5GAPK

Body region of the u4/u6.u5 tri-snrnp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA, 5' region, nucleotides 1-67
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gapK00
5FLXM 3N4ZA 1VQ5F 5A2QM 2KTVA 3OBWA 3ON1A 5GIPC 1YI2F 1Q82H 1YHQF 1VQ7F 1VQLF 2VGMA 3CG6A 3CC7F 3CCQF 3LWPC 3HJWC 4BW0B 1YJNF 3J80M 1Q86H 1KQSF 1CK2A 3LWQC 1K8AH 2OTJF 3CCUF 1N8RH 3OW2F 5G4VC 3GYQA 3E1YA 3CD6F 2JNBA 5GIOC 1YITF 1CN7A 2FC3A 3O85A 2OHWA 3RA5A 3VMFB 1VQKF 1T0KB 3CXCF 3CCSF 2CZWA 3NMUC 3CCMF 2WALA 1W42A 4X3LA 1JJ2F 1VQ6F 3J81M 1S72F 5G4UC 5FJ4C 1M1KH 3G4SF 3CCVF 1VQOF 1XBIA 1QVGF 5GANK 1E7KA 1NJIH 3PAFA 3NVIB 3RA6A 2KTUA 2AIFA 3G6EF 3NK7A 2OZBA 1VQ9F 3NK6A 1GZ0A 1KD1H 2QI2A 1W41A 3LWRC 3CPQA 2LBWA 1QVFF 2KG4A 3CCEF 3J7AR 1RLGA 1YJ9F 3CMAF 1DT9A 3WXMB 3I55F 1X52A 1ZWZA 2OTLF 1VQMF 1YIJF 1GO1A 3CCLF 5EWRA 1VQPF 1K73H 1W40A 3E20B 1IPAA 3V7QA 3N4YA 1GO0A 4X3MA 1PXWA 3FFMA 4TZZA 1X7OA 1VQ4F 2LBXA 3JAMM 1W3EX 3HAXD 3G71F 1Q81H 2QEXF 4BY9D 3NVKE 3CPWF 2I6DA 3VI6A 1M90H 2QA4F 1SDSA 1VQNF 1KC8H 5IT9M 3CC4F 3CCJF 3PLAC 1NMUB 5DCVA 3JCMM 3SIUA 2HVYD 3SIVA 3CCRF 3CC2F 1Q7YH 3OBYA 4C4WC 3CMEF 1X7PA 3LWVC 1YJWF 1RA4A 3MCAB 1K9MH 4NUTA 3LFOA 1W2BF 4LCKA 1H7MA 2BO1A 3V7EA 5GINC 3LWOC 2ALEA 5EO3A 3IR9A 1VQ8F 5GAPK 3AGKA 2VGNA 3I56F
chains in the Genus database with same CATH superfamily
1JFFA 4TV9A 4O2BA 1FFXA 1Z5WA 4BT6A 2VXYA 4RHAA 5IYZB 3M84A 2KTVA 5A2QM 3ON1A 3FD5A 1Q82H 4DRXA 5CB4A 5LP6C 3CG6A 3CC7F 1JD1A 3KJJA 3LWPC 1W55A 3HKDB 5HP8A 5HP7A 1W57A 2H8EA 4FFBA 5HY2A 1RLUA 5J2TB 3OW2F 3LMEA 3WGKA 5LP6A 4ZHVA 1U43A 5GONB 2CVLA 3VMFB 2IQQA 2FGYA 3CXCF 3CCSF 2CZWA 5LYJA 4X3LA 4ZI7A 3QHDA 1XBIA 3D00A 4G88A 3LYBA 4BVTA 3PAFA 2Z1EA 3NK7A 4X1KB 1SA0B 4HNAB 5EYPA 4G4WA 4O4IB 2QI2A 1KD1H 4EI8A 3RYFA 3LWRC 2PHNA 3N2GA 1UI9A 3JATA 4I55B 3VO8A 1QVFF 3CCEF 3RYCB 4EB6B 1RLGA 5JQGA 4C8EA 3JALB 3WXMB 2L26A 2OTLF 3S06A 2HP3A 1K73H 3E20B 3V7QA 3JAWB 4TZZA 3WGNA 3JAMM 1TVKB 2BTUA 3RYIA 5B8FA 2QEXF 4EI7A 4O4LA 1IV3A 1YGYA 4ZHQB 3NVKE 2ZVYA 4LNUA 2I6DA 2GZLA 3CC4F 4BVQA 3HKBA 3PLAC 