5GAPK

Body region of the u4/u6.u5 tri-snrnp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA, 5' region, nucleotides 1-67
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gapK00
5IT9M 1YJ9F 5EO3A 1X52A 3J80M 1Q81H 2ALEA 2QA4F 5GAPK 3GYQA 4LCKA 4C4WC 1DT9A 1NMUB 1VQ5F 1YJNF 1SDSA 5A2QM 2CZWA 3CCRF 2OHWA 1QVGF 3I55F 2VGMA 1K8AH 3AGKA 3CMAF 1VQMF 3RA5A 1KQSF 2HVYD 4BW0B 3OW2F 5GANK 1S72F 1YIJF 1ZWZA 1W41A 1VQ6F 1XBIA 3CCQF 1GZ0A 1YHQF 4X3LA 1QVFF 3E1YA 1E7KA 2KTUA 4X3MA 1NJIH 3CPWF 3MCAB 3O85A 2FC3A 3J81M 5DCVA 1CN7A 1K73H 1YITF 3LWPC 5G4VC 5GIPC 3CCVF 2OTJF 2QEXF 3CCMF 3NVIB 1M1KH 1M90H 3NK6A 1KD1H 1YI2F 3SIVA 1VQ4F 4TZZA 3RA6A 3G4SF 2LBXA 3CCSF 5EWRA 3V7EA 3VMFB 2OZBA 1VQKF 3LWQC 1VQ8F 1Q7YH 2LBWA 2OTLF 5GIOC 3JAMM 3E20B 3LFOA 5FLXM 3NK7A 3PAFA 1PXWA 3CMEF 1W40A 5G4UC 3CXCF 2KG4A 5GINC 1Q86H 3CC2F 3CCLF 3I56F 3ON1A 3G6EF 3PLAC 1W42A 1VQNF 1VQPF 3VI6A 3CC7F 1X7PA 2WALA 3SIUA 1Q82H 1VQOF 3N4ZA 3LWOC 1W3EX 3N4YA 1VQ9F 1N8RH 2AIFA 3J7AR 3FFMA 3JCMM 1T0KB 2QI2A 3HAXD 3LWRC 1RA4A 3CCUF 3HJWC 1VQLF 1RLGA 3CCJF 3CG6A 3WXMB 4NUTA 3OBWA 1KC8H 1H7MA 1GO0A 3IR9A 1YJWF 1JJ2F 2I6DA 3CCEF 1X7OA 3CD6F 3CPQA 1CK2A 3OBYA 3G71F 3NVKE 1K9MH 5FJ4C 2VGNA 3NMUC 3CC4F 4BY9D 1IPAA 2BO1A 3LWVC 2JNBA 3V7QA 1VQ7F 1W2BF 2KTVA 1GO1A
chains in the Genus database with same CATH superfamily
3F0EA 1VH8A 5EO3A 2BTUA 2ALEA 3JARB 2ZVZA 5GAPK 2YYEA 1DT9A 1CLIA 2V9YA 3HWUA 5A2QM 2DYYA 3QUWA 2VGMA 3I55F 1KNKA 2R6R1 4EB6A 2HVYD 4BW0B 4RQOA 5ITZB 3K14A 5HXUA 5FNVA 4ZK7A 4O4HB 3WJPA 1S72F 1YIJF 1FNJA 1FFXA 1GZ0A 3T80A 4X20B 1YHQF 1QVFF 2HRUA 1E7KA 2GLZA 2ZVYA 3CPWF 3MCAB 1CN7A 1K73H 1YITF 2HX0A 3LWPC 4IIJA 3HKDA 5J2TA 2UYKA 1VQVA 5IJ9A 5ITZA 4B46A 5MN6A 4B62A 3NVIB 4XCQA 2Q1YA 3HKCA 3OONA 3RYHB 3VIUA 5BMVA 5EYPA 3IEQA 5EWRA 3UT5A 3CYQA 3VMFB 2OZBA 2R751 3L7QA 3LWQC 1QU9A 5EIBC 3I3FA 1TUBB 4ZHQB 1VQ8F 4O4IA 3WGLA 2DT4A 4X1IA 4YJ2A 5JH7A 3JAMM 1YQNA 3ZP7A 4O4JB 3R0PA 3LDTA 2RHJA 3M1XA 4G4VA 1Q86H 5LP6C 2HS3A 5HXZA 4I4TB 5IJ0B 4BT4A 3I56F 3ON1A 4G4YA 2LCAA 1XV2A 3KJKA 2Z1EA 1W42A 