5GAPK

Body region of the u4/u6.u5 tri-snrnp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
b'APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA, 5' region, nucleotides 1-67
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gapK00
2I6DA 3CC4F 3G71F 3J7AR 1YIJF 1GO1A 1YHQF 1ZWZA 1VQ7F 1VQLF 3CD6F 2HVYD 4LCKA 1VQ6F 1Q82H 1NJIH 3ON1A 1VQNF 3G4SF 3JCMM 3LWRC 2WALA 1VQMF 1W2BF 1VQ9F 1VQ5F 1K73H 1T0KB 2JNBA 5GIOC 1XBIA 4X3MA 1KC8H 3LWVC 1K8AH 3NMUC 1W42A 1KQSF 2OHWA 2VGMA 3PAFA 1X7OA 1YJWF 5GANK 1SDSA 5A2QM 3E1YA 3OBYA 3FFMA 3CC7F 3HJWC 1M90H 1RLGA 2LBWA 2KTVA 3HAXD 3MCAB 3N4ZA 1RA4A 1N8RH 3LFOA 2FC3A 3VMFB 3IR9A 1W3EX 2KTUA 3LWQC 1VQ8F 1YJNF 3N4YA 1QVFF 3SIUA 3CCSF 1K9MH 2AIFA 2VGNA 3RA5A 1YITF 1JJ2F 1NMUB 5DCVA 1IPAA 3AGKA 3O85A 2KG4A 3LWPC 2QA4F 1Q7YH 3CCMF 3SIVA 5G4UC 1GO0A 3CPWF 3PLAC 3V7QA 4C4WC 3CCQF 2OTJF 3CCEF 4X3LA 3CCRF 1PXWA 1H7MA 1VQ4F 3J80M 3CCLF 5EO3A 1Q86H 2QI2A 1GZ0A 4BY9D 3CMEF 1QVGF 1S72F 3J81M 3JAMM 3NVIB 1YJ9F 1Q81H 3OW2F 3CXCF 4BW0B 1KD1H 3GYQA 3E20B 1CK2A 2LBXA 5EWRA 2QEXF 1X52A 3CCVF 4TZZA 1X7PA 3V7EA 3CC2F 3NK6A 1VQPF 1CN7A 2CZWA 3CG6A 1VQOF 3CCUF 5GAPK 3CMAF 3I55F 1E7KA 1YI2F 3G6EF 3OBWA 3I56F 3NK7A 5FJ4C 5GIPC 5G4VC 3VI6A 3CPQA 1VQKF 3RA6A 1W41A 1DT9A 2BO1A 4NUTA 5IT9M 2OTLF 3CCJF 2ALEA 1M1KH 1W40A 3WXMB 5GINC 2OZBA 5FLXM 3LWOC 3NVKE
chains in the Genus database with same CATH superfamily
1RQ2A 2I6DA 5MN6A 3K14A 5KMGB 4I55A 4BT7A 1GO1A 3N2GB 1YIJF 1ZWZA 2OTMA 5GONB 3CD6F 4PWTA 4YJ3B 1NJIH 3HKDA 2UYKA 3ESJA 3JCMM 4B62A 1VQMF 1VQ9F 4ZHYB 1VQ5F 4NWOB 4EI7A 2RHLA 3RYIA 2ZVZA 4IIJB 3LDTA 3JASB 1VQVA 3WGLA 5ITZB 2IQQA 1M90H 1RLGA 4U39A 2VAPA 2UYJA 3HKEA 3M1XA 3WGNA 1RA4A 2Z01A 2FC3A 3VMFB 5IJ0A 5LXTA 4I55B 3ZP7A 1VQ8F 2R751 5LP6C 1W5EA 5B8FA 1JFFA 3N4YA 1W5BA 5FNVA 3V3TA 4G4ZA 1JN1A 1OAPA 1NMUB 3JALA 3RYIB 3LWPC 1Q7YH 3SIVA 3K0TA 2Z1UA 1X25A 3V7QA 3FD5A 3VYSC 2OTJF 2HRUA 3CCEF 2IAFA 3WPXA 3I3FA 3HKEB 3UT5B 1U3LA 1GZ0A 3N2KB 3CMEF 5LXTB 2HS3A 5EZYA 3JAMM 3TD5A 3GTZA 1YJ9F 2HX0A 3OW2F 5MN5A 3RE3A 1CK2A 2LBXA 3VOBA 3QTYA 