5DCVA

Crystal structure of phorpp38-sl12m complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of a kink-turn motif by an archaeal homologue of human RNase P protein Rpp38
pubmed doi rcsb
source organism Pyrococcus horikoshii (strain atcc 700860 / dsm 12428 / jcm 9974 / nbrc 100139 /
molecule tags Rna binding protein/rna
molecule keywords 50S ribosomal protein L7Ae
total genus 34
structure length 118
sequence length 118
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5dcvA00
3V7QA 4BY9D 1GO0A 5G4VC 1KD1H 3RA5A 2CZWA 3CCRF 3I56F 1VQ7F 3CCSF 3CPWF 1K73H 1VQOF 1VQNF 2I6DA 2JNBA 2QI2A 1Q82H 1Q7YH 2FC3A 1YHQF 2LBXA 2OTLF 3CD6F 4C4WC 5GIOC 2VGNA 3NK7A 4TZZA 1IPAA 2BO1A 1Q86H 1NMUB 3G6EF 5DCVA 5EWRA 3CCVF 3VI6A 5GIPC 3E20B 1VQMF 1XBIA 3LFOA 5A2QM 1Q81H 3NMUC 3I55F 3RA6A 5EO3A 3WXMB 3JCMM 1X52A 3JAMM 1W3EX 1VQ5F 3CMEF 3J80M 1DT9A 3CXCF 1VQLF 1X7PA 2KTUA 3CC2F 1T0KB 1W2BF 1VQ9F 1PXWA 3IR9A 1QVFF 3LWOC 2WALA 3HJWC 3CC7F 3N4YA 1K9MH 1ZWZA 5GINC 1VQ4F 1W42A 3VMFB 1KC8H 2KG4A 3N4ZA 3CC4F 3FFMA 2VGMA 1N8RH 1RLGA 3CCUF 2QA4F 2OTJF 1YJ9F 4X3LA 1M1KH 3CCJF 1E7KA 3LWRC 1W41A 1VQ8F 1YI2F 3CCEF 3G71F 1VQKF 4X3MA 2OHWA 1RA4A 3CMAF 5GANK 3CCMF 1QVGF 3CCQF 3CCLF 1M90H 3ON1A 5FLXM 1S72F 3GYQA 3HAXD 1SDSA 4LCKA 3CPQA 1VQPF 3NVIB 3O85A 3J7AR 1GO1A 3E1YA 2QEXF 2AIFA 3LWVC 2KTVA 2LBWA 1H7MA 3LWQC 3PLAC 3SIUA 1JJ2F 5G4UC 3PAFA 3LWPC 3SIVA 2ALEA 3AGKA 1KQSF 3NVKE 4BW0B 1NJIH 2OZBA 3OBYA 1CK2A 4NUTA 5IT9M 1X7OA 5FJ4C 3V7EA 3J81M 1W40A 1GZ0A 3OBWA 1YJNF 1CN7A 1YJWF 1K8AH 5GAPK 3NK6A 1VQ6F 2HVYD 3CG6A 3G4SF 1YITF 1YIJF 3OW2F 3MCAB
chains in the Genus database with same CATH superfamily
1YQNA 1GO0A 2I6RA 3VYUC 3RA5A 2CZWA 3CCRF 1KD1H 5BMVA 3CCSF 3CPWF 5B8FA 4U3JB 5MN4A 3C9TA 2JNBA 1Q82H 5IYZB 3UT5A 4BT3A 2FC3A 3CD6F 4O4JB 5EYPA 3D00A 2VGNA 3NK7A 4TZZA 1Q86H 1UI9A 1CLIA 4U3JA 4X1YA 1GX1A 1U43A 1XV2A 5GIPC 4YJ3A 1VHAA 5HY4A 3KHNA 3I3FA 4O2BB 1W5EA 3N2GB 3RA6A 5JVDA 1R1MA 5JQGA 3C8LA 4G4WA 3WJPA 4ZHQB 5GONB 3J80M 1DT9A 5MN5A 3QHDA 3RYIB 5IJ0B 5J2TB 2BTUA 2CVLA 3VOBA 3HKBA 5IJ9B 1PXWA 3IEQA 4EB6A 3DDNA 