3PLAC 4WBNB 3CC7F 4U3JA 4NQ3A 3S0HA 3SIUA 3RYFB 1IV1A 2ZODA 4TUYA 3N4ZA 2RB9A 3JAKA 1ONIA 3HAXD 3WGNA 3E22A 1PF5A 1SA0A 5GONA 4LNUA 5EB1B 3N2KB 3ZO8A 3IEWA 3K12A 3RYIB 3CG6A 2Z1UA 4I55A 3MCQA 3VO8A 5JQGB 1U43A 4ZI7A 5EZYA 1OAPA 3CCEF 3U0OA 1U3LA 3OBYA 3G71F 4X1KB 3P10A 1IV3A 4WBNA 1K9MH 3NMUC 1UI9A 2GVIA 2BO1A 1NJIH 1GO1A 1JN1A 1YJ9F 4O2AB 3JATA 2CHTA 3GYQA 4C4WC 1NMUB 4TV9A 1JFFB 4BT6A 1W581 1QVGF 4EB6B 2AMTA 5FNVB 3F0GA 3OW2F 3IKEA 5LA6B 1RQ7A 1FFXB 4YJ3A 2K1SA 3WPWA 3HKEB 4E6EA 1XRGA 3P4EA 4PWTA 4X3MA 3MDOA 4BVSA 3N2GA 1Z5VA 2HS0A 1FNKA 5JCOC 3WGJA 4O2AA 3F0DA 1H48A 3RYCA 1JFFA 3D01A 4IIJB 3HKDB 5GIPC 3S0WA 5J2TB 5IJ9B 3VYUC 3GTZA 1ODEA 3CCMF 2VAPA 1M90H 1U3PA 1H47A 1QD9A 3HKCB 1KD1H 5LA6A 2PMPA 3SIVA 3M84A 3JVHA 1VQ4F 5BMVB 5EYPB 3G4SF 2LBXA 3UT5B 2UYJA 3HKEA 3KIZA 2RHLA 2HP0A 4ZHWA 2AIZP 1OFUA 2EWCA 4O4IB 5EAZA 4YJ2B 4X1IB 5JH7B 5FLXM 3NK7A 3PAFA 1PXWA 3S02A 4C8EA 1NQ3A 2KG4A 3MQWA 3LYBA 3CC2F 2UYPA 4ZHYB 2CSLA 3K2XA 1VQNF 4U3JB 3LMEA 3V4DA 4IHJA 1Q8RA 4HNAA 3I7TA 5LXTA 4TUYB 3TD4A 1W3EX 1VQ9F 1N8RH 4F6RA 3JAKB 4EI9A 1U40A 2QI2A 3V3TA 4BVQA 3LWRC 3E22B 3VCZA 3WPXA 1SA0B 3VOAA 5GONB 4LNUB 3HJWC 1COMA 4EI8A 3KE1A 4I55B 4NUTA 1H7MA 4M8IA 4ZI7B 5EZYB 2CHSA 1YJWF 2I6DA 3QHDA 3CD6F 2H6LA 2IAFA 2QTPA 3NVKE 1RLUA 3S06A 3KJJA 2VGNA 3ZOPA 5J2UA 4BY9D 5EIBD 3LWVC 3VYTC 1W2BF 4G4XA 4BVRA 3S03A 2YXZA 1X52A 5HP8A 3JATB 3D00A 4LCKA 4TV9B 4BVTA 3B6NA 1SDSA 4G4ZA 2CZWA 3CCRF 2OHWA 1K8AH 3CMAF 2G9IA 4KWEA 2W8BC 3ESJA 1KQSF 3WJQA 3QTYA 2BTQB 3JALA 3TD5A 5JVDA 2I6RA 5GANK 5LP6A 3EORA 3HKBA 1W41A 5C8YA 1VQ6F 1XBIA 4YJ3B 3CCQF 3F6MA 5CA1A 1T0AA 3N2GB 3ELCA 2Z1TA 4X1YA 1KNJA 3FBAA 4ZOLA 5LOVA 1RQ2A 3RYCB 3DC2A 2L26A 2UZHA 5G4VC 5HY2A 4BT3A 3JAWA 3WGMA 1VK3A 2PHNA 3VOBA 2MQEA 2H8EA 1J7HA 4B45A 1M1KH 4C8GA 3FPIA 4FFBA 3RA6A 3CCSF 3V7EA 2B33A 3VTIC 3DDNA 1SZQA 3BYQA 4DXDA 5LYJA 4O2BA 1W5BA 1VQKF 2HP0B 3JASA 2H8CA 4O4LB 5CA0B 5GIOC 3E20B 3LFOA 1TVKA 2N48A 3RE3A 4C82A 4G88A 3CMEF 1W40A 5G4UC 1W5FA 5IYZB 3CXCF 1W5EA 3KHNA 4R40B 1IV4A 3GHZA 5KMGA 1VQPF 3ZP4A 4IHJB 