1U3PA

Ispf native
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structure of 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase Involved in Mevalonate Independent Biosynthesis of Isoprenoids
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1u3pA00
1U40A 3Q8HA 1KNKA 1VHAA 4C8EA 1KNJA 2UZHA 3IEWA 1GX1A 1U43A 3F0EA 3F0FA 2PMPA 3IKEA 1JY8A 1H47A 1H48A 3EORA 1JN1A 1IV4A 3IEQA 1IV2A 3K2XA 1YQNA 3FBAA 1U3LA 1IV3A 3JVHA 4C82A 4C81A 3IKFA 3F0GA 3P0ZA 2GZLA 3P10A 5B8FA 3FPIA 3QHDA 4C8IA 3F0DA 3RE3A 3MBMA 3T80A 1W57A 1VH8A 3B6NA 3K14A 4C8GA 2AMTA 1IV1A 3ERNA 1T0AA 3GHZA 3F6MA 3ELCA 3KE1A 1W55A 1U3PA 3ESJA
chains in the Genus database with same CATH superfamily
1H7MA 4C8EA 3VYUC 1GX1A 1U43A 4BT6A 3WGKA 2Z1TA 5LP6C 4X1YA 1W2BF 2OHWA 3NK7A 1OAPA 3RYHA 3JAWB 3JVHA 5GINC 1W5BA 1YIJF 1YJWF 4X1IB 3WJRA 2ZF8A 3JATB 5C8YB 2DYYA 2VAMA 2LBTA 1W5FA 5CA1B 1VQVA 2L26A 2IAFA 3I7TA 1VHAA 5KMGB 3ZP4A 3NK6A 4X20B 3F0FA 1VQ4F 2LBWA 3CCUF 2HQSC 3JAWA 3N4YA 5EO3A 5IJ0A 4X1IA 2CVLA 5LXTB 3ZO8A 4BVTA 1Q81H 3MCAB 2MQEA 1Q8RA 5C8YA 3P10A 5J2UB 1NQ3A 5CA1A 3ZP7A 3G6EF 2ZVYA 5FJ4C 2CHTA 4I55B 5FNVB 5KMGA 4M8IA 2FC3A 1RLGA 1QAHA 1Z5VA 4X20A 4B45A 3WJQA 2R6R1 3C8LA 3JCMM 3TD5A 5HP7A 2WALA 1CLIA 3M4SA 1VK3A 5LXTA 3VTIC 1H48A 2KTUA 2UYKA 2HP0A 3K2XA 4TV8A 2V9YA 5FLXM 1U3LA 3WPWA 2AIFA 3J7AR 2JNBA 3AGKA 3CC7F 2QI2A 4IIJB 2GLZA 3OBYA 1YJNF 3D01A 5MN6A 5HY0A 5KX5B 1Q86H 3BYQA 2RHLA 2UYJA 3JAMM 3WXMB 3S03A 4DRXB 1YHQF 3WGJA 1FSZA 3E22B 1U3PA 4F6RB 3JASA 1VQNF 3D54A 4ZOLA 5JVDA 2UZHA 5A2QM 2VAPA 5EZYB 3LMEA 1FFXB 3PAFA 5LOVB 3HKBA 4IHJA 3HKDB 5GIOC 4I50B 5HXZA 3CCLF 5LYJA 1SDSA 1CK2A 1OFUA 4B5CA 3MDOA 3RYIB 4F6RA 3E22A 2ZVZA 1PXWA 3OBWA 4TV9A 3LWOC 4G4XA 4G4ZA 4O2BA 4ZI7A 5DCVA 2RHHA 1GO1A 4BT5A 3CCQF 3LWVC 1XV2A 3WPXA 1FNKA 2OTJF 1W5EA 5EYPA 3CCVF 1H47A 3HKDA 5LP6B 5EAZA 3S02A 3CMAF 4O4JB 4BVSA 2BO1A 2GVIA 5GANK 5ITZB 3JARB 3RYIA 1YITF 5HY2A 3P0ZA 3CPQA 4E6EA 2QEXF 1CN7A 5HY1A 3RE3A 3N4ZA 3MBMA 3DC2A 5CA0A 1XRGA 3N2KB 3VOAA 1K9MH 1DT9A 4WBNB 2CHSA 2HRYA 1JD1A 1RQ7A 5BMVB 3J81M 1E7KA 4LCKA 3M84A 4XCQA 5LP6A 5EIBC 