5GAPK

Body region of the u4/u6.u5 tri-snrnp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA, 5' region, nucleotides 1-67
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gapK00
3LFOA 3ON1A 3RA5A 1KC8H 3NVKE 3CCLF 1Q86H 5A2QM 1QVFF 1SDSA 1Q81H 3NVIB 3PAFA 3O85A 3LWQC 1M90H 3PLAC 1YJNF 3OBYA 5IT9M 3CG6A 2ALEA 3CD6F 2OTJF 1VQOF 3GYQA 1GZ0A 3HAXD 1NJIH 3CCRF 3E1YA 1W42A 3CC2F 1VQNF 2OHWA 1VQLF 3CXCF 3CCQF 2KTUA 3E20B 1X52A 1XBIA 3FFMA 2WALA 5GANK 2OTLF 1YJ9F 3CMEF 3CCMF 3V7QA 3J80M 1M1KH 1W41A 3CCEF 1T0KB 2KG4A 1CN7A 1GO1A 2VGNA 4LCKA 1KD1H 1CK2A 5GINC 2KTVA 3I56F 1YI2F 1GO0A 2QI2A 1VQ4F 1VQ8F 3G4SF 3IR9A 3I55F 3J7AR 1VQ5F 1VQMF 3RA6A 2HVYD 3N4ZA 2LBXA 2FC3A 1K8AH 1ZWZA 3CCVF 3V7EA 1S72F 4BW0B 1RLGA 3CCUF 3CPWF 5FJ4C 3WXMB 1PXWA 1X7PA 3CMAF 3J81M 1IPAA 3NMUC 1E7KA 3NK7A 3NK6A 1Q82H 5G4VC 2CZWA 3G6EF 3OW2F 3VMFB 3CC4F 3LWPC 5DCVA 1NMUB 3CPQA 5GIPC 3N4YA 1YIJF 2VGMA 3CC7F 4X3MA 3VI6A 3LWVC 1H7MA 1DT9A 3JAMM 2OZBA 3MCAB 3CCJF 1W40A 3AGKA 1W2BF 3HJWC 2BO1A 1VQKF 1YITF 3OBWA 1KQSF 5GAPK 1QVGF 1VQ7F 5FLXM 5G4UC 3LWRC 1JJ2F 2QEXF 1VQ6F 4NUTA 3SIUA 3G71F 1K9MH 1VQ9F 3LWOC 1N8RH 1Q7YH 1RA4A 2I6DA 1K73H 4BY9D 3CCSF 4X3LA 4C4WC 4TZZA 5EWRA 2AIFA 5EO3A 2QA4F 3JCMM 1VQPF 1YJWF 2JNBA 1W3EX 1X7OA 1YHQF 3SIVA 5GIOC 2LBWA
chains in the Genus database with same CATH superfamily
3LFOA 2Z1EA 3NVKE 4G4WA 2PHNA 3IEWA 4XCQA 5EIBD 3DDNA 4TV8A 3VCZA 4BT2A 2UYNA 4ZHQA 3PLAC 5JQGA 1YJNF 3OBYA 3HKDB 2Z1FA 4BVRA 2MQEA 3QHDA 4O2BA 5B8FA 4O2AB 1W42A 2KGWA 3CC2F 2OHWA 1ODEA 4EI7A 3WPWA 3JVHA 1XBIA 3K0TA 2OTLF 4HNAA 3GTZA 1W55A 3ZO8A 3CCMF 1JFFB 4O4LA 5ITZB 5J2TA 1COMA 3KHNA 5J2UB 1Z5VA 1CN7A 3RYIB 5HP7A 3S0YA 4ZHQB 4U3JB 1ONIA 3TD5A 4YJ2A 1CK2A 1JFFA 2KTVA 4EI9A 5LXTB 1YI2F 3G4SF 3J7AR 3JAWB 4TV9B 4I4TB 1J7HA 2ZAUA 3RA6A 2HVYD 3N4ZA 2FC3A 1RLGA 3RE3A 3WJPA 3ZOPA 3CCUF 1RQ7A 3ZP7A 4TV9A 5BMVA 3LMEA 4ZK7A 2UYNB 3N2GA 1U40A 2CSLA 3GHZA 3HKDA 3CYPB 1Q82H 5G4VC 2GZLA 2CZWA 3G6EF 2Z1UA 1TUBA 1JY8A 3KJKA 1NMUB 4X20B 5J2UA 3LWPC 5GIPC 5DCVA 3HKBA 2FGYA 2HP0A 1SA0B 3N4YA 3JATA 