4HNAB 2HP3A 5LXTB 3F0FA 4F6RB 2AIFA 4TV8A 3J7AR 3JCMM 5JCOA 5HP7A 1JD1A 4O4LA 5CA0A 1VQLF 4DRXB 1XHOA 4G4WA 1W5AA 2KGWA 1GO0A 3IR9A 4BT7A 5IYZA 1X7OA 1W57A 4I50A 3CPQA 2VAWA 5EB0A 2HS4A 4C81A 3P0ZA 5FJ4C 1QAHA 5J2UB 3CC4F 3ERNA 3FD6A 2CWJA 5IT9M 4BT2A 3J80M 1Q81H 3WGKA 5AVMA 3JARA 2QA4F 3TD3A 3MBMA 1VQ5F 1YJNF 5MN4A 3K0TA 2FGYA 1DBFA 3AGKA 5HWEA 1VQMF 4DRXA 3RA5A 3JALB 5JVDB 2BTOA 1IV2A 2HQSC 4O4HA 5LP6B 3HKBB 1ZWZA 5C8YB 1VHAA 3C9RA 2ZF8A 4X20A 4X3LA 2ZAUA 3WJRA 3HTNA 5CA1B 3E1YA 2KTUA 5B8FA 4EI7A 4X1YB 3O85A 4ZOLB 5LOVB 2FC3A 3M4SA 3C8LA 2UYNB 3J81M 5DCVA 4NWOB 1UFYA 3CCVF 3JAWB 3C9UA 2OTJF 2OTMA 2Z1FA 2QEXF 3NK6A 5KX5B 1YI2F 4B5CA 4FFBB 1W59A 3RYHA 4TZZA 2VAMA 2HRYA 5LYJB 3Q8HA 4O2BB 3JASB 2GZLA 3IMPA 1Q7YH 2RHOA 2NMUA 1TUBA 2LBWA 4ZHQA 4U39A 3FD5A 2OTLF 2F9ZC 1GX1A 1TVKB 2CVLA 2UYNA 4C8IA 3CYPB 4O4JA 2P6YA 4RHAA 5GINC 5HY1A 3CCLF 4I4TA 5IJ0A 3G6EF 5CB4B 5KMGB 3VI6A 3VYSC 1Z5WA 2LBTA 5KX5A 1X7PA 4ZHVA 2RHHA 1YGYA 2WALA 1Q82H 1VQOF 3RYFA 1FSZA 3CB2A 3LWOC 3IKFA 3N4YA 1W55A 1R1MA 4TV8B 3FFMA 1T0KB 1RA4A 3CCUF 1RLGA 3N2KA 2IQQA 3CCJF 3WXMB 2ZOVA 3RYIA 3D54A 3OBWA 1KC8H 5JQGA 2CW4A 2Z01A 3C9TA 1JJ2F 2VXYA 5MN5A 2Q1XA 4I50B 4ERHA 1CK2A 1JY8A 4BT5A 5CB4A 4X1KA 5HY4A 1X25A 5HY0A 3S0YA 2IG8A 1IPAA 2JNBA 3V7QA 1VQ7F 3C9SA 2KTVA
chains in the Genus database with same CATH topology
5IT9M 1YJ9F 5EO3A 1X52A 3J80M 1Q81H 2ALEA 3D00A 5GAPK 3GYQA 2QA4F 4LCKA 1DT9A 1NMUB 4BVTA 1YJNF 1VQ5F 5A2QM 2CZWA 3CCRF 1SDSA 2OHWA 1QVGF 2FGYA 2VGMA 5HWEA 3AGKA 3I55F 3CMAF 1VQMF 1K8AH 3RA5A 1KQSF 2HVYD 4BW0B 5HXUA 3OW2F 5GANK 1S72F 1YIJF 1ZWZA 1W41A 1VQ6F 1XBIA 3CCQF 1GZ0A 1YHQF 4X3LA 1QVFF 4C4WC 3E1YA 1E7KA 2KTUA 2GLZA 4X3MA 4BVSA 4EI7A 1NJIH 3CPWF 3MCAB 3O85A 2FC3A 3J81M 4BVRA 5DCVA 1CN7A 1K73H 1YITF 3LWPC 5G4VC 5GIPC 3CCVF 5HY2A 2OTJF 2QEXF 3CCMF 3NVIB 4XCQA 1M1KH 1M90H 3NK6A 1KD1H 1YI2F 3SIVA 1VQ4F 4TZZA 3RA6A 3G4SF 2LBXA 3CCSF 5EWRA 3V7EA 3VMFB 2OZBA 1VQKF 3LWQC 1VQ8F 1Q7YH 2LBWA 2OTLF 2F9ZC 5GIOC 3E20B 3JAMM 3LFOA 5FLXM 3NK7A 3PAFA 1PXWA 3CMEF 1W40A 5G4UC 3CXCF 