5GAPK

Body region of the u4/u6.u5 tri-snrnp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA, 5' region, nucleotides 1-67
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gapK00
1W2BF 2KTVA 3G71F 1YIJF 2FC3A 1K9MH 1DT9A 3N4YA 5IT9M 1VQLF 3V7QA 3VMFB 3RA6A 3N4ZA 3RA5A 1X7PA 1W41A 1GO1A 3CPQA 1W3EX 3LWOC 3HJWC 5FLXM 3CG6A 5A2QM 2KTUA 3NVIB 2QA4F 3JAMM 2CZWA 2KG4A 1QVGF 1T0KB 1VQ8F 1GO0A 1PXWA 1E7KA 2OZBA 4BW0B 1VQMF 3AGKA 1VQ7F 2OTLF 3FFMA 1JJ2F 3J81M 3CCEF 3CXCF 1W40A 2VGNA 3CCSF 1KD1H 1IPAA 1KC8H 1KQSF 1YITF 3NK7A 3CCRF 1YI2F 1RA4A 3ON1A 1Q81H 3VI6A 5G4VC 3LFOA 5GANK 3I55F 3JCMM 2QI2A 5G4UC 1VQPF 4TZZA 2I6DA 3CC4F 2LBXA 3CC2F 3E20B 3HAXD 1VQ6F 3CMAF 3CC7F 1RLGA 5GIPC 1VQ4F 3MCAB 3IR9A 1VQ5F 1VQNF 1SDSA 3LWPC 3NVKE 1K8AH 3LWQC 1Q82H 3CMEF 1M90H 3SIVA 2JNBA 1VQOF 3CCVF 1XBIA 3OBWA 3CCLF 5GIOC 1VQ9F 3E1YA 4NUTA 1Q7YH 3I56F 1NJIH 4X3MA 4LCKA 3OW2F 3G4SF 3CPWF 5GAPK 3PLAC 2WALA 1H7MA 1N8RH 2QEXF 3J80M 3V7EA 4BY9D 3CD6F 3SIUA 1X7OA 5EWRA 1K73H 1YHQF 2ALEA 2BO1A 3O85A 3PAFA 2VGMA 3CCJF 5GINC 3CCQF 1VQKF 3WXMB 1YJNF 5EO3A 1YJWF 2HVYD 1ZWZA 2LBWA 1Q86H 1CN7A 3J7AR 1NMUB 1S72F 3NMUC 5FJ4C 1M1KH 1W42A 3G6EF 5DCVA 3LWVC 1QVFF 3NK6A 2OHWA 2AIFA 3GYQA 3OBYA 3CCUF 1YJ9F 4X3LA 1X52A 3CCMF 2OTJF 4C4WC 1CK2A 1GZ0A 3LWRC
chains in the Genus database with same CATH superfamily
4X1IB 3RYCB 5EIBD 1YIJF 2FC3A 1K9MH 1H47A 3VMFB 1OAPA 1YQNA 1TUBA 4ZI7A 1GO1A 1KNJA 3MQWA 1X25A 5B8FA 2K1SA 5KX5B 4BVSA 5LP6A 3UT5A 2CWJA 2KTUA 3JAWA 1QVGF 3ELCA 1PXWA 3N2KB 1E7KA 2NMUA 3HKEA 3KIZA 5HXUA 2HX0A 3IKFA 3N2KA 2DYYA 1JJ2F 2KGWA 5GONB 4O4HB 3M1XA 3NK7A 4IHJA 3CCRF 2OTMA 3JARB 3ESJA 4O4HA 1YI2F 5KMGB 1Q81H 3VYUC 5MN4A 2RB9A 4BVTA 5GANK 1JY8A 5BMVB 3I3FA 2QI2A 5G4UC 3LMEA 4O4JA 1VQPF 2HP0A 4C82A 1RQ2A 2Z1EA 4TUYB 3S02A 3F6MA 5EB1B 2CW4A 3CC7F 4EI7A 3KHNA 2ZVZA 2UYNA 5JQGA 3IR9A 1VQ5F 1VQNF 2F9ZC 4EI9A 1VH8A 5HXZA 5C8YA 5LP6B 5JH7B 2JNBA 3OBWA 5JCOC 1TUBB 1T0AA 5GIOC 1XHOA 4YJ3B 4LCKA 1NJIH 4TV9A 4X3MA 1IV4A 3OW2F 4BT6A 4X1YB 1DBFA 4G4XA 5CA0B 3RYCA 2RHJA 1W5AA 3WGLA 3FD5A 