4TUYA 2K1SA 3SIUA 4I4TB 4O4HB 4BT2A 3CC2F 3F0EA 4O2AA 4BT4A 1JFFB 3RYHA 1FFXB 3WGJA 3CB2A 5HXZA 3DDNA 1K9MH 3IKFA 4NUTA 3QTYA 4YJ3A 4LCKA 4DRXB 5J2UB 3V7EA 5CB4B 2HRYA 3CYQA 2HS4A 5EO3A 4BVSA 2BTQB 2VGNA 2Q1XA 1M1KH 4X20B 5FLXM 2RHHA 3IEQA 3N4ZA 3V3TA 2ZAUA 5JCOC 1VQ5F 2ZF8A 2R6R1 3JARA 4FFBB 3N2KA 2VAPA 3OBWA 3I3FA 4R40B 3WJQA 3S03A 2VGMA 3UT5A 3CCQF 3KHNA 2HRUA 3WJRA 1U3PA 5HY4A 2HS0A 1CK2A 2AIZP 3K12A 5LYJB 2PMPA 3MCQA 1QAHA 4ZI7B 3M1XA 5G4VC 3GYQA 3S0WA 2V9YA 3CD6F 5GIOC 1CN7A 2FC3A 3RA5A 5MN5A 2NMUA 3NMUC 1W581 2ZVZA 3RYFB 4ZOLA 3JATB 3C9RA 5IJ0A 3G4SF 3CCVF 5LA6A 4I50B 3GTZA 3TD3A 2KTUA 2UYPA 3C9TA 3D01A 4M8IA 2UYNB 3NK6A 2GLZA 3QUWA 4ERHA 2B33A 2CW4A 3F0FA 3Q8HA 1JY8A 3U0OA 4B45A 1QU9A 4X1IA 2LBWA 2KG4A 3JASA 3KE1A 4WBNA 2DT4A 4YJ2A 2CWJA 1ONIA 2Z1TA 3RYIB 3WJPA 1KNKA 3CMAF 1DT9A 1IV4A 4O4LB 3I55F 1W5BA 4KWEA 3CYPB 1VQPF 1W40A 1IPAA 2Z1UA 3VIUA 3N4YA 3VYTC 1GO0A 1PXWA 1X25A 3HWUA 4BT3A 1XV2A 1VQ4F 2LBXA 1OAPA 5ITZB 3B6NA 4C81A 1COMA 3G71F 1RQ7A 1VH8A 2VAMA 4O2AB 4C8IA 2YYEA 3P0ZA 3VI6A 2H8CA 4ZHWA 5LXTA 1TUBA 4YJ3B 5DCVA 3JCMM 5HY1A 1NQ3A 5CA1A 2HP0A 2HVYD 1GX1A 2YXZA 1Q7YH 3ZP7A 3CMEF 5HXUA 4O4JA 3L7QA 3MCAB 1UFYA 3JARB 5LOVA 2DYYA 3N2KB 2GVIA 1W5AA 3LFOA 1W2BF 3FBAA 1VQVA 4XCQA 5GINC 2ALEA 4X1YA 1VK3A 3BYQA 3IR9A 3JVHA 2EWCA 3E22A 3HKCA 4B46A 3HKDA 1DBFA 5JH7B 2CSLA 2ZODA 1YHQF 5J2TA 4TV8A 3DC2A 2ZOVA 2H6LA 3HTNA 5GONA 4TV9B 4BW0B 4O2BB 4ZHYB 1YJNF 3TD5A 1KQSF 1Q8RA 3EORA 3LWQC 3VYSC 1K8AH 1RQ2A 1VHAA 2RHLA 3F6MA 3CCUF 5IJ0B 1N8RH 1W59A 4U3JA 5LA6B 2HQSC 3IEWA 5CA0A 2JNBA 1YITF 1T0KB 3JAKA 3CCMF 2BTOA 1SA0A 2WALA 5KMGA 3ESJA 1JJ2F 1VQ6F 5EB1B 4PWTA 1U40A 3J81M 1S72F 5G4UC 5JVDA 5LP6B 5FJ4C 4WBNB 2W8BC 2MQEA 4YJ2B 1VQOF 2N48A 1E7KA 1W5FA 4EB6A 3RYCA 3RA6A 2KGWA 3ZP4A 2OZBA 3JALA 4RQOA 1GZ0A 5JCOA 4EI9A 3C9UA 3ZO8A 1KNJA 2I6RA 5EIBC 5KX5A 3CPQA 3T80A 3JAWA 3ELCA 4C82A 5BMVA 3MQWA 1YJ9F 4U39A 5EB0A 2UZHA 1X52A 5EYPB 1YIJF 4IHJA 3CCLF 2Q1YA 5EWRA 1J7HA 4ZHQA 3N2GB 3VYUC 3OONA 1TUBB 3FFMA 3S0HA 1X7OA 3MBMA 3TD4A 5JQGB 5CA1B 2HP0B 3VTIC 