 4GWKA 3NW9A 5BPHA 4P3YA 3VZSA 1JJAA 5CXUA 4ZJYA 4I08A 3GMTA 1CE8A 4RQOA 3IRUA 4Z4QA 1HR0O 2XUAA 4IBOA 4OHZA 1W30A 1FY2A 4B7ZA 1QK5A 5H9VA 4PNEA 1MAHA 1LRKA 2B8NA 2FPRA 2ZRLA 3OCCA 5REQB 2CEAA 3P0EA 3BAAA 1K63A 3TBFA 4WCEV 1YI2V 2WSIA 2ATXA 3B5EA 4C8EA 1RYFA 4H0FA 1MMMA 3DE4X 2BLNA 2PLRA 3FJYA 4RTOA 4K0RA 2YIBA 3GJQA 4UBIA 2EU8A 1MU0A 4UU7A 4TYYA 1CUCA 1AKVA 2BISA 4P34A 5CGZA 5IJWA 4MQUA 1G21E 3BQMB 5FI1B 1R5JA 3IDQA 2TMYA 2DFLA 3K9NA 4LY0A 1XWWA 1GT91 3CH7A 5GZ6A 4BJHB 1FRVA 2RFLA 1JNXX 2ZB8A 4JI4B 4MR8A 3CJHA 1IU9A 1QLEC 1W0KD 1E1MA 2QD5A 4AZ0A 2RHMA 1L7AA 5I7EA 1UJBA 2WZDA 1RI2A 2HP0A 3N5KA 1Q16A 1NW3A 2FFQA 3VJLA 1OBOA 2CTRA 3LQQA 4P7FA 1BVHA 1MEOA 2G5TA 4FUTA 5EZQA 3SE0A 3O4VA 2RCVA 3H2YA 4TXHA 3V7FA 3D3QA 1FF9A 1E79G 2Q67A 1QKJA 2NZXA 3U1VA 2I5PO 2QBYA 1ISMA 5DBEX 2QV0A 4RK6A 2PEYA 2XTJA 1WHTB 3NHMA 4J4BA 4B3RO 2CXUA 2YL2A 5B6PA 1Q7EA 1JSRA 2NYRA 3DHNA 3FNRA 3L0SA 2PWPA 4URHA 4MKXA 4ZDIA 4ALKA 4FNMA 3X43A 4BB6A 3H2SA 1KI4A 1T9AA 4E2YA 2DPYA 1JIVA 1DO2A 1FLAA 4D4MA 4Q7EA 1EWTA 1YB5A 2BFMA 1Z8HA 3HVUA 2QX6A 4JDUA 4NFYA 5LBUA 2ZJ4A 4QX6A 3Q5EA 4B80A 3I3SR 3MJVA 2MHCA 3BD6A 3BEHA 5JJKA 1KI6B 2IHZA 4R9SA 4ZA2A 3RKRA 3SF0A 3VVMA 3WL3A 3FTPA 2XT0A 2RHJA 4AN4A 1U7XA 4B40A 3GVHA 4J0CA 5DXFA 3ZNQA 4F3NA 1V6SA 1RDFA 2CW4A 2WKPA 4LOIA 3GJ4A 4RV5A 2ILVA 1P1BA 1RVV1 2IV7A 2JHAA 3C1OA 3WK4A 1DOHA 1GV1A 1HDIA 1YS4A 1U8XX 4HGRA 1QHHB 3B1ZA 4ZO8A 2HU7A 4E1BA 5HZHA 2ZSDA 3MT0A 4MZDA 4CLDA 1ZJZA 3FB7C 4JASB 3JWJA 2VHEA 1RM4A 3UHAA 1YF3A 2P5UA 1OV4A 1IX9A 1I5EA 2P6NA 4UNSA 4ZEMA 3IT3A 4IHKA 4CIAA 1Y37A 1RXSA 4N5HX 1KXZA 4ZZ0A 1TA0A 3D4PA 4WMLA 3ASUA 4W5JA 5GGXA 4EVRA 4QKQA 1X7XA 1ZZEA 3OPYI 4PSUA 3LYHA 1YCHA 1QMPA 1O4WA 1JQDA 5ARBA 3JRNA 3OHSX 2YJ5A 3LOUA 4W5NA 1ZH0A 1IV1A 2I3DA 5L4SA 5LZ4A 3W5HA 2WJPA 1W42A 1RR6A 4WERA 3VC3A 3ZY6A 3VYSB 1UXHA 1ZSPA 1LFDB 4OCZA 2ZR0A 3ZNOA 1ODTC 4M55A 3QKUA 3ESZA 4XVHA 1KO7A 3HKCB 1C50A 1WV1A 3GAMA 3LGSA 2PS9A 4BMDA 2HIAA 4DDHA 1Q7GA 4TZKA 5LQCA 1Q1NA 2C78A 4Q6GA 1EMDA 1KFBB 1OV6A 3A37A 2OG2A 5HXAA 5JASA 3PA6A 4QWWA 4KR2A 2R11A 3ETGA 3CRQA 1B3BA 3K2QA 4RJKA 3ZC3A 4YAKA 2FKAA 5BZBA 3E18A 5T6BA 4FHZA 2V7QG 2ONKA 4XDYA 1NVGA 4IX9A 2DQZA 2XAFA 3CIOA 5EMKA 3QPDA 3OLYA 2R5FA 1OAKA 2G63A 2QSJA 4GKJO 2V1XA 3BE6A 2IPOA 3BFKA 3H0EA 1AZLA 1A4RA 3SMQA 3WK6A 1QPBA 1FNJA 3A04A 4HAVA 2KS6A 1XVVA 4LBYA 3L6RA 3B6KA 5CCDA 3BVOA 4CL2A 2FP4A 4JL6A 5B1NA 4QTTB 2R8BA 2Y1XA 3PNQA 4PBTA 2AYZA 3I39X 4XAQA 1F6BA 4BMXA 4CR6A 3VH4A 3UV7A 5L3QA 4QUDA 4RK7A 4MSUA 2ZI6A 5IH3A 1Z12A 3IIKA 4GDFA 2OY0A 3L0PA 1FDUA 1EGHA 1PNMA 5TISZ 3BC1A 3VRHA 4DZRA 5DNDA 4QAQA 3TMKA 1D8TA 4A15A 3IEXA 2OHXA 3TSZA 1CR0A 3ZN2A 2PGOA 1WU8A 2PH1A 3Q7EA 3ZMVA 3CX5F 1D2DA 2GJKA 3FYHA 1WSDA 3RN4A 1WABA 2LO1A 3IDFA 4QBKA 5AHOA 3JVUA 2VT6A 3R2JA 1DHRA 4OMUA 2A2ZA 2RGEA 3QVGA 4ZOAA 2GYWA 3ZE8A 4ZHYB 4X3PA 1IHPA 1WVIA 3L7OA 2PUBA 5GADl 3C5EA 2R25B 1QIEA 4XD7D 3FF1A 3N8DA 4NWIA 5IXSA 2ZUCA 3OT7A 2Q7HA 4XM0A 3SY8A 1UWVA 3L7KA 3JQDA 1W2HA 4D74A 1OZHA 5HK9A 5G4KB 1DMSA 4IDAA 1NMEA 3TW4A 3HA2A 2E37A 3L92A 