3CB2A 4X1IB 1DT9A 3S0HA 3JAMM 3P4EA 1XRGA 4HNAB 2HP3A 1FSZA 3S02A 4O4JA 3K12A 1KQSF 1QVGF 1VQ7F 3LWRC 1VQ6F 2Z01A 2RHHA 5BMVB 3C9SA 1N8RH 3VYTC 1Q7YH 5KX5A 3WGJA 3CCSF 4ZHWA 3RYCA 3C9RA 4X3LA 4B46A 4I4TA 5EWRA 1SA0A 3VO8A 3HKCA 3JCMM 1RLUA 3SIVA 2HS3A 5JH7B 5GIOC 5JVDA 3RA5A 3ON1A 3CCLF 1QVFF 4PWTA 1U3LA 3NVIB 5LYJB 1W57A 2V9YA 1M90H 3FPIA 3CG6A 3UT5B 3MDOA 2HS0A 3KIZA 1U43A 4O4HB 2LCAA 5KMGB 4BT7A 5CA1B 5MN4A 3CD6F 3S06A 4O4IB 4G88A 2ZOVA 1VQNF 2UYKA 4ZI7A 3CCQF 1KNKA 4EI8A 3TD4A 2KTUA 1X52A 1TVKA 4WBNA 2N48A 4X1YB 1TUBB 4X20A 4ZHYB 1YJ9F 2HP0B 3J80M 1YQNA 1W41A 5EAZA 1M1KH 3C9TA 1GO1A 3IKEA 1T0AA 3M4SA 3JARB 3F0DA 4LNUB 5GINC 4C8IA 3I56F 1GO0A 2QI2A 1VQ4F 3DC2A 4O4JB 3IR9A 5EZYB 2BTOA 3JALB 5CB4B 5JQGB 1VQ5F 3I3FA 3FD6A 2RHJA 2LBXA 2Q1YA 3QUWA 5HY2A 1S72F 3FBAA 4BW0B 3S03A 2IAFA 4O2AA 5IJ0A 2YXZA 1KNJA 3WXMB 1PXWA 2P6YA 5FJ4C 4WBNB 3K14A 4G4XA 2R751 2BTQB 3NMUC 3EORA 3C9UA 4I55A 1E7KA 3HKEB 3HKCB 3VOAA 3WJRA 4BVTA 4M8IA 3CC4F 4IIJA 5EYPB 3VMFB 1SZQA 1W5FA 3M1XA 3JAKB 2VGMA 4X3MA 1CLIA 4RQOA 5JCOA 3LWVC 5IYZB 2LBTA 3WGNA 2OZBA 3CCJF 3ZP4A 1OAPA 1W40A 3AGKA 5EB0A 3HJWC 4I50A 5MN5A 3OBWA 2AIZP 5GAPK 1JJ2F 3SIUA 1X25A 2UZHA 5JCOC 3HKEA 2DYYA 3F0EA 3K2XA 4U39A 4X1YA 5EO3A 3L7QA 4B62A 2JNBA 1X7OA 4R40B 2HQSC 1IV1A 5LA6A 3D00A 2IQQA 4E6EA 3BYQA 3RYFB 4NUTA 2LBWA 5FNVA 2EWCA 3T80A 5C8YB 3JARA 3E22A 3S0WA 4I50B 1Q81H 3WGKA 2HRUA 5LA6B 5EZYA 2CW4A 4YJ3B 5FNVB 3IEQA 3VTIC 5LXTA 4EB6A 2BTUA 1W581 4DXDA 3JAWA 5IYZA 2OTJF 1VK3A 1GZ0A 2UYPA 1NJIH 3CCRF 3E1YA 1NQ3A 3JATB 1VQLF 4G4YA 3VOBA 4BT6A 1VHAA 1H48A 2L26A 4EB6B 4O4LB 5ITZA 1UFYA 2K1SA 3F0FA 3VYUC 5CA0A 4ERHA 4I55B 3WPXA 3FFMA 3ESJA 1YGYA 3CMEF 5EIBC 1JD1A 2G9IA 3E22B 1T0KB 2KG4A 2VAMA 2VGNA 4LCKA 5HY1A 4BT5A 3LDTA 1JN1A 5LYJA 3RYHB 5IJ9B 3KJJA 2PMPA 3WGLA 2GLZA 1K8AH 1ZWZA 2CVLA 3ELCA 2VAWA 4O4IA 4RHAA 5JH7A 3CPWF 3IMPA 1X7PA 1VH8A 4B45A 2NMUA 3J81M 1IPAA 5KX5B 1Z5WA 2VAPA 3NK7A 3NK6A 5GONA 3U0OA 2RHLA 5LOVB 3OW2F 3QTYA 3JASA 4O2BB 3CPQA 3D01A 3N2GB 1YIJF 4NWOB 4BT3A 4C8GA 3VI6A 2HS4A 1IV2A 4TUYB 