3SIUA 5EWRA 1YHQF 3C9SA 2ALEA 2BO1A 3CCJF 5GINC 4ZHYB 5IJ0B 3C9RA 3DC2A 3JALA 2LBTA 3ZP4A 5IYZB 2HS4A 1YJWF 5HY2A 5LXTA 1ZWZA 1Q86H 3J7AR 1NMUB 4U3JB 3VYSC 3C9TA 5FJ4C 4G4VA 3RE3A 1W42A 3RYFA 3G6EF 1QVFF 3NK6A 2OHWA 2AIZP 3OBYA 2Z1UA 5LOVA 3N2GB 3RYIA 1YJ9F 4X3LA 3HKDA 5CA1B 5J2UB 2VAMA 3VIUA 3R0PA 3JAKB 4B45A 1UI9A 2UYKA 4B5CA 3MBMA 1QU9A 4IIJA 4YJ2A 1DT9A 5MN5A 2HS0A 5IJ9A 5HWEA 3KE1A 1W581 4I4TB 3N4ZA 5MN6A 3U0OA 1QAHA 3P0ZA 2BTOA 5HP8A 5IJ9B 4BT5A 4BT4A 1TVKA 1W3EX 2V9YA 3LWOC 3BYQA 3CG6A 4ZHQA 3GHZA 1XRGA 1T0KB 1JN1A 1U43A 3IMPA 2BTUA 1VQ7F 2G9IA 1JFFB 4ERHA 3E22B 2DT4A 4X1YA 3J81M 3CXCF 2VGNA 3CCEF 1QD9A 3RYHB 1KD1H 1KC8H 3T80A 3F0DA 1W5BA 3MDOA 1YITF 4U39A 3RYHA 1RA4A 4ZOLB 3S0YA 1W57A 4DXDA 3ON1A 3V3TA 3VI6A 2YYEA 5G4VC 4X1IA 3I55F 3JAKA 5JCOA 3CC4F 2VAPA 1J7HA 4ZHQB 5LA6B 3E20B 2RHOA 3KJKA 3JASB 2CHTA 2HP0B 2HQSC 1RLGA 3MCAB 2UYPA 2HP3A 1PF5A 4M8IA 1NQ3A 3IEQA 1SDSA 4O4LB 4I50A 3NVKE 1FNKA 4KWEA 1K8AH 3LWQC 3CMEF 1M90H 2UZHA 3SIVA 1VQOF 3CCVF 2AMTA 1XBIA 2MQEA 3CCLF 2HRYA 3CYQA 2VAWA 2VXYA 5J2UA 1VQ9F 4NUTA 1Q7YH 5GONA 4TUYA 2ZOVA 4R40B 1ONIA 3J80M 5LYJA 1RLUA 3JASA 3CD6F 4G4ZA 3CB2A 5CA0A 3O85A 3PAFA 5KMGA 3CCQF 4X1KA 2CHSA 5LOVB 3WXMB 1YJNF 2H6LA 2HVYD 3CYPB 5IJ0A 4O4LA 4HNAB 1M1KH 2HS3A 5DCVA 3LWVC 5HY0A 1VK3A 5ITZA 3F0FA 4EI8A 3QTYA 4XCQA 3IKEA 2QTPA 1CK2A 4B46A 1GZ0A 3LWRC 4EB6A 1W2BF 3G71F 3VCZA 3ZOPA 3D54A 3HKCB 3N4YA 1VQLF 3V7QA 4ZOLA 3LYBA 4YJ3A 4C81A 1TVKB 3JALB 4IHJB 2UYNB 3KJJA 3P4EA 5JQGB 3TD5A 3HJWC 3ERNA 3K12A 3C8LA 4DRXB 2H8CA 1FSZA 2N48A 3NVIB 2QA4F 2CZWA 5J2TB 1VQ8F 2OZBA 4O4JB 3AGKA 5ITZB 2ZAUA 2OTLF 5JVDB 3WPXA 3FFMA 1JD1A 4FFBA 1W40A 2IQQA 2I6RA 3CCSF 4LNUB 3K0TA 4BT2A 1IV2A 4DRXA 2ZODA 3B6NA 1W5EA 1KQSF 2RHLA 3D00A 3VYTC 3VOBA 3MCQA 5C8YB 5EIBC 3RYFB 4ZHWA 3ZP7A 1VQVA 1H48A 1UFYA 2H8EA 3HTNA 3LFOA 5LYJB 3ZO8A 5CA1A 4O4IB 2LBXA 1SA0B 3F0EA 5EYPB 3CC2F 4BVQA 3HAXD 4FFBB 3WJRA 5EAZA 2IAFA 3QUWA 3WGNA 4X20A 3I7TA 5AVMA 3EORA 2GVIA 4U3JA 3F0GA 3TD4A 3UT5B 1FFXB 3LWPC 1Z5VA 3HKCA 3S0HA 3S0WA 3GTZA 5EB0A 2UYJA 4PWTA 