1ZKDA 2Q9LA 2VDOB 4MVJD 1G4UR 2WWHA 4TV8A 3FMIA 3ZG6A 1RM3A 2JLXA 1QFXA 2ZTUA 1DKQA 2YWFA 3OU2A 4DJAA 1EJBA 1QGDA 4NQRA 3L7QA 3DA8A 4NE7A 3UJ9A 3O3NB 1YC2A 4YCSA 3HV2A 3W4JA 1COMA 1FYJA 1M6VB 1E8MA 2G88A 3URMA 1GTRA 4DK0A 1TMKA 3HZZA 3F0EA 1B0ZA 4Q4HA 2POQX 3EZ7A 3O0TA 2OMKA 3W05A 2Y99A 2EQBA 1QJ4A 4DIUA 5DLQC 5GY7A 4M2LA 2XAJA 2AUTA 1JDVA 2PI4A 1D2CA 1OTHA 2VDQB 1X1QA 2GD0A 3B51X 4QFDA 2C7RA 4I1PA 2FJ0A 1SRQA 1Y6FA 1K3TA 1CJUC 2BZ1A 2VF8A 4KQKA 3WYBA 2OHWA 1KA9H 1OREA 1XCJA 4X66O 1E6EA 3HI4A 4L4ZA 4R3UC 1N5IA 2VT3A 1P0QA 1ZNXA 2C3UA 3CPWU 4NECA 2WKQA 2VRZA 1NN5A 2DH5A 3M83A 3O9MA 4GQBA 1K66A 2D2FA 2OYCA 4D97A 1CK4A 5ICGA 2DLDA 5BMVA 2V7QD 4L0DA 2OESA 4WZAB 2JGIA 1TEXA 1QWSA 3PYLA 3HKDA 3GVXA 4EW2A 1DF5A 3HU3A 3N0TA 3KSDO 1KZGB 4M89A 4WK6A 1GLGA 2E2WA 2Q1SA 3AXTA 3TJZA 4ZMRA 1XD2A 4H7DA 2JAPA 5C8YA 4M0MA 3H5NA 3LGAA 2P3OA 4FOLA 4JOQA 5HP7A 1P18A 2XYHA 5JS8A 1PG2A 1Y67A 1JHQA 4YRPA 4B6EA 4JGIA 1VJCA 4HFJA 2QS9A 5CURA 1VL6A 4FW8A 4RH3A 4PA9A 3HEAA 1MZEA 1GX1A 1P7WA 2PD3A 1FNSA 1T3GA 3ETQA 5AG2A 2HBZA 2A9OA 1B0UA 5FO0A 1U81A 4A8PA 5HK8A 1NVFA 3BSFA 1NJIH 2A0UA 4MRRA 4QEZA 1A7UA 4O4LF 3EZYA 1DRJA 1EFVB 4M0DA 2GZRA 3O85A 1VL0A 3BH7A 3KSBC 4FLWA 4DLYA 1V25A 4BNGA 4LECA 4CMKA 5CLHA 3CPHA 1CUFA 4LX0A 1TA8A 2QWOB 1OCEA 3HJRA 4C01A 2HMTA 5DHAA 3CBGA 4KPUA 2I34A 2R68A 2WWWA 2QEQA 1GZ7A 1IBCA 2OZEA 2GYVA 1KI2A 4D2IA 3IC7A 3K0EA 1CX9B 4YBZA 2A1TR 4HCJA 3U16A 4OB6A 1BMFA 2FKNA 5HFMA 3TYXA 3CZCA 3A0HZ 1XMOO 3MS2A 3X2EA 4ZJZA 4OLBA 2B1RA 1EHIA 2C2HA 1GSOA 1QO0A 2W6IG 4HEQA 4OHFA 1NVVQ 1Q0SA 2IRWA 2VPWA 4MR9B 5ILOA 2NVWA 4Z53A 3GYBA 4CF7A 4NBVA 4R2MA 4KITB 4W9MC 9ATCA 1EI9A 3IAM1 1NUUA 3DLHA 4NNOA 1ZCJA 2YY6A 1AKYA 2I1LA 3FD8A 4EGSA 1EFAA 1ZY2A 1FDRA 4LYGA 4Z4FA 2HK8A 2P1RA 2PMDA 1CRLA 1UFIA 4P93A 1W6UA 1ZPDA 1MP0A 1J06A 3AHDA 1RQPA 1ZCZA 5JALA 3RW9A 1Z4IA 3FZEA 2LUOA 2YOGA 3F0GA 3VI6A 4FM9A 2IV3A 1IXSB 4F0JA 1T9GR 3S7TA 2OGUA 4QGAA 4V38A 1JFRA 2HRZA 4KV7A 4N40A 2Q5QA 1V71A 4TT8A 4WXMA 5JDCC 2PAAA 3NRCA 1AK2A 1C3EA 4MYHA 2DHQA 2QTMA 3TOVA 4IXMA 1QZTA 3A7EA 1U80A 1DFIA 2JHFA 2VDJA 4QQ8A 4XQEA 1HDJA 5CBFA 4JLWA 1CZKA 2Q6VA 2C4VA 3LT0A 2RJNA 3QKWA 3OZBA 4B34A 1DELA 3NCTA 3OZCA 5FOTA 2N1BA 3EWNA 3OLXA 1KOGA 3IUNA 5EB1B 2VI5A 3FNEA 3VNSA 1UDXA 4GMGA 2QD1A 2GO1A 2Q0HA 2Z6VA 5B3JA 3LT4A 1G38A 1UAAA 1NXPA 1YR7A 4OAOA 4EI7A 2VA8A 1RLIA 4Q9NA 4IPTA 4K9PA 2GETA 3GJYA 5BN4A 3UGTA 2EULA 1QHHA 3DBVO 1WV0A 2GKOA 5IC5A 4DJTA 1NJ5A 1VSBA 3R23A 2EBWA 2GKGA 1REQB 4MVWA 4EA8A 5JFGA 2AEFA 3NH9A 5FUXA 2OD2A 2CXHA 1Z7BA 3KKPA 4AUEA 1LTHR 1TO2E 3ZRVA 6LDHA 2OHFA 1TU4A 1MRNA 3PE6A 4BC0A 4S1OA 1XCBA 3DHVA 3G0HA 1MFPA 2VHQA 4GZ6A 3HFGA 1F8GA 3HGQA 2G4LA 3JQ9C 2VZ9A 4PTLA 2P91A 2WLNA 2OCGA 3PCXA 4P53A 4CBVA 2O1EA 1SVIA 2I6TA 3DULA 1XF1A 4QQFA 5IZ4A 3CLRC 3DNFA 1O4VA 4N8EA 3TTXA 2IX9A 1UOQA 1ZAUA 2IS2A 5G1PA 2Y66A 5AKHA 4DMGA 3ABLB 5AKLA 3ZY3A 2IKSA 621PA 5JATA 1H05A 1HBJA 1YMVA 4I50A 2R60A 5LC1A 3RIXA 4BR6A 4M1SA 4EKEA 2WTXA 2ONZA 3ADPA 1I2DA 4NF2A 5IBPA 3PC8C 5AVZA 4TTQA 4IZIA 4OGQB 4MW1A 5JY1A 4LTNA 2R1ZA 