5GONB 3HTNA 5LOVA 5CA0B 3JASB 3MCAB 2R6R1 4LNUA 3WJQA 5HP8A 1QAHA 3IKFA 3N2KB 1W2BF 4G4VA 1U3PA 4X1IA 1YITF 1VQKF 3V4DA 1TVKB 1W5AA 1RQ2A 2H8CA 3KE1A 5FLXM 5J2TB 5G4UC 2QEXF 4ZOLA 3RYIA 1VQ9F 2CHTA 1H47A 1W5EA 4DRXA 1RA4A 5HY4A 5AVMA 1QD9A 5CA1A 1K73H 2CHSA 3RYHA 4C4WC 4ZI7B 1W5BA 2QA4F 3D54A 1W3EX 3F0GA 4F6RB 1QU9A 3JAKA 1XV2A 1IV3A 2DT4A 2H8EA 2F9ZC 5MN6A 1KC8H 1Q86H 5A2QM 1SDSA 2VXYA 2HX0A 3PAFA 3C8LA 3O85A 3LWQC 4NQ3A 4ZOLB 5IT9M 2AMTA 4DRXB 2ALEA 1FNKA 4KWEA 1VQOF 3GYQA 4TUYA 3HAXD 4BVQA 1Q8RA 2OTMA 3RYCB 5HXZA 2QTPA 1FFXB 1IV4A 2ZODA 3CXCF 3UT5A 4ZHVA 3CYQA 4O4HA 3N2KA 2H6LA 4G4ZA 3R0PA 3E20B 2GVIA 1GX1A 3M84A 2WALA 4X1KA 4F6RA 5GANK 4FFBB 1FFXA 4B5CA 1OFUA 3V3TA 3V7QA 3Q8HA 3CCEF 4BT4A 4IIJB 5EYPA 3MQWA 1DBFA 1KD1H 5EB1B 3P10A 1R1MA 1VQ8F 3I55F 5LP6C 1UI9A 3B6NA 5LP6B 4YJ3A 1VQMF 3I7TA 3TD3A 3V7EA 3CCVF 3LYBA 3WGMA 2I6RA 1FNJA 3MCQA 5CB4A 3RYFA 3ERNA 4IHJA 2ZVZA 4X1KB 2ZVYA 4FFBA 5C8YA 4C8EA 3CMAF 2RHOA 1PF5A 2YYEA 4C81A 5KMGA 2Z1TA 3FD5A 2W8BC 5HWEA 4IHJB 3VYSC 2Q1XA 2UYJA 3HWUA 5JVDB 3CC7F 2B33A 1H7MA 1VQVA 4U3JA 5HXUA 4C82A 2CWJA 5LP6A 3OONA 2IG8A 2ZF8A 2BO1A 3MBMA 5IJ9A 5IJ0B 3G71F 2HRYA 1K9MH 3P0ZA 3LWOC 4BVSA 2I6DA 4BY9D 1W59A 1XHOA 2RB9A 3JALA 4TZZA 3F6MA 4YJ2B 2AIFA 1VQPF 3VIUA 1YJWF 1YHQF 4TV8B 5HY0A 3HKBB
chains in the Genus database with same CATH topology
3LFOA 3ON1A 2F9ZC 3RA5A 1KC8H 3NVKE 3CCLF 1Q86H 4XCQA 5A2QM 1QVFF 1SDSA 1Q81H 3NVIB 3PAFA 3O85A 3LWQC 1M90H 3PLAC 1YJNF 3OBYA 4NQ3A 5IT9M 3CG6A 4BVRA 2ALEA 3CD6F 2OTJF 1VQOF 3GYQA 1GZ0A 3HAXD 4BVQA 1NJIH 3CCRF 3E1YA 5HXZA 1W42A 3CC2F 1VQNF 2OHWA 1VQLF 3CXCF 3CCQF 4EI7A 4EI8A 2KTUA 3E20B 1X52A 1XBIA 3FFMA 2WALA 5GANK 2OTLF 1YJ9F 3CMEF 3V3TA 3V7QA 3CCMF 3J80M 1M1KH 1W41A 3CCEF 1T0KB 2KG4A 1CN7A 1GO1A 2VGNA 4LCKA 5HY1A 1KD1H 1CK2A 5GINC 2KTVA 4EI9A 3I56F 1YI2F 1GO0A 2QI2A 1VQ4F 1VQ8F 3G4SF 3IR9A 3I55F 3J7AR 1VQ5F 1VQMF 3RA6A 2HVYD 3N4ZA 2LBXA 2FC3A 2GLZA 1ZWZA 5HY2A 3CCVF 1K8AH 3V7EA 1S72F 4BW0B 1RLGA 3CCUF 3CPWF 5FJ4C 3WXMB 1PXWA 1X7PA 3CMAF 3J81M 1IPAA 3NMUC 1E7KA 3NK7A 