3LYBA 4BY9D 2BTQB 4O4JA 5EIBD 3CMEF 1IV4A 1RLUA 1IV2A 4G88A 3GYQA 2VXYA 4YJ3A 4FFBB 1R1MA 3N2KA 4TUYB 4WBNA 3CYQA 3T80A 4NUTA 2H6LA 1W57A 3B6NA 4U3JB 3CB2A 1Q82H 2OTLF 4ZHYB 2HS0A 1QU9A 1J7HA 5J2TB 3CCSF 3CG6A 3TD4A 2Z1UA 2KGWA 1JY8A 1QVGF 3FD6A 4NQ3A 5JH7B 4FFBA 3ON1A 1VQ9F 1Q7YH 3JATA 2LCAA 3K0TA 3LWPC 1X7OA 1IV1A 2ZOVA 2DT4A 5EB1B 5GAPK 1VQLF 5JH7A 4KWEA 3F0EA 3HKEB 5MN4A 3CCEF 3U0OA 1NJIH 3WJPA 1IV3A 5J2UA 5HP8A 1NMUB 1VQPF 4C8IA 3S0WA 4I55A 4O2AB 5FNVA 3VYTC 3CCMF 2HP3A 4BT4A 4DXDA 2ALEA 3KHNA 3HKEA 1YI2F 5IJ9B 2YXZA 5IYZB 1Z5WA 3JAKB 3CXCF 4O4LB 2IQQA 3CYPB 2VGNA 3LDTA 4BT2A 4IIJA 4C81A 3J80M 5KX5A 3FPIA 3N2GB 5LA6B 1JJ2F 3F0DA 5G4UC 4DRXA 1GZ0A 4U39A 3PLAC 3K14A 3RA6A 1T0AA 2B33A 3GHZA 3F6MA 4R40B 4BW0B 4ZHWA 5IJ9A 3Q8HA 5EZYA 3D00A 1FFXA 4EI7A 5IYZA 5LOVA 1QVFF 1RQ2A 4O4LA 4X3LA 3TD3A 4YJ2B 3NVKE 3K12A 3IMPA 4I50A 1VQ7F 4EI8A 3FBAA 4C82A 3CD6F 5JCOC 1X25A 3ZOPA 4ZK7A 2UYPA 3CCJF 1VQKF 2AMTA 3ERNA 4X1KB 3HTNA 3LFOA 1FNJA 2Z1EA 3ESJA 4O4IB 3HAXD 4RQOA 3C9SA 2H8EA 4X3MA 1COMA 1W59A 1YJ9F 4BT3A 3EORA 3C9RA 2OTMA 5ITZA 2I6RA 3JARA 1W42A 3G4SF 3SIVA 3CCRF 4C4WC 1JFFB 4I4TB 1GO0A 4X1KA 2CW4A 5MN5A 2KG4A 2VGMA 5BMVA 3WGNA 3ELCA 3IKEA 1ONIA 1QD9A 4O4HB 2CZWA 5G4VC 1UFYA 3I3FA 5EWRA 2W8BC 3FFMA 2ZAUA 4ZHVA 2NMUA 2PMPA 5IT9M 3LWRC 1X7PA 3I55F 2H8CA 2BTUA 3IEQA 4G4WA 3HJWC 2RB9A 4B62A 1RA4A 4TUYA 4HNAB 3S06A 1JFFA 3RYFB 4I4TA 3UT5B 5CB4B 5IJ0B 1KC8H 3I56F 4U3JA 3NVIB 3M1XA 1K73H 5JQGB 3VI6A 3R0PA 3DDNA 4NWOB 2R751 1SA0B 3OONA 4O4HA 2HVYD 3IR9A 2Z01A 5J2TA 3OW2F 1M1KH 3HKCB 3VIUA 1KNKA 2HS3A 2ZODA 3IEWA 3VYSC 5GIPC 1PF5A 4HNAA 3RYFA 3UT5A 1JN1A 5CB4A 5EB0A 2F9ZC 1W581 2HP0B 2YYEA 4TV8B 5JQGA 3IKFA 2LBXA 1DBFA 2I6DA 4BVRA 4EB6B 1SA0A 3QHDA 5B8FA 1K8AH 1IPAA 1W41A 1VH8A 1KQSF 1W40A 3QTYA 3HKCA 4ZHQB 2VAWA 1ZWZA 1W55A 2OZBA 1XBIA 1XHOA 3S0YA 3JASB 2PHNA 3RA5A 4ZOLB 5JVDB 2AIZP 4B46A 2FGYA 2Q1YA 1YQNA 2HS4A 3FD5A 3JALB 4EB6A 3HKBB 4IHJB 3G71F 1YGYA 2RHJA 3C9UA 1SZQA 1KD1H 2HX0A 2GZLA 3E1YA 3E20B 3V3TA 4O2AA 4ZHQA 5LYJB 5GONB 5HY4A 2EWCA 2G9IA 3S0HA 4TV9B 3KJKA 1U40A 4O2BB 1X52A 4ZI7B 4LNUB 3VO8A 