5T4HA 4IVRA 3BB3A 1LK0A 1RP3B 3MWEB 3PQEA 4YT8A 2Z6UA 2WKWA 5AO9A 4CTNA 3EVNA 2O1SA 5ALDA 3ZMSA 2HCFA 4BIUA 1PFYA 2CFOA 4IIYA 2BR5A 5C37A 5AVJA 4JV5B 5MN6A 2QBYB 4H1UA 5HDQA 2DWQA 3BQNB 2WSLA 1JEQB 3LT5A 1QHIA 1TEVA 1E6MA 2CMFA 2VDKB 4NY1A 3AKYA 4RPIA 3U4CA 4EJSA 1KD1H 1C1DA 2B34A 1VQ8V 3CKLA 1TB4A 4YV0A 3LUKA 2VPQA 3G02A 1P1CA 4DW0A 4GGOA 5ELMA 1YGPA 2W6IA 4Y1EA 1YQQA 4DR2B 2G0NA 3FF4A 4N1AA 4X6XA 1H2NA 2MTBA 4MR8B 3MAJA 5DWDA 4RH1A 1ZRNA 3SS9X 2QMHA 2VC2B 4G41A 4OK3A 1Y0BA 2QVLA 1N2CE 1Y8QA 1DI0A 3A9RA 5DNVA 3RUHA 3O93A 1NN0A 5JXWA 3A9CA 4QJFB 1XI1A 3NOOA 3TZLA 1EJ2A 2NSYA 1OJLA 1RI1A 3ML0A 4PA3A 2C2MA 2F3PA 1SZDA 2GK4A 2ID7A 1Q0QA 1PX2A 2FW0A 2Z8XA 5JWOA 1NR7A 3HCEA 3K0DA 1B41A 1T2FA 3ETHA 1K2VN 2XNKA 4Q66C 3QJGA 1OX6A 3TLCA 1CY4A 4HRYA 1GAEO 1RLMA 5K3DA 3SLKA 4ZGGA 4WFHA 1W57A 3SS8A 1Z36A 1ZIYA 2FE1A 5CIYA 2GTIA 5CR9A 2XUKA 2PNJA 4YAWA 5GJCA 4PDVA 1KQPA 5TMPA 3E8MA 4YP6A 1UT5A 1XEXA 2O59A 4PAGA 1SKAA 2C3YA 4UREA 3RG8A 2J3QA 1NBIA 1ANKA 4JPRA 1Z3CA 5CHYA 4D4JA 3PC6A 1STOA 5JDIC 1KS2A 4O1IA 4LHEA 1TZKA 1MO6A 4NV3A 3S1AA 3TTUA 3ZI7A 3AESA 4B6OA 3K92A 3HXOA 3ZWQA 2FN3A 3N07A 1QIGA 3B2NA 3ZRXA 1AT1A 3B85A 3DTUB 3GA0A 3H1EA 2JBHA 4KH1A 2V7WA 4MYRA 2PTHA 4DNQA 6AT1A 2IZ5A 2E5LB 1H4SA 5IYCO 4G09A 4MI9A 3DPIA 3F8WA 3T9CA 2AHZA 1FVFA 2YWRA 3V8EA 1RJ9B 1IN7A 4E09A 3OZGA 1DKPA 5MF6A 1AQ6A 1E9BA 1F0PA 2A5DA 1X2EA 3H8JA 4L5YA 3V4OA 4BT3A 1C1DB 3Q8MA 2CGEA 1VSTA 1QP8A 3PJGA 5EC8A 2JHPA 3RTCA 1COWD 2V7GA 4DB4A 1ZGBA 2XMDA 1M1YE 1YJCA 1J70A 2FUG6 2CN1A 2J31A 2XXJA 4L8FA 4QJBA 1N1GA 3ZJ5A 1YT5A 3QLTA 3ITEA 3I61A 5K7SA 4WCVA 2GEDA 3CCLV 5AM0A 5BURA 4RQUA 3F0FA 2MSLA 2YWCA 4E33A 2O6LA 3DAOA 2G7MC 2G1PA 1Y1KE 1W96A 3C6ZA 3FR8A 1R0ZA 4XARA 4OPHA 3P4UA 4BIMA 3C16C 4C7OA 5CT5A 4CDMA 2ZYTX 1EYZA 3ZTWA 1PJ4A 4QYSA 1G9SA 1A95A 1EHCA 1D1PA 1VE3A 4OJNA 5ULLA 3WL8A 1I33A 2WAXA 4GRIA 4YWHA 4LPSA 1JDJA 1JKIA 3I1YA 3LE8A 5CFQA 4AI6A 1VM6A 3EORA 1W5TA 3HDYA 1TF2A 2Q9CA 4R7GA 3Q87B 3R7WB 3TI7A 2LCQA 4DBVO 2XBLA 2PZMA 2D54A 4R1UA 3U62A 3LCRA 5I7HA 1VQNF 2X0DA 3TL2A 4BMVA 2L2QA 3AF4A 1M2NA 4OBBA 2Y93A 3C7CB 2H17A 3MTEA 4HADA 2RHLA 2O8EB 4G24A 1J9EA 1RYYA 2Y4OA 4L3WA 4RIHA 2BKXA 1BNCA 1QYRA 1V9SA 2VK8A 1BZYA 3J80M 3CJTA 5BN4B 2RIRA 3V7EA 3BYZA 3FMFA 3SJZA 1GKLA 3UOAB 2LD4A 4GKKO 3RSOA 4AB1A 1SA0B 2A4MA 3L8MA 4V3BA 1TTHA 1WLYA 3NHJA 2H85A 5EXEA 4GRAA 3VC7A 1KPIA 5FFNA 3SHWA 5MN5A 3CC8A 1HE5A 4DTIA 4ND3A 5LQSA 2OYSA 4UHDA 3W8EA 1M6YA 4MQEB 5IMSA 2IUFA 4KAFA 1ADYA 1H1DA 4JODA 1G0OA 5AJXA 3CEHA 1L1RA 3E0QA 1U0TA 4IKEA 4UM5A 4LF7O 1XNQO 1RLUA 3CW8X 2P9JA 5EOVA 3RI3A 3FAKA 2WF9A 4G0ZA 3EPKA 3A25A 1E2JA 1R10A 1I3CA 2CBGA 3VYUC 1K8ZB 2ZJFA 3Q0TA 2H9YA 4KP4A 1T8TA 2CZQA 4Q3NA 2FYTA 5AVWA 4E0BA 2I55A 4BKMA 2ZYRA 2ISQA 4MR7A 3D00A 1CNMA 1W1IA 3DGEC 4WFQA 1YJ8A 1R6DA 5G4LA 2R6GA 1X8LA 4DMMA 1AVMA 4P4GA 4BAZA 1TUBA 5EBLC 1JTVA 1V1MB 1K5PA 1D2MA 3JQ7B 1FFEA 2IY9A 4IDCA 4ZAYA 4JYPA 1YVPA 3Q7SA 3FUWA 2BKAA 1JEOA 3HUFA 1SKQA 3NH6A 3HL0A 5LMUO 5EAZA 2C2YA 1E1DA 1IXBA 1YR9A 1HE4A 1UM9B 3BSSA 4DR4B 5FLXN 2FMHA 