2KG4A 5GINC 1Q86H 5HY1A 3CC2F 5HXZA 3CCLF 3I56F 3ON1A 3G6EF 3PLAC 1W42A 1VQNF 1VQPF 3VI6A 3CC7F 1X7PA 4NQ3A 2WALA 3SIUA 1Q82H 1VQOF 3N4ZA 3LWOC 1W3EX 3N4YA 1VQ9F 1N8RH 2AIFA 3J7AR 3FFMA 3JCMM 4EI9A 1T0KB 2QI2A 3V3TA 4BVQA 3HAXD 3LWRC 1RA4A 3CCUF 3HJWC 1VQLF 1RLGA 4EI8A 3CCJF 3CG6A 3WXMB 4NUTA 3OBWA 1KC8H 1H7MA 1GO0A 3IR9A 1YJWF 1JJ2F 2I6DA 3CCEF 1X7OA 3CD6F 3CPQA 1CK2A 3OBYA 3G71F 3NVKE 1K9MH 5HY4A 5FJ4C 2VGNA 5HY0A 3NMUC 3CC4F 4BY9D 1IPAA 2BO1A 3LWVC 2JNBA 3V7QA 1VQ7F 1W2BF 2KTVA 1GO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 M;  1YJ9 F;  5EO3 A;  1X52 A;  3J80 M;  1Q81 H;  2ALE A;  2QA4 F;  5GAP K;  3GYQ A;  4LCK A;  4C4W C;  1DT9 A;  1NMU B;  1VQ5 F;  1YJN F;  1SDS A;  5A2Q M;  2CZW A;  3CCR F;  2OHW A;  1QVG F;  3I55 F;  2VGM A;  1K8A H;  3AGK A;  3CMA F;  1VQM F;  3RA5 A;  1KQS F;  2HVY D;  4BW0 B;  3OW2 F;  5GAN K;  1S72 F;  1YIJ F;  1ZWZ A;  1W41 A;  1VQ6 F;  1XBI A;  3CCQ F;  1GZ0 A;  1YHQ F;  4X3L A;  1QVF F;  3E1Y A;  1E7K A;  2KTU A;  4X3M A;  1NJI H;  3CPW F;  3MCA B;  3O85 A;  2FC3 A;  3J81 M;  5DCV A;  1CN7 A;  1K73 H;  1YIT F;  3LWP C;  5G4V C;  5GIP C;  3CCV F;  2OTJ F;  2QEX F;  3CCM F;  3NVI B;  1M1K H;  1M90 H;  3NK6 A;  1KD1 H;  1YI2 F;  3SIV A;  1VQ4 F;  4TZZ A;  3RA6 A;  3G4S F;  2LBX A;  3CCS F;  5EWR A;  3V7E A;  3VMF B;  2OZB A;  1VQK F;  3LWQ C;  1VQ8 F;  1Q7Y H;  2LBW A;  2OTL F;  5GIO C;  3JAM M;  3E20 B;  3LFO A;  5FLX M;  3NK7 A;  3PAF A;  1PXW A;  3CME F;  1W40 A;  5G4U C;  3CXC F;  2KG4 A;  5GIN C;  1Q86 H;  3CC2 F;  3CCL F;  3I56 F;  3ON1 A;  3G6E F;  3PLA C;  1W42 A;  1VQN F;  1VQP F;  3VI6 A;  3CC7 F;  1X7P A;  2WAL A;  3SIU A;  1Q82 H;  1VQO F;  3N4Z A;  3LWO C;  1W3E X;  3N4Y A;  1VQ9 F;  1N8R H;  2AIF A;  3J7A R;  3FFM A;  3JCM M;  1T0K B;  2QI2 A;  3HAX D;  3LWR C;  1RA4 A;  3CCU F;  3HJW C;  1VQL F;  1RLG A;  3CCJ F;  3CG6 A;  3WXM B;  4NUT A;  3OBW A;  1KC8 H;  1H7M A;  1GO0 A;  3IR9 A;  1YJW F;  1JJ2 F;  2I6D A;  3CCE F;  1X7O A;  3CD6 F;  3CPQ A;  1CK2 A;  3OBY A;  3G71 F;  3NVK E;  1K9M H;  5FJ4 C;  2VGN A;  3NMU C;  3CC4 F;  4BY9 D;  1IPA A;  2BO1 A;  3LWV C;  2JNB A;  3V7Q A;  1VQ7 F;  1W2B F;  2KTV A;  1GO1 A; 