3JATA 2CSLA 3E1YA 2BTQB 5JVDA 3I56F 3G4SF 3PLAC 5GAPK 2WALA 5HY4A 2Z1FA 1N8RH 4F6RB 3C9UA 2QEXF 5EZYB 2R751 4BY9D 3V7EA 3M84A 1X7OA 3S03A 4I55B 1XV2A 4G4YA 1SA0A 5EYPA 2VGMA 3Q8HA 1VQKF 4C8EA 5EO3A 1COMA 1IV3A 4TV8B 4WBNB 2ZF8A 3FD6A 2FGYA 3VO8A 4HNAA 3S06A 1CN7A 3FPIA 4ZHVA 4C8IA 3WGKA 2AIFA 5FNVB 4O2BA 3CCUF 4LNUA 3CCMF 3HKDB 4C4WC 1CLIA 1Q82H 3HKEB 4RHAA 2KTVA 3HWUA 4O2BB 4NWOB 5HP7A 5J2TA 5IT9M 3D01A 3RA6A 2GZLA 3RA5A 5CB4A 1U40A 1X7PA 1W41A 1Q8RA 1U3LA 3TD3A 3CPQA 5LXTB 3IEWA 5LP6C 4ZK7A 3HKBB 5FLXM 4I50B 5A2QM 1W5FA 3JVHA 3JAMM 2KG4A 1GO0A 3LDTA 4BW0B 1VQMF 2GLZA 5LA6A 4TV9B 3WGMA 4BT7A 1IPAA 3HKBA 2HRUA 1KNKA 2L26A 1ODEA 5IYZA 1YGYA 2Z1TA 4O2AB 2W8BC 2ZVYA 1W59A 4G4WA 4B62A 5JH7A 1GX1A 5CB4B 3L7QA 2Z01A 1Z5WA 3E22A 4EB6B 5EZYA 4IIJB 4YJ2B 3JCMM 3VOAA 3WJQA 4TZZA 2I6DA 4NQ3A 2R6R1 2B33A 1VQ6F 3CMAF 2PHNA 4O4IA 1R1MA 1SZQA 3DDNA 5GIPC 1VQ4F 5HY1A 4O2AA 4BT3A 1FNJA 1OFUA 4X1KB 4G88A 3WGJA 4BVRA 3K14A 3WPWA 3CPWF 1H7MA 3N2GA 3RYIB 1RQ7A 5BMVA 2CVLA 4RQOA 1K73H 3K2XA 2EWCA 1W55A 3FBAA 2PMPA 3JARA 4E6EA 5FNVA 2LCAA 4TV8A 3M4SA 3VTIC 5KX5A 3WJPA 2LBWA 4I4TA 4C8GA 4ZI7B 1S72F 3NMUC 3QHDA 1FFXA 4WBNA 1IV1A 2Q1YA 2YXZA 3GYQA 1U3PA 2RHHA 3OONA 4X20B 4F6RA 2P6YA 3V4DA 3JAWB 1X52A 1VHAA 2Q1XA 3P10A 4I55A 3JATB 2OTJF 2IG8A 1JFFA
chains in the Genus database with same CATH topology
1W2BF 2KTVA 3G71F 1YIJF 2FC3A 1K9MH 1DT9A 3N4YA 5IT9M 1VQLF 3V7QA 3VMFB 5HWEA 3RA6A 3N4ZA 3RA5A 1X7PA 1W41A 1GO1A 3CPQA 1W3EX 3LWOC 4BVSA 3HJWC 5FLXM 3CG6A 5A2QM 2KTUA 3NVIB 2QA4F 3JAMM 2CZWA 2KG4A 1QVGF 1T0KB 1VQ8F 1GO0A 1PXWA 1E7KA 2OZBA 4BW0B 1VQMF 3AGKA 1VQ7F 2OTLF 2GLZA 3FFMA 5HXUA 1JJ2F 3J81M 3CCEF 3CXCF 1W40A 2VGNA 3CCSF 1KD1H 1IPAA 1KC8H 1KQSF 3D00A 1YITF 3NK7A 3CCRF 1YI2F 1RA4A 3ON1A 1Q81H 3V3TA 3VI6A 5G4VC 3LFOA 4BVTA 5GANK 3I55F 3JCMM 2QI2A 5G4UC 1VQPF 4TZZA 2I6DA 3CC4F 2LBXA 4NQ3A 3CC2F 4BVQA 3E20B 3HAXD 1VQ6F 3CMAF 3CC7F 4EI7A 1RLGA 5GIPC 1VQ4F 3MCAB 3IR9A 1VQ5F 1VQNF 5HY1A 2F9ZC 4EI9A 1SDSA 5HXZA 3LWPC 3NVKE 1K8AH 3LWQC 1Q82H 3CMEF 1M90H 3SIVA 2JNBA 1VQOF 