2PBLA 3E3MA 3FX2A 3LDFA 3MTGA 4K86A 3S99A 2FPPA 3JU3A 2QZ9A 4DDUA 1ZH8A 1XLUA 3GIDA 5F51A 1MA1A 5JNWA 2QLMA 3AFNA 1CJSA 2HO4A 3DHEA 1DC4A 3OP1A 1O9HA 5F1PA 1T15A 1S2OA 2NVBA 5A1TA 1A1VA 3ERCA 2GZAA 1JVMA 4WASA 3C5CA 1X86B 3O38A 2ZRKA 1NUTA 1U2ZA 3DQQA 3FW1A 1CF9A 1EFHA 1XZQA 5I7WA 2P90A 3NAQA 2E4UA 1OLOA 3ZMZA 3OZAA 1X0VA 4Z9BA 4ENUA 1G1XB 1NN3A 1BXGA 1VP9A 2CV0A 1RQRA 1L5HB 2QR5A 2J4CA 4AUKA 1I8TA 4Y1RB 1WA8A 3OJOA 3IIEA 5KOYA 4NZYA 1N3LA 4FFPA 4KI0A 3N39C 1XRSB 3H9BA 1QVGU 1I14A 1XJWA 3T7IA 5FPYA 3I72A 2BFCB 2JCVA 3JCZA 3NR7A 3UMGA 4CIYA 1KK0A 2CHQA 1E77A 2RGGA 4YYZA 5CFPA 3KQLA 1JG4A 4MT8A 3O75A 4KBYA 2NO5A 1EESA 1U2DC 1G21B 1OE0A 5ALYA 5J63A 3WGGA 2DPMA 5HKAA 3REGA 3TLEA 3DCJA 3DZHA 3A05A 4DBLE 1S8FA 3TMAA 1G63A 4AXBA 3WZMA 1K3EA 4DAEA 2C4NA 4QUGA 1SC5B 1PW5A 1R1MA 4X3CA 1T5LA 4AYWA 2PJRA 1U2EA 4GZ3A 1KS9A 2XCRB 5IAKA 2QXUA 4KB5A 4DRZA 3CEAA 5D86A 3FX7A 4KXMA 4DR6O 5AOCA 5KTKA 1JFLA 2ZBRA 2JK5C 1NNI1 1R8SA 1JN0A 4RD1A 5K01A 3Q3HA 4CCAA 2GBOA 1HE1C 4LFCB 4OO3A 4PCUA 5DE3A 3VR6A 3R6DA 1A2QA 1PAUA 5F4ZA 4F86A 1UDWA 4I4TA 1OROA 2J7KA 2REXB 1LSJA 1XHZA 3K15A 4LQCA 3L8GA 3KIPA 4PO3X 5KVVA 1Z82A 1XZFA 5FJ4C 2C96A 3BCHA 3MD9A 4KN8A 5JYCA 3ENQA 1V9CA 1Q1EA 3ISVA 1N36B 4I5SA 2NPFA 5K3EA 1L7QA 3EXEB 1PJBA 3OKPA 3QUQA 2G8NA 2G08A 2NTNA 3TD9A 1T6BY 4CT4B 4EEZA 4HEA6 3ZN1A 2WZBA 3HO8A 1FNNA 3PFCA 2QX7A 1T8RA 4MIEA 4PNPA 2FOIA 3D6TB 4TKLA 5EE5B 3WWCA 1X19A 4RK1A 3RFTA 5ENVA 3IERA 1WW8A 3QVWA 1PWHA 4UNNA 2Y71A 3M6AA 4Q21A 5ADWA 1ORQC 1VBFA 4LVCA 3UWMA 4D9NA 1NYQA 2IYZA 1V4NA 3IP8A 5EP3A 1FSZA 1RQ2A 1L7MA 1L9KA 5FA5A 5JYDA 3I6IA 1CJKC 2ADQB 2VT7A 3S4YA 1PS8A 3ZWCA 5KYUB 4RJLA 2Q5OA 4H4EA 1W4CA 4MTGA 1DOAA 2XOKA 5FL7G 1SOVA 5BRAA 1SKVA 1XHOA 4FMBB 4BIZA 2GWRA 1KJYA 1UQUA 2RHRA 3F6BX 3LY7A 2JI9A 4N9WA 3T34A 4EFKA 1MJFA 5BR7A 3LQYA 3PUIA 3TE7A 1GK9A 2YCBA 3LV8A 4O4IB 1YASA 3FFWA 4TL6A 4RTRA 2OBYA 3F1KA 2O2IA 1SHLA 2DQSA 5M34A 3RSSA 1AS2A 4YO8A 1P8AA 4FKZA 2KSDA 3ANYB 3G7SA 4WFIA 3CJRA 4E2FA 2GCOA 3O1LA 3SSNA 3M9LA 3JD0A 4O2AB 1G5FA 2IW1A 2WA2A 1RXEA 1ZJ5A 3AYXB 3FKSD 3W3ZB 4U7OA 2HMVA 3OQ6A 4UBLA 2PGGA 1WJGA 2CE7A 2COUA 3KKOA 4FILA 2HVJC 1SVOA 2VPZA 4YDSA 5EPEA 2X8AA 3ST7A 1J4AA 1JG7A 4YC7A 5L9AA 2ZZMA 3KVNA 2NP7A 4CFSA 4PC1A 1MSWD 2ILTA 1TUBB 1V1MA 1ZQ9A 3BA1A 3FMGA 5LQRA 2V6MA 1SQGA 1HLGA 4G01B 2XB2A 4PI2A 4DR3B 2O52A 4O4JA 3Q8KA 2PQMA 3OF5A 5BSUA 4WBNB 8ATCA 3WG7C 1KNJA 1Z26A 1T4MA 3M2TA 1RKUA 1WB8A 1U0FA 1GPWB 1FOEB 4J7XA 1L0LH 2YW9A 4DQKA 4RKYA 1DP4A 3M84A 5IW8A 1K8QA 5EJMA 4AECA 4EJFA 2NSDA 2EJBA 3K70C 3FDJA 5JBNA 5EO3A 1AQLA 1EX6A 3NC1C 3PSAA 3IEPA 1YKSA 2UYPA 2NAPA 3JPYA 3PRYA 5AJYA 2B2CA 3X2FA 1YE8A 3UF0A 2O8VA 3IEWA 2QV7A 4MUGA 4YCCA 2ZS9A 3BN3A 4QXQA 4X24A 4PV1B 5EZ5A 3WJ7A 1ZXLA 5FWXA 4CWAA 2ZIXB 4NS1A 4HQ6A 2HS3A 1NKTA 1CR6A 4PIVA 1M8PA 2IUEA 3K20A 3RYTC 1M1KW 4JXXA 4HR7A 4WX2B 1M3SA 4JLAA 4PFSA 3WBKA 1W85A 1YZGA 2BF4A 1NU6A 3WHIA 3FI9A 4CC5A 2YCLA 1ISJA 3F47A 2PZFA 3CA8A 4HDRB 4J2TA 4J0FA 2AOXA 3S6JA 3U48A 2DECA 1KZYC 3QOWA 3H2IA 2ZJ3A 4RYDA 4ZQFA 3W6NA 4LZAA 1JH9A 