5DCVA

Crystal structure of phorpp38-sl12m complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
118
Chain Sequence
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords 50S ribosomal protein L7Ae
publication title Structural basis for recognition of a kink-turn motif by an archaeal homologue of human RNase P protein Rpp38
pubmed doi rcsb
source organism Pyrococcus horikoshii (strain atcc 700860 / dsm 12428 / jcm 9974 / nbrc 100139 /
total genus 34
structure length 118
sequence length 118
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5dcvA00
1KQSF 1VQ6F 3I55F 1VQKF 1CN7A 5GIPC 3LWOC 4BY9D 3VI6A 1DT9A 4TZZA 5G4UC 3CCQF 3FFMA 3J81M 5GANK 2JNBA 5GAPK 1X52A 5G4VC 4NUTA 1X7OA 3CMAF 1YIJF 3WXMB 2QI2A 5A2QM 2LBWA 3CCVF 3NMUC 3SIUA 2OHWA 3CD6F 3G4SF 4LCKA 3CCUF 3N4YA 1VQ7F 3V7EA 1QVFF 2QA4F 4BW0B 2AIFA 2KG4A 3CCJF 2BO1A 3LWRC 1M90H 1H7MA 4X3LA 4C4WC 3OW2F 4X3MA 1IPAA 1W3EX 3JCMM 3N4ZA 1VQLF 1E7KA 3CCLF 2VGNA 3G71F 3JAMM 3E1YA 3CPQA 3RA6A 1K73H 1VQ8F 3CPWF 2OTLF 2QEXF 1K8AH 1RLGA 3NK7A 1VQ4F 1W41A 1S72F 3CCSF 3E20B 5FJ4C 1YJ9F 1Q81H 1JJ2F 3HJWC 2OZBA 1GZ0A 2LBXA 1T0KB 3RA5A 1XBIA 3VMFB 1N8RH 1ZWZA 3CG6A 3MCAB 1VQ5F 5EWRA 1VQ9F 3SIVA 2OTJF 3LWPC 3CCEF 3OBYA 3J80M 1VQOF 1YI2F 3CCMF 5EO3A 3NVKE 3PLAC 1SDSA 3CC7F 2VGMA 1Q86H 3AGKA 2WALA 3I56F 1VQPF 1YJWF 1YHQF 3J7AR 1W42A 2HVYD 1W2BF 1NJIH 1PXWA 2ALEA 3PAFA 1QVGF 3CC2F 3GYQA 1NMUB 3IR9A 3NVIB 1VQNF 5IT9M 1Q82H 1KC8H 2KTVA 5DCVA 3HAXD 1CK2A 1GO0A 1KD1H 3CXCF 2KTUA 1YITF 1W40A 5FLXM 2I6DA 5GIOC 1Q7YH 3CC4F 3OBWA 3G6EF 1M1KH 3ON1A 1GO1A 3LFOA 3V7QA 3NK6A 1X7PA 3CCRF 3CMEF 1K9MH 2CZWA 3LWQC 2FC3A 5GINC 1VQMF 3LWVC 3O85A 1RA4A 1YJNF
chains in the Genus database with same CATH superfamily
2HX0A 4O4IB 1KQSF 3Q8HA 3LWOC 2Q1XA 1DT9A 5GANK 5G4VC 1X7OA 2H8CA 1U3PA 2QI2A 2LBWA 3M1XA 5HXUA 3UT5B 2CSLA 3V7EA 4YJ3B 5JCOC 3V3TA 4IIJA 2QA4F 3P0ZA 2OTMA 3LWRC 3F0DA 5GONB 1H7MA 5ITZB 5HY1A 4M8IA 4BT2A 5J2UB 5LXTB 2AIZP 3JCMM 3N4ZA 3FD5A 3WGKA 2UYNA 4TUYA 3WGMA 1E7KA 3K0TA 3CCLF 4TV9B 3ZP7A 3VO8A 3FPIA 2DT4A 4G88A 2K1SA 2RHLA 2VXYA 4YJ2B 3CPQA 3F6MA 3RYCB 