3CCVF 2UZHA 1Q8RA 3JALB 4B46A 2Q1YA 2YXZA 3E22A 1RLUA 1VQPF 3ZOPA 5EYPA 3S02A 2VAMA 4I50A 3OBWA 3MDOA 4C81A 5GIPC 5HP8A 3HTNA 3CPQA 4BVTA 3JATA 3TD4A 2CHSA 1W41A 4O4JB 4HNAB 1ODEA 2HQSC 5EZYB 2NMUA 5IT9M 2ALEA 1M1KH 3WPWA 4ZI7A 5GINC 2ZOVA 4DRXA 3DDNA 3RYCB 2R6R1 4O2BA 1TUBA 3J7AR 1RQ7A 3E22B 4LNUA 5EIBC 5GONA 5JCOA 2HVYD 3KHNA 3C9RA 4NQ3A 4YJ2B 5EYPB 1VQNF 2HRYA 3M84A 4XCQA 1W55A 2Q1XA 2MQEA 2WALA 2W8BC 5GIOC 2CHTA 2Z1TA 3B6NA 5KX5A 4TV8B 4G4XA 2OHWA 1YJWF 3CB2A 1X7OA 4ZI7B 5ITZA 5HY2A 5A2QM 3IKEA 3OBYA 3CC7F 3HJWC 1YQNA 4DRXB 2VAWA 3GHZA 4G88A 3N4ZA 2GZLA 4O2BB 1TUBB 1W5FA 4LNUB 2KTUA 4X1IA 4O4LA 2FGYA 4IHJA 3RYHA 3HKCA 3SIUA 3WJQA 2PHNA 2AIFA 3RA5A 3TD3A 1FSZA 1ONIA 2AIZP 4ZHWA 3HWUA 1IPAA 2QA4F 5KX5B 4G4VA 3WJPA 3PLAC 2DT4A 3CCQF 5BMVA 5IYZA 5IJ9A 2KGWA 1PXWA 1VQ4F 3UT5A 3F6MA 3J80M 1J7HA 3N2KA 5EB1B 2QI2A 2K1SA 4X1KA 2UYNA 4O4LB 4X1IB 4IHJB 3RYHB 3JAKA 3HKCB 3LYBA 1Q81H 3VIUA 2RHOA 2RHHA 3D00A 2ZF8A 5JH7A 3ZO8A 5EWRA 3WGJA 3VYTC 3C8LA 5J2UA 1X7PA 3LMEA 4O2AA 4BVRA 1W581 1KNJA 3NK6A 3CG6A 5BMVB 2DYYA 5IYZB 5IJ9B 1IV4A 2ZODA 1XRGA 1KNKA 4TV9A 3D01A 4BVQA 1FNKA 3I55F 5LOVA 3C9UA 1YI2F 3G6EF 4C8GA 2CVLA 3I56F 5FJ4C 2QTPA 1SA0A 4HNAA 4O4JA 4X1KB 1VQKF 1IV2A 1XHOA 2UYNB 1DT9A 2BO1A 3OONA 4NUTA 3JAKB 1H47A 1U43A 1W40A 3WXMB 2HP3A 3L7QA 4BVSA 5FLXM 5JH7B 3NVKE 2CSLA 3RYCA 3VCZA 2VXYA 3CC4F 5J2UB 4O2AB 4O4IA 1YGYA 1VHAA 2Z1FA 2PMPA 1DBFA 1VQ7F 4LCKA 4YJ2A 4TV9B 3MQWA 2P6YA 5LOVB 3ON1A 4C8IA 2H8EA 3K12A 1W2BF 4I4TA 1T0KB 1K73H 3T80A 1SA0B 2JNBA 5MN4A 4TV8A 4X1YA 4X3MA 4BT3A 1KC8H 3P0ZA 2YYEA 3LWVC 5AVMA 1K8AH 4ZHQA 1KQSF 1T0AA 2VGMA 3PAFA 5GANK 2BTOA 1JY8A 3S06A 5HWEA 3MBMA 3FFMA 3CYPB 3VOAA 3HAXD 3C9TA 2H8CA 3LFOA 4O4IB 5JCOC 1W3EX 5EB0A 2CW4A 3HKBA 1FFXA 1YJNF 2LCAA 3FPIA 2RHJA 3S0WA 3IEQA 4ZHVA 1VH8A 1IV3A 1W5AA 1U3PA 5HY0A 1JJ2F 3S0YA 4I4TB 3VYUC 3IKFA 1GX1A 2L26A 1VK3A 2KG4A 2F9ZC 3P10A 4X1YB 3CCMF 5G4UC 3K2XA 4BT5A 5HXZA 1GO0A 1TVKA 1IV1A 4ZHQB 4C4WC 2Z1EA 1W59A 1H7MA 1R1MA 5EIBD 4EB6A 4WBNB 1Q86H 5CB4A 4BY9D 1QVGF 3VO8A 3HKBB 1S72F 4ZOLA 3J81M 