3UMBA 2V6GA 1N6IA 3TNYA 3EMDA 1I7SB 4P3KA 5IT0A 5J2UF 2ZXUA 3EC2A 4HYYA 4DLKA 3SQLA 4XRGA 1KDTA 3S0WA 3HB0A 4M1KA 5CVVA 1GAXA 1V26A 1DZ3A 2VDRB 3HTNA 2I6GA 3BOSA 1GN2A 5D8DA 3MELA 4D98A 4D80A 1P45A 1T24A 3K0SA 2GPNA 3NONA 3SGLA 3A26A 1ZD8A 1YHQF 5IVKA 3P2JA 4HMPA 1YCGA 3H11A 1AP6A 3RVOA 1LX7A 4NR0A 4C7OB 2VDLB 3E9ZA 3HUEA 1AS0A 4GM0A 4MB0A 4DJFC 4HPXB 5JMTA 1G60A 4QE9A 1KAHA 3QLVA 4DEXA 2UUBO 1CJCA 3K35A 4AMGA 1UBFA 5K4GA 1KJQA 3WOHA 2VJLA 5LXTB 4C3UA 5I5EA 3LDDA 2LPMA 3SYPA 5EHGA 2GFQA 5C8XA 2QUBA 2QMYA 5DWQA 1TYCA 3GPDG 1W36D 1DC3A 1FFHA 4EGAA 4FZ0A 2XBUA 3VTAA 2Q6AA 2DULA 1JQEA 3RTDA 1ZC4A 3N6XA 3O3OB 4ZIBA 2X7HA 3DEKA 1C4XA 1PNVA 1EVJA 4I46A 5BXYA 1WSBA 1H0KA 3CD6F 2A88A 3N6VA 4YRAA 1KPHA 4DV4B 1AHHA 2GO7A 2ECOA 2PMBA 3NDRA 4ZYZA 3VPAA 5L3GA 1M8GA 1M75A 2YKGA 2Z1EA 1OX4A 1NVKA 1DSSG 5IM4A 2BTEA 3QKTA 3PQ3A 3LUCA 5FL7A 2Q1TA 1E6UA 4LXHA 1ODLA 2PUHA 2KG7A 1XV5A 3AL3A 3QPWA 5E3JA 5IU6A 1CZHA 3B3FA 3VZBA 3AEXA 4DNOA 3OFJA 1AGNA 1XXHB 2JLZA 1ICEA 1ZA1A 2J59A 2KWIA 1LNSA 3NYIA 1KYZA 3OIGA 3NJRA 1UUFA 4TRJA 1O95D 4ZOCA 2BRUC 1EX7A 3SJCA 3B6NA 4CNBA 4WRRA 3OWOA 5HPYB 2QSYA 3BPSA 4DR1O 1IQPA 3JSXA 2Q2WA 1RAAA 4OY3A 1SWVA 3ZIDA 3B1JA 1DT5A 1P29A 2Q5HA 3DDCA 4KV9A 2Y1OA 4KREA 3NK7A 2R8RA 1IBLB 2RQ6A 1T1RA 1ZIOA 1NDQA 6REQB 3SYCA 4GX2A 2EW1A 4G1FA 3PLAE 1G55A 4IS3A 1E20A 1ODFA 1YJNV 3LT2A 2QUJA 4ONEA 5I4BA 3I2KA 4IIFA 4AWAA 3VOAA 4NPCA 4UHHA 3CKMA 1M5TA 4JI7O 4XX0B 1QPZA 2PYDA 2OOSA 3Q8HA 3DMHA 4C07A 2QTRA 1RACA 2B82A 3GFQA 2Z0AA 2ZT7A 2HRDA 2QP3A 4PR3A 1VKRA 1PK9A 2L35A 2QTWB 5I7FA 4LC1A 2IYWA 3QXHA 1G20B 3KJEA 4DV1B 2IAFA 1U3FA 3CMEF 1IAVA 3FVVA 4MHSA 4YJHA 1TQ8A 5JRDS 2VUHB 2QKAA 2J6HA 3I1IA 3L0CA 4FGZA 1JG6A 5JW6A 2CNWD 1LLFA 3L9XA 3PD1A 4KHPB 1OTYA 2CF5A 2RHTA 2BO1A 1CB7A 1E5LA 1NLYA 5HZKA 3SYAA 2VS1A 2W71A 2ZREA 4RHTA 4TMYA 2VCYA 3SPHA 2R79A 4KXXA 1T3LA 1UKBA 1GRVA 4KMRA 4NOKA 3KUUA 2F1OA 2XDAA 3TNDA 1EFRG 3PVZA 3BWVA 4ZPJA 3WWOA 4B75A 5HKBA 3OTGA 5CM8B 4C2BA 5TMBA 3G7UA 5AK4A 3H2JA 4D6XA 4RY8A 2NVUB 1BWRA 1VCMA 3KOXA 3PFHA 3PL5A 3QP9A 5HIKA 2R8EA 2X6RA 3MGGA 1Z2AA 4AICA 3DD5A 3MYRA 1GQ2A 3UFXA 4NZMA 1FMJA 3WLJA 2HSJA 2QRMA 4DFDA 2YIDA 2BE7A 1PGNA 4MDYA 4MV7A 2HA5A 1XN1A 3RS4A 3MC1A 3WP1B 3KQOA 3LUFA 2NUAA 2WWVD 2R8YA 3CCLF 1CHNA 3HDHA 3K32A 4DA0A 4EMUA 1Z2NX 4K1XA 5EHXA 1W85B 2VUSA 1X70A 3OF2A 4RMJA 4WBXC 1IVNA 1VGRA 4FHFA 4O1MA 4DMFA 1UP6A 4PCAA 2OG1A 1B0AA 3K72B 4E12A 2A1UB 5FR1A 2OYQA 1FVHA 5L3VA 4C5BA 4HYTA 1R73A 3JSAA 4YONB 1B1CA 3QUAA 3TZHA 4MQFA 1EQ2A 1H5NA 3D9QX 2DUUA 2E4VA 1GZSA 4MVRA 5B3SB 1ZA2A 2CXSA 3QVXA 4LF5O 1CRQA 2HPVA 2GPTA 4RELA 3D3JA 4EDHA 3UMMA 4ARZB 5IDWA 1HT1E 4HXGA 3BSYA 2CDCA 2PAFA 4LGMA 1U4NA 1OC4A 4IJKA 2WLHA 2W48A 4LCBA 4ZT7A 2NV0A 4Q6WA 5FAXA 3T7TA 3I8OA 1I08A 1JU9A 1KEWA 4UNIA 3BAZA 3KUKA 1S5LZ 1L4LA 2B1QA 2NLOA 2VUTA 1QNLA 3OQJA 5BNZA 4AP5A 5DHQA 4FOSA 2UVPB 5H2FZ 3AERB 4U3JA 1WVMA 2RB9A 3K09C 5BW6B 1F23A 1S2IA 1QS0B 3B5IA 4HL6A 4DIDA 1AP5A 1QGUA 3T4ZA 1E2DA 4HQNA 3COJA 1I5RA 1M6HA 1YAJA 3BJRA 1FX0B 3F7VC 3C4VA 3HNRA 3IUMA 2WAAA 