3CCVF 1XBIA 3OBWA 3CCLF 4BVRA 5GIOC 1VQ9F 3E1YA 4NUTA 1Q7YH 3I56F 1NJIH 4X3MA 4LCKA 3OW2F 3G4SF 3CPWF 5GAPK 3PLAC 2WALA 5HY4A 1H7MA 1N8RH 2QEXF 3J80M 3V7EA 4BY9D 3CD6F 3SIUA 1X7OA 5EWRA 1K73H 1YHQF 2ALEA 2BO1A 3O85A 3PAFA 2VGMA 3CCJF 5GINC 3CCQF 1VQKF 3WXMB 1YJNF 5EO3A 1YJWF 2HVYD 5HY2A 1ZWZA 2LBWA 1Q86H 2FGYA 1CN7A 3J7AR 1NMUB 1S72F 3NMUC 5FJ4C 1M1KH 1W42A 3G6EF 5DCVA 3LWVC 1QVFF 3NK6A 5HY0A 2OHWA 2AIFA 3GYQA 3OBYA 3CCUF 1YJ9F 4X3LA 1X52A 4EI8A 3CCMF 4XCQA 2OTJF 4C4WC 1CK2A 1GZ0A 3LWRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B F;  2KTV A;  3G71 F;  1YIJ F;  2FC3 A;  1K9M H;  1DT9 A;  3N4Y A;  5IT9 M;  1VQL F;  3V7Q A;  3VMF B;  3RA6 A;  3N4Z A;  3RA5 A;  1X7P A;  1W41 A;  1GO1 A;  3CPQ A;  1W3E X;  3LWO C;  3HJW C;  5FLX M;  3CG6 A;  5A2Q M;  2KTU A;  3NVI B;  2QA4 F;  3JAM M;  2CZW A;  2KG4 A;  1QVG F;  1T0K B;  1VQ8 F;  1GO0 A;  1PXW A;  1E7K A;  2OZB A;  4BW0 B;  1VQM F;  3AGK A;  1VQ7 F;  2OTL F;  3FFM A;  1JJ2 F;  3J81 M;  3CCE F;  3CXC F;  1W40 A;  2VGN A;  3CCS F;  1KD1 H;  1IPA A;  1KC8 H;  1KQS F;  1YIT F;  3NK7 A;  3CCR F;  1YI2 F;  1RA4 A;  3ON1 A;  1Q81 H;  3VI6 A;  5G4V C;  3LFO A;  5GAN K;  3I55 F;  3JCM M;  2QI2 A;  5G4U C;  1VQP F;  4TZZ A;  2I6D A;  3CC4 F;  2LBX A;  3CC2 F;  3E20 B;  3HAX D;  1VQ6 F;  3CMA F;  3CC7 F;  1RLG A;  5GIP C;  1VQ4 F;  3MCA B;  3IR9 A;  1VQ5 F;  1VQN F;  1SDS A;  3LWP C;  3NVK E;  1K8A H;  3LWQ C;  1Q82 H;  3CME F;  1M90 H;  3SIV A;  2JNB A;  1VQO F;  3CCV F;  1XBI A;  3OBW A;  3CCL F;  5GIO C;  1VQ9 F;  3E1Y A;  4NUT A;  1Q7Y H;  3I56 F;  1NJI H;  4X3M A;  4LCK A;  3OW2 F;  3G4S F;  3CPW F;  5GAP K;  3PLA C;  2WAL A;  1H7M A;  1N8R H;  2QEX F;  3J80 M;  3V7E A;  4BY9 D;  3CD6 F;  3SIU A;  1X7O A;  5EWR A;  1K73 H;  1YHQ F;  2ALE A;  2BO1 A;  3O85 A;  3PAF A;  2VGM A;  3CCJ F;  5GIN C;  3CCQ F;  1VQK F;  3WXM B;  1YJN F;  5EO3 A;  1YJW F;  2HVY D;  1ZWZ A;  2LBW A;  1Q86 H;  1CN7 A;  3J7A R;  1NMU B;  1S72 F;  3NMU C;  5FJ4 C;  1M1K H;  1W42 A;  3G6E F;  5DCV A;  3LWV C;  1QVF F;  3NK6 A;  2OHW A;  2AIF A;  3GYQ A;  3OBY A;  3CCU F;  1YJ9 F;  4X3L A;  1X52 A;  3CCM F;  2OTJ F;  4C4W C;  1CK2 A;  1GZ0 A;  3LWR C; 