5HWEA 1KNJA 3CC2F 2CWJA 2Z1FA 3JAKA 2QTPA 1VQ8F 3JALA 3RYCB 2QA4F 1M90H 1VQ5F 2KTVA 5EYPB 5JCOA 3O85A 3CPWF 3N2GA 1TVKB 2N48A 2RHOA 3KJJA 5GONA 5LA6A 3V7EA 1S72F 3V7QA 1VQOF 3V4DA 3QUWA 2IG8A 4C8GA 2UYNB 5CA0B 1VQ6F 4LNUA 3GTZA 2Q1XA 2BTOA 2HRUA 3KIZA 1N8RH 3RYCA 3L7QA 4G4YA 4YJ2A 1TUBB 2K1SA 3VCZA 1W3EX 4ERHA 3LWQC 4RHAA 1TVKA 1W5AA 3WGLA 3C9TA 3MQWA 1UI9A 4EI9A 3MCQA 4X1YB 1T0KB 3SIUA 3VOBA 3RYHB 1ODEA 3F0GA 4BVQA 3HWUA 4YJ3B 4PWTA 2P6YA 2UYNA 4BT7A 2CSLA 5AVMA 4G4VA 3CC4F 3P4EA 5HXUA 3WGMA 3VMFB 4O4IA 3KE1A 1TUBA 4TZZA 1VQMF 3NMUC
chains in the Genus database with same CATH topology
1U40A 3Q8HA 1KNKA 1VHAA 4C8EA 1KNJA 2UZHA 3IEWA 1GX1A 1U43A 3F0EA 3F0FA 2PMPA 3IKEA 1JY8A 1H47A 1H48A 3EORA 1JN1A 1IV4A 3IEQA 1IV2A 3K2XA 1YQNA 3FBAA 1U3LA 1IV3A 3JVHA 4C82A 4C81A 3IKFA 3F0GA 3P0ZA 2GZLA 3P10A 5B8FA 3FPIA 3QHDA 4C8IA 3F0DA 3RE3A 3MBMA 3T80A 1W57A 1VH8A 3B6NA 3K14A 4C8GA 2AMTA 1IV1A 3ERNA 1T0AA 3GHZA 3F6MA 3ELCA 3KE1A 1W55A 1U3PA 3ESJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U40 A;  3Q8H A;  1KNK A;  1VHA A;  4C8E A;  1KNJ A;  2UZH A;  3IEW A;  1GX1 A;  1U43 A;  3F0E A;  3F0F A;  2PMP A;  3IKE A;  1JY8 A;  1H47 A;  1H48 A;  3EOR A;  1JN1 A;  1IV4 A;  3IEQ A;  1IV2 A;  3K2X A;  1YQN A;  3FBA A;  1U3L A;  1IV3 A;  3JVH A;  4C82 A;  4C81 A;  3IKF A;  3F0G A;  3P0Z A;  2GZL A;  3P10 A;  5B8F A;  3FPI A;  3QHD A;  4C8I A;  3F0D A;  3RE3 A;  3MBM A;  3T80 A;  1W57 A;  1VH8 A;  3B6N A;  3K14 A;  4C8G A;  2AMT A;  1IV1 A;  3ERN A;  1T0A A;  3GHZ A;  3F6M A;  3ELC A;  3KE1 A;  1W55 A;  1U3P A;  3ESJ A; 
#chains in the Genus database with same CATH topology
 1H7M A;  4C8E A;  3VYU C;  1GX1 A;  1U43 A;  4BT6 A;  3WGK A;  2Z1T A;  5LP6 C;  4X1Y A;  1W2B F;  2OHW A;  3NK7 A;  1OAP A;  3RYH A;  3JAW B;  3JVH A;  5GIN C;  1W5B A;  1YIJ F;  1YJW F;  4X1I B;  3WJR A;  2ZF8 A;  3JAT B;  5C8Y B;  2DYY A;  2VAM A;  2LBT A;  1W5F A;  5CA1 B;  1VQV A;  2L26 A;  2IAF A;  3I7T A;  1VHA A;  5KMG B;  3ZP4 A;  3NK6 A;  4X20 B;  3F0F A;  1VQ4 F;  2LBW A;  3CCU F;  2HQS C;  3JAW A;  3N4Y A;  5EO3 A;  5IJ0 