3NK6A 4BVTA 5G4VC 1Q82H 2CZWA 3G6EF 3OW2F 3VMFB 5HWEA 3CC4F 3LWPC 5DCVA 1NMUB 3CPQA 5GIPC 2FGYA 3N4YA 1YIJF 2VGMA 3CC7F 4X3MA 3VI6A 3LWVC 1H7MA 1DT9A 3JAMM 2OZBA 3MCAB 5HXUA 3CCJF 1W40A 3AGKA 1W2BF 3HJWC 2BO1A 1VQKF 1YITF 3OBWA 1KQSF 5GAPK 1QVGF 1VQ7F 5FLXM 5G4UC 3LWRC 1JJ2F 2QEXF 1VQ6F 4NUTA 3SIUA 3G71F 1K9MH 1VQ9F 3LWOC 1N8RH 4BVSA 1RA4A 1Q7YH 5HY4A 2I6DA 1K73H 4BY9D 3CCSF 4X3LA 4C4WC 4TZZA 5EWRA 2AIFA 5EO3A 2QA4F 3JCMM 1VQPF 1YJWF 2JNBA 1W3EX 1X7OA 1YHQF 5HY0A 3SIVA 3D00A 5GIOC 2LBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFO A;  3ON1 A;  3RA5 A;  1KC8 H;  3NVK E;  3CCL F;  1Q86 H;  5A2Q M;  1QVF F;  1SDS A;  1Q81 H;  3NVI B;  3PAF A;  3O85 A;  3LWQ C;  1M90 H;  3PLA C;  1YJN F;  3OBY A;  5IT9 M;  3CG6 A;  2ALE A;  3CD6 F;  2OTJ F;  1VQO F;  3GYQ A;  1GZ0 A;  3HAX D;  1NJI H;  3CCR F;  3E1Y A;  1W42 A;  3CC2 F;  1VQN F;  2OHW A;  1VQL F;  3CXC F;  3CCQ F;  2KTU A;  3E20 B;  1X52 A;  1XBI A;  3FFM A;  2WAL A;  5GAN K;  2OTL F;  1YJ9 F;  3CME F;  3CCM F;  3V7Q A;  3J80 M;  1M1K H;  1W41 A;  3CCE F;  1T0K B;  2KG4 A;  1CN7 A;  1GO1 A;  2VGN A;  4LCK A;  1KD1 H;  1CK2 A;  5GIN C;  2KTV A;  3I56 F;  1YI2 F;  1GO0 A;  2QI2 A;  1VQ4 F;  1VQ8 F;  3G4S F;  3IR9 A;  3I55 F;  3J7A R;  1VQ5 F;  1VQM F;  3RA6 A;  2HVY D;  3N4Z A;  2LBX A;  2FC3 A;  1K8A H;  1ZWZ A;  3CCV F;  3V7E A;  1S72 F;  4BW0 B;  1RLG A;  3CCU F;  3CPW F;  5FJ4 C;  3WXM B;  1PXW A;  1X7P A;  3CMA F;  3J81 M;  1IPA A;  3NMU C;  1E7K A;  3NK7 A;  3NK6 A;  1Q82 H;  5G4V C;  2CZW A;  3G6E F;  3OW2 F;  3VMF B;  3CC4 F;  3LWP C;  5DCV A;  1NMU B;  3CPQ A;  5GIP C;  3N4Y A;  1YIJ F;  2VGM A;  3CC7 F;  4X3M A;  3VI6 A;  3LWV C;  1H7M A;  1DT9 A;  3JAM M;  2OZB A;  3MCA B;  3CCJ F;  1W40 A;  3AGK A;  1W2B F;  3HJW C;  2BO1 A;  1VQK F;  1YIT F;  3OBW A;  1KQS F;  5GAP K;  1QVG F;  1VQ7 F;  5FLX M;  5G4U C;  3LWR C;  1JJ2 F;  2QEX F;  1VQ6 F;  4NUT A;  3SIU A;  3G71 F;  1K9M H;  1VQ9 F;  3LWO C;  1N8R H;  1Q7Y H;  1RA4 A;  2I6D A;  1K73 H;  4BY9 D;  3CCS F;  4X3L A;  4C4W C;  4TZZ A;  5EWR A;  2AIF A;  5EO3 A;  2QA4 F;  3JCM M;  1VQP F;  1YJW F;  2JNB A;  1W3E X;  1X7O A;  1YHQ F;  3SIV A;  5GIO C;  2LBW A; 