#chains in the Genus database with same CATH topology
 4X1I B;  3RYC B;  5EIB D;  1YIJ F;  2FC3 A;  1K9M H;  1H47 A;  3VMF B;  1OAP A;  1YQN A;  1TUB A;  4ZI7 A;  1GO1 A;  1KNJ A;  3MQW A;  1X25 A;  5B8F A;  2K1S A;  5KX5 B;  4BVS A;  5LP6 A;  3UT5 A;  2CWJ A;  2KTU A;  3JAW A;  1QVG F;  3ELC A;  1PXW A;  3N2K B;  1E7K A;  2NMU A;  3HKE A;  3KIZ A;  5HXU A;  2HX0 A;  3IKF A;  3N2K A;  2DYY A;  1JJ2 F;  2KGW A;  5GON B;  4O4H B;  3M1X A;  3NK7 A;  4IHJ A;  3CCR F;  2OTM A;  3JAR B;  3ESJ A;  4O4H A;  1YI2 F;  5KMG B;  1Q81 H;  3VYU C;  5MN4 A;  2RB9 A;  4BVT A;  5GAN K;  1JY8 A;  5BMV B;  3I3F A;  2QI2 A;  5G4U C;  3LME A;  4O4J A;  1VQP F;  2HP0 A;  4C82 A;  1RQ2 A;  2Z1E A;  4TUY B;  3S02 A;  3F6M A;  5EB1 B;  2CW4 A;  3CC7 F;  4EI7 A;  3KHN A;  2ZVZ A;  2UYN A;  5JQG A;  3IR9 A;  1VQ5 F;  1VQN F;  2F9Z C;  4EI9 A;  1VH8 A;  5HXZ A;  5C8Y A;  5LP6 B;  5JH7 B;  2JNB A;  3OBW A;  5JCO C;  1TUB B;  1T0A A;  5GIO C;  1XHO A;  4YJ3 B;  4LCK A;  1NJI H;  4TV9 A;  4X3M A;  1IV4 A;  3OW2 F;  4BT6 A;  4X1Y B;  1DBF A;  4G4X A;  5CA0 B;  3RYC A;  2RHJ A;  1W5A A;  3WGL A;  3FD5 A;  3SIU A;  5EWR A;  1YHQ F;  3C9S A;  2ALE A;  2BO1 A;  3CCJ F;  5GIN C;  4ZHY B;  5IJ0 B;  3C9R A;  3DC2 A;  3JAL A;  2LBT A;  3ZP4 A;  5IYZ B;  2HS4 A;  1YJW F;  5HY2 A;  5LXT A;  1ZWZ A;  1Q86 H;  3J7A R;  1NMU B;  4U3J B;  3VYS C;  3C9T A;  5FJ4 C;  4G4V A;  3RE3 A;  1W42 A;  3RYF A;  3G6E F;  1QVF F;  3NK6 A;  2OHW A;  2AIZ P;  3OBY A;  2Z1U A;  5LOV A;  3N2G B;  3RYI A;  1YJ9 F;  4X3L A;  3HKD A;  5CA1 B;  5J2U B;  2VAM A;  3VIU A;  3R0P A;  3JAK B;  4B45 A;  1UI9 A;  2UYK A;  4B5C A;  3MBM A;  1QU9 A;  4IIJ A;  4YJ2 A;  1DT9 A;  5MN5 A;  2HS0 A;  5IJ9 A;  5HWE A;  3KE1 A;  1W58 1;  4I4T B;  3N4Z A;  5MN6 A;  3U0O A;  1QAH A;  3P0Z A;  2BTO A;  5HP8 A;  5IJ9 B;  4BT5 A;  4BT4 A;  1TVK A;  1W3E X;  2V9Y A;  3LWO C;  3BYQ A;  3CG6 A;  4ZHQ A;  