1FFXB 4BT4A 1NQ3A 3RYFA 2GVIA 4BW0B 1KD1H 3GYQA 3E20B 3KJKA 2QEXF 4G4WA 1XV2A 4B45A 3CC2F 5JVDA 1TVKB 1CN7A 1SZQA 2CZWA 3Q8HA 2HP0A 5CA1A 3CMAF 3FBAA 1E7KA 4EB6B 4C82A 2G9IA 4EI9A 5CB4B 1CLIA 3RA6A 4TUYA 4ZOLB 2EWCA 3RYFB 3CCJF 3MCQA 3WGKA 4BT6A 3P4EA 1COMA 3LWOC 5EAZA 2UYPA 3F0GA 4M8IA 3ELCA 2BTQB 4X20B 4B5CA 3U0OA 2GLZA 3R0PA 3G71F 3IEWA 5JVDB 3CYQA 1YHQF 1QAHA 2I6RA 2HP0B 3M4SA 4ZK7A 5HY4A 5C8YA 5CA1B 2CWJA 1VQLF 5LA6A 1VQ6F 1Q82H 5LP6A 5HXUA 2HS4A 3G4SF 2B33A 3HKDB 3LWRC 3S0HA 3KE1A 4FFBA 1XBIA 4KWEA 3JVHA 4TUYB 3QHDA 3KJJA 4DXDA 3NMUC 1W42A 4F6RA 2ZVYA 1SDSA 1UFYA 4E6EA 3C9SA 3F0EA 3E1YA 3JARA 3F0FA 2N48A 4EI8A 2LBWA 2KTVA 1PF5A 3MCAB 3WGMA 3V4DA 1U40A 3F0DA 4BT2A 3IMPA 1N8RH 3IR9A 5JQGA 5IJ0B 3LWQC 5LYJA 1QD9A 5C8YB 1QVFF 5LA6B 1JFFB 5LP6B 5FNVB 3CCSF 1Z5VA 1K9MH 2AMTA 4O4HA 2H6LA 2VGNA 2RB9A 4R40B 5CA0A 1YITF 1JD1A 3ZP4A 5DCVA 4FFBB 3AGKA 3O85A 3CPWF 4F6RB 4RHAA 1H48A 4X3LA 3CCRF 3D54A 3JARB 4C8EA 4WBNA 3CCLF 5EO3A 5HP7A 2LBTA 2HS0A 5JQGB 3BYQA 3VTIC 3NVIB 2IG8A 5LYJB 4ERHA 3JAWA 1Z5WA 3I7TA 3CXCF 4O4HB 4U3JA 5J2TA 5CA0B 3KIZA 1X52A 1UI9A 2BTUA 1OFUA 4TZZA 3V7EA 5KMGA 5HY1A 3WJRA 3N2GA 2V9YA 3EORA 4RQOA 1VQOF 3CCUF 1FNJA 2ZAUA 5GAPK 4YJ3A 1QU9A 3NK7A 4I50B 5G4VC 3VI6A 4G4YA 3FD6A 3JATB 3QUWA 3S03A 4IIJA 2OTLF 3JASA 3JAWB 3DC2A 2OZBA 4U3JB 3ERNA 4X20A 5J2TB 1W57A
chains in the Genus database with same CATH topology
2GLZA 2I6DA 3CC4F 3G71F 3J7AR 1YIJF 1GO1A 1YHQF 1ZWZA 1VQ7F 1VQLF 5HY4A 2HVYD 3CD6F 4LCKA 1VQ6F 4NQ3A 1Q82H 1NJIH 3ON1A 5HXUA 1VQNF 3G4SF 4XCQA 3JCMM 3LWRC 2WALA 1VQMF 1W2BF 1VQ9F 1VQ5F 1K73H 1T0KB 2JNBA 5GIOC 4EI7A 1XBIA 4X3MA 1KC8H 3LWVC 1K8AH 3NMUC 1W42A 1KQSF 2OHWA 2VGMA 3PAFA 1X7OA 1YJWF 5GANK 1SDSA 5HWEA 5HY2A 5A2QM 3E1YA 3OBYA 3FFMA 3CC7F 3HJWC 1M90H 1RLGA 4EI8A 2LBWA 2KTVA 3HAXD 3MCAB 3N4ZA 1RA4A 1N8RH 3LFOA 2FC3A 3VMFB 3IR9A 1W3EX 2KTUA 3LWQC 2FGYA 1VQ8F 1YJNF 3N4YA 1QVFF 3SIUA 3V3TA 3CCSF 1K9MH 2AIFA 2VGNA 3RA5A 5HY0A 1YITF 1JJ2F 1NMUB 5DCVA 1IPAA 3AGKA 3O85A 2KG4A 2F9ZC 3LWPC 2QA4F 3CCMF 1Q7YH 3SIVA 5HXZA 3CPWF 5G4UC 1GO0A 