1QVFF 3N4YA 3FPIA 1ZWZA 1H48A 4TUYB 1W42A 2HX0A 1KC8H 2KG4A 2VGMA 5C8YB 1Z5VA 2Z1UA 3JVHA 4ZHVA 3ELCA 5EYPB 4O4IB 2OTJF 3OONA 3R0PA 2Q1YA 3LWRC 1JY8A 1VQ8F 1YI2F 3CCEF 5MN6A 4IIJB 1RA4A 2B33A 3TD3A 4X20B 4DRXB 3WGMA 5GANK 1QVGF 4HNAA 5EZYB 1IV3A 2N48A 3B6NA 5HP7A 3FD5A 5KMGA 3GYQA 3HAXD 4LCKA 2V9YA 3D54A 3VYTC 4BT4A 3BYQA 2PMPA 2AIFA 3P4EA 2CWJA 3QTYA 5HY2A 3SIUA 3M84A 1W581 3JAKB 3MCQA 1JN1A 4G4YA 1KQSF 1NJIH 5C8YA 5IT9M 1X7OA 3N2GA 5HXUA 3OBWA 1CN7A 2HP0B 4FFBA 2OTMA 2LBTA 1K8AH 4TV8B 5EB1B 5GAPK 3NK6A 3S06A 2HVYD 3MBMA 4TV9A 3G4SF 1UFYA 1FNKA 3OW2F 1J7HA 3UT5B 3VO8A 5EZYA 1FFXA 5J2TA 1ONIA 4ZOLA 3HKDB 1VQ7F 3TD5A 5KMGB 1W59A 1VQOF 1VQNF 5JQGB 1JFFB 3VOAA 5JCOA 5ITZB 4G4VA 1DBFA 4XCQA 3WPXA 1XRGA 2UYJA 4C4WC 2P6YA 2HRYA 3G6EF 5DCVA 5EWRA 2ZOVA 2AIZP 1PF5A 3F0EA 5LA6B 2IAFA 3WJQA 3I55F 3FBAA 5IYZA 3JCMM 1X52A 3JAMM 3F6MA 4C81A 5EIBD 3CMEF 4KWEA 3CXCF 4O4HA 1VQLF 4I4TA 4EI8A 2GVIA 4I50B 3CC2F 3C9RA 4ZHQA 2BTQB 5LYJA 1XHOA 5AVMA 5KX5B 1W2BF 3RYCB 1VQ9F 4X20A 4DRXA 3ZOPA 3HJWC 3CC7F 1U3LA 3HKCA 4BVRA 3K2XA 1Z5WA 3FFMA 3V3TA 3HWUA 1N8RH 4ZK7A 3WGLA 1RLGA 4O4JA 5LA6A 2ZODA 3EORA 2AMTA 3CCJF 1W41A 2UYPA 3CMAF 1TUBB 3CCLF 3E22B 5FLXM 4G4XA 3VYSC 1IV4A 3M1XA 3HKEA 1SDSA 4G4ZA 3CPQA 4O4LA 3C9SA 3NVIB 3J7AR 1GO1A 2HP0A 4BT2A 4ZHYB 3FD6A 3S0YA 2RHOA 1H7MA 2LBWA 4O2AA 1FSZA 5EB0A 4NQ3A 3JATB 2KGWA 5G4UC 4O2BA 2F9ZC 3VIUA 4BT7A 2HS3A 2ALEA 3AGKA 1U3PA 4EB6B 4NUTA 5FJ4C 1GZ0A 1YJNF 3HKCB 2ZAUA 3RYFB 2LCAA 3M4SA 3MDOA 4B45A 3CYPB 5LP6B 2DYYA 4C8GA 2UZHA 5IJ0A 4YJ2A 3JASB 4F6RB 1YIJF 5LYJB 3VCZA 2WALA 3V7QA 4BY9D 5ITZA 3IKEA 5EAZA 2R6R1 1TUBA 5G4VC 2Z1TA 1QU9A 4C82A 1K73H 3JASA 2I6DA 3JAWA 3S02A 5HY1A 4YJ2B 5LP6A 4X1IA 3WGJA 1YHQF 2LBXA 1JD1A 3RE3A 1IPAA 2BO1A 1KNJA 5FNVB 3RYHB 1NMUB 3VTIC 3CCVF 2Q1XA 2R751 2EWCA 3E20B 2VAMA 4U39A 1IV2A 2Z1EA 1XBIA 5A2QM 1Q81H 5IJ9A 2HQSC 3WXMB 5J2UA 4ZI7A 3KJJA 5CB4A 5CA1B 2CSLA 5JH7B 4PWTA 1X7PA 1T0KB 1SZQA 4R40B 2UYKA 2GLZA 2VAWA 3P0ZA 4C8IA 3LWOC 2UYNB 1QAHA 4O4HB 2Z1FA 4IHJB 4ERHA 1K9MH 1VQ4F 5CB4B 3ZO8A 1TVKB 4NWOB 5FNVA 3CYQA 4EI9A 2G9IA 4WBNB 2L26A 3CCUF 