#chains in the Genus database with same CATH topology
 3F0E A;  1VH8 A;  5EO3 A;  2BTU A;  2ALE A;  3JAR B;  2ZVZ A;  5GAP K;  2YYE A;  1DT9 A;  1CLI A;  2V9Y A;  3HWU A;  5A2Q M;  2DYY A;  3QUW A;  2VGM A;  3I55 F;  1KNK A;  2R6R 1;  4EB6 A;  2HVY D;  4BW0 B;  4RQO A;  5ITZ B;  3K14 A;  5HXU A;  5FNV A;  4ZK7 A;  4O4H B;  3WJP A;  1S72 F;  1YIJ F;  1FNJ A;  1FFX A;  1GZ0 A;  3T80 A;  4X20 B;  1YHQ F;  1QVF F;  2HRU A;  1E7K A;  2GLZ A;  2ZVY A;  3CPW F;  3MCA B;  1CN7 A;  1K73 H;  1YIT F;  2HX0 A;  3LWP C;  4IIJ A;  3HKD A;  5J2T A;  2UYK A;  1VQV A;  5IJ9 A;  5ITZ A;  4B46 A;  5MN6 A;  4B62 A;  3NVI B;  4XCQ A;  2Q1Y A;  3HKC A;  3OON A;  3RYH B;  3VIU A;  5BMV A;  5EYP A;  3IEQ A;  5EWR A;  3UT5 A;  3CYQ A;  3VMF B;  2OZB A;  2R75 1;  3L7Q A;  3LWQ C;  1QU9 A;  5EIB C;  3I3F A;  1TUB B;  4ZHQ B;  1VQ8 F;  4O4I A;  3WGL A;  2DT4 A;  4X1I A;  4YJ2 A;  5JH7 A;  3JAM M;  1YQN A;  3ZP7 A;  4O4J B;  3R0P A;  3LDT A;  2RHJ A;  3M1X A;  4G4V A;  1Q86 H;  5LP6 C;  2HS3 A;  5HXZ A;  4I4T B;  5IJ0 B;  4BT4 A;  3I56 F;  3ON1 A;  4G4Y A;  2LCA A;  1XV2 A;  3KJK A;  2Z1E A;  1W42 A;  3PLA C;  4WBN B;  3CC7 F;  4U3J A;  4NQ3 A;  3S0H A;  3SIU A;  3RYF B;  1IV1 A;  2ZOD A;  4TUY A;  3N4Z A;  2RB9 A;  3JAK A;  1ONI A;  3HAX D;  3WGN A;  3E22 A;  1PF5 A;  1SA0 A;  5GON A;  4LNU A;  5EB1 B;  3N2K B;  3ZO8 A;  3IEW A;  3K12 A;  3RYI B;  3CG6 A;  2Z1U A;  4I55 A;  3MCQ A;  3VO8 A;  5JQG B;  1U43 A;  4ZI7 A;  5EZY A;  1OAP A;  3CCE F;  3U0O A;  1U3L A;  3OBY A;  3G71 F;  4X1K B;  3P10 A;  1IV3 A;  4WBN A;  1K9M H;  3NMU C;  1UI9 A;  2GVI A;  2BO1 A;  1NJI H;  1GO1 A;  1JN1 A;  1YJ9 F;  4O2A B;  3JAT A;  2CHT A;  3GYQ A;  4C4W C;  1NMU B;  4TV9 A;  1JFF B;  4BT6 A;  1W58 1;  1QVG F;  4EB6 B;  2AMT A;  5FNV B;  3F0G A;  3OW2 F;  3IKE A;  5LA6 B;  1RQ7 A;  1FFX B;  4YJ3 A;  2K1S A;  3WPW A;  3HKE B;  4E6E A;  1XRG A;  3P4E A;  4PWT A;  