#chains in the Genus database with same CATH topology
 3LFO A;  2Z1E A;  3NVK E;  4G4W A;  2PHN A;  3IEW A;  4XCQ A;  5EIB D;  3DDN A;  4TV8 A;  3VCZ A;  4BT2 A;  2UYN A;  4ZHQ A;  3PLA C;  5JQG A;  1YJN F;  3OBY A;  3HKD B;  2Z1F A;  4BVR A;  2MQE A;  3QHD A;  4O2B A;  5B8F A;  4O2A B;  1W42 A;  2KGW A;  3CC2 F;  2OHW A;  1ODE A;  4EI7 A;  3WPW A;  3JVH A;  1XBI A;  3K0T A;  2OTL F;  4HNA A;  3GTZ A;  1W55 A;  3ZO8 A;  3CCM F;  1JFF B;  4O4L A;  5ITZ B;  5J2T A;  1COM A;  3KHN A;  5J2U B;  1Z5V A;  1CN7 A;  3RYI B;  5HP7 A;  3S0Y A;  4ZHQ B;  4U3J B;  1ONI A;  3TD5 A;  4YJ2 A;  1CK2 A;  1JFF A;  2KTV A;  4EI9 A;  5LXT B;  1YI2 F;  3G4S F;  3J7A R;  3JAW B;  4TV9 B;  4I4T B;  1J7H A;  2ZAU A;  3RA6 A;  2HVY D;  3N4Z A;  2FC3 A;  1RLG A;  3RE3 A;  3WJP A;  3ZOP A;  3CCU F;  1RQ7 A;  3ZP7 A;  4TV9 A;  5BMV A;  3LME A;  4ZK7 A;  2UYN B;  3N2G A;  1U40 A;  2CSL A;  3GHZ A;  3HKD A;  3CYP B;  1Q82 H;  5G4V C;  2GZL A;  2CZW A;  3G6E F;  2Z1U A;  1TUB A;  1JY8 A;  3KJK A;  1NMU B;  4X20 B;  5J2U A;  3LWP C;  5GIP C;  5DCV A;  3HKB A;  2FGY A;  2HP0 A;  1SA0 B;  3N4Y A;  3JAT A;  3CB2 A;  4X1I B;  1DT9 A;  3S0H A;  3JAM M;  3P4E A;  1XRG A;  4HNA B;  2HP3 A;  1FSZ A;  3S02 A;  4O4J A;  3K12 A;  1KQS F;  1QVG F;  1VQ7 F;  3LWR C;  1VQ6 F;  2Z01 A;  2RHH A;  5BMV B;  3C9S A;  1N8R H;  3VYT C;  1Q7Y H;  5KX5 A;  3WGJ A;  3CCS F;  4ZHW A;  3RYC A;  3C9R A;  4X3L A;  4B46 A;  4I4T A;  5EWR A;  1SA0 A;  3VO8 A;  3HKC A;  3JCM M;  1RLU A;  3SIV A;  2HS3 A;  5JH7 B;  5GIO C;  5JVD A;  3RA5 A;  3ON1 A;  3CCL F;  1QVF F;  4PWT A;  1U3L A;  3NVI B;  5LYJ B;  1W57 A;  2V9Y A;  1M90 H;  3FPI A;  3CG6 A;  3UT5 B;  3MDO A;  2HS0 A;  3KIZ A;  1U43 A;  4O4H B;  2LCA A;  5KMG B;  4BT7 A;  5CA1 B;  5MN4 A;  3CD6 F;  3S06 A;  4O4I B;  4G88 A;  2ZOV A;  1VQN F;  2UYK A;  4ZI7 A;  3CCQ F;  1KNK A;  4EI8 A;  3TD4 A;  2KTU A;  1X52 A;  1TVK A;  