1W3EX 4B62A 1H47A 1Q81H 3VOAA 4BT5A 1R1MA 2RHJA 1SDSA 5LOVB 1NMUB 3WGLA 5MN4A 1IV2A 1H48A 4X1YB 3SIVA 5J2UA 5EZYA 4F6RA 1FNKA 3E22B 3HKEA 3HKCB 5IJ9A 3CCRF 3OBYA 4B5CA 4LNUB 4C4WC 1X7PA 5C8YA 3LWVC 1YJWF 3HKBB 1XRGA 4TUYB 4X20A 1FNJA 3R0PA 3I7TA 4BVRA 1W5EA 2RHOA 4TV8B 3LWOC 1PF5A 3WGMA 1VQ8F 4IIJA 5FNVA 3VCZA 3RYHB 3I56F 1QD9A 2UYJA 1U3LA 4G4YA 4U3JB 5GIPC 1VQ7F 1YI2F 1VQLF 2QTPA 3WPXA 2Z1FA 3M4SA 5CA0B 2IAFA 1JN1A 3HJWC 1FSZA 3J80M 1IV1A 1Q86H 3JAKB 2Z01A 3P10A 4NWOB 5KMGB 2RB9A 2OTJF 1OFUA 5JVDB 5IYZA 5AVMA 1XHOA 3UT5B 5HY0A 3E1YA 2AMTA 4I50A 3K2XA 2OTMA 5MN6A 3S02A 3O85A 2OHWA 1VQKF 5HWEA 5KX5B 3P4EA 2UYNA 2P6YA 1W42A 3WPWA 4DXDA 1ODEA 3IKEA 1QVGF 4ZK7A 5GANK 5BMVB 1NJIH 1SZQA 2F9ZC 3NVIB 2LBTA 2AIFA 3MDOA 3G6EF 4IHJB 1VQ9F 3K0TA 4G4ZA 3KJKA 1T0AA 4ZOLB 4BT7A 2CHSA 1W41A 3C9SA 3ERNA 3FD6A 4E6EA 3FPIA 3LDTA 3J7AR 2G9IA 2R751 3K14A 5ITZA 3GHZA 1YQNA 1ZWZA 4X1KA 4G4VA 1GO1A 4HNAA 1VQMF 4X1IB 3F0DA 4O4IA 3JASB 4X3MA 3RE3A 3C8LA 4I55A 1Z5VA 3VOBA 5EZYB 4F6RB 3HKEB 5IJ9B 3HAXD 4BY9D 5C8YB 2UYKA 3CPWF 1M90H 4C8GA 2QA4F 1VQNF 2HX0A 1KC8H 5IT9M 3V4DA 3CCJF 3D54A 3ZOPA 3KIZA 4IIJB 1TVKA 5FNVB 2HS3A 2CHTA 5EIBD 2LCAA 3IMPA 5LXTB 3S0YA 1RA4A 5EAZA 5JH7A 1H7MA 4NQ3A 2BO1A 2IG8A 2VAWA 4I4TA 4O4HA 5GAPK 1CLIA 3AGKA 4O4JB 3F0GA 4G4XA
chains in the Genus database with same CATH topology
5FLXM 3N4ZA 3V3TA 1VQ5F 5A2QM 2KTVA 3OBWA 3ON1A 5GIPC 1YI2F 1Q82H 1YHQF 1VQ7F 1VQLF 2VGMA 3CG6A 3CC7F 3CCQF 3LWPC 3HJWC 4BW0B 1YJNF 3J80M 5HY4A 1Q86H 1KQSF 1CK2A 3LWQC 1K8AH 2OTJF 5HY2A 3CCUF 1N8RH 3OW2F 5G4VC 3GYQA 5HY0A 3E1YA 3CD6F 2JNBA 5GIOC 1YITF 1CN7A 2FC3A 3O85A 2OHWA 3RA5A 3VMFB 1VQKF 2FGYA 1T0KB 3CXCF 3CCSF 2CZWA 5HWEA 3NMUC 3CCMF 2WALA 1W42A 4X3LA 1JJ2F 1VQ6F 3J81M 1S72F 5G4UC 5FJ4C 1M1KH 3G4SF 3CCVF 1VQOF 1XBIA 3D00A 5GANK 1QVGF 1E7KA 4BVTA 1NJIH 2F9ZC 3PAFA 3NVIB 3RA6A 2KTUA 2AIFA 3G6EF 3NK7A 2OZBA 1VQ9F 4EI9A 3NK6A 1GZ0A 2GLZA 1KD1H 2QI2A 1W41A 4EI8A 3LWRC 3CPQA 2LBWA 1QVFF 2KG4A 3CCEF 3J7AR 1RLGA 1YJ9F 3CMAF 1DT9A 3WXMB 3I55F 1X52A 1ZWZA 2OTLF 1VQMF 1YIJF 