3GHZ A;  1XRG A;  1T0K B;  1JN1 A;  1U43 A;  3IMP A;  2BTU A;  1VQ7 F;  2G9I A;  1JFF B;  4ERH A;  3E22 B;  2DT4 A;  4X1Y A;  3J81 M;  3CXC F;  2VGN A;  3CCE F;  1QD9 A;  3RYH B;  1KD1 H;  1KC8 H;  3T80 A;  3F0D A;  1W5B A;  3MDO A;  1YIT F;  4U39 A;  3RYH A;  1RA4 A;  4ZOL B;  3S0Y A;  1W57 A;  4DXD A;  3ON1 A;  3V3T A;  3VI6 A;  2YYE A;  5G4V C;  4X1I A;  3I55 F;  3JAK A;  5JCO A;  3CC4 F;  2VAP A;  1J7H A;  4ZHQ B;  5LA6 B;  3E20 B;  2RHO A;  3KJK A;  3JAS B;  2CHT A;  2HP0 B;  2HQS C;  1RLG A;  3MCA B;  2UYP A;  2HP3 A;  1PF5 A;  4M8I A;  1NQ3 A;  3IEQ A;  1SDS A;  4O4L B;  4I50 A;  3NVK E;  1FNK A;  4KWE A;  1K8A H;  3LWQ C;  3CME F;  1M90 H;  2UZH A;  3SIV A;  1VQO F;  3CCV F;  2AMT A;  1XBI A;  2MQE A;  3CCL F;  2HRY A;  3CYQ A;  2VAW A;  2VXY A;  5J2U A;  1VQ9 F;  4NUT A;  1Q7Y H;  5GON A;  4TUY A;  2ZOV A;  4R40 B;  1ONI A;  3J80 M;  5LYJ A;  1RLU A;  3JAS A;  3CD6 F;  4G4Z A;  3CB2 A;  5CA0 A;  3O85 A;  3PAF A;  5KMG A;  3CCQ F;  4X1K A;  2CHS A;  5LOV B;  3WXM B;  1YJN F;  2H6L A;  2HVY D;  3CYP B;  5IJ0 A;  4O4L A;  4HNA B;  1M1K H;  2HS3 A;  5DCV A;  3LWV C;  5HY0 A;  1VK3 A;  5ITZ A;  3F0F A;  4EI8 A;  3QTY A;  4XCQ A;  3IKE A;  2QTP A;  1CK2 A;  4B46 A;  1GZ0 A;  3LWR C;  4EB6 A;  1W2B F;  3G71 F;  3VCZ A;  3ZOP A;  3D54 A;  3HKC B;  3N4Y A;  1VQL F;  3V7Q A;  4ZOL A;  3LYB A;  4YJ3 A;  4C81 A;  1TVK B;  3JAL B;  4IHJ B;  2UYN B;  3KJJ A;  3P4E A;  5JQG B;  3TD5 A;  3HJW C;  3ERN A;  3K12 A;  3C8L A;  4DRX B;  2H8C A;  1FSZ A;  2N48 A;  3NVI B;  2QA4 F;  2CZW A;  5J2T B;  1VQ8 F;  2OZB A;  4O4J B;  3AGK A;  5ITZ B;  2ZAU A;  2OTL F;  5JVD B;  3WPX A;  3FFM A;  1JD1 A;  4FFB A;  1W40 A;  2IQQ A;  2I6R A;  3CCS F;  4LNU B;  3K0T A;  4BT2 A;  1IV2 A;  4DRX A;  2ZOD A;  3B6N A;  1W5E A;  1KQS F;  2RHL A;  3D00 A;  3VYT C;  3VOB A;  3MCQ A;  5C8Y B;  5EIB C;  3RYF B;  4ZHW A;  3ZP7 A;  1VQV A;  1H48 A;  1UFY A;  2H8E A;  3HTN A;  3LFO A;  5LYJ B;  3ZO8 A;  5CA1 A;  4O4I B;  2LBX A;  1SA0 B;  3F0E A;  5EYP B;  3CC2 F;  4BVQ A;  3HAX