2UYJA 1RLGA 1VQ4F 1RQ7A 3HKBA 1IV1A 3E20B 1T0AA 4B46A 5FJ4C 4X1KA 3KJJA 3S0HA 2OZBA 1GZ0A 3CYPB 4C81A 4I50B 1UI9A 1YQNA 4G4YA 1N8RH 2H6LA 1RLUA 1ZWZA 3CG6A 3MCAB 5MN5A 2CVLA 2HP0B 2HS3A 5MN6A 1VQ5F 2OTJF 4X1IA 2CWJA 5AVMA 3S0WA 3VCZA 5JQGA 3NVKE 3E22A 3AGKA 4EI7A 2I6RA 3CB2A 3ZO8A 1W42A 4E6EA 3HKDA 2GVIA 3WJQA 5LOVA 3KHNA 3IR9A 4HNAB 3RYFA 1OAPA 4TV8A 5IT9M 1Q82H 1KC8H 1W5AA 3WJPA 4G4WA 1CK2A 2ZVZA 3HAXD 2UYNB 4O4LA 4TUYB 1W40A 1JN1A 1NQ3A 4O4JA 3IKFA 3RYIA 3K2XA 2ZAUA 5B8FA 1XHOA 5FNVB 3LFOA 3NK6A 1OFUA 4R40B 3CMEF 3TD3A 5LA6A 3LWQC 3HKBB 1VQMF 5GINC 1J7HA 3C9RA 3O85A 4X1YA 4BT3A 3JATA 4X1KB 2ZVYA 4BY9D 4F6RA 1FFXB 2RHJA 3CCQF 3FFMA 4FFBB 2HP3A 2EWCA 5GAPK 4RHAA 4EI8A 1FNJA 3FBAA 5A2QM 2OHWA 4X1IB 1R1MA 2Z1UA 5JQGB 4U39A 4DRXB 1QVFF 1IV3A 1FSZA 4XCQA 3E22B 2RB9A 2KG4A 2HRYA 3CCJF 3JARB 4X3LA 5JCOA 4G4VA 3HKDB 4O2AA 3OW2F 2RHOA 4C4WC 5LOVB 4X20B 2VAWA 3RYFB 3N2KB 2VGNA 4TV8B 3LDTA 3QHDA 3VYTC 2ZODA 4O4LB 2BTOA 5CB4A 3K14A 1TUBA 2BTQB 1K73H 1K8AH 5IJ0A 3RYIB 4DXDA 3WJRA 1W41A 1SA0A 1VH8A 3JALA 1W57A 1JJ2F 5LA6B 3HJWC 5HY2A 1T0KB 3RA5A 4X1YB 3I3FA 4NWOB 3JATB 3VMFB 1CLIA 3IKEA 3B6NA 1QAHA 3S06A 4RQOA 3TD5A 4ZHVA 4O2BA 5EWRA 4F6RB 4KWEA 3SIVA 1VQVA 3CCEF 5CA1A 1VQOF 3JAKA 3JAWA 3QTYA 1YI2F 4ZHYB 5HP8A 3PLAC 1JFFA 3VIUA 1XV2A 4B62A 2WALA 4EB6A 5LP6A 3I56F 5LYJA 1YHQF 3HKCA 3HTNA 5IYZB 1QVGF 3L7QA 3CC2F 2N48A 3NVIB 4LNUB 4O2AB 5IJ9A 3VYUC 4B45A 5HWEA 2HS4A 1KD1H 1H48A 2KTUA 3C9TA 1YITF 2YYEA 2PMPA 4ZHWA 3N2GA 3CC4F 1KNJA 5EZYA 4C8IA 3G6EF 5LP6C 1M1KH 5CB4B 3C9UA 1TUBB 3MBMA 2AMTA 1X7PA 4ZI7A 5IJ0B 1K9MH 3WGNA 2L26A 4IIJB 4U3JA 3LWVC 4ERHA 3VOAA 3JALB 3FD6A 4IHJA 4ZOLA 5BMVA 1VQKF 1JD1A 1CN7A 4BVQA 3VI6A 4TZZA 2B33A 5G4UC 3J81M 2NMUA 3IEQA 3WXMB 2R6R1 4ZK7A 3KE1A 5CA1B 3CD6F 3JAKB 3JAWB 4LCKA 3N4YA 4NQ3A 3ZP4A 4G4ZA 4BW0B 2AIFA 2BO1A 3DDNA 3VYSC 4WBNA 1JFFB 4EB6B 1M90H 3IMPA 1XRGA 3HKCB 3M4SA 3F0FA 4I4TA 3WGJA 1IPAA 1W3EX 4G4XA 4C8GA 2IAFA 3U0OA 5MN4A 4BT5A 1QD9A 2H8EA 3C9SA 4YJ3A 3CPWF 5HY4A 3V4DA 2QEXF 5EZYB 3TD4A 5GONA 5ITZA 4PWTA 1S72F 2V9YA 5EAZA 5J2UA 4C8EA 2LBTA 2LBXA 3MCQA 4TV9A 3ESJA 