1GO1A 3CCLF 5EWRA 1VQPF 1K73H 1W40A 3E20B 1IPAA 3V7QA 3N4YA 1GO0A 4X3MA 1PXWA 3FFMA 4TZZA 1X7OA 1VQ4F 2LBXA 3JAMM 1W3EX 3HAXD 3G71F 1Q81H 2QEXF 4EI7A 4BY9D 3NVKE 3CPWF 2I6DA 3VI6A 1M90H 2QA4F 1SDSA 1VQNF 1KC8H 5IT9M 3CC4F 4BVQA 3CCJF 3PLAC 1NMUB 5DCVA 3JCMM 3SIUA 5HY1A 2HVYD 3SIVA 3CCRF 3CC2F 1Q7YH 3OBYA 4C4WC 3CMEF 5HXUA 1X7PA 3LWVC 1YJWF 1RA4A 5HXZA 3MCAB 1K9MH 4NUTA 3LFOA 1W2BF 4BVRA 4LCKA 1H7MA 4NQ3A 2BO1A 4XCQA 3V7EA 5GINC 3LWOC 2ALEA 5EO3A 3IR9A 1VQ8F 5GAPK 4BVSA 3AGKA 2VGNA 3I56F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX M;  3N4Z A;  1VQ5 F;  5A2Q M;  2KTV A;  3OBW A;  3ON1 A;  5GIP C;  1YI2 F;  1Q82 H;  1YHQ F;  1VQ7 F;  1VQL F;  2VGM A;  3CG6 A;  3CC7 F;  3CCQ F;  3LWP C;  3HJW C;  4BW0 B;  1YJN F;  3J80 M;  1Q86 H;  1KQS F;  1CK2 A;  3LWQ C;  1K8A H;  2OTJ F;  3CCU F;  1N8R H;  3OW2 F;  5G4V C;  3GYQ A;  3E1Y A;  3CD6 F;  2JNB A;  5GIO C;  1YIT F;  1CN7 A;  2FC3 A;  3O85 A;  2OHW A;  3RA5 A;  3VMF B;  1VQK F;  1T0K B;  3CXC F;  3CCS F;  2CZW A;  3NMU C;  3CCM F;  2WAL A;  1W42 A;  4X3L A;  1JJ2 F;  1VQ6 F;  3J81 M;  1S72 F;  5G4U C;  5FJ4 C;  1M1K H;  3G4S F;  3CCV F;  1VQO F;  1XBI A;  1QVG F;  5GAN K;  1E7K A;  1NJI H;  3PAF A;  3NVI B;  3RA6 A;  2KTU A;  2AIF A;  3G6E F;  3NK7 A;  2OZB A;  1VQ9 F;  3NK6 A;  1GZ0 A;  1KD1 H;  2QI2 A;  1W41 A;  3LWR C;  3CPQ A;  2LBW A;  1QVF F;  2KG4 A;  3CCE F;  3J7A R;  1RLG A;  1YJ9 F;  3CMA F;  1DT9 A;  3WXM B;  3I55 F;  1X52 A;  1ZWZ A;  2OTL F;  1VQM F;  1YIJ F;  1GO1 A;  3CCL F;  5EWR A;  1VQP F;  1K73 H;  1W40 A;  3E20 B;  1IPA A;  3V7Q A;  3N4Y A;  1GO0 A;  4X3M A;  1PXW A;  3FFM A;  4TZZ A;  1X7O A;  1VQ4 F;  2LBX A;  3JAM M;  1W3E X;  3HAX D;  3G71 F;  1Q81 H;  2QEX F;  4BY9 D;  3NVK E;  3CPW F;  2I6D A;  3VI6 A;  1M90 H;  2QA4 F;  1SDS A;  1VQN F;  1KC8 H;  5IT9 M;  3CC4 F;  3CCJ F;  3PLA C;  1NMU B;  5DCV A;  3JCM M;  3SIU A;  2HVY D;  3SIV A;  3CCR F;  3CC2 F;  1Q7Y H;  3OBY A;  4C4W C;  3CME F;  1X7P A;  3LWV C;  1YJW F;  1RA4 A;  3MCA B;  1K9M H;  4NUT A;  3LFO A;  1W2B F;  4LCK A;  1H7M A;  2BO1 A;  3V7E A;  5GIN C;  3LWO C;  2ALE A;  5EO3 A;  3IR9 A;  1VQ8 F;  5GAP K;  3AGK A;  2VGN A;  3I56 F; 