4LNUA 2QA4F 4X1IB 1YJ9F 3F0DA 1M1KH 4X1KB 3HKEB 3RYHA 2RHJA 4X3MA 4ZHWA 1OFUA 2H6LA 1W57A 1H47A 1QD9A 1SA0A 3HKDA 3K14A 2HS4A 3CCMF 4I55B 2PHNA 1FFXB 3ON1A 3JARA 3JALA 4I50A 3ESJA 1T0AA 1VQVA 1VQPF 3JARB 2ZVYA 3O85A 2VAPA 1NQ3A 2QEXF 3HTNA 4BT6A 1W55A 3ZP7A 2BTOA 4IIJA 3KJKA 1JJ2F 2IG8A 3GHZA 1YGYA 2QTPA 4TV8A 4BVSA 3SIVA 4RHAA 4WBNA 3C9UA 1CK2A 3OBYA 5JVDB 3V7EA 1TVKA 4TUYA 3V4DA 2CW4A 3N2KA 3F0GA 2ZF8A 2MQEA 3JAKA 1JFFA 2RB9A 3ERNA 3WGKA 1YITF 3HKBB 3L7QA 3E22A 3LDTA 1OAPA 1RQ7A 1VH8A 3MCAB 3S0HA 1COMA 4B62A 5EIBC 2NMUA 4E6EA 4I55A 4O4LB 1VK3A 2CHTA 1X25A 3I56F 2ZVZA 5LOVA 4ZI7B 2QI2A 3S03A 4FFBB 1Q7YH 2OTLF 4O4IA 5JCOC 4EI7A 5GIOC 2IQQA 4F6RA 3TD4A 5LXTB 2RHLA 2YYEA 3VI6A 3MQWA 5LP6C 1W5AA 5CA0A 4LNUB 3KE1A 1VQMF 3GTZA 3CB2A 3LFOA 5HXZA 3NMUC 5KX5A 4B46A 5EO3A 3WJRA 1W3EX 1FNJA 2W8BC 1VQ5F 4IHJA 1RQ2A 4TV9B 2UYNA 3WGNA 4B5CA 2FGYA 4G88A 1Q8RA 3S0WA 1ODEA 2KTUA 1RLUA 4BT5A 4O2AB 3K0TA 3QUWA 1W5FA 5J2UB 3RYIA 3IR9A 2GZLA 4I4TB 5GINC 3VMFB 3T80A 3N4ZA 3WPWA 3CC4F 5LXTA 5HWEA 4YJ3B 3ZP4A 2K1SA 4X3LA 5CA0B 4X1YB 2H8CA 1E7KA 2Z01A 3I7TA 1KNKA 3G71F 1VQKF 3JATA 2OHWA 3LYBA 3JALB 3DC2A 3CCQF 1M90H 2HS0A 1SA0B 5LOVB 1S72F 5HY0A 4DXDA 5BMVB 3U0OA 5JH7A 4ZOLB 4BVQA 5CA1A 4X1KA 3N2KB 3E1YA 3D01A 3LWVC 3F0FA 2KTVA 3LWQC 3PLAC 2H8EA 2DT4A 2HRUA 4M8IA 3PAFA 1U40A 3K12A 3Q8HA 3LWPC 3IMPA 3RYFA 4C8EA 3NVKE 4BW0B 1IV1A 2OZBA 1W5BA 3J81M 1W40A 3IEWA 5HP8A 1YJWF 3P10A 1VQ6F 2RHHA 3LMEA 4RQOA 3CG6A 3JAWB 3RYCA 5GONA 4BVTA 2VXYA 3IKFA 2YXZA 2CHSA 2HP3A 4HNAB 3KIZA
chains in the Genus database with same CATH topology
3V7QA 4BY9D 1GO0A 5G4VC 1KD1H 3RA5A 2CZWA 3CCRF 3I56F 1VQ7F 3CCSF 3CPWF 1K73H 1VQOF 1VQNF 2I6DA 5HY1A 2JNBA 2QI2A 1Q82H 4XCQA 1Q7YH 2FC3A 1YHQF 2LBXA 2OTLF 3CD6F 4EI7A 4C4WC 5GIOC 3D00A 2VGNA 3NK7A 4TZZA 1IPAA 2BO1A 1Q86H 1NMUB 3G6EF 5DCVA 5EWRA 3CCVF 3VI6A 5GIPC 3E20B 1VQMF 1XBIA 3LFOA 5HY4A 5HXZA 5A2QM 1Q81H 3NMUC 3I55F 3RA6A 5EO3A 3WXMB 3JCMM 1X52A 3JAMM 1W3EX 1VQ5F 3CMEF 3J80M 1DT9A 3CXCF 1VQLF 2FGYA 4EI8A 1X7PA 2KTUA 3CC2F 1T0KB 1W2BF 2GLZA 1VQ9F 1PXWA 3IR9A 1QVFF 2WALA 3LWOC 3HJWC 