D;  4FFB B;  3WJR A;  5EAZ A;  2IAF A;  3QUW A;  3WGN A;  4X20 A;  3I7T A;  5AVM A;  3EOR A;  2GVI A;  4U3J A;  3F0G A;  3TD4 A;  3UT5 B;  1FFX B;  3LWP C;  1Z5V A;  3HKC A;  3S0H A;  3S0W A;  3GTZ A;  5EB0 A;  2UYJ A;  4PWT A;  3JAT A;  2CSL A;  3E1Y A;  2BTQ B;  5JVD A;  3I56 F;  3G4S F;  3PLA C;  5GAP K;  2WAL A;  5HY4 A;  2Z1F A;  1N8R H;  4F6R B;  3C9U A;  2QEX F;  5EZY B;  2R75 1;  4BY9 D;  3V7E A;  3M84 A;  1X7O A;  3S03 A;  4I55 B;  1XV2 A;  4G4Y A;  1SA0 A;  5EYP A;  2VGM A;  3Q8H A;  1VQK F;  4C8E A;  5EO3 A;  1COM A;  1IV3 A;  4TV8 B;  4WBN B;  2ZF8 A;  3FD6 A;  2FGY A;  3VO8 A;  4HNA A;  3S06 A;  1CN7 A;  3FPI A;  4ZHV A;  4C8I A;  3WGK A;  2AIF A;  5FNV B;  4O2B A;  3CCU F;  4LNU A;  3CCM F;  3HKD B;  4C4W C;  1CLI A;  1Q82 H;  3HKE B;  4RHA A;  2KTV A;  3HWU A;  4O2B B;  4NWO B;  5HP7 A;  5J2T A;  5IT9 M;  3D01 A;  3RA6 A;  2GZL A;  3RA5 A;  5CB4 A;  1U40 A;  1X7P A;  1W41 A;  1Q8R A;  1U3L A;  3TD3 A;  3CPQ A;  5LXT B;  3IEW A;  5LP6 C;  4ZK7 A;  3HKB B;  5FLX M;  4I50 B;  5A2Q M;  1W5F A;  3JVH A;  3JAM M;  2KG4 A;  1GO0 A;  3LDT A;  4BW0 B;  1VQM F;  2GLZ A;  5LA6 A;  4TV9 B;  3WGM A;  4BT7 A;  1IPA A;  3HKB A;  2HRU A;  1KNK A;  2L26 A;  1ODE A;  5IYZ A;  1YGY A;  2Z1T A;  4O2A B;  2W8B C;  2ZVY A;  1W59 A;  4G4W A;  4B62 A;  5JH7 A;  1GX1 A;  5CB4 B;  3L7Q A;  2Z01 A;  1Z5W A;  3E22 A;  4EB6 B;  5EZY A;  4IIJ B;  4YJ2 B;  3JCM M;  3VOA A;  3WJQ A;  4TZZ A;  2I6D A;  4NQ3 A;  2R6R 1;  2B33 A;  1VQ6 F;  3CMA F;  2PHN A;  4O4I A;  1R1M A;  1SZQ A;  3DDN A;  5GIP C;  1VQ4 F;  5HY1 A;  4O2A A;  4BT3 A;  1FNJ A;  1OFU A;  4X1K B;  4G88 A;  3WGJ A;  4BVR A;  3K14 A;  3WPW A;  3CPW F;  1H7M A;  3N2G A;  3RYI B;  1RQ7 A;  5BMV A;  2CVL A;  4RQO A;  1K73 H;  3K2X A;  2EWC A;  1W55 A;  3FBA A;  2PMP A;  3JAR A;  4E6E A;  5FNV A;  2LCA A;  4TV8 A;  3M4S A;  3VTI C;  5KX5 A;  3WJP A;  2LBW A;  4I4T A;  4C8G A;  4ZI7 B;  1S72 F;  3NMU C;  3QHD A;  1FFX A;  4WBN A;  1IV1 A;  2Q1Y A;  2YXZ A;  3GYQ A;  1U3P A;  2RHH A;  3OON A;  4X20 B;  4F6R A;  2P6Y A;  3V4D A;  3JAW B;  1X52 A;  1VHA A;  2Q1X A;  3P10 A;  4I55 A;  3JAT B;  2OTJ F;  2IG8 A;  1JFF A; 