#chains in the Genus database with same CATH topology
 1JFF A;  4TV9 A;  4O2B A;  1FFX A;  1Z5W A;  4BT6 A;  2VXY A;  4RHA A;  5IYZ B;  3M84 A;  2KTV A;  5A2Q M;  3ON1 A;  3FD5 A;  1Q82 H;  4DRX A;  5CB4 A;  5LP6 C;  3CG6 A;  3CC7 F;  1JD1 A;  3KJJ A;  3LWP C;  1W55 A;  3HKD B;  5HP8 A;  5HP7 A;  1W57 A;  2H8E A;  4FFB A;  5HY2 A;  1RLU A;  5J2T B;  3OW2 F;  3LME A;  3WGK A;  5LP6 A;  4ZHV A;  1U43 A;  5GON B;  2CVL A;  3VMF B;  2IQQ A;  2FGY A;  3CXC F;  3CCS F;  2CZW A;  5LYJ A;  4X3L A;  4ZI7 A;  3QHD A;  1XBI A;  3D00 A;  4G88 A;  3LYB A;  4BVT A;  3PAF A;  2Z1E A;  3NK7 A;  4X1K B;  1SA0 B;  4HNA B;  5EYP A;  4G4W A;  4O4I B;  2QI2 A;  1KD1 H;  4EI8 A;  3RYF A;  3LWR C;  2PHN A;  3N2G A;  1UI9 A;  3JAT A;  4I55 B;  3VO8 A;  1QVF F;  3CCE F;  3RYC B;  4EB6 B;  1RLG A;  5JQG A;  4C8E A;  3JAL B;  3WXM B;  2L26 A;  2OTL F;  3S06 A;  2HP3 A;  1K73 H;  3E20 B;  3V7Q A;  3JAW B;  4TZZ A;  3WGN A;  3JAM M;  1TVK B;  2BTU A;  3RYI A;  5B8F A;  2QEX F;  4EI7 A;  4O4L A;  1IV3 A;  1YGY A;  4ZHQ B;  3NVK E;  2ZVY A;  4LNU A;  2I6D A;  2GZL A;  3CC4 F;  4BVQ A;  3HKB A;  3PLA C;  4TUY A;  2K1S A;  3SIU A;  4I4T B;  4O4H B;  4BT2 A;  3CC2 F;  3F0E A;  4O2A A;  4BT4 A;  1JFF B;  3RYH A;  1FFX B;  3WGJ A;  3CB2 A;  5HXZ A;  3DDN A;  1K9M H;  3IKF A;  4NUT A;  3QTY A;  4YJ3 A;  4LCK A;  4DRX B;  5J2U B;  3V7E A;  5CB4 B;  2HRY A;  3CYQ A;  2HS4 A;  5EO3 A;  4BVS A;  2BTQ B;  2VGN A;  2Q1X A;  1M1K H;  4X20 B;  5FLX M;  2RHH A;  3IEQ A;  3N4Z A;  3V3T A;  2ZAU A;  5JCO C;  1VQ5 F;  2ZF8 A;  2R6R 1;  3JAR A;  4FFB B;  3N2K A;  2VAP A;  3OBW A;  3I3F A;  4R40 B;  3WJQ A;  3S03 A;  2VGM A;  3UT5 A;  3CCQ F;  3KHN A;  2HRU A;  3WJR A;  1U3P A;  5HY4 A;  2HS0 A;  1CK2 A;  2AIZ P;  3K12 A;  5LYJ B;  2PMP A;  3MCQ A;  1QAH A;  4ZI7 B;  3M1X A;  5G4V C;  3GYQ A;  3S0W A;  2V9Y A;  3CD6 F;  5GIO C;  1CN7 A;  2FC3 A;  3RA5 A;  5MN5 A;  