3CC7F 3N4YA 1K9MH 1ZWZA 5GINC 1VQ4F 1W42A 3VMFB 4BVRA 2KG4A 1KC8H 3N4ZA 3CC4F 3FFMA 2VGMA 5HWEA 3V3TA 4EI9A 1N8RH 1RLGA 3CCUF 2QA4F 2OTJF 1YJ9F 4X3LA 1M1KH 3CCJF 1E7KA 3LWRC 1W41A 1VQ8F 1YI2F 3CCEF 3G71F 1VQKF 4X3MA 2OHWA 1RA4A 3CMAF 5GANK 3CCMF 1QVGF 3CCQF 3CCLF 1M90H 3ON1A 5FLXM 1S72F 5HY0A 3GYQA 3HAXD 1SDSA 4LCKA 3CPQA 1VQPF 4BVQA 3NVIB 3O85A 3J7AR 1GO1A 3E1YA 2QEXF 2AIFA 3LWVC 2KTVA 2LBWA 1H7MA 3LWQC 4NQ3A 5HY2A 3PLAC 3SIUA 1JJ2F 5G4UC 3PAFA 3LWPC 4BVSA 3SIVA 2F9ZC 2ALEA 3AGKA 1KQSF 3NVKE 4BW0B 1NJIH 2OZBA 3OBYA 1CK2A 4NUTA 5IT9M 1X7OA 5FJ4C 3V7EA 3J81M 1W40A 5HXUA 1GZ0A 3OBWA 1YJNF 1CN7A 1YJWF 1K8AH 5GAPK 3NK6A 1VQ6F 2HVYD 3CG6A 3G4SF 4BVTA 1YITF 1YIJF 3OW2F 3MCAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7Q A;  4BY9 D;  1GO0 A;  5G4V C;  1KD1 H;  3RA5 A;  2CZW A;  3CCR F;  3I56 F;  1VQ7 F;  3CCS F;  3CPW F;  1K73 H;  1VQO F;  1VQN F;  2I6D A;  2JNB A;  2QI2 A;  1Q82 H;  1Q7Y H;  2FC3 A;  1YHQ F;  2LBX A;  2OTL F;  3CD6 F;  4C4W C;  5GIO C;  2VGN A;  3NK7 A;  4TZZ A;  1IPA A;  2BO1 A;  1Q86 H;  1NMU B;  3G6E F;  5DCV A;  5EWR A;  3CCV F;  3VI6 A;  5GIP C;  3E20 B;  1VQM F;  1XBI A;  3LFO A;  5A2Q M;  1Q81 H;  3NMU C;  3I55 F;  3RA6 A;  5EO3 A;  3WXM B;  3JCM M;  1X52 A;  3JAM M;  1W3E X;  1VQ5 F;  3CME F;  3J80 M;  1DT9 A;  3CXC F;  1VQL F;  1X7P A;  2KTU A;  3CC2 F;  1T0K B;  1W2B F;  1VQ9 F;  1PXW A;  3IR9 A;  1QVF F;  3LWO C;  2WAL A;  3HJW C;  3CC7 F;  3N4Y A;  1K9M H;  1ZWZ A;  5GIN C;  1VQ4 F;  1W42 A;  3VMF B;  1KC8 H;  2KG4 A;  3N4Z A;  3CC4 F;  3FFM A;  2VGM A;  1N8R H;  1RLG A;  3CCU F;  2QA4 F;  2OTJ F;  1YJ9 F;  4X3L A;  1M1K H;  3CCJ F;  1E7K A;  3LWR C;  1W41 A;  1VQ8 F;  1YI2 F;  3CCE F;  3G71 F;  1VQK F;  4X3M A;  2OHW A;  1RA4 A;  3CMA F;  5GAN K;  3CCM F;  1QVG F;  3CCQ F;  3CCL F;  1M90 H;  3ON1 A;  5FLX M;  1S72 F;  3GYQ A;  3HAX D;  1SDS A;  4LCK A;  3CPQ A;  1VQP F;  3NVI B;  3O85 A;  3J7A R;  1GO1 A;  3E1Y A;  2QEX F;  2AIF A;  3LWV C;  2KTV A;  2LBW A;  1H7M A;  3LWQ C;  3PLA C;  3SIU A;  1JJ2 F;  5G4U C;  3PAF A;  3LWP C;  3SIV A;  2ALE A;  3AGK A;  1KQS F;  3NVK E;  4BW0 B;  1NJI H;  2OZB A;  3OBY A;  1CK2 A;  4NUT A;  5IT9 M;  1X7O A;  5FJ4 C;  3V7E A;  3J81 M;  1W40 A;  1GZ0 A;  3OBW A;  1YJN F;  1CN7 A;  1YJW F;  1K8A H;  5GAP K;  3NK6 A;  1VQ6 F;  2HVY D;  3CG6 A;  3G4S F;  1YIT F;  1YIJ F;  3OW2 F;  3MCA B; 