4WBN A;  2N48 A;  4X1Y B;  1TUB B;  4X20 A;  4ZHY B;  1YJ9 F;  2HP0 B;  3J80 M;  1YQN A;  1W41 A;  5EAZ A;  1M1K H;  3C9T A;  1GO1 A;  3IKE A;  1T0A A;  3M4S A;  3JAR B;  3F0D A;  4LNU B;  5GIN C;  4C8I A;  3I56 F;  1GO0 A;  2QI2 A;  1VQ4 F;  3DC2 A;  4O4J B;  3IR9 A;  5EZY B;  2BTO A;  3JAL B;  5CB4 B;  5JQG B;  1VQ5 F;  3I3F A;  3FD6 A;  2RHJ A;  2LBX A;  2Q1Y A;  3QUW A;  5HY2 A;  1S72 F;  3FBA A;  4BW0 B;  3S03 A;  2IAF A;  4O2A A;  5IJ0 A;  2YXZ A;  1KNJ A;  3WXM B;  1PXW A;  2P6Y A;  5FJ4 C;  4WBN B;  3K14 A;  4G4X A;  2R75 1;  2BTQ B;  3NMU C;  3EOR A;  3C9U A;  4I55 A;  1E7K A;  3HKE B;  3HKC B;  3VOA A;  3WJR A;  4BVT A;  4M8I A;  3CC4 F;  4IIJ A;  5EYP B;  3VMF B;  1SZQ A;  1W5F A;  3M1X A;  3JAK B;  2VGM A;  4X3M A;  1CLI A;  4RQO A;  5JCO A;  3LWV C;  5IYZ B;  2LBT A;  3WGN A;  2OZB A;  3CCJ F;  3ZP4 A;  1OAP A;  1W40 A;  3AGK A;  5EB0 A;  3HJW C;  4I50 A;  5MN5 A;  3OBW A;  2AIZ P;  5GAP K;  1JJ2 F;  3SIU A;  1X25 A;  2UZH A;  5JCO C;  3HKE A;  2DYY A;  3F0E A;  3K2X A;  4U39 A;  4X1Y A;  5EO3 A;  3L7Q A;  4B62 A;  2JNB A;  1X7O A;  4R40 B;  2HQS C;  1IV1 A;  5LA6 A;  3D00 A;  2IQQ A;  4E6E A;  3BYQ A;  3RYF B;  4NUT A;  2LBW A;  5FNV A;  2EWC A;  3T80 A;  5C8Y B;  3JAR A;  3E22 A;  3S0W A;  4I50 B;  1Q81 H;  3WGK A;  2HRU A;  5LA6 B;  5EZY A;  2CW4 A;  4YJ3 B;  5FNV B;  3IEQ A;  3VTI C;  5LXT A;  4EB6 A;  2BTU A;  1W58 1;  4DXD A;  3JAW A;  5IYZ A;  2OTJ F;  1VK3 A;  1GZ0 A;  2UYP A;  1NJI H;  3CCR F;  3E1Y A;  1NQ3 A;  3JAT B;  1VQL F;  4G4Y A;  3VOB A;  4BT6 A;  1VHA A;  1H48 A;  2L26 A;  4EB6 B;  4O4L B;  5ITZ A;  1UFY A;  2K1S A;  3F0F A;  3VYU C;  5CA0 A;  4ERH A;  4I55 B;  3WPX A;  3FFM A;  3ESJ A;  1YGY A;  3CME F;  5EIB C;  1JD1 A;  2G9I A;  3E22 B;  1T0K B;  2KG4 A;  2VAM A;  2VGN A;  4LCK A;  5HY1 A;  4BT5 A;  3LDT A;  1JN1 A;  5LYJ A;  3RYH B;  5IJ9 B;  3KJJ A;  2PMP A;  3WGL A;  2GLZ A;  1K8A H;  1ZWZ A;  2CVL A;  3ELC A;  2VAW A;  4O4I A;  4RHA A;  5JH7 A;  3CPW F;  3IMP A;  1X7P A;  1VH8 A;  4B45 A;  2NMU A;  3J81 