3OONA

The structure of an outer membrance protein from borrelia burgdorferi b31
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
113
Chain Sequence
NAAIEVEKNNKGINLSFDIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNILIEGHTEQFGLEEEMHELSEKRARAIGNYLIKMKVKDKDQILFKGWGSQKAKNRRVEITILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of an outer membrance protein from Borrelia burgdorferi B31
rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
molecule keywords Outer membrane protein (Tpn50)
total genus 36
structure length 113
sequence length 123
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3oonA00
4ZHWA 4RHAA 2ZVZA 3WPWA 2W8BC 2K1SA 4G4VA 3TD4A 4PWTA 4ERHA 2LBTA 3WPXA 3KHNA 4ZHVA 3S0WA 3LDTA 3TD5A 1R1MA 4B5CA 5EB0A 4ZHYB 3TD3A 2L26A 3CYPB 3S03A 2ZF8A 2AIZP 4B62A 3IMPA 2ZVYA 3CYQA 4G4ZA 3S0HA 4G88A 3S0YA 3OONA 1OAPA 4G4YA 3S06A 5EB1B 2KGWA 2LCAA 5EAZA 4G4WA 2HQSC 2MQEA 4G4XA 4R40B 2N48A 3S02A 2ZOVA
chains in the Genus database with same CATH superfamily
4F6RB 1YGYA 2QTPA 1QU9A 3BYQA 3CC2F 2OZBA 1VH8A 4C8EA 5FLXM 5BMVA 3ZP7A 1K8AH 3F0EA 4C82A 3HKCB 5KX5B 2IQQA 3N2KA 3RE3A 4EI9A 1QD9A 3JAKB 5A2QM 1X7PA 4O4LA 1YJ9F 2KTVA 3VYUC 2Q1XA 1Z5VA 1Q82H 2HP3A 4