#chains in the Genus database with same CATH topology
 1YQN A;  1GO0 A;  2I6R A;  3VYU C;  3RA5 A;  2CZW A;  3CCR F;  1KD1 H;  5BMV A;  3CCS F;  3CPW F;  5B8F A;  4U3J B;  5MN4 A;  3C9T A;  2JNB A;  1Q82 H;  5IYZ B;  3UT5 A;  4BT3 A;  2FC3 A;  3CD6 F;  4O4J B;  5EYP A;  3D00 A;  2VGN A;  3NK7 A;  4TZZ A;  1Q86 H;  1UI9 A;  1CLI A;  4U3J A;  4X1Y A;  1GX1 A;  1U43 A;  1XV2 A;  5GIP C;  4YJ3 A;  1VHA A;  5HY4 A;  3KHN A;  3I3F A;  4O2B B;  1W5E A;  3N2G B;  3RA6 A;  5JVD A;  1R1M A;  5JQG A;  3C8L A;  4G4W A;  3WJP A;  4ZHQ B;  5GON B;  3J80 M;  1DT9 A;  5MN5 A;  3QHD A;  3RYI B;  5IJ0 B;  5J2T B;  2BTU A;  2CVL A;  3VOB A;  3HKB A;  5IJ9 B;  1PXW A;  3IEQ A;  4EB6 A;  3DDN A;  1QVF F;  3N4Y A;  3FPI A;  1ZWZ A;  1H48 A;  4TUY B;  1W42 A;  2HX0 A;  1KC8 H;  2KG4 A;  2VGM A;  5C8Y B;  1Z5V A;  2Z1U A;  3JVH A;  4ZHV A;  3ELC A;  5EYP B;  4O4I B;  2OTJ F;  3OON A;  3R0P A;  2Q1Y A;  3LWR C;  1JY8 A;  1VQ8 F;  1YI2 F;  3CCE F;  5MN6 A;  4IIJ B;  1RA4 A;  2B33 A;  3TD3 A;  4X20 B;  4DRX B;  3WGM A;  5GAN K;  1QVG F;  4HNA A;  5EZY B;  1IV3 A;  2N48 A;  3B6N A;  5HP7 A;  3FD5 A;  5KMG A;  3GYQ A;  3HAX D;  4LCK A;  2V9Y A;  3D54 A;  3VYT C;  4BT4 A;  3BYQ A;  2PMP A;  2AIF A;  3P4E A;  2CWJ A;  3QTY A;  5HY2 A;  3SIU A;  3M84 A;  1W58 1;  3JAK B;  3MCQ A;  1JN1 A;  4G4Y A;  1KQS F;  1NJI H;  5C8Y A;  5IT9 M;  1X7O A;  3N2G A;  5HXU A;  3OBW A;  1CN7 A;  2HP0 B;  4FFB A;  2OTM A;  2LBT A;  1K8A H;  4TV8 B;  5EB1 B;  5GAP K;  3NK6 A;  3S06 A;  2HVY D;  3MBM A;  4TV9 A;  3G4S F;  1UFY A;  1FNK A;  3OW2 F;  1J7H A;  3UT5 B;  3VO8 A;  5EZY A;  1FFX A;  5J2T A;  1ONI A;  4ZOL A;  3HKD B;  1VQ7 F;  3TD5 A;  5KMG B;  1W59 A;  1VQO F;  1VQN F;  5JQG B;  1JFF B;  3VOA A;  5JCO A;  5ITZ B;  4G4V A;  1DBF A;  4XCQ A;  3WPX