5EB0A 3R0PA 2W8BC 4IHJB 4ZOLB 3ERNA 2UYKA 5HP7A 1VK3A 2R751 4YJ2A 1VQ9F 2RHHA 3J80M 2P6YA 5KX5A 3CCMF 3HWUA 1W5EA 3D54A 1SDSA 4O4JB 3F0EA 3JASA 1Q86H 2UZHA 1U40A 3S0YA 1VQPF 1YJWF 2IG8A 3J7AR 3D01A 3F0GA 2Q1YA 2ZF8A 1NJIH 2VAMA 3GYQA 1NMUB 5JH7A 3S02A 1RQ2A 2HP0A 1VQNF 4I4TB 5DCVA 3JVHA 2Z1TA 3VTIC 1U43A 2HQSC 1W581 4BT4A 5JVDA 1Z5WA 5EIBC 5FLXM 3DC2A 3P10A 3I7TA 5CA0A 3RE3A 4ZHQA 2CHTA 3S03A 2CZWA 4HNAA 1IV4A 2HS0A 3WPWA 3CYQA 2Z1EA 2HRUA 1VQ6F 1YGYA 3I55F 3BYQA 5GIPC 1VHAA 1TVKA 2JNBA 5HXZA 1X52A 3GHZA 3GTZA 4NUTA 3CMAF 1YIJF 3CCVF 5FNVA 4BVRA 4EI9A 3NMUC 2CW4A 3SIUA 3G4SF 1X25A 3CCUF 1VQ7F 5KX5B 2ZOVA 1GX1A 3LYBA 5J2TA 2GZLA 3RYHA 3JASB 2CHSA 1PF5A 2FGYA 3WPXA 4O4HA 2BTUA 1SA0B 1COMA 1FFXA 1W5FA 4X3MA 5EIBD 4FFBA 1Q8RA 2YXZA 3IEWA 4BVTA 1VQLF 5JH7B 3HKEA 4I55A 2LCAA 3KJKA 2KGWA 3G71F 2GLZA 5JVDB 3JAMM 5EYPA 4DRXA 4O2BB 1KNKA 3WGLA 3M84A 1U3LA 3E1YA 3ZOPA 3RA6A 1VQ8F 2OTLF 5KMGA 1IV2A 3C8LA 3JARA 3NK7A 2PHNA 1H47A 1JY8A 1SZQA 2QTPA 3CCSF 2IQQA 5C8YA 1YJ9F 2G9IA 4O4IA 4X20A 4ZHQB 5CA0B 5LP6B 1Q81H 5LYJB 3K12A 3OONA 4C82A 3N2KA 3ELCA 1XBIA 4BT6A 1W5BA 1W59A 1ONIA 2VAPA 3LMEA 5IJ9B 4B5CA 3LWPC 3OBYA 1TVKB 1FNKA 3T80A 1ODEA 1W55A 5EO3A 3UT5A 1Z5VA 2UYPA 3CC7F 3N2GB 2VGMA 2F9ZC 1QU9A 4BT7A 4WBNB 5J2TB 3QUWA 2HVYD 3RYHB 2DYYA 4ZI7B 5LXTA 1W2BF 1PXWA 2ALEA 3PAFA 4O4HB 1UFYA 4U3JB 2KTVA 1GO0A 2MQEA 5BMVB 3MQWA 2Z1FA 3VOBA 3HKEB 3CXCF 3EORA 4I55B 5GIOC 2I6DA 1Q7YH 3OBWA 3MDOA 2Z01A 3RYCA 5HY0A 3ON1A 1GO1A 5EYPB 3KIZA 3D00A 3V7QA 5KMGB 3CCRF 4BVSA 5IYZA 5EB1B 1DBFA 2FC3A 5C8YB 4LNUA 1RA4A 4I50A 3P4EA 1YJNF
chains in the Genus database with same CATH topology
1KQSF 1VQ6F 3I55F 1VQKF 1CN7A 5GIPC 3LWOC 4BVQA 3VI6A 1DT9A 4TZZA 4BY9D 5G4UC 3CCQF 3FFMA 3J81M 5GANK 2JNBA 5HXZA 1X52A 5G4VC 4NUTA 1X7OA 4EI8A 5GAPK 3CMAF 1YIJF 3WXMB 2QI2A 5A2QM 2LBWA 4BVRA 4EI9A 3CCVF 2OHWA 3NMUC 3SIUA 3CD6F 3G4SF 4LCKA 3CCUF 3N4YA 5HXUA 1VQ7F 4NQ3A 3V7EA 1QVFF 4XCQA 3V3TA 2QA4F 4BW0B 2AIFA 2KG4A 3CCJF 2BO1A 3LWRC 2FGYA 1M90H 1H7MA 4X3LA 5HY1A 4C4WC 3OW2F 4X3MA 1IPAA 1W3EX 4BVTA 3JCMM 3N4ZA 1VQLF 1E7KA 3CCLF 2VGNA 3G71F 