3PLAC 3V7QA 4C4WC 3CCQF 2OTJF 3CCEF 4X3LA 3CCRF 1PXWA 1H7MA 1VQ4F 3J80M 3CCLF 5EO3A 1Q86H 2QI2A 1GZ0A 4BY9D 3CMEF 1QVGF 1S72F 3J81M 3JAMM 3NVIB 1YJ9F 1Q81H 3OW2F 3CXCF 4BW0B 3D00A 1KD1H 3GYQA 3E20B 1CK2A 2LBXA 5EWRA 2QEXF 1X52A 3CCVF 4TZZA 1X7PA 3V7EA 5HY1A 4BVRA 3CC2F 3NK6A 1VQPF 1CN7A 2CZWA 3CG6A 1VQOF 3CCUF 5GAPK 4BVQA 3CMAF 3I55F 1E7KA 1YI2F 3G6EF 3OBWA 3I56F 3NK7A 5FJ4C 5GIPC 4EI9A 5G4VC 3VI6A 4BVTA 3CPQA 1VQKF 3RA6A 1W41A 1DT9A 2BO1A 4NUTA 5IT9M 2OTLF 3CCJF 2ALEA 1M1KH 1W40A 3WXMB 5GINC 2OZBA 4BVSA 5FLXM 3LWOC 3NVKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  3CC4 F;  3G71 F;  3J7A R;  1YIJ F;  1GO1 A;  1YHQ F;  1ZWZ A;  1VQ7 F;  1VQL F;  3CD6 F;  2HVY D;  4LCK A;  1VQ6 F;  1Q82 H;  1NJI H;  3ON1 A;  1VQN F;  3G4S F;  3JCM M;  3LWR C;  2WAL A;  1VQM F;  1W2B F;  1VQ9 F;  1VQ5 F;  1K73 H;  1T0K B;  2JNB A;  5GIO C;  1XBI A;  4X3M A;  1KC8 H;  3LWV C;  1K8A H;  3NMU C;  1W42 A;  1KQS F;  2OHW A;  2VGM A;  3PAF A;  1X7O A;  1YJW F;  5GAN K;  1SDS A;  5A2Q M;  3E1Y A;  3OBY A;  3FFM A;  3CC7 F;  3HJW C;  1M90 H;  1RLG A;  2LBW A;  2KTV A;  3HAX D;  3MCA B;  3N4Z A;  1RA4 A;  1N8R H;  3LFO A;  2FC3 A;  3VMF B;  3IR9 A;  1W3E X;  2KTU A;  3LWQ C;  1VQ8 F;  1YJN F;  3N4Y A;  1QVF F;  3SIU A;  3CCS F;  1K9M H;  2AIF A;  2VGN A;  3RA5 A;  1YIT F;  1JJ2 F;  1NMU B;  5DCV A;  1IPA A;  3AGK A;  3O85 A;  2KG4 A;  3LWP C;  2QA4 F;  1Q7Y H;  3CCM F;  3SIV A;  5G4U C;  1GO0 A;  3CPW F;  3PLA C;  3V7Q A;  4C4W C;  3CCQ F;  2OTJ F;  3CCE F;  4X3L A;  3CCR F;  1PXW A;  1H7M A;  1VQ4 F;  3J80 M;  3CCL F;  5EO3 A;  1Q86 H;  2QI2 A;  1GZ0 A;  4BY9 D;  3CME F;  1QVG F;  1S72 F;  3J81 M;  3JAM M;  3NVI B;  1YJ9 F;  1Q81 H;  3OW2 F;  3CXC F;  4BW0 B;  1KD1 H;  3GYQ A;  3E20 B;  1CK2 A;  2LBX A;  5EWR A;  2QEX F;  1X52 A;  3CCV F;  4TZZ A;  1X7P A;  3V7E A;  3CC2 F;  3NK6 A;  1VQP F;  1CN7 A;  2CZW A;  3CG6 A;  1VQO F;  3CCU F;  5GAP K;  3CMA F;  3I55 F;  1E7K A;  1YI2 F;  3G6E F;  3OBW A;  3I56 F;  3NK7 A;  5FJ4 C;  5GIP C;  5G4V C;  3VI6 A;  3CPQ A;  1VQK F;  3RA6 A;  1W41 A;  1DT9 A;  2BO1 A;  4NUT A;  5IT9 M;  2OTL F;  3CCJ F;  2ALE A;  1M1K H;  1W40 A;  3WXM B;  5GIN C;  2OZB A;  5FLX M;  3LWO C;  3NVK E; 