A;  4X1I A;  2CVL A;  5LXT B;  3ZO8 A;  4BVT A;  1Q81 H;  3MCA B;  2MQE A;  1Q8R A;  5C8Y A;  3P10 A;  5J2U B;  1NQ3 A;  5CA1 A;  3ZP7 A;  3G6E F;  2ZVY A;  5FJ4 C;  2CHT A;  4I55 B;  5FNV B;  5KMG A;  4M8I A;  2FC3 A;  1RLG A;  1QAH A;  1Z5V A;  4X20 A;  4B45 A;  3WJQ A;  2R6R 1;  3C8L A;  3JCM M;  3TD5 A;  5HP7 A;  2WAL A;  1CLI A;  3M4S A;  1VK3 A;  5LXT A;  3VTI C;  1H48 A;  2KTU A;  2UYK A;  2HP0 A;  3K2X A;  4TV8 A;  2V9Y A;  5FLX M;  1U3L A;  3WPW A;  2AIF A;  3J7A R;  2JNB A;  3AGK A;  3CC7 F;  2QI2 A;  4IIJ B;  2GLZ A;  3OBY A;  1YJN F;  3D01 A;  5MN6 A;  5HY0 A;  5KX5 B;  1Q86 H;  3BYQ A;  2RHL A;  2UYJ A;  3JAM M;  3WXM B;  3S03 A;  4DRX B;  1YHQ F;  3WGJ A;  1FSZ A;  3E22 B;  1U3P A;  4F6R B;  3JAS A;  1VQN F;  3D54 A;  4ZOL A;  5JVD A;  2UZH A;  5A2Q M;  2VAP A;  5EZY B;  3LME A;  1FFX B;  3PAF A;  5LOV B;  3HKB A;  4IHJ A;  3HKD B;  5GIO C;  4I50 B;  5HXZ A;  3CCL F;  5LYJ A;  1SDS A;  1CK2 A;  1OFU A;  4B5C A;  3MDO A;  3RYI B;  4F6R A;  3E22 A;  2ZVZ A;  1PXW A;  3OBW A;  4TV9 A;  3LWO C;  4G4X A;  4G4Z A;  4O2B A;  4ZI7 A;  5DCV A;  2RHH A;  1GO1 A;  4BT5 A;  3CCQ F;  3LWV C;  1XV2 A;  3WPX A;  1FNK A;  2OTJ F;  1W5E A;  5EYP A;  3CCV F;  1H47 A;  3HKD A;  5LP6 B;  5EAZ A;  3S02 A;  3CMA F;  4O4J B;  4BVS A;  2BO1 A;  2GVI A;  5GAN K;  5ITZ B;  3JAR B;  3RYI A;  1YIT F;  5HY2 A;  3P0Z A;  3CPQ A;  4E6E A;  2QEX F;  1CN7 A;  5HY1 A;  3RE3 A;  3N4Z A;  3MBM A;  3DC2 A;  5CA0 A;  1XRG A;  3N2K B;  3VOA A;  1K9M H;  1DT9 A;  4WBN B;  2CHS A;  2HRY A;  1JD1 A;  1RQ7 A;  5BMV B;  3J81 M;  1E7K A;  4LCK A;  3M84 A;  4XCQ A;  5LP6 A;  5EIB C;  3LYB A;  4BY9 D;  2BTQ B;  4O4J A;  5EIB D;  3CME F;  1IV4 A;  1RLU A;  1IV2 A;  4G88 A;  3GYQ A;  2VXY A;  4YJ3 A;  4FFB B;  1R1M A;  3N2K A;  4TUY B;  4WBN A;  3CYQ A;  3T80 A;  4NUT A;  2H6L A;  1W57 A;  3B6N A;  4U3J B;  3CB2 A;  1Q82 H;  2OTL F;  4ZHY B;  2HS0 A;  1QU9 A;  1J7H A;  5J2T B;  3CCS F;  3CG6 A;  3TD4 A;  2Z1U A;  2KGW A;  1JY8 A;  1QVG F;  3FD6 A;  4NQ3 A;  5JH7 B;  4FFB A;  3ON1 A;  1VQ9 F;  1Q7Y H;  3JAT A;  2LCA A;  