2GLZA 3JAMM 3E1YA 3CPQA 3RA6A 1K73H 1VQ8F 3CPWF 2OTLF 5HY4A 2QEXF 1K8AH 1RLGA 3NK7A 1VQ4F 1W41A 1S72F 3CCSF 3E20B 5FJ4C 1YJ9F 1Q81H 1JJ2F 3HJWC 2OZBA 1GZ0A 2LBXA 5HY2A 1T0KB 3RA5A 1XBIA 3VMFB 1N8RH 1ZWZA 3CG6A 3MCAB 1VQ5F 5EWRA 1VQ9F 3SIVA 2OTJF 3LWPC 3CCEF 3OBYA 3J80M 1VQOF 1YI2F 3CCMF 5EO3A 3NVKE 3PLAC 1SDSA 3CC7F 2VGMA 1Q86H 2F9ZC 3AGKA 2WALA 4EI7A 3I56F 1VQPF 1YJWF 1YHQF 3J7AR 1W42A 2HVYD 1W2BF 1NJIH 1PXWA 2ALEA 3PAFA 1QVGF 3CC2F 3GYQA 1NMUB 3IR9A 3NVIB 1VQNF 5IT9M 1Q82H 1KC8H 2KTVA 5DCVA 3HAXD 1CK2A 5HWEA 1KD1H 1GO0A 3CXCF 2KTUA 1YITF 1W40A 5FLXM 2I6DA 5GIOC 1Q7YH 3CC4F 3OBWA 3G6EF 1M1KH 5HY0A 3ON1A 1GO1A 3D00A 3LFOA 3V7QA 3NK6A 1X7PA 3CCRF 3CMEF 4BVSA 1K9MH 2CZWA 3LWQC 2FC3A 5GINC 1VQMF 3LWVC 3O85A 1RA4A 1YJNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS F;  1VQ6 F;  3I55 F;  1VQK F;  1CN7 A;  5GIP C;  3LWO C;  4BY9 D;  3VI6 A;  1DT9 A;  4TZZ A;  5G4U C;  3CCQ F;  3FFM A;  3J81 M;  5GAN K;  2JNB A;  5GAP K;  1X52 A;  5G4V C;  4NUT A;  1X7O A;  3CMA F;  1YIJ F;  3WXM B;  2QI2 A;  5A2Q M;  2LBW A;  3CCV F;  3NMU C;  3SIU A;  2OHW A;  3CD6 F;  3G4S F;  4LCK A;  3CCU F;  3N4Y A;  1VQ7 F;  3V7E A;  1QVF F;  2QA4 F;  4BW0 B;  2AIF A;  2KG4 A;  3CCJ F;  2BO1 A;  3LWR C;  1M90 H;  1H7M A;  4X3L A;  4C4W C;  3OW2 F;  4X3M A;  1IPA A;  1W3E X;  3JCM M;  3N4Z A;  1VQL F;  1E7K A;  3CCL F;  2VGN A;  3G71 F;  3JAM M;  3E1Y A;  3CPQ A;  3RA6 A;  1K73 H;  1VQ8 F;  3CPW F;  2OTL F;  2QEX F;  1K8A H;  1RLG A;  3NK7 A;  1VQ4 F;  1W41 A;  1S72 F;  3CCS F;  3E20 B;  5FJ4 C;  1YJ9 F;  1Q81 H;  1JJ2 F;  3HJW C;  2OZB A;  1GZ0 A;  2LBX A;  1T0K B;  3RA5 A;  1XBI A;  3VMF B;  1N8R H;  1ZWZ A;  3CG6 A;  3MCA B;  1VQ5 F;  5EWR A;  1VQ9 F;  3SIV A;  2OTJ F;  3LWP C;  3CCE F;  3OBY A;  3J80 M;  1VQO F;  1YI2 F;  3CCM F;  5EO3 A;  3NVK E;  3PLA C;  1SDS A;  3CC7 F;  2VGM A;  1Q86 H;  3AGK A;  2WAL A;  3I56 F;  1VQP F;  1YJW F;  1YHQ F;  3J7A R;  1W42 A;  2HVY D;  1W2B F;  1NJI H;  1PXW A;  2ALE A;  3PAF A;  1QVG F;  3CC2 F;  3GYQ A;  1NMU B;  3IR9 A;  3NVI B;  1VQN F;  5IT9 M;  1Q82 H;  1KC8 H;  2KTV A;  