#chains in the Genus database with same CATH topology
 1RQ2 A;  2I6D A;  5MN6 A;  3K14 A;  5KMG B;  4I55 A;  4BT7 A;  1GO1 A;  3N2G B;  1YIJ F;  1ZWZ A;  2OTM A;  5GON B;  3CD6 F;  4PWT A;  4YJ3 B;  1NJI H;  3HKD A;  2UYK A;  3ESJ A;  3JCM M;  4B62 A;  1VQM F;  1VQ9 F;  4ZHY B;  1VQ5 F;  4NWO B;  4EI7 A;  2RHL A;  3RYI A;  2ZVZ A;  4IIJ B;  3LDT A;  3JAS B;  1VQV A;  3WGL A;  5ITZ B;  2IQQ A;  1M90 H;  1RLG A;  4U39 A;  2VAP A;  2UYJ A;  3HKE A;  3M1X A;  3WGN A;  1RA4 A;  2Z01 A;  2FC3 A;  3VMF B;  5IJ0 A;  5LXT A;  4I55 B;  3ZP7 A;  1VQ8 F;  2R75 1;  5LP6 C;  1W5E A;  5B8F A;  1JFF A;  3N4Y A;  1W5B A;  5FNV A;  3V3T A;  4G4Z A;  1JN1 A;  1OAP A;  1NMU B;  3JAL A;  3RYI B;  3LWP C;  1Q7Y H;  3SIV A;  3K0T A;  2Z1U A;  1X25 A;  3V7Q A;  3FD5 A;  3VYS C;  2OTJ F;  2HRU A;  3CCE F;  2IAF A;  3WPX A;  3I3F A;  3HKE B;  3UT5 B;  1U3L A;  1GZ0 A;  3N2K B;  3CME F;  5LXT B;  2HS3 A;  5EZY A;  3JAM M;  3TD5 A;  3GTZ A;  1YJ9 F;  2HX0 A;  3OW2 F;  5MN5 A;  3RE3 A;  1CK2 A;  2LBX A;  3VOB A;  3QTY A;  3CCV F;  2UZH A;  1Q8R A;  3JAL B;  4B46 A;  2Q1Y A;  2YXZ A;  3E22 A;  1RLU A;  1VQP F;  3ZOP A;  5EYP A;  3S02 A;  2VAM A;  4I50 A;  3OBW A;  3MDO A;  4C81 A;  5GIP C;  5HP8 A;  3HTN A;  3CPQ A;  4BVT A;  3JAT A;  3TD4 A;  2CHS A;  1W41 A;  4O4J B;  4HNA B;  1ODE A;  2HQS C;  5EZY B;  2NMU A;  5IT9 M;  2ALE A;  1M1K H;  3WPW A;  4ZI7 A;  5GIN C;  2ZOV A;  4DRX A;  3DDN A;  3RYC B;  2R6R 1;  4O2B A;  1TUB A;  3J7A R;  1RQ7 A;  3E22 B;  4LNU A;  5EIB C;  5GON A;  5JCO A;  2HVY D;  3KHN A;  3C9R A;  4NQ3 A;  4YJ2 B;  5EYP B;  1VQN F;  2HRY A;  3M84 A;  4XCQ A;  1W55 A;  2Q1X A;  2MQE A;  2WAL A;  2W8B C;  5GIO C;  2CHT A;  2Z1T A;  3B6N A;  5KX5 A;  4TV8 B;  4G4X A;  2OHW A;  1YJW F;  3CB2 A;  1X7O A;  4ZI7 B;  5ITZ A;  5HY2 A;  5A2Q M;  3IKE A;  3OBY A;  3CC7 F;  3HJW C;  1YQN A;  4DRX B;  2VAW A;  3GHZ A;  