1ZOPA 2E74B 2P4UA 3ODPA 4FZJA 2HJFC 4ZVRA 2WOOA 2B2NA 4XFKA 3DTVD 1RI5A 3CCQV 1F17A 2D1FA 4FLXA 2WINI 3PUYA 4JUFA 3N74A 3ZK8A 2QRHA 5GIOE 4OI4A 3QPAA 5BVHB 3UT0A 2A59A 2P9HA 3G2KA 3Q9LA 2BGGA 1Z7WA 1JLLB 1YMUA 3F1LA 3VPCA 1RHQA 4RA9A 1CS0B 1JLMA 3B4SA 1QE5A 3KJJA 1JIJA 3R40A 2MYUA 1OCZB 3JAMM 1EFVA 3OUUA 3ZVMA 3Q4HA 3FAVB 2I54A 4M46A 3RAGA 4MJ3A 3VDRA 4RY9A 4BRWA 4ALLA 4R8KA 3C7TA 3BTUA 1W4AA 4J7AA 5K3AA 4BNHA 2BFFA 3ANNA 4GG1A 3EVBA 5CH3A 5ALJA 4C30A 4ARBA 4YA6A 3WAGA 3LC2O 3RAFC 2P0EA 4KGXA 3PQ8A 3EXEA 2RGRA 3EXG1 4EYQA 3E9MA 3DWFA 3WHLA 1DJLA 4GXQA 3TDMA 3PEUA 4BV9A 1MD9A 2JFHA 3OC6A 5KTYA 4J0QA 5JSUA 5EIAA 1P0CA 3OJXA 4NNPA 4FD3A 4WVFA 3TLMA 1GSAA 4YRKA 3BIFA 2J6BA 4Z2YA 4BNFA 1BOOA 2QRZA 4DSUA 1U9JA 4DKJA 1OTXA 3PBKA 3STXA 2BJWA 1PFUA 1KZ6A 2H4JA 2QG9A 1P2FA 3X1DA 1E3LA 1T2DA 2Q5LA 2H5JA 2BBWA 2GXUA 4FGKA 1KP3A 4FYXA 2DUNA 3Q40A 4K6GA 4ZYVA 2V1UA 5AM1A 2VUIB 1HQYE 4DV7O 3IODA 3UK7A 3ETCA 2J6IA 5FA6A 1OH7A 4FMDB 1G8JA 1YD7A 2P9EA 3KVRA 4Z7NB 4AKSA 3AI7A 2X2PA 3WB1A 2FSVA 3DXFA 3ORQA 4GE0A 4UDXX 4C21A 4CN8A 5H5JA 5HMLA 4B4KA 2QPLA 3WMEA 3KXIA 2C4WA 2VZ8A 2EWVA 1R3DA 1A97A 2V03A 2YJ4A 3WJPA 3NV7A 4HDSA 4LEIA 1I7PA 1ZK3A 2PSSA 5EXDA 2H2AA 3GVIA 5SZIA 3DXYA 4BZPA 5JC1A 3FGOA 4B5LA 1M34E 5KTTA 5F9FA 5K0FA 1A9YA 2JNBA 1CUDA 1F2TA 2I8LA 3QXSA 3OO1A 4XE5A 1YQUA 1N1DA 4H4DA 1USGA 1XRPA 2DBVO 2FMXA 3M1YA 4AF8A 5L3CA 1CJBA 3LY8A 3MOSA 3REQB 3LZDA 2KMLA 1QQ7A 3HRIA 3NTXA 2AJTA 4NBTA 3V4RA 2EGGA 3OI7A 3EY9A 4JBXA 4X1IA 4Q48A 4NCKA 1F06A 3AMVA 4UUPA 5KPJA 2QORA 3DKPA 4F5ZA 3I52A 1L5QA 3V8PA 3OQNA 3H11B 5T5QA 3N2GA 1WMAA 2GDSA 2GM3A 1CP9A 2J7PD 2WBLC 1SB8A 2G17A 4G36A 4B83A 4H31A 2P6JA 4HAUA 1UDRA 3RIEA 4NBUA 1AKTA 2RI1A 3O4IA 2AT1A 1I4LD 3OEWA 4P54A 5TPZA 2BHNA 2P27A 4JJZA 5JEDA 5GMOA 4K8ZA 1A72A 1KHHA 1JFFA 2PX6A 4GP9A 3LWOC 2GKSA 3MGAA 4ILKA 2JGUA 4LGYA 1SO8A 1O97C 2H57A 4OHKA 1KRWA 3O8CA 1PXWA 5JXIA 4C89A 1D09A 1W1UA 4WXEA 5B2FA 4DDKA 4PRYA 2VYFA 3WFVA 1WVGA 4JB3A 2BMDA 3OP4A 1TYZA 1Y3IA 2L19A 1PTKA 5IDJA 2W4QA 4N5LA 1BDHA 3V7NA 3W7BA 3ZDDA 2GCPA 1SOUA 2E48A 2YJNA 1PQ4A 3WQSB 4DR4O 2AR9A 2D0OB 2RAFA 3PI7A 3I6BA 1E69A 3X1KA 3F4BA 4GXRA 4PZAA 2PS0A 1B06A 1PZGA 1V41E 3JWPA 3FBGA 2RGXA 2OCCC 1S9HA 1E3IA 2Z2JA 3D2LA 3LHKA 4ICIA 4J3NA 3IL2A 3IPLA 4DG8A 3DL4A 1ORVA 1L2TA 3GJ6A 3EFFK 5DN6A 2HZ7A 4ZVPA 5H59A 3VHQA 1S3SA 2PKXA 1CXZA 4WPGA 4PXSA 4MVJE 4Y2JA 5A03A 4ER3A 5L4NA 3NNNA 1U5BA 3QYFA 4MKHA 3AETB 4PCLA 4F97A 2JAWA 3NLLA 5LYYA 4CZ2A 2PZJA 5A9SA 3C8ZA 4CLXA 2YW2A 4C0QC 4Z8XA 3Q2KA 2XODA 4GOND 3H9QA 2B5WA 1K6MA 3DVLA 4UCXA 1VKZA 3OJLA 4R8SA 4ESHA 1HORA 1KAMA 2BONA 5LUBA 5CFLA 1PT8A 1EE2A 4P4TA 2QM7A 3OBWA 2HEIA 3HKCA 4GSYA 4K9LA 1KYOF 2YI9A 1HFWA 2WA1A 5KWJA 1QM5A 1AXEA 3EGXB 3HR8A 3NHRA 3CW9A 4ZIRA 2XCOA 5ENZA 4E1AA 3RRZA 4M9RA 4JL5A 3CC2F 3TDKA 2BEUB 2QN6A 4MVJA 1JVNA 4JI0O 4IJQA 4RVGA 4ZKEA 1YRBA 3T1QA 4ITUA 3IAFA 1Y9DA 3TTVA 1RWNA 3HCAA 4Y2VA 1ZXXA 4FZ5A 4RS4A 4FE4A 3CNNA 3T4PA 3ML1A 3WHKA 1EVIA 4MVYA 3MYYA 2C7OA 3CX6A 5IARA 4HBNA 2I22A 2JFNA 3GUCA 1FYFA 1NUSA 1NVAA 1C0LA 