A;  1XRG A;  2UYJ A;  4C4W C;  2P6Y A;  2HRY A;  3G6E F;  5DCV A;  5EWR A;  2ZOV A;  2AIZ P;  1PF5 A;  3F0E A;  5LA6 B;  2IAF A;  3WJQ A;  3I55 F;  3FBA A;  5IYZ A;  3JCM M;  1X52 A;  3JAM M;  3F6M A;  4C81 A;  5EIB D;  3CME F;  4KWE A;  3CXC F;  4O4H A;  1VQL F;  4I4T A;  4EI8 A;  2GVI A;  4I50 B;  3CC2 F;  3C9R A;  4ZHQ A;  2BTQ B;  5LYJ A;  1XHO A;  5AVM A;  5KX5 B;  1W2B F;  3RYC B;  1VQ9 F;  4X20 A;  4DRX A;  3ZOP A;  3HJW C;  3CC7 F;  1U3L A;  3HKC A;  4BVR A;  3K2X A;  1Z5W A;  3FFM A;  3V3T A;  3HWU A;  1N8R H;  4ZK7 A;  3WGL A;  1RLG A;  4O4J A;  5LA6 A;  2ZOD A;  3EOR A;  2AMT A;  3CCJ F;  1W41 A;  2UYP A;  3CMA F;  1TUB B;  3CCL F;  3E22 B;  5FLX M;  4G4X A;  3VYS C;  1IV4 A;  3M1X A;  3HKE A;  1SDS A;  4G4Z A;  3CPQ A;  4O4L A;  3C9S A;  3NVI B;  3J7A R;  1GO1 A;  2HP0 A;  4BT2 A;  4ZHY B;  3FD6 A;  3S0Y A;  2RHO A;  1H7M A;  2LBW A;  4O2A A;  1FSZ A;  5EB0 A;  4NQ3 A;  3JAT B;  2KGW A;  5G4U C;  4O2B A;  2F9Z C;  3VIU A;  4BT7 A;  2HS3 A;  2ALE A;  3AGK A;  1U3P A;  4EB6 B;  4NUT A;  5FJ4 C;  1GZ0 A;  1YJN F;  3HKC B;  2ZAU A;  3RYF B;  2LCA A;  3M4S A;  3MDO A;  4B45 A;  3CYP B;  5LP6 B;  2DYY A;  4C8G A;  2UZH A;  5IJ0 A;  4YJ2 A;  3JAS B;  4F6R B;  1YIJ F;  5LYJ B;  3VCZ A;  2WAL A;  3V7Q A;  4BY9 D;  5ITZ A;  3IKE A;  5EAZ A;  2R6R 1;  1TUB A;  5G4V C;  2Z1T A;  1QU9 A;  4C82 A;  1K73 H;  3JAS A;  2I6D A;  3JAW A;  3S02 A;  5HY1 A;  4YJ2 B;  5LP6 A;  4X1I A;  3WGJ A;  1YHQ F;  2LBX A;  1JD1 A;  3RE3 A;  1IPA A;  2BO1 A;  1KNJ A;  5FNV B;  3RYH B;  1NMU B;  3VTI C;  3CCV F;  2Q1X A;  2R75 1;  2EWC A;  3E20 B;  2VAM A;  4U39 A;  1IV2 A;  2Z1E A;  1XBI A;  5A2Q M;  1Q81 H;  5IJ9 A;  2HQS C;  3WXM B;  5J2U A;  4ZI7 A;  3KJJ A;  5CB4 A;  5CA1 B;  2CSL A;  5JH7 B;  4PWT A;  1X7P A;  1T0K B;  1SZQ A;  4R40 B;  2UYK A;  2GLZ A;  2VAW A;  3P0Z A;  4C8I A;  3LWO C;  2UYN B;  1QAH A;  4O4H B;  2Z1F A;  4IHJ B;  4ERH A;  1K9M H;  1VQ4 F;  5CB4 B;  3ZO8 A;  1TVK B;  4NWO B;  5FNV A;  3CYQ A;  4EI9 A;  2G9I A;  4WBN B;  2L26 A;  3CCU F;  4LNU A;  2QA4 F;  4X1I B;  1YJ9 F;  