5DCV A;  3HAX D;  1CK2 A;  1GO0 A;  1KD1 H;  3CXC F;  2KTU A;  1YIT F;  1W40 A;  5FLX M;  2I6D A;  5GIO C;  1Q7Y H;  3CC4 F;  3OBW A;  3G6E F;  1M1K H;  3ON1 A;  1GO1 A;  3LFO A;  3V7Q A;  3NK6 A;  1X7P A;  3CCR F;  3CME F;  1K9M H;  2CZW A;  3LWQ C;  2FC3 A;  5GIN C;  1VQM F;  3LWV C;  3O85 A;  1RA4 A;  1YJN F; 
#chains in the Genus database with same CATH topology
 2HX0 A;  4O4I B;  1KQS F;  3Q8H A;  3LWO C;  2Q1X A;  1DT9 A;  5GAN K;  5G4V C;  1X7O A;  2H8C A;  1U3P A;  2QI2 A;  2LBW A;  3M1X A;  5HXU A;  3UT5 B;  2CSL A;  3V7E A;  4YJ3 B;  5JCO C;  3V3T A;  4IIJ A;  2QA4 F;  3P0Z A;  2OTM A;  3LWR C;  3F0D A;  5GON B;  1H7M A;  5ITZ B;  5HY1 A;  4M8I A;  4BT2 A;  5J2U B;  5LXT B;  2AIZ P;  3JCM M;  3N4Z A;  3FD5 A;  3WGK A;  2UYN A;  4TUY A;  3WGM A;  1E7K A;  3K0T A;  3CCL F;  4TV9 B;  3ZP7 A;  3VO8 A;  3FPI A;  2DT4 A;  4G88 A;  2K1S A;  2RHL A;  2VXY A;  4YJ2 B;  3CPQ A;  3F6M A;  3RYC B;  2UYJ A;  1RLG A;  1VQ4 F;  1RQ7 A;  3HKB A;  1IV1 A;  3E20 B;  1T0A A;  4B46 A;  5FJ4 C;  4X1K A;  3KJJ A;  3S0H A;  2OZB A;  1GZ0 A;  3CYP B;  4C81 A;  4I50 B;  1UI9 A;  1YQN A;  4G4Y A;  1N8R H;  2H6L A;  1RLU A;  1ZWZ A;  3CG6 A;  3MCA B;  5MN5 A;  2CVL A;  2HP0 B;  2HS3 A;  5MN6 A;  1VQ5 F;  2OTJ F;  4X1I A;  2CWJ A;  5AVM A;  3S0W A;  3VCZ A;  5JQG A;  3NVK E;  3E22 A;  3AGK A;  4EI7 A;  2I6R A;  3CB2 A;  3ZO8 A;  1W42 A;  4E6E A;  3HKD A;  2GVI A;  3WJQ A;  5LOV A;  3KHN A;  3IR9 A;  4HNA B;  3RYF A;  1OAP A;  4TV8 A;  5IT9 M;  1Q82 H;  1KC8 H;  1W5A A;  3WJP A;  4G4W A;  1CK2 A;  2ZVZ A;  3HAX D;  2UYN B;  4O4L A;  4TUY B;  1W40 A;  1JN1 A;  1NQ3 A;  4O4J A;  3IKF A;  3RYI A;  3K2X A;  2ZAU A;  5B8F A;  1XHO A;  5FNV B;  3LFO A;  3NK6 A;  1OFU A;  4R40 B;  3CME F;  3TD3 A;  5LA6 A;  3LWQ C;  3HKB B;  1VQM F;  5GIN C;  1J7H A;  3C9R A;  3O85 A;  4X1Y A;  4BT3 A;  3JAT A;  4X1K B;  2ZVY A;  4BY9 D;  4F6R A;  1FFX B;  2RHJ A;  3CCQ F;  3FFM A;  4FFB B;  2HP3 A;  2EWC A;  5GAP K;  4RHA A;  4EI8 A;  1FNJ A;  3FBA A;  5A2Q M;  2OHW A;  4X1I B;  1R1M A;  2Z1U A;  5JQG B;  4U39 A;  4DRX B;  1QVF