2NMU A;  3NMU C;  1W58 1;  2ZVZ A;  3RYF B;  4ZOL A;  3JAT B;  3C9R A;  5IJ0 A;  3G4S F;  3CCV F;  5LA6 A;  4I50 B;  3GTZ A;  3TD3 A;  2KTU A;  2UYP A;  3C9T A;  3D01 A;  4M8I A;  2UYN B;  3NK6 A;  2GLZ A;  3QUW A;  4ERH A;  2B33 A;  2CW4 A;  3F0F A;  3Q8H A;  1JY8 A;  3U0O A;  4B45 A;  1QU9 A;  4X1I A;  2LBW A;  2KG4 A;  3JAS A;  3KE1 A;  4WBN A;  2DT4 A;  4YJ2 A;  2CWJ A;  1ONI A;  2Z1T A;  3RYI B;  3WJP A;  1KNK A;  3CMA F;  1DT9 A;  1IV4 A;  4O4L B;  3I55 F;  1W5B A;  4KWE A;  3CYP B;  1VQP F;  1W40 A;  1IPA A;  2Z1U A;  3VIU A;  3N4Y A;  3VYT C;  1GO0 A;  1PXW A;  1X25 A;  3HWU A;  4BT3 A;  1XV2 A;  1VQ4 F;  2LBX A;  1OAP A;  5ITZ B;  3B6N A;  4C81 A;  1COM A;  3G71 F;  1RQ7 A;  1VH8 A;  2VAM A;  4O2A B;  4C8I A;  2YYE A;  3P0Z A;  3VI6 A;  2H8C A;  4ZHW A;  5LXT A;  1TUB A;  4YJ3 B;  5DCV A;  3JCM M;  5HY1 A;  1NQ3 A;  5CA1 A;  2HP0 A;  2HVY D;  1GX1 A;  2YXZ A;  1Q7Y H;  3ZP7 A;  3CME F;  5HXU A;  4O4J A;  3L7Q A;  3MCA B;  1UFY A;  3JAR B;  5LOV A;  2DYY A;  3N2K B;  2GVI A;  1W5A A;  3LFO A;  1W2B F;  3FBA A;  1VQV A;  4XCQ A;  5GIN C;  2ALE A;  4X1Y A;  1VK3 A;  3BYQ A;  3IR9 A;  3JVH A;  2EWC A;  3E22 A;  3HKC A;  4B46 A;  3HKD A;  1DBF A;  5JH7 B;  2CSL A;  2ZOD A;  1YHQ F;  5J2T A;  4TV8 A;  3DC2 A;  2ZOV A;  2H6L A;  3HTN A;  5GON A;  4TV9 B;  4BW0 B;  4O2B B;  4ZHY B;  1YJN F;  3TD5 A;  1KQS F;  1Q8R A;  3EOR A;  3LWQ C;  3VYS C;  1K8A H;  1RQ2 A;  1VHA A;  2RHL A;  3F6M A;  3CCU F;  5IJ0 B;  1N8R H;  1W59 A;  4U3J A;  5LA6 B;  2HQS C;  3IEW A;  5CA0 A;  2JNB A;  1YIT F;  1T0K B;  3JAK A;  3CCM F;  2BTO A;  1SA0 A;  2WAL A;  5KMG A;  3ESJ A;  1JJ2 F;  1VQ6 F;  5EB1 B;  4PWT A;  1U40 A;  3J81 M;  1S72 F;  5G4U C;  5JVD A;  5LP6 B;  5FJ4 C;  4WBN B;  2W8B C;  2MQE A;  4YJ2 B;  1VQO F;  2N48 A;  1E7K A;  1W5F A;  4EB6 A;  3RYC A;  3RA6 A;  2KGW A;  3ZP4 A;  2OZB A;  3JAL A;  4RQO A;  1GZ0 A;  5JCO A;  4EI9 A;  3C9U A;  3ZO8 A;  1KNJ A;  2I6R A;  5EIB C;  5KX5 A;  3CPQ A;  3T80 A;  3JAW A;  3ELC A;  4C82 A;  5BMV A;  3MQW A;  1YJ9 