3F0D A;  1M1K H;  4X1K B;  3HKE B;  3RYH A;  2RHJ A;  4X3M A;  4ZHW A;  1OFU A;  2H6L A;  1W57 A;  1H47 A;  1QD9 A;  1SA0 A;  3HKD A;  3K14 A;  2HS4 A;  3CCM F;  4I55 B;  2PHN A;  1FFX B;  3ON1 A;  3JAR A;  3JAL A;  4I50 A;  3ESJ A;  1T0A A;  1VQV A;  1VQP F;  3JAR B;  2ZVY A;  3O85 A;  2VAP A;  1NQ3 A;  2QEX F;  3HTN A;  4BT6 A;  1W55 A;  3ZP7 A;  2BTO A;  4IIJ A;  3KJK A;  1JJ2 F;  2IG8 A;  3GHZ A;  1YGY A;  2QTP A;  4TV8 A;  4BVS A;  3SIV A;  4RHA A;  4WBN A;  3C9U A;  1CK2 A;  3OBY A;  5JVD B;  3V7E A;  1TVK A;  4TUY A;  3V4D A;  2CW4 A;  3N2K A;  3F0G A;  2ZF8 A;  2MQE A;  3JAK A;  1JFF A;  2RB9 A;  3ERN A;  3WGK A;  1YIT F;  3HKB B;  3L7Q A;  3E22 A;  3LDT A;  1OAP A;  1RQ7 A;  1VH8 A;  3MCA B;  3S0H A;  1COM A;  4B62 A;  5EIB C;  2NMU A;  4E6E A;  4I55 A;  4O4L B;  1VK3 A;  2CHT A;  1X25 A;  3I56 F;  2ZVZ A;  5LOV A;  4ZI7 B;  2QI2 A;  3S03 A;  4FFB B;  1Q7Y H;  2OTL F;  4O4I A;  5JCO C;  4EI7 A;  5GIO C;  2IQQ A;  4F6R A;  3TD4 A;  5LXT B;  2RHL A;  2YYE A;  3VI6 A;  3MQW A;  5LP6 C;  1W5A A;  5CA0 A;  4LNU B;  3KE1 A;  1VQM F;  3GTZ A;  3CB2 A;  3LFO A;  5HXZ A;  3NMU C;  5KX5 A;  4B46 A;  5EO3 A;  3WJR A;  1W3E X;  1FNJ A;  2W8B C;  1VQ5 F;  4IHJ A;  1RQ2 A;  4TV9 B;  2UYN A;  3WGN A;  4B5C A;  2FGY A;  4G88 A;  1Q8R A;  3S0W A;  1ODE A;  2KTU A;  1RLU A;  4BT5 A;  4O2A B;  3K0T A;  3QUW A;  1W5F A;  5J2U B;  3RYI A;  3IR9 A;  2GZL A;  4I4T B;  5GIN C;  3VMF B;  3T80 A;  3N4Z A;  3WPW A;  3CC4 F;  5LXT A;  5HWE A;  4YJ3 B;  3ZP4 A;  2K1S A;  4X3L A;  5CA0 B;  4X1Y B;  2H8C A;  1E7K A;  2Z01 A;  3I7T A;  1KNK A;  3G71 F;  1VQK F;  3JAT A;  2OHW A;  3LYB A;  3JAL B;  3DC2 A;  3CCQ F;  1M90 H;  2HS0 A;  1SA0 B;  5LOV B;  1S72 F;  5HY0 A;  4DXD A;  5BMV B;  3U0O A;  5JH7 A;  4ZOL B;  4BVQ A;  5CA1 A;  4X1K A;  3N2K B;  3E1Y A;  3D01 A;  3LWV C;  3F0F A;  2KTV A;  3LWQ C;  3PLA C;  2H8E A;  2DT4 A;  2HRU A;  4M8I A;  3PAF A;  1U40 A;  3K12 A;  3Q8H A;  3LWP C;  3IMP A;  3RYF A;  4C8E A;  3NVK E;  4BW0 B;  1IV1 A;  2OZB A;  1W5B A;  3J81 M;  1W40 A;  3IEW A;  5HP8 A;  1YJW F;  3P10 A;  1VQ6 F;  2RHH A;  3LME A;  4RQO A;  3CG6 A;  3JAW B;  3RYC A;  5GON A;  4BVT A;  2VXY A;  3IKF A;  2YXZ A;  2CHS A;  2HP3 A;  4HNA B;  3KIZ A; 