F;  1IV3 A;  1FSZ A;  4XCQ A;  3E22 B;  2RB9 A;  2KG4 A;  2HRY A;  3CCJ F;  3JAR B;  4X3L A;  5JCO A;  4G4V A;  3HKD B;  4O2A A;  3OW2 F;  2RHO A;  4C4W C;  5LOV B;  4X20 B;  2VAW A;  3RYF B;  3N2K B;  2VGN A;  4TV8 B;  3LDT A;  3QHD A;  3VYT C;  2ZOD A;  4O4L B;  2BTO A;  5CB4 A;  3K14 A;  1TUB A;  2BTQ B;  1K73 H;  1K8A H;  5IJ0 A;  3RYI B;  4DXD A;  3WJR A;  1W41 A;  1SA0 A;  1VH8 A;  3JAL A;  1W57 A;  1JJ2 F;  5LA6 B;  3HJW C;  5HY2 A;  1T0K B;  3RA5 A;  4X1Y B;  3I3F A;  4NWO B;  3JAT B;  3VMF B;  1CLI A;  3IKE A;  3B6N A;  1QAH A;  3S06 A;  4RQO A;  3TD5 A;  4ZHV A;  4O2B A;  5EWR A;  4F6R B;  4KWE A;  3SIV A;  1VQV A;  3CCE F;  5CA1 A;  1VQO F;  3JAK A;  3JAW A;  3QTY A;  1YI2 F;  4ZHY B;  5HP8 A;  3PLA C;  1JFF A;  3VIU A;  1XV2 A;  4B62 A;  2WAL A;  4EB6 A;  5LP6 A;  3I56 F;  5LYJ A;  1YHQ F;  3HKC A;  3HTN A;  5IYZ B;  1QVG F;  3L7Q A;  3CC2 F;  2N48 A;  3NVI B;  4LNU B;  4O2A B;  5IJ9 A;  3VYU C;  4B45 A;  5HWE A;  2HS4 A;  1KD1 H;  1H48 A;  2KTU A;  3C9T A;  1YIT F;  2YYE A;  2PMP A;  4ZHW A;  3N2G A;  3CC4 F;  1KNJ A;  5EZY A;  4C8I A;  3G6E F;  5LP6 C;  1M1K H;  5CB4 B;  3C9U A;  1TUB B;  3MBM A;  2AMT A;  1X7P A;  4ZI7 A;  5IJ0 B;  1K9M H;  3WGN A;  2L26 A;  4IIJ B;  4U3J A;  3LWV C;  4ERH A;  3VOA A;  3JAL B;  3FD6 A;  4IHJ A;  4ZOL A;  5BMV A;  1VQK F;  1JD1 A;  1CN7 A;  4BVQ A;  3VI6 A;  4TZZ A;  2B33 A;  5G4U C;  3J81 M;  2NMU A;  3IEQ A;  3WXM B;  2R6R 1;  4ZK7 A;  3KE1 A;  5CA1 B;  3CD6 F;  3JAK B;  3JAW B;  4LCK A;  3N4Y A;  4NQ3 A;  3ZP4 A;  4G4Z A;  4BW0 B;  2AIF A;  2BO1 A;  3DDN A;  3VYS C;  4WBN A;  1JFF B;  4EB6 B;  1M90 H;  3IMP A;  1XRG A;  3HKC B;  3M4S A;  3F0F A;  4I4T A;  3WGJ A;  1IPA A;  1W3E X;  4G4X A;  4C8G A;  2IAF A;  3U0O A;  5MN4 A;  4BT5 A;  1QD9 A;  2H8E A;  3C9S A;  4YJ3 A;  3CPW F;  5HY4 A;  3V4D A;  2QEX F;  5EZY B;  3TD4 A;  5GON A;  5ITZ A;  4PWT A;  1S72 F;  2V9Y A;  5EAZ A;  5J2U A;  4C8E A;  2LBT A;  2LBX A;  3MCQ A;  4TV9 A;  3ESJ A;  5EB0 A;  3R0P A;  2W8B C;  4IHJ B;  4ZOL B;  3ERN A;  2UYK A;  5HP7 A;  1VK3 A;  2R75 1;  4YJ2 A;  