4X3M A;  3MDO A;  4BVS A;  3N2G A;  1Z5V A;  2HS0 A;  1FNK A;  5JCO C;  3WGJ A;  4O2A A;  3F0D A;  1H48 A;  3RYC A;  1JFF A;  3D01 A;  4IIJ B;  3HKD B;  5GIP C;  3S0W A;  5J2T B;  5IJ9 B;  3VYU C;  3GTZ A;  1ODE A;  3CCM F;  2VAP A;  1M90 H;  1U3P A;  1H47 A;  1QD9 A;  3HKC B;  1KD1 H;  5LA6 A;  2PMP A;  3SIV A;  3M84 A;  3JVH A;  1VQ4 F;  5BMV B;  5EYP B;  3G4S F;  2LBX A;  3UT5 B;  2UYJ A;  3HKE A;  3KIZ A;  2RHL A;  2HP0 A;  4ZHW A;  2AIZ P;  1OFU A;  2EWC A;  4O4I B;  5EAZ A;  4YJ2 B;  4X1I B;  5JH7 B;  5FLX M;  3NK7 A;  3PAF A;  1PXW A;  3S02 A;  4C8E A;  1NQ3 A;  2KG4 A;  3MQW A;  3LYB A;  3CC2 F;  2UYP A;  4ZHY B;  2CSL A;  3K2X A;  1VQN F;  4U3J B;  3LME A;  3V4D A;  4IHJ A;  1Q8R A;  4HNA A;  3I7T A;  5LXT A;  4TUY B;  3TD4 A;  1W3E X;  1VQ9 F;  1N8R H;  4F6R A;  3JAK B;  4EI9 A;  1U40 A;  2QI2 A;  3V3T A;  4BVQ A;  3LWR C;  3E22 B;  3VCZ A;  3WPX A;  1SA0 B;  3VOA A;  5GON B;  4LNU B;  3HJW C;  1COM A;  4EI8 A;  3KE1 A;  4I55 B;  4NUT A;  1H7M A;  4M8I A;  4ZI7 B;  5EZY B;  2CHS A;  1YJW F;  2I6D A;  3QHD A;  3CD6 F;  2H6L A;  2IAF A;  2QTP A;  3NVK E;  1RLU A;  3S06 A;  3KJJ A;  2VGN A;  3ZOP A;  5J2U A;  4BY9 D;  5EIB D;  3LWV C;  3VYT C;  1W2B F;  4G4X A;  4BVR A;  3S03 A;  2YXZ A;  1X52 A;  5HP8 A;  3JAT B;  3D00 A;  4LCK A;  4TV9 B;  4BVT A;  3B6N A;  1SDS A;  4G4Z A;  2CZW A;  3CCR F;  2OHW A;  1K8A H;  3CMA F;  2G9I A;  4KWE A;  2W8B C;  3ESJ A;  1KQS F;  3WJQ A;  3QTY A;  2BTQ B;  3JAL A;  3TD5 A;  5JVD A;  2I6R A;  5GAN K;  5LP6 A;  3EOR A;  3HKB A;  1W41 A;  5C8Y A;  1VQ6 F;  1XBI A;  4YJ3 B;  3CCQ F;  3F6M A;  5CA1 A;  1T0A A;  3N2G B;  3ELC A;  2Z1T A;  4X1Y A;  1KNJ A;  3FBA A;  4ZOL A;  5LOV A;  1RQ2 A;  3RYC B;  3DC2 A;  2L26 A;  2UZH A;  5G4V C;  5HY2 A;  4BT3 A;  3JAW A;  3WGM A;  1VK3 A;  2PHN A;  3VOB A;  2MQE A;  2H8E A;  1J7H A;  4B45 A;  1M1K H;  4C8G A;  3FPI A;  4FFB A;  3RA6 A;  3CCS F;  3V7E A;  2B33 A;  3VTI C;  3DDN A;  1SZQ A;  3BYQ A;  4DXD A;  5LYJ A;  4O2B A;  1W5B A;  1VQK F;  2HP0 B;  3JAS A;  2H8C