F;  4U39 A;  5EB0 A;  2UZH A;  1X52 A;  5EYP B;  1YIJ F;  4IHJ A;  3CCL F;  2Q1Y A;  5EWR A;  1J7H A;  4ZHQ A;  3N2G B;  3VYU C;  3OON A;  1TUB B;  3FFM A;  3S0H A;  1X7O A;  3MBM A;  3TD4 A;  5JQG B;  5CA1 B;  2HP0 B;  3VTI C;  1W3E X;  4B62 A;  1H47 A;  1Q81 H;  3VOA A;  4BT5 A;  1R1M A;  2RHJ A;  1SDS A;  5LOV B;  1NMU B;  3WGL A;  5MN4 A;  1IV2 A;  1H48 A;  4X1Y B;  3SIV A;  5J2U A;  5EZY A;  4F6R A;  1FNK A;  3E22 B;  3HKE A;  3HKC B;  5IJ9 A;  3CCR F;  3OBY A;  4B5C A;  4LNU B;  4C4W C;  1X7P A;  5C8Y A;  3LWV C;  1YJW F;  3HKB B;  1XRG A;  4TUY B;  4X20 A;  1FNJ A;  3R0P A;  3I7T A;  4BVR A;  1W5E A;  2RHO A;  4TV8 B;  3LWO C;  1PF5 A;  3WGM A;  1VQ8 F;  4IIJ A;  5FNV A;  3VCZ A;  3RYH B;  3I56 F;  1QD9 A;  2UYJ A;  1U3L A;  4G4Y A;  4U3J B;  5GIP C;  1VQ7 F;  1YI2 F;  1VQL F;  2QTP A;  3WPX A;  2Z1F A;  3M4S A;  5CA0 B;  2IAF A;  1JN1 A;  3HJW C;  1FSZ A;  3J80 M;  1IV1 A;  1Q86 H;  3JAK B;  2Z01 A;  3P10 A;  4NWO B;  5KMG B;  2RB9 A;  2OTJ F;  1OFU A;  5JVD B;  5IYZ A;  5AVM A;  1XHO A;  3UT5 B;  5HY0 A;  3E1Y A;  2AMT A;  4I50 A;  3K2X A;  2OTM A;  5MN6 A;  3S02 A;  3O85 A;  2OHW A;  1VQK F;  5HWE A;  5KX5 B;  3P4E A;  2UYN A;  2P6Y A;  1W42 A;  3WPW A;  4DXD A;  1ODE A;  3IKE A;  1QVG F;  4ZK7 A;  5GAN K;  5BMV B;  1NJI H;  1SZQ A;  2F9Z C;  3NVI B;  2LBT A;  2AIF A;  3MDO A;  3G6E F;  4IHJ B;  1VQ9 F;  3K0T A;  4G4Z A;  3KJK A;  1T0A A;  4ZOL B;  4BT7 A;  2CHS A;  1W41 A;  3C9S A;  3ERN A;  3FD6 A;  4E6E A;  3FPI A;  3LDT A;  3J7A R;  2G9I A;  2R75 1;  3K14 A;  5ITZ A;  3GHZ A;  1YQN A;  1ZWZ A;  4X1K A;  4G4V A;  1GO1 A;  4HNA A;  1VQM F;  4X1I B;  3F0D A;  4O4I A;  3JAS B;  4X3M A;  3RE3 A;  3C8L A;  4I55 A;  1Z5V A;  3VOB A;  5EZY B;  4F6R B;  3HKE B;  5IJ9 B;  3HAX D;  4BY9 D;  5C8Y B;  2UYK A;  3CPW F;  1M90 H;  4C8G A;  2QA4 F;  1VQN F;  2HX0 A;  1KC8 H;  5IT9 M;  3V4D A;  3CCJ F;  3D54 A;  3ZOP A;  3KIZ A;  4IIJ B;  1TVK A;  5FNV B;  2HS3 A;  2CHT A;  5EIB D;  2LCA A;  3IMP A;  5LXT B;  3S0Y A;  1RA4 A;  5EAZ A;  5JH7 A;  1H7M A;  4NQ3 A;  2BO1 A;  2IG8 A;  2VAW A;  4I4T A;  4O4H A;  5GAP K;  1CLI A;  3AGK A;  4O4J B;  3F0G A;  4G4X A; 