4G88 A;  3N4Z A;  2GZL A;  4O2B B;  1TUB B;  1W5F A;  4LNU B;  2KTU A;  4X1I A;  4O4L A;  2FGY A;  4IHJ A;  3RYH A;  3HKC A;  3SIU A;  3WJQ A;  2PHN A;  2AIF A;  3RA5 A;  3TD3 A;  1FSZ A;  1ONI A;  2AIZ P;  4ZHW A;  3HWU A;  1IPA A;  2QA4 F;  5KX5 B;  4G4V A;  3WJP A;  3PLA C;  2DT4 A;  3CCQ F;  5BMV A;  5IYZ A;  5IJ9 A;  2KGW A;  1PXW A;  1VQ4 F;  3UT5 A;  3F6M A;  3J80 M;  1J7H A;  3N2K A;  5EB1 B;  2QI2 A;  2K1S A;  4X1K A;  2UYN A;  4O4L B;  4X1I B;  4IHJ B;  3RYH B;  3JAK A;  3HKC B;  3LYB A;  1Q81 H;  3VIU A;  2RHO A;  2RHH A;  3D00 A;  2ZF8 A;  5JH7 A;  3ZO8 A;  5EWR A;  3WGJ A;  3VYT C;  3C8L A;  5J2U A;  1X7P A;  3LME A;  4O2A A;  4BVR A;  1W58 1;  1KNJ A;  3NK6 A;  3CG6 A;  5BMV B;  2DYY A;  5IYZ B;  5IJ9 B;  1IV4 A;  2ZOD A;  1XRG A;  1KNK A;  4TV9 A;  3D01 A;  4BVQ A;  1FNK A;  3I55 F;  5LOV A;  3C9U A;  1YI2 F;  3G6E F;  4C8G A;  2CVL A;  3I56 F;  5FJ4 C;  2QTP A;  1SA0 A;  4HNA A;  4O4J A;  4X1K B;  1VQK F;  1IV2 A;  1XHO A;  2UYN B;  1DT9 A;  2BO1 A;  3OON A;  4NUT A;  3JAK B;  1H47 A;  1U43 A;  1W40 A;  3WXM B;  2HP3 A;  3L7Q A;  4BVS A;  5FLX M;  5JH7 B;  3NVK E;  2CSL A;  3RYC A;  3VCZ A;  2VXY A;  3CC4 F;  5J2U B;  4O2A B;  4O4I A;  1YGY A;  1VHA A;  2Z1F A;  2PMP A;  1DBF A;  1VQ7 F;  4LCK A;  4YJ2 A;  4TV9 B;  3MQW A;  2P6Y A;  5LOV B;  3ON1 A;  4C8I A;  2H8E A;  3K12 A;  1W2B F;  4I4T A;  1T0K B;  1K73 H;  3T80 A;  1SA0 B;  2JNB A;  5MN4 A;  4TV8 A;  4X1Y A;  4X3M A;  4BT3 A;  1KC8 H;  3P0Z A;  2YYE A;  3LWV C;  5AVM A;  1K8A H;  4ZHQ A;  1KQS F;  1T0A A;  2VGM A;  3PAF A;  5GAN K;  2BTO A;  1JY8 A;  3S06 A;  5HWE A;  3MBM A;  3FFM A;  3CYP B;  3VOA A;  3HAX D;  3C9T A;  2H8C A;  3LFO A;  4O4I B;  5JCO C;  1W3E X;  5EB0 A;  2CW4 A;  3HKB A;  1FFX A;  1YJN F;  2LCA A;  3FPI A;  2RHJ A;  3S0W A;  3IEQ A;  4ZHV A;  1VH8 A;  1IV3 A;  1W5A A;  1U3P A;  5HY0 A;  1JJ2 F;  3S0Y A;  4I4T B;  3VYU C;  3IKF A;  1GX1 A;  2L26 A;  1VK3 A;  2KG4 A;  2F9Z C;  3P10 A;  4X1Y B;  3CCM F;  5G4U C;  3K2X A;  4BT5 A;  5HXZ A;  1GO0 A;  1TVK A;  