3K0T A;  3LWP C;  1X7O A;  1IV1 A;  2ZOV A;  2DT4 A;  5EB1 B;  5GAP K;  1VQL F;  5JH7 A;  4KWE A;  3F0E A;  3HKE B;  5MN4 A;  3CCE F;  3U0O A;  1NJI H;  3WJP A;  1IV3 A;  5J2U A;  5HP8 A;  1NMU B;  1VQP F;  4C8I A;  3S0W A;  4I55 A;  4O2A B;  5FNV A;  3VYT C;  3CCM F;  2HP3 A;  4BT4 A;  4DXD A;  2ALE A;  3KHN A;  3HKE A;  1YI2 F;  5IJ9 B;  2YXZ A;  5IYZ B;  1Z5W A;  3JAK B;  3CXC F;  4O4L B;  2IQQ A;  3CYP B;  2VGN A;  3LDT A;  4BT2 A;  4IIJ A;  4C81 A;  3J80 M;  5KX5 A;  3FPI A;  3N2G B;  5LA6 B;  1JJ2 F;  3F0D A;  5G4U C;  4DRX A;  1GZ0 A;  4U39 A;  3PLA C;  3K14 A;  3RA6 A;  1T0A A;  2B33 A;  3GHZ A;  3F6M A;  4R40 B;  4BW0 B;  4ZHW A;  5IJ9 A;  3Q8H A;  5EZY A;  3D00 A;  1FFX A;  4EI7 A;  5IYZ A;  5LOV A;  1QVF F;  1RQ2 A;  4O4L A;  4X3L A;  3TD3 A;  4YJ2 B;  3NVK E;  3K12 A;  3IMP A;  4I50 A;  1VQ7 F;  4EI8 A;  3FBA A;  4C82 A;  3CD6 F;  5JCO C;  1X25 A;  3ZOP A;  4ZK7 A;  2UYP A;  3CCJ F;  1VQK F;  2AMT A;  3ERN A;  4X1K B;  3HTN A;  3LFO A;  1FNJ A;  2Z1E A;  3ESJ A;  4O4I B;  3HAX D;  4RQO A;  3C9S A;  2H8E A;  4X3M A;  1COM A;  1W59 A;  1YJ9 F;  4BT3 A;  3EOR A;  3C9R A;  2OTM A;  5ITZ A;  2I6R A;  3JAR A;  1W42 A;  3G4S F;  3SIV A;  3CCR F;  4C4W C;  1JFF B;  4I4T B;  1GO0 A;  4X1K A;  2CW4 A;  5MN5 A;  2KG4 A;  2VGM A;  5BMV A;  3WGN A;  3ELC A;  3IKE A;  1ONI A;  1QD9 A;  4O4H B;  2CZW A;  5G4V C;  1UFY A;  3I3F A;  5EWR A;  2W8B C;  3FFM A;  2ZAU A;  4ZHV A;  2NMU A;  2PMP A;  5IT9 M;  3LWR C;  1X7P A;  3I55 F;  2H8C A;  2BTU A;  3IEQ A;  4G4W A;  3HJW C;  2RB9 A;  4B62 A;  1RA4 A;  4TUY A;  4HNA B;  3S06 A;  1JFF A;  3RYF B;  4I4T A;  3UT5 B;  5CB4 B;  5IJ0 B;  1KC8 H;  3I56 F;  4U3J A;  3NVI B;  3M1X A;  1K73 H;  5JQG B;  3VI6 A;  3R0P A;  3DDN A;  4NWO B;  2R75 1;  1SA0 B;  3OON A;  4O4H A;  2HVY D;  3IR9 A;  2Z01 A;  5J2T A;  3OW2 F;  1M1K H;  3HKC B;  3VIU A;  1KNK A;  2HS3 A;  2ZOD A;  3IEW A;  3VYS C;  5GIP C;  1PF5 A;  4HNA A;  3RYF A;  3UT5 A;  1JN1 A;  5CB4 A;  5EB0 A;  2F9Z C;  1W58 1;  2HP0 B;  2YYE A;  4TV8 B;  5JQG A;  3IKF A;  2LBX A;  1DBF A;  2I6D A;  4BVR