M;  1IPA A;  5KX5 B;  1Z5W A;  2VAP A;  3NK7 A;  3NK6 A;  5GON A;  3U0O A;  2RHL A;  5LOV B;  3OW2 F;  3QTY A;  3JAS A;  4O2B B;  3CPQ A;  3D01 A;  3N2G B;  1YIJ F;  4NWO B;  4BT3 A;  4C8G A;  3VI6 A;  2HS4 A;  1IV2 A;  4TUY B;  5GON B;  3HTN A;  5LOV A;  5CA0 B;  3JAS B;  3MCA B;  2R6R 1;  4LNU A;  3WJQ A;  5HP8 A;  1QAH A;  3IKF A;  3N2K B;  1W2B F;  4G4V A;  1U3P A;  4X1I A;  1YIT F;  1VQK F;  3V4D A;  1TVK B;  1W5A A;  1RQ2 A;  2H8C A;  3KE1 A;  5FLX M;  5J2T B;  5G4U C;  2QEX F;  4ZOL A;  3RYI A;  1VQ9 F;  2CHT A;  1H47 A;  1W5E A;  4DRX A;  1RA4 A;  5HY4 A;  5AVM A;  1QD9 A;  5CA1 A;  1K73 H;  2CHS A;  3RYH A;  4C4W C;  4ZI7 B;  1W5B A;  2QA4 F;  3D54 A;  1W3E X;  3F0G A;  4F6R B;  1QU9 A;  3JAK A;  1XV2 A;  1IV3 A;  2DT4 A;  2H8E A;  2F9Z C;  5MN6 A;  1KC8 H;  1Q86 H;  5A2Q M;  1SDS A;  2VXY A;  2HX0 A;  3PAF A;  3C8L A;  3O85 A;  3LWQ C;  4NQ3 A;  4ZOL B;  5IT9 M;  2AMT A;  4DRX B;  2ALE A;  1FNK A;  4KWE A;  1VQO F;  3GYQ A;  4TUY A;  3HAX D;  4BVQ A;  1Q8R A;  2OTM A;  3RYC B;  5HXZ A;  2QTP A;  1FFX B;  1IV4 A;  2ZOD A;  3CXC F;  3UT5 A;  4ZHV A;  3CYQ A;  4O4H A;  3N2K A;  2H6L A;  4G4Z A;  3R0P A;  3E20 B;  2GVI A;  1GX1 A;  3M84 A;  2WAL A;  4X1K A;  4F6R A;  5GAN K;  4FFB B;  1FFX A;  4B5C A;  1OFU A;  3V3T A;  3V7Q A;  3Q8H A;  3CCE F;  4BT4 A;  4IIJ B;  5EYP A;  3MQW A;  1DBF A;  1KD1 H;  5EB1 B;  3P10 A;  1R1M A;  1VQ8 F;  3I55 F;  5LP6 C;  1UI9 A;  3B6N A;  5LP6 B;  4YJ3 A;  1VQM F;  3I7T A;  3TD3 A;  3V7E A;  3CCV F;  3LYB A;  3WGM A;  2I6R A;  1FNJ A;  3MCQ A;  5CB4 A;  3RYF A;  3ERN A;  4IHJ A;  2ZVZ A;  4X1K B;  2ZVY A;  4FFB A;  5C8Y A;  4C8E A;  3CMA F;  2RHO A;  1PF5 A;  2YYE A;  4C81 A;  5KMG A;  2Z1T A;  3FD5 A;  2W8B C;  5HWE A;  4IHJ B;  3VYS C;  2Q1X A;  2UYJ A;  3HWU A;  5JVD B;  3CC7 F;  2B33 A;  1H7M A;  1VQV A;  4U3J A;  5HXU A;  4C82 A;  2CWJ A;  5LP6 A;  3OON A;  2IG8 A;  2ZF8 A;  2BO1 A;  3MBM A;  5IJ9 A;  5IJ0 B;  3G71 F;  2HRY A;  1K9M H;  3P0Z A;  3LWO C;  4BVS A;  2I6D A;  4BY9 D;  1W59 A;  1XHO A;  2RB9 A;  3JAL A;  4TZZ A;  3F6M A;  4YJ2 B;  2AIF A;  1VQP F;  3VIU A;  1YJW F;  1YHQ F;  4TV8 B;  5HY0 A;  3HKB B; 