#chains in the Genus database with same CATH homology
 1W2B F;  2KTV A;  3G71 F;  1YIJ F;  2FC3 A;  1K9M H;  1DT9 A;  3N4Y A;  5IT9 M;  1VQL F;  3V7Q A;  3VMF B;  5HWE A;  3RA6 A;  3N4Z A;  3RA5 A;  1X7P A;  1W41 A;  1GO1 A;  3CPQ A;  1W3E X;  3LWO C;  4BVS A;  3HJW C;  5FLX M;  3CG6 A;  5A2Q M;  2KTU A;  3NVI B;  2QA4 F;  3JAM M;  2CZW A;  2KG4 A;  1QVG F;  1T0K B;  1VQ8 F;  1GO0 A;  1PXW A;  1E7K A;  2OZB A;  4BW0 B;  1VQM F;  3AGK A;  1VQ7 F;  2OTL F;  2GLZ A;  3FFM A;  5HXU A;  1JJ2 F;  3J81 M;  3CCE F;  3CXC F;  1W40 A;  2VGN A;  3CCS F;  1KD1 H;  1IPA A;  1KC8 H;  1KQS F;  3D00 A;  1YIT F;  3NK7 A;  3CCR F;  1YI2 F;  1RA4 A;  3ON1 A;  1Q81 H;  3V3T A;  3VI6 A;  5G4V C;  3LFO A;  4BVT A;  5GAN K;  3I55 F;  3JCM M;  2QI2 A;  5G4U C;  1VQP F;  4TZZ A;  2I6D A;  3CC4 F;  2LBX A;  4NQ3 A;  3CC2 F;  4BVQ A;  3E20 B;  3HAX D;  1VQ6 F;  3CMA F;  3CC7 F;  4EI7 A;  1RLG A;  5GIP C;  1VQ4 F;  3MCA B;  3IR9 A;  1VQ5 F;  1VQN F;  5HY1 A;  2F9Z C;  4EI9 A;  1SDS A;  5HXZ A;  3LWP C;  3NVK E;  1K8A H;  3LWQ C;  1Q82 H;  3CME F;  1M90 H;  3SIV A;  2JNB A;  1VQO F;  3CCV F;  1XBI A;  3OBW A;  3CCL F;  4BVR A;  5GIO C;  1VQ9 F;  3E1Y A;  4NUT A;  1Q7Y H;  3I56 F;  1NJI H;  4X3M A;  4LCK A;  3OW2 F;  3G4S F;  3CPW F;  5GAP K;  3PLA C;  2WAL A;  5HY4 A;  1H7M A;  1N8R H;  2QEX F;  3J80 M;  3V7E A;  4BY9 D;  3CD6 F;  3SIU A;  1X7O A;  5EWR A;  1K73 H;  1YHQ F;  2ALE A;  2BO1 A;  3O85 A;  3PAF A;  2VGM A;  3CCJ F;  5GIN C;  3CCQ F;  1VQK F;  3WXM B;  1YJN F;  5EO3 A;  1YJW F;  2HVY D;  5HY2 A;  1ZWZ A;  2LBW A;  1Q86 H;  2FGY A;  1CN7 A;  3J7A R;  1NMU B;  1S72 F;  3NMU C;  5FJ4 C;  1M1K H;  1W42 A;  3G6E F;  5DCV A;  3LWV C;  1QVF F;  3NK6 A;  5HY0 A;  2OHW A;  2AIF A;  3GYQ A;  3OBY A;  3CCU F;  1YJ9 F;  4X3L A;  1X52 A;  4EI8 A;  3CCM F;  4XCQ A;  2OTJ F;  4C4W C;  1CK2 A;  1GZ0 A;  3LWR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...