A;  4EB6 B;  1SA0 A;  3QHD A;  5B8F A;  1K8A H;  1IPA A;  1W41 A;  1VH8 A;  1KQS F;  1W40 A;  3QTY A;  3HKC A;  4ZHQ B;  2VAW A;  1ZWZ A;  1W55 A;  2OZB A;  1XBI A;  1XHO A;  3S0Y A;  3JAS B;  2PHN A;  3RA5 A;  4ZOL B;  5JVD B;  2AIZ P;  4B46 A;  2FGY A;  2Q1Y A;  1YQN A;  2HS4 A;  3FD5 A;  3JAL B;  4EB6 A;  3HKB B;  4IHJ B;  3G71 F;  1YGY A;  2RHJ A;  3C9U A;  1SZQ A;  1KD1 H;  2HX0 A;  2GZL A;  3E1Y A;  3E20 B;  3V3T A;  4O2A A;  4ZHQ A;  5LYJ B;  5GON B;  5HY4 A;  2EWC A;  2G9I A;  3S0H A;  4TV9 B;  3KJK A;  1U40 A;  4O2B B;  1X52 A;  4ZI7 B;  4LNU B;  3VO8 A;  5HWE A;  1KNJ A;  3CC2 F;  2CWJ A;  2Z1F A;  3JAK A;  2QTP A;  1VQ8 F;  3JAL A;  3RYC B;  2QA4 F;  1M90 H;  1VQ5 F;  2KTV A;  5EYP B;  5JCO A;  3O85 A;  3CPW F;  3N2G A;  1TVK B;  2N48 A;  2RHO A;  3KJJ A;  5GON A;  5LA6 A;  3V7E A;  1S72 F;  3V7Q A;  1VQO F;  3V4D A;  3QUW A;  2IG8 A;  4C8G A;  2UYN B;  5CA0 B;  1VQ6 F;  4LNU A;  3GTZ A;  2Q1X A;  2BTO A;  2HRU A;  3KIZ A;  1N8R H;  3RYC A;  3L7Q A;  4G4Y A;  4YJ2 A;  1TUB B;  2K1S A;  3VCZ A;  1W3E X;  4ERH A;  3LWQ C;  4RHA A;  1TVK A;  1W5A A;  3WGL A;  3C9T A;  3MQW A;  1UI9 A;  4EI9 A;  3MCQ A;  4X1Y B;  1T0K B;  3SIU A;  3VOB A;  3RYH B;  1ODE A;  3F0G A;  4BVQ A;  3HWU A;  4YJ3 B;  4PWT A;  2P6Y A;  2UYN A;  4BT7 A;  2CSL A;  5AVM A;  4G4V A;  3CC4 F;  3P4E A;  5HXU A;  3WGM A;  3VMF B;  4O4I A;  3KE1 A;  1TUB A;  4TZZ A;  1VQM F;  3NMU C; 
#chains in the Genus database with same CATH homology
 1U40 A;  3Q8H A;  1KNK A;  1VHA A;  4C8E A;  1KNJ A;  2UZH A;  3IEW A;  1GX1 A;  1U43 A;  3F0E A;  3F0F A;  2PMP A;  3IKE A;  1JY8 A;  1H47 A;  1H48 A;  3EOR A;  1JN1 A;  1IV4 A;  3IEQ A;  1IV2 A;  3K2X A;  1YQN A;  3FBA A;  1U3L A;  1IV3 A;  3JVH A;  4C82 A;  4C81 A;  3IKF A;  3F0G A;  3P0Z A;  2GZL A;  3P10 A;  5B8F A;  3FPI A;  3QHD A;  4C8I A;  3F0D A;  3RE3 A;  3MBM A;  3T80 A;  1W57 A;  1VH8 A;  3B6N A;  3K14 A;  4C8G A;  2AMT A;  1IV1 A;  3ERN A;  1T0A A;  3GHZ A;  3F6M A;  3ELC A;  3KE1 A;  1W55 A;  1U3P A;  3ESJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...