#chains in the Genus database with same CATH homology
 3V7Q A;  4BY9 D;  1GO0 A;  5G4V C;  1KD1 H;  3RA5 A;  2CZW A;  3CCR F;  3I56 F;  1VQ7 F;  3CCS F;  3CPW F;  1K73 H;  1VQO F;  1VQN F;  2I6D A;  5HY1 A;  2JNB A;  2QI2 A;  1Q82 H;  4XCQ A;  1Q7Y H;  2FC3 A;  1YHQ F;  2LBX A;  2OTL F;  3CD6 F;  4EI7 A;  4C4W C;  5GIO C;  3D00 A;  2VGN A;  3NK7 A;  4TZZ A;  1IPA A;  2BO1 A;  1Q86 H;  1NMU B;  3G6E F;  5DCV A;  5EWR A;  3CCV F;  3VI6 A;  5GIP C;  3E20 B;  1VQM F;  1XBI A;  3LFO A;  5HY4 A;  5HXZ A;  5A2Q M;  1Q81 H;  3NMU C;  3I55 F;  3RA6 A;  5EO3 A;  3WXM B;  3JCM M;  1X52 A;  3JAM M;  1W3E X;  1VQ5 F;  3CME F;  3J80 M;  1DT9 A;  3CXC F;  1VQL F;  2FGY A;  4EI8 A;  1X7P A;  2KTU A;  3CC2 F;  1T0K B;  1W2B F;  2GLZ A;  1VQ9 F;  1PXW A;  3IR9 A;  1QVF F;  2WAL A;  3LWO C;  3HJW C;  3CC7 F;  3N4Y A;  1K9M H;  1ZWZ A;  5GIN C;  1VQ4 F;  1W42 A;  3VMF B;  4BVR A;  2KG4 A;  1KC8 H;  3N4Z A;  3CC4 F;  3FFM A;  2VGM A;  5HWE A;  3V3T A;  4EI9 A;  1N8R H;  1RLG A;  3CCU F;  2QA4 F;  2OTJ F;  1YJ9 F;  4X3L A;  1M1K H;  3CCJ F;  1E7K A;  3LWR C;  1W41 A;  1VQ8 F;  1YI2 F;  3CCE F;  3G71 F;  1VQK F;  4X3M A;  2OHW A;  1RA4 A;  3CMA F;  5GAN K;  3CCM F;  1QVG F;  3CCQ F;  3CCL F;  1M90 H;  3ON1 A;  5FLX M;  1S72 F;  5HY0 A;  3GYQ A;  3HAX D;  1SDS A;  4LCK A;  3CPQ A;  1VQP F;  4BVQ A;  3NVI B;  3O85 A;  3J7A R;  1GO1 A;  3E1Y A;  2QEX F;  2AIF A;  3LWV C;  2KTV A;  2LBW A;  1H7M A;  3LWQ C;  4NQ3 A;  5HY2 A;  3PLA C;  3SIU A;  1JJ2 F;  5G4U C;  3PAF A;  3LWP C;  4BVS A;  3SIV A;  2F9Z C;  2ALE A;  3AGK A;  1KQS F;  3NVK E;  4BW0 B;  1NJI H;  2OZB A;  3OBY A;  1CK2 A;  4NUT A;  5IT9 M;  1X7O A;  5FJ4 C;  3V7E A;  3J81 M;  1W40 A;  5HXU A;  1GZ0 A;  3OBW A;  1YJN F;  1CN7 A;  1YJW F;  1K8A H;  5GAP K;  3NK6 A;  1VQ6 F;  2HVY D;  3CG6 A;  3G4S F;  4BVT A;  1YIT F;  1YIJ F;  3OW2 F;  3MCA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...