3V80A 3ZCTA 4UCSA 3WGMA 2PZLA 2XJ4A 2NU6B 4HP8A 4JSTA 3P1JA 4U7WA 5FF9A 4U7DA 2IH5A 5A9RA 1YJWV 2FN9A 3O1HB 1AXGA 1N7GA 3F2IA 5K1ZA 4LQLA 4EHJA 2L42A 2IBZH 1QCEA 2FTKE 2WW8A 1K5QA 1G4HA 4TZ0A 4J0KA 4LI3X 4BBZA 1V0JA 5JVDA 3GRKA 1U9ZA 4HB0A 4EI8A 4J7KA 1LCIA 1V8FA 2VP0A 1MEJA 3AO0B 3MIZA 3PDJA 1D1QA 4UAUA 5CFRA 1RQNA 1TIKA 1IL0A 2ZIMA 3L07A 3SKVA 1WDWB 2EQ5A 4BO6A 1YI2F 2C00A 4WDRA 4EMSA 2X6CA 2UU9B 3ZHRA 1US8A 3QLEA 1D2EA 4BQFA 1CUYA 4EEKA 4YJ2B 4TRRA 2GCGA 3JWIA 3NGLA 1AKWA 4U02A 4AJLA 3G5MA 3VH1A 3A1WA 4HNRA 1SXHA 1IMJA 4F4LA 5B5EZ 1J07A 1QLJA 1U0LA 1X77A 5GVRA 5BYJA 4JJ4A 3L6OO 2WZCA 2P6MA 4IDPA 2C2KA 3C8UA 2Q0AA 4LRYA 4QPZA 5DHUA 3U3JA 3UTCA 2QOEA 2UYYA 4UARA 1XUOA 1ZN7A 4G4IA 5FH9A 1MX1A 1G7RA 2NZ8A 1NW4A 4MGHA 5G0UA 4FLFA 2X1LA 3U4HA 1SRRA 1QYWA 3CCJV 4PCVA 3C4JA 3KXDA 4TZ6A 1DBQA 1IHUA 1QHXA 1CB0A 1P9RA 1FQWA 2WNHA 2Y05A 1CTQA 1FC0A 1U2GA 3T3IA 3DFIA 2O3TA 4KSCA 1KC1A 1Y34E 4YAJA 3ZWWA 1KUQA 5WRFA 2ZE5A 3VFDA 5IUJC 4ATNA 5HTOA 1Q81W 4IZ6A 4DKXA 3NCHA 4BCCA 3JQBC 1G291 2JJQA 2D4HA 4UPVA 2OGWA 4M8SA 4MQBA 3VQXA 1Y8RB 2V6BA 1QQTA 4AJ9A 4FKMA 4J07A 3OA2A 5ALSA 1GTOA 1BWSA 3F3KA 3KQYA 4JJIA 4CG1A 1H1LA 1XRMA 2EEZA 2R6AA 3FPEA 1L9XA 3JQFC 5CCEA 2P7TC 2FRXA 2Z4TA 2ZLBA 1FFYA 1CYEA 1R6XA 3A0RB 3I73A 4I55B 2X9LA 4QA9A 5K51A 2TMDA 1IWOA 2HSZA 2Q07A 1DFHA 5AD1A 4CXMA 1NQOA 1U1CA 2HIMA 3KKKA 4DC1A 1RRPA 3ZJUA 1MFZA 2XF2A 4ALJA 5F98A 3ROTA 3DFZA 3FTFA 1YCIA 3K5WA 4PIPA 1JEJA 4DCTA 1X94A 1HT2E 5EIWA 3DTNA 3L6DA 4JBNA 3CF2A 3DB1A 3L0ZA 3LK6A 3OE5A 3DW3X 4CIVA 3TD6A 4TMVA 3TI9A 4EB6A 4MJXA 2WUWE 2AMYA 3LSTA 3E8HA 5D3MA 1BDMA 1GZVA 1K1EA 2I33A 2P9TA 3FUXA 3PF8A 2HLNA 4YP9A 3U40A 3RM3A 4DCUA 2FMTA 3NWBA 1L1FA 4PNHA 3HEBA 2H8PC 4PC7A 4RDIA 5D6NA 2G9RA 3GB7C 4MUBA 4NFLA 1YVRA 3RSLA 3UWKA 2WDZA 1ZMTA 4LJSA 4U2FA 1K68A 3OPMA 1YR1A 4CU5A 4FEGA 4RFSB 5DHRA 4GCZA 2CD9A 4AJJA 5CLQA 5TS2A 2OBBA 2VNHA 5BSKA 1XKQA 2QQGA 5C2JB 1EH5A 3K9CA 2WI8A 1J0DA 4LMRA 4QDKA 5FUBA 1Z7EA 4RLQA 4LHYA 1KI7A 1LC3A 3D3EA 1UM9A 3ZZUA 4I4IA 1F38A 3RS0A 2WIGA 3VA7A 5C53B 2JB9A 4JAUA 3MQ2A 2V9PA 4LOHA 4N03A 2ARHA 4TMTA 4CKBA 7YASA 2XCQA 4RETA 2Z2YA 3WLKX 2ODQA 2PO5A 3UZUA 3CF6R 1SVNA 2ZSKA 4OLFA 4X8HA 2ID8A 1C3VA 4A9AA 1YXBA 1H66A 1AJNA 4HAIA 3T3GA 2DYSB 1P3Y1 2IS4A 1SDSA 1JQ5A 1KK2A 2I6UA 1BXRB 2MSKA 4DUPA 3VU3A 4ZCLA 4K3UA 3S2UA 4PYJA 1ZK4A 1VP7A 3UGQA 5AHKA 3LVQE 1QFMA 5EERA 4S0ZA 3TM5A 3RE3A 2VDUE 3OE4A 1VMDA 4V0RA 4ZI5A 2ZW9A 4HUJA 4AXXA 3GC6A 2ECKA 1VQVA 2XHBA 3CMEV 1H6CA 3C7KA 4DCSA 3VOSA 4GZMA 1PBTA 2P3SA 3V8BA 3DAFA 4Z1OA 2QI2A 1GTMA 3AR5A 3QW2A 2WA3A 3V33A 1SUSA 5JJEB 4C1NA 3NHSA 4C4PA 4PX3A 1B14A 1FS6A 1N2HA 3D81A 1EBBA 3N2EA 5L7YA 4JYMA 1NDHA 3O6VA 2GNOA 1K5DA 1XBLA 4W1SA 2W37A 5PGMA 1KI3A 1Z5PA 3SQXA 2V7UA 3CEIA 5B7NA 1M1ZA 2ZFUA 4JEHA 4YLYA 1I7NA 3JRXA 4B46A 2PWAA 2BE3A 3BVPA 4OJMX 1YITV 1RAEA 3NM5A 2GN8A 4IUYA 1QQ5A 3NBZC 4UAVA 2VQFO 3FCAA 3M33A 4XIGS 3BCRA 5IE9A 3QSYA 3S7ZA 3AB7A 1VIDA 2P9ZA 4YWJA 1I13A 1C3OB 1BXRA 4NYMQ 4XJVA 1FNMA 4ZAGA 2FZEA 1D6JA 2ORWA 1P72A 2OTCA 2HFKA 5E1OA 2PZGA 