1IV1 A;  4ZHQ B;  4C4W C;  2Z1E A;  1W59 A;  1H7M A;  1R1M A;  5EIB D;  4EB6 A;  4WBN B;  1Q86 H;  5CB4 A;  4BY9 D;  1QVG F;  3VO8 A;  3HKB B;  1S72 F;  4ZOL A;  3J81 M;  1FFX B;  4BT4 A;  1NQ3 A;  3RYF A;  2GVI A;  4BW0 B;  1KD1 H;  3GYQ A;  3E20 B;  3KJK A;  2QEX F;  4G4W A;  1XV2 A;  4B45 A;  3CC2 F;  5JVD A;  1TVK B;  1CN7 A;  1SZQ A;  2CZW A;  3Q8H A;  2HP0 A;  5CA1 A;  3CMA F;  3FBA A;  1E7K A;  4EB6 B;  4C82 A;  2G9I A;  4EI9 A;  5CB4 B;  1CLI A;  3RA6 A;  4TUY A;  4ZOL B;  2EWC A;  3RYF B;  3CCJ F;  3MCQ A;  3WGK A;  4BT6 A;  3P4E A;  1COM A;  3LWO C;  5EAZ A;  2UYP A;  3F0G A;  4M8I A;  3ELC A;  2BTQ B;  4X20 B;  4B5C A;  3U0O A;  2GLZ A;  3R0P A;  3G71 F;  3IEW A;  5JVD B;  3CYQ A;  1YHQ F;  1QAH A;  2I6R A;  2HP0 B;  3M4S A;  4ZK7 A;  5HY4 A;  5C8Y A;  5CA1 B;  2CWJ A;  1VQL F;  5LA6 A;  1VQ6 F;  1Q82 H;  5LP6 A;  5HXU A;  2HS4 A;  3G4S F;  2B33 A;  3HKD B;  3LWR C;  3S0H A;  3KE1 A;  4FFB A;  1XBI A;  4KWE A;  3JVH A;  4TUY B;  3QHD A;  3KJJ A;  4DXD A;  3NMU C;  1W42 A;  4F6R A;  2ZVY A;  1SDS A;  1UFY A;  4E6E A;  3C9S A;  3F0E A;  3E1Y A;  3JAR A;  3F0F A;  2N48 A;  4EI8 A;  2LBW A;  2KTV A;  1PF5 A;  3MCA B;  3WGM A;  3V4D A;  1U40 A;  3F0D A;  4BT2 A;  3IMP A;  1N8R H;  3IR9 A;  5JQG A;  5IJ0 B;  3LWQ C;  5LYJ A;  1QD9 A;  5C8Y B;  1QVF F;  5LA6 B;  1JFF B;  5LP6 B;  5FNV B;  3CCS F;  1Z5V A;  1K9M H;  2AMT A;  4O4H A;  2H6L A;  2VGN A;  2RB9 A;  4R40 B;  5CA0 A;  1YIT F;  1JD1 A;  3ZP4 A;  5DCV A;  4FFB B;  3AGK A;  3O85 A;  3CPW F;  4F6R B;  4RHA A;  1H48 A;  4X3L A;  3CCR F;  3D54 A;  3JAR B;  4C8E A;  4WBN A;  3CCL F;  5EO3 A;  5HP7 A;  2LBT A;  2HS0 A;  5JQG B;  3BYQ A;  3VTI C;  3NVI B;  2IG8 A;  5LYJ B;  4ERH A;  3JAW A;  1Z5W A;  3I7T A;  3CXC F;  4O4H B;  4U3J A;  5J2T A;  5CA0 B;  3KIZ A;  1X52 A;  1UI9 A;  2BTU A;  1OFU A;  4TZZ A;  3V7E A;  5KMG A;  5HY1 A;  3WJR A;  3N2G A;  2V9Y A;  3EOR A;  4RQO A;  1VQO F;  3CCU F;  1FNJ A;  2ZAU A;  5GAP K;  4YJ3 A;  1QU9 A;  3NK7 A;  4I50 B;  5G4V C;  3VI6 A;  4G4Y A;  3FD6 A;  3JAT B;  3QUW A;  3S03 A;  4IIJ A;  2OTL F;  3JAS A;  3JAW B;  3DC2 A;  2OZB A;  4U3J B;  3ERN A;  4X20 A;  5J2T B;  1W57 A; 