A;  4O4L B;  5CA0 B;  5GIO C;  3E20 B;  3LFO A;  1TVK A;  2N48 A;  3RE3 A;  4C82 A;  4G88 A;  3CME F;  1W40 A;  5G4U C;  1W5F A;  5IYZ B;  3CXC F;  1W5E A;  3KHN A;  4R40 B;  1IV4 A;  3GHZ A;  5KMG A;  1VQP F;  3ZP4 A;  4IHJ B;  4HNA B;  2HP3 A;  5LXT B;  3F0F A;  4F6R B;  2AIF A;  4TV8 A;  3J7A R;  3JCM M;  5JCO A;  5HP7 A;  1JD1 A;  4O4L A;  5CA0 A;  1VQL F;  4DRX B;  1XHO A;  4G4W A;  1W5A A;  2KGW A;  1GO0 A;  3IR9 A;  4BT7 A;  5IYZ A;  1X7O A;  1W57 A;  4I50 A;  3CPQ A;  2VAW A;  5EB0 A;  2HS4 A;  4C81 A;  3P0Z A;  5FJ4 C;  1QAH A;  5J2U B;  3CC4 F;  3ERN A;  3FD6 A;  2CWJ A;  5IT9 M;  4BT2 A;  3J80 M;  1Q81 H;  3WGK A;  5AVM A;  3JAR A;  2QA4 F;  3TD3 A;  3MBM A;  1VQ5 F;  1YJN F;  5MN4 A;  3K0T A;  2FGY A;  1DBF A;  3AGK A;  5HWE A;  1VQM F;  4DRX A;  3RA5 A;  3JAL B;  5JVD B;  2BTO A;  1IV2 A;  2HQS C;  4O4H A;  5LP6 B;  3HKB B;  1ZWZ A;  5C8Y B;  1VHA A;  3C9R A;  2ZF8 A;  4X20 A;  4X3L A;  2ZAU A;  3WJR A;  3HTN A;  5CA1 B;  3E1Y A;  2KTU A;  5B8F A;  4EI7 A;  4X1Y B;  3O85 A;  4ZOL B;  5LOV B;  2FC3 A;  3M4S A;  3C8L A;  2UYN B;  3J81 M;  5DCV A;  4NWO B;  1UFY A;  3CCV F;  3JAW B;  3C9U A;  2OTJ F;  2OTM A;  2Z1F A;  2QEX F;  3NK6 A;  5KX5 B;  1YI2 F;  4B5C A;  4FFB B;  1W59 A;  3RYH A;  4TZZ A;  2VAM A;  2HRY A;  5LYJ B;  3Q8H A;  4O2B B;  3JAS B;  2GZL A;  3IMP A;  1Q7Y H;  2RHO A;  2NMU A;  1TUB A;  2LBW A;  4ZHQ A;  4U39 A;  3FD5 A;  2OTL F;  2F9Z C;  1GX1 A;  1TVK B;  2CVL A;  2UYN A;  4C8I A;  3CYP B;  4O4J A;  2P6Y A;  4RHA A;  5GIN C;  5HY1 A;  3CCL F;  4I4T A;  5IJ0 A;  3G6E F;  5CB4 B;  5KMG B;  3VI6 A;  3VYS C;  1Z5W A;  2LBT A;  5KX5 A;  1X7P A;  4ZHV A;  2RHH A;  1YGY A;  2WAL A;  1Q82 H;  1VQO F;  3RYF A;  1FSZ A;  3CB2 A;  3LWO C;  3IKF A;  3N4Y A;  1W55 A;  1R1M A;  4TV8 B;  3FFM A;  1T0K B;  1RA4 A;  3CCU F;  1RLG A;  3N2K A;  2IQQ A;  3CCJ F;  3WXM B;  2ZOV A;  3RYI A;  3D54 A;  3OBW A;  1KC8 H;  5JQG A;  2CW4 A;  2Z01 A;  3C9T A;  1JJ2 F;  2VXY A;  5MN5 A;  2Q1X A;  4I50 B;  4ERH A;  1CK2 A;  1JY8 A;  4BT5 A;  5CB4 A;  4X1K A;  5HY4 A;  1X25 A;  5HY0 A;  3S0Y A;  2IG8 A;  1IPA A;  2JNB A;  3V7Q A;  1VQ7 F;  3C9S A;  2KTV A; 