#chains in the Genus database with same CATH homology
 3LFO A;  3ON1 A;  2F9Z C;  3RA5 A;  1KC8 H;  3NVK E;  3CCL F;  1Q86 H;  4XCQ A;  5A2Q M;  1QVF F;  1SDS A;  1Q81 H;  3NVI B;  3PAF A;  3O85 A;  3LWQ C;  1M90 H;  3PLA C;  1YJN F;  3OBY A;  4NQ3 A;  5IT9 M;  3CG6 A;  4BVR A;  2ALE A;  3CD6 F;  2OTJ F;  1VQO F;  3GYQ A;  1GZ0 A;  3HAX D;  4BVQ A;  1NJI H;  3CCR F;  3E1Y A;  5HXZ A;  1W42 A;  3CC2 F;  1VQN F;  2OHW A;  1VQL F;  3CXC F;  3CCQ F;  4EI7 A;  4EI8 A;  2KTU A;  3E20 B;  1X52 A;  1XBI A;  3FFM A;  2WAL A;  5GAN K;  2OTL F;  1YJ9 F;  3CME F;  3V3T A;  3V7Q A;  3CCM F;  3J80 M;  1M1K H;  1W41 A;  3CCE F;  1T0K B;  2KG4 A;  1CN7 A;  1GO1 A;  2VGN A;  4LCK A;  5HY1 A;  1KD1 H;  1CK2 A;  5GIN C;  2KTV A;  4EI9 A;  3I56 F;  1YI2 F;  1GO0 A;  2QI2 A;  1VQ4 F;  1VQ8 F;  3G4S F;  3IR9 A;  3I55 F;  3J7A R;  1VQ5 F;  1VQM F;  3RA6 A;  2HVY D;  3N4Z A;  2LBX A;  2FC3 A;  2GLZ A;  1ZWZ A;  5HY2 A;  3CCV F;  1K8A H;  3V7E A;  1S72 F;  4BW0 B;  1RLG A;  3CCU F;  3CPW F;  5FJ4 C;  3WXM B;  1PXW A;  1X7P A;  3CMA F;  3J81 M;  1IPA A;  3NMU C;  1E7K A;  3NK7 A;  3NK6 A;  4BVT A;  5G4V C;  1Q82 H;  2CZW A;  3G6E F;  3OW2 F;  3VMF B;  5HWE A;  3CC4 F;  3LWP C;  5DCV A;  1NMU B;  3CPQ A;  5GIP C;  2FGY A;  3N4Y A;  1YIJ F;  2VGM A;  3CC7 F;  4X3M A;  3VI6 A;  3LWV C;  1H7M A;  1DT9 A;  3JAM M;  2OZB A;  3MCA B;  5HXU A;  3CCJ F;  1W40 A;  3AGK A;  1W2B F;  3HJW C;  2BO1 A;  1VQK F;  1YIT F;  3OBW A;  1KQS F;  5GAP K;  1QVG F;  1VQ7 F;  5FLX M;  5G4U C;  3LWR C;  1JJ2 F;  2QEX F;  1VQ6 F;  4NUT A;  3SIU A;  3G71 F;  1K9M H;  1VQ9 F;  3LWO C;  1N8R H;  4BVS A;  1RA4 A;  1Q7Y H;  5HY4 A;  2I6D A;  1K73 H;  4BY9 D;  3CCS F;  4X3L A;  4C4W C;  4TZZ A;  5EWR A;  2AIF A;  5EO3 A;  2QA4 F;  3JCM M;  1VQP F;  1YJW F;  2JNB A;  1W3E X;  1X7O A;  1YHQ F;  5HY0 A;  3SIV A;  3D00 A;  5GIO C;  2LBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...