1VQ9 F;  2RHH A;  3J80 M;  2P6Y A;  5KX5 A;  3CCM F;  3HWU A;  1W5E A;  3D54 A;  1SDS A;  4O4J B;  3F0E A;  3JAS A;  1Q86 H;  2UZH A;  1U40 A;  3S0Y A;  1VQP F;  1YJW F;  2IG8 A;  3J7A R;  3D01 A;  3F0G A;  2Q1Y A;  2ZF8 A;  1NJI H;  2VAM A;  3GYQ A;  1NMU B;  5JH7 A;  3S02 A;  1RQ2 A;  2HP0 A;  1VQN F;  4I4T B;  5DCV A;  3JVH A;  2Z1T A;  3VTI C;  1U43 A;  2HQS C;  1W58 1;  4BT4 A;  5JVD A;  1Z5W A;  5EIB C;  5FLX M;  3DC2 A;  3P10 A;  3I7T A;  5CA0 A;  3RE3 A;  4ZHQ A;  2CHT A;  3S03 A;  2CZW A;  4HNA A;  1IV4 A;  2HS0 A;  3WPW A;  3CYQ A;  2Z1E A;  2HRU A;  1VQ6 F;  1YGY A;  3I55 F;  3BYQ A;  5GIP C;  1VHA A;  1TVK A;  2JNB A;  5HXZ A;  1X52 A;  3GHZ A;  3GTZ A;  4NUT A;  3CMA F;  1YIJ F;  3CCV F;  5FNV A;  4BVR A;  4EI9 A;  3NMU C;  2CW4 A;  3SIU A;  3G4S F;  1X25 A;  3CCU F;  1VQ7 F;  5KX5 B;  2ZOV A;  1GX1 A;  3LYB A;  5J2T A;  2GZL A;  3RYH A;  3JAS B;  2CHS A;  1PF5 A;  2FGY A;  3WPX A;  4O4H A;  2BTU A;  1SA0 B;  1COM A;  1FFX A;  1W5F A;  4X3M A;  5EIB D;  4FFB A;  1Q8R A;  2YXZ A;  3IEW A;  4BVT A;  1VQL F;  5JH7 B;  3HKE A;  4I55 A;  2LCA A;  3KJK A;  2KGW A;  3G71 F;  2GLZ A;  5JVD B;  3JAM M;  5EYP A;  4DRX A;  4O2B B;  1KNK A;  3WGL A;  3M84 A;  1U3L A;  3E1Y A;  3ZOP A;  3RA6 A;  1VQ8 F;  2OTL F;  5KMG A;  1IV2 A;  3C8L A;  3JAR A;  3NK7 A;  2PHN A;  1H47 A;  1JY8 A;  1SZQ A;  2QTP A;  3CCS F;  2IQQ A;  5C8Y A;  1YJ9 F;  2G9I A;  4O4I A;  4X20 A;  4ZHQ B;  5CA0 B;  5LP6 B;  1Q81 H;  5LYJ B;  3K12 A;  3OON A;  4C82 A;  3N2K A;  3ELC A;  1XBI A;  4BT6 A;  1W5B A;  1W59 A;  1ONI A;  2VAP A;  3LME A;  5IJ9 B;  4B5C A;  3LWP C;  3OBY A;  1TVK B;  1FNK A;  3T80 A;  1ODE A;  1W55 A;  5EO3 A;  3UT5 A;  1Z5V A;  2UYP A;  3CC7 F;  3N2G B;  2VGM A;  2F9Z C;  1QU9 A;  4BT7 A;  4WBN B;  5J2T B;  3QUW A;  2HVY D;  3RYH B;  2DYY A;  4ZI7 B;  5LXT A;  1W2B F;  1PXW A;  2ALE A;  3PAF A;  4O4H B;  1UFY A;  4U3J B;  2KTV A;  1GO0 A;  2MQE A;  5BMV B;  3MQW A;  2Z1F A;  3VOB A;  3HKE B;  3CXC F;  3EOR A;  4I55 B;  5GIO C;  2I6D A;  1Q7Y H;  3OBW A;  3MDO A;  2Z01 A;  3RYC A;  5HY0 A;  3ON1 A;  1GO1 A;  5EYP B;  3KIZ A;  3D00 A;  3V7Q A;  5KMG B;  3CCR F;  4BVS A;  5IYZ A;  5EB1 B;  1DBF A;  2FC3 A;  5C8Y B;  4LNU A;  1RA4 A;  4I50 A;  3P4E A;  1YJN F; 