#chains in the Genus database with same CATH homology
 5IT9 M;  1YJ9 F;  5EO3 A;  1X52 A;  3J80 M;  1Q81 H;  2ALE A;  3D00 A;  5GAP K;  3GYQ A;  2QA4 F;  4LCK A;  1DT9 A;  1NMU B;  4BVT A;  1YJN F;  1VQ5 F;  5A2Q M;  2CZW A;  3CCR F;  1SDS A;  2OHW A;  1QVG F;  2FGY A;  2VGM A;  5HWE A;  3AGK A;  3I55 F;  3CMA F;  1VQM F;  1K8A H;  3RA5 A;  1KQS F;  2HVY D;  4BW0 B;  5HXU A;  3OW2 F;  5GAN K;  1S72 F;  1YIJ F;  1ZWZ A;  1W41 A;  1VQ6 F;  1XBI A;  3CCQ F;  1GZ0 A;  1YHQ F;  4X3L A;  1QVF F;  4C4W C;  3E1Y A;  1E7K A;  2KTU A;  2GLZ A;  4X3M A;  4BVS A;  4EI7 A;  1NJI H;  3CPW F;  3MCA B;  3O85 A;  2FC3 A;  3J81 M;  4BVR A;  5DCV A;  1CN7 A;  1K73 H;  1YIT F;  3LWP C;  5G4V C;  5GIP C;  3CCV F;  5HY2 A;  2OTJ F;  2QEX F;  3CCM F;  3NVI B;  4XCQ A;  1M1K H;  1M90 H;  3NK6 A;  1KD1 H;  1YI2 F;  3SIV A;  1VQ4 F;  4TZZ A;  3RA6 A;  3G4S F;  2LBX A;  3CCS F;  5EWR A;  3V7E A;  3VMF B;  2OZB A;  1VQK F;  3LWQ C;  1VQ8 F;  1Q7Y H;  2LBW A;  2OTL F;  2F9Z C;  5GIO C;  3E20 B;  3JAM M;  3LFO A;  5FLX M;  3NK7 A;  3PAF A;  1PXW A;  3CME F;  1W40 A;  5G4U C;  3CXC F;  2KG4 A;  5GIN C;  1Q86 H;  5HY1 A;  3CC2 F;  5HXZ A;  3CCL F;  3I56 F;  3ON1 A;  3G6E F;  3PLA C;  1W42 A;  1VQN F;  1VQP F;  3VI6 A;  3CC7 F;  1X7P A;  4NQ3 A;  2WAL A;  3SIU A;  1Q82 H;  1VQO F;  3N4Z A;  3LWO C;  1W3E X;  3N4Y A;  1VQ9 F;  1N8R H;  2AIF A;  3J7A R;  3FFM A;  3JCM M;  4EI9 A;  1T0K B;  2QI2 A;  3V3T A;  4BVQ A;  3HAX D;  3LWR C;  1RA4 A;  3CCU F;  3HJW C;  1VQL F;  1RLG A;  4EI8 A;  3CCJ F;  3CG6 A;  3WXM B;  4NUT A;  3OBW A;  1KC8 H;  1H7M A;  1GO0 A;  3IR9 A;  1YJW F;  1JJ2 F;  2I6D A;  3CCE F;  1X7O A;  3CD6 F;  3CPQ A;  1CK2 A;  3OBY A;  3G71 F;  3NVK E;  1K9M H;  5HY4 A;  5FJ4 C;  2VGN A;  5HY0 A;  3NMU C;  3CC4 F;  4BY9 D;  1IPA A;  2BO1 A;  3LWV C;  2JNB A;  3V7Q A;  1VQ7 F;  1W2B F;  2KTV A;  1GO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...