3TX6A 3TVDA 3A9VA 3MTQA 1SPXA 2NQTA 1W5BA 1DX4A 1P84F 1ZSYA 3ZRWA 2B8TA 2FR8A 2QJFA 2OE2A 2Z5GA 3E03A 4F4FA 1YFLA 1RMYA 2FWNA 4LHWA 4B08A 1Z0AA 2W6JA 2PYLA 4DR5O 2WHQA 2VA9A 4ZGBA 1HL3A 5B7QA 5KOJA 3IILA 3TGWA 3DHYA 1J33A 2GQ0A 1POXA 1ZNWA 3G5AA 1YRAA 4BV3A 5JECA 3LH5A 5G2OA 2GEKA 3R44A 4XIFA 3OZWA 4N54A 5JS2A 4JITA 1C7FA 1RXIA 2YASA 4H1HA 4IQFA 3CZPA 4OGGA 3RQIA 3CU5A 5DCVA 1A9XB 1N5LA 3E8XA 4DLXA 1A71A 4UHFA 1ZH2A 4KQEA 5EMLA 1Q0RA 3ECAA 3BWBA 3BXZA 1T4CA 3B7GA 5FOXA 5IMBA 5IYZF 4P4SA 4RHYA 1PUJA 3VSEA 4B76A 5AW7A 3AVVA 4Z9YA 1MMFB 1OBCA 4LSZA 1Q95A 4U7PB 3OOHA 4L07A 5KC8A 1XTZA 3MJRA 1IY1A 3D7NA 3VNAA 3IB3A 3A4TA 4JKYA 5JCJA 2FPOA 4UVAA 3LCUA 1MX3A 3UUEA 1X7ZA 4DRXA 4Y98A 2QJRA 3DMTC 3TIIA 2XAGA 3WR5A 1UBSB 1GPH1 1T25A 3IQEA 1MO2A 1OHHD 4LYFA 1G3MA 1WUKS 2QN8A 1FTWA 2XRMA 3A1FA 4NENA 4QT0A 1P7BA 4QYTA 2Z5VA 3C6XA 3WY9A 2PWBA 3KWLA 4HEHA 3OFND 4CC6A 4B43A 1TAUA 3K03A 3K9AA 4INOA 4MGKR 4RKFA 4UQOA 5E4TA 4D6PA 1PEAA 1EJ0A 4OMCA 2HAEA 2ORED 3ENKA 1SAYA 1SUDA 2C03A 2ATIA 1E0SA 2V6FA 5LZ9A 4MDHA 3AY0A 1SG9A 1EP9A 3K9SA 3BY6A 1T1EA 5L3ZA 4EJSB 4E5DA 1GNTA 3LF2A 3O3CA 4QO7A 5LXTF 1AKRA 3RABA 3UOWA 3RHTA 1KARA 1H2KA 1QZZA 1I4TD 5GTHZ 3E9YA 2WD7B 5HSGA 1WXDA 1I5OA 1JILA 1FMLA 3DLPX 1G5IA 1POWA 3B9PA 3H3XA 3H1KH 2EBFX 1MGOA 4QUAA 3EN0A 3KDAA 4MWDA 1N0HA 1Z39A 3OZTA 1X1CA 3QWBA 4QTZA 4RXUA 5DX8A 4M9XA 4REQB 3VR4D 5K0EA 4B71A 5KIAA 2KKWA 1PU2A 4OB7A 5HF5A 3AOGA 2RK6A 1OFUX 4NHOA 3U60B 3QFSA 1T2AA 2JJ1D 4LFAB 3PE3A 1TGOA 1SXJA 3UHOA 4BQOA 3P71T 4KQFA 2R62A 4UUQA 4A92A 1XYGA 5J2UB 2WTAA 5IAOA 4OXKA 4MUJA 4AURA 3DCYA 1E9EA 4BLPA 1SJ9A 3ABMB 4OHOA 1EP3B 4UUBA 4ECEA 2W6PA 2ZOVA 3JR3A 3FB6C 4KQ1A 4S1TA 4TV8F 4A5SA 4DG5A 5BWBA 3WFJA 2R4UA 3QMMA 1Z38A 2HLDG 1OAPA 2DMXA 1ECPA 1R9NA 1TZMA 3PWKA 4M1QA 4RW0A 1IIBA 4UXNA 2EBHX 3HSKA 3M6WA 3NIBA 5KYYB 1RQ7A 2MT9A 3Q3EA 4HLUA 3RKUA 5LMZA 5BNIA 4BUJA 2ORYA 3KIZA 2H65A 5E6RB 1KBHA 1TOAA 1XN4A 1P6QA 3KR2A 1P9WA 1LEHA 1J9GA 4C6HA 3D5EA 1AB5A 1FRZA 3I5MA 5AW9A 3QEMA 1ST2A 2QW0X 4JI3B 2YJTD 4IXNA 1W581 4UEJA 4BNDB 3O94A 3SYNA 1NOKA 4NC9A 1U7OA 5BN1A 2VYNA 5EJ8A 2EILB 4HVTA 1GPUA 2UUBB 1WOYA 2PD6A 3HCBA 2AIFA 4OATA 1Z0ZA 3KB1A 3VDMA 1LJUA 2QMZA 1T4GA 2FOLA 4A1OA 4B1FA 2C7VA 3O8BA 3AV0B 3RGBA 4XXHA 2OCIA 4K3AA 2P8JA 4F3RA 2EILC 3A2LA 2RAPA 3RF6A 3VV2A 4GPAA 2QZ4A 1LU9A 3QEKA 3UCXA 3WLNA 4D0SA 1PQWA 2BOBC 5GVSA 3G0CA 4C0JA 1DIHA 2YV5A 1K7CA 4MVJF 1XCOA 1U3UA 4ND8A 5DPMA 5DTEA 1U1FA 3CGWA 1U8TA 3ROZA 1KMHB 2WV9A 4F6RA 4BVBA 1OYWA 2OAGA 2LV8A 3F0DA 2Y27A 4HS4A 4IV5A 2OHOA 4G0OA 1T3TA 4NZPA 4IEIA 2BGKA 2HLPA 3IBYA 4GVLA 4IINA 4B3MB 2Y1DA 1Y3CE 4MSWC 3I42A 1ZM4A 4FCVA 4H9GA 4FINA 2LR0A 1Q8IA 5C8VA 1A9RA 3VBEA 4O4JB 4L57A 3UA3A 3OR7C 2DFKB 2M6SA 4TTRA 3IGFA 1L7NA 1WRBA 1Z4JA 5HZGA 2BI7A 1SU6A 4G86A 4IGIA 3P9IA 4PVDA 5IBCA 2DMRA 2ZBGA 4YN3A 4LH6A 4KDRA 3H8VA 4IQ0A 5JSFA 5LLTA 2NZUG 3T1NA 2QX9A 2XSZA 3H8WA 1GYRA 2Z58A 1JF8A 2W0XA 4QATA 4ZAWA 2J5BA 3OG9A 3BE5A 4QEDA 1DBWA 3HAXD 5AFSA 1VQ1A 1QR8A 4DPKA 3NDIA 1AI7A 5A3RA 4DCJA 4PGAA 4ZQCB 3GBSA 3BXFA 3STWA