#chains in the Genus database with same CATH homology
 2GLZ A;  2I6D A;  3CC4 F;  3G71 F;  3J7A R;  1YIJ F;  1GO1 A;  1YHQ F;  1ZWZ A;  1VQ7 F;  1VQL F;  5HY4 A;  2HVY D;  3CD6 F;  4LCK A;  1VQ6 F;  4NQ3 A;  1Q82 H;  1NJI H;  3ON1 A;  5HXU A;  1VQN F;  3G4S F;  4XCQ A;  3JCM M;  3LWR C;  2WAL A;  1VQM F;  1W2B F;  1VQ9 F;  1VQ5 F;  1K73 H;  1T0K B;  2JNB A;  5GIO C;  4EI7 A;  1XBI A;  4X3M A;  1KC8 H;  3LWV C;  1K8A H;  3NMU C;  1W42 A;  1KQS F;  2OHW A;  2VGM A;  3PAF A;  1X7O A;  1YJW F;  5GAN K;  1SDS A;  5HWE A;  5HY2 A;  5A2Q M;  3E1Y A;  3OBY A;  3FFM A;  3CC7 F;  3HJW C;  1M90 H;  1RLG A;  4EI8 A;  2LBW A;  2KTV A;  3HAX D;  3MCA B;  3N4Z A;  1RA4 A;  1N8R H;  3LFO A;  2FC3 A;  3VMF B;  3IR9 A;  1W3E X;  2KTU A;  3LWQ C;  2FGY A;  1VQ8 F;  1YJN F;  3N4Y A;  1QVF F;  3SIU A;  3V3T A;  3CCS F;  1K9M H;  2AIF A;  2VGN A;  3RA5 A;  5HY0 A;  1YIT F;  1JJ2 F;  1NMU B;  5DCV A;  1IPA A;  3AGK A;  3O85 A;  2KG4 A;  2F9Z C;  3LWP C;  2QA4 F;  3CCM F;  1Q7Y H;  3SIV A;  5HXZ A;  3CPW F;  5G4U C;  1GO0 A;  3PLA C;  3V7Q A;  4C4W C;  3CCQ F;  2OTJ F;  3CCE F;  4X3L A;  3CCR F;  1PXW A;  1H7M A;  1VQ4 F;  3J80 M;  3CCL F;  5EO3 A;  1Q86 H;  2QI2 A;  1GZ0 A;  4BY9 D;  3CME F;  1QVG F;  1S72 F;  3J81 M;  3JAM M;  3NVI B;  1YJ9 F;  1Q81 H;  3OW2 F;  3CXC F;  4BW0 B;  3D00 A;  1KD1 H;  3GYQ A;  3E20 B;  1CK2 A;  2LBX A;  5EWR A;  2QEX F;  1X52 A;  3CCV F;  4TZZ A;  1X7P A;  3V7E A;  5HY1 A;  4BVR A;  3CC2 F;  3NK6 A;  1VQP F;  1CN7 A;  2CZW A;  3CG6 A;  1VQO F;  3CCU F;  5GAP K;  4BVQ A;  3CMA F;  3I55 F;  1E7K A;  1YI2 F;  3G6E F;  3OBW A;  3I56 F;  3NK7 A;  5FJ4 C;  5GIP C;  4EI9 A;  5G4V C;  3VI6 A;  4BVT A;  3CPQ A;  1VQK F;  3RA6 A;  1W41 A;  1DT9 A;  2BO1 A;  4NUT A;  5IT9 M;  2OTL F;  3CCJ F;  2ALE A;  1M1K H;  1W40 A;  3WXM B;  5GIN C;  2OZB A;  4BVS A;  5FLX M;  3LWO C;  3NVK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...