#chains in the Genus database with same CATH homology
 1KQS F;  1VQ6 F;  3I55 F;  1VQK F;  1CN7 A;  5GIP C;  3LWO C;  4BVQ A;  3VI6 A;  1DT9 A;  4TZZ A;  4BY9 D;  5G4U C;  3CCQ F;  3FFM A;  3J81 M;  5GAN K;  2JNB A;  5HXZ A;  1X52 A;  5G4V C;  4NUT A;  1X7O A;  4EI8 A;  5GAP K;  3CMA F;  1YIJ F;  3WXM B;  2QI2 A;  5A2Q M;  2LBW A;  4BVR A;  4EI9 A;  3CCV F;  2OHW A;  3NMU C;  3SIU A;  3CD6 F;  3G4S F;  4LCK A;  3CCU F;  3N4Y A;  5HXU A;  1VQ7 F;  4NQ3 A;  3V7E A;  1QVF F;  4XCQ A;  3V3T A;  2QA4 F;  4BW0 B;  2AIF A;  2KG4 A;  3CCJ F;  2BO1 A;  3LWR C;  2FGY A;  1M90 H;  1H7M A;  4X3L A;  5HY1 A;  4C4W C;  3OW2 F;  4X3M A;  1IPA A;  1W3E X;  4BVT A;  3JCM M;  3N4Z A;  1VQL F;  1E7K A;  3CCL F;  2VGN A;  3G71 F;  2GLZ A;  3JAM M;  3E1Y A;  3CPQ A;  3RA6 A;  1K73 H;  1VQ8 F;  3CPW F;  2OTL F;  5HY4 A;  2QEX F;  1K8A H;  1RLG A;  3NK7 A;  1VQ4 F;  1W41 A;  1S72 F;  3CCS F;  3E20 B;  5FJ4 C;  1YJ9 F;  1Q81 H;  1JJ2 F;  3HJW C;  2OZB A;  1GZ0 A;  2LBX A;  5HY2 A;  1T0K B;  3RA5 A;  1XBI A;  3VMF B;  1N8R H;  1ZWZ A;  3CG6 A;  3MCA B;  1VQ5 F;  5EWR A;  1VQ9 F;  3SIV A;  2OTJ F;  3LWP C;  3CCE F;  3OBY A;  3J80 M;  1VQO F;  1YI2 F;  3CCM F;  5EO3 A;  3NVK E;  3PLA C;  1SDS A;  3CC7 F;  2VGM A;  1Q86 H;  2F9Z C;  3AGK A;  2WAL A;  4EI7 A;  3I56 F;  1VQP F;  1YJW F;  1YHQ F;  3J7A R;  1W42 A;  2HVY D;  1W2B F;  1NJI H;  1PXW A;  2ALE A;  3PAF A;  1QVG F;  3CC2 F;  3GYQ A;  1NMU B;  3IR9 A;  3NVI B;  1VQN F;  5IT9 M;  1Q82 H;  1KC8 H;  2KTV A;  5DCV A;  3HAX D;  1CK2 A;  5HWE A;  1KD1 H;  1GO0 A;  3CXC F;  2KTU A;  1YIT F;  1W40 A;  5FLX M;  2I6D A;  5GIO C;  1Q7Y H;  3CC4 F;  3OBW A;  3G6E F;  1M1K H;  5HY0 A;  3ON1 A;  1GO1 A;  3D00 A;  3LFO A;  3V7Q A;  3NK6 A;  1X7P A;  3CCR F;  3CME F;  4BVS A;  1K9M H;  2CZW A;  3LWQ C;  2FC3 A;  5GIN C;  1VQM F;  3LWV C;  3O85 A;  1RA4 A;  1YJN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...