#chains in the Genus database with same CATH homology
 5FLX M;  3N4Z A;  3V3T A;  1VQ5 F;  5A2Q M;  2KTV A;  3OBW A;  3ON1 A;  5GIP C;  1YI2 F;  1Q82 H;  1YHQ F;  1VQ7 F;  1VQL F;  2VGM A;  3CG6 A;  3CC7 F;  3CCQ F;  3LWP C;  3HJW C;  4BW0 B;  1YJN F;  3J80 M;  5HY4 A;  1Q86 H;  1KQS F;  1CK2 A;  3LWQ C;  1K8A H;  2OTJ F;  5HY2 A;  3CCU F;  1N8R H;  3OW2 F;  5G4V C;  3GYQ A;  5HY0 A;  3E1Y A;  3CD6 F;  2JNB A;  5GIO C;  1YIT F;  1CN7 A;  2FC3 A;  3O85 A;  2OHW A;  3RA5 A;  3VMF B;  1VQK F;  2FGY A;  1T0K B;  3CXC F;  3CCS F;  2CZW A;  5HWE A;  3NMU C;  3CCM F;  2WAL A;  1W42 A;  4X3L A;  1JJ2 F;  1VQ6 F;  3J81 M;  1S72 F;  5G4U C;  5FJ4 C;  1M1K H;  3G4S F;  3CCV F;  1VQO F;  1XBI A;  3D00 A;  5GAN K;  1QVG F;  1E7K A;  4BVT A;  1NJI H;  2F9Z C;  3PAF A;  3NVI B;  3RA6 A;  2KTU A;  2AIF A;  3G6E F;  3NK7 A;  2OZB A;  1VQ9 F;  4EI9 A;  3NK6 A;  1GZ0 A;  2GLZ A;  1KD1 H;  2QI2 A;  1W41 A;  4EI8 A;  3LWR C;  3CPQ A;  2LBW A;  1QVF F;  2KG4 A;  3CCE F;  3J7A R;  1RLG A;  1YJ9 F;  3CMA F;  1DT9 A;  3WXM B;  3I55 F;  1X52 A;  1ZWZ A;  2OTL F;  1VQM F;  1YIJ F;  1GO1 A;  3CCL F;  5EWR A;  1VQP F;  1K73 H;  1W40 A;  3E20 B;  1IPA A;  3V7Q A;  3N4Y A;  1GO0 A;  4X3M A;  1PXW A;  3FFM A;  4TZZ A;  1X7O A;  1VQ4 F;  2LBX A;  3JAM M;  1W3E X;  3HAX D;  3G71 F;  1Q81 H;  2QEX F;  4EI7 A;  4BY9 D;  3NVK E;  3CPW F;  2I6D A;  3VI6 A;  1M90 H;  2QA4 F;  1SDS A;  1VQN F;  1KC8 H;  5IT9 M;  3CC4 F;  4BVQ A;  3CCJ F;  3PLA C;  1NMU B;  5DCV A;  3JCM M;  3SIU A;  5HY1 A;  2HVY D;  3SIV A;  3CCR F;  3CC2 F;  1Q7Y H;  3OBY A;  4C4W C;  3CME F;  5HXU A;  1X7P A;  3LWV C;  1YJW F;  1RA4 A;  5HXZ A;  3MCA B;  1K9M H;  4NUT A;  3LFO A;  1W2B F;  4BVR A;  4LCK A;  1H7M A;  4NQ3 A;  2BO1 A;  4XCQ A;  3V7E A;  5GIN C;  3LWO C;  2ALE A;  5EO3 A;  3IR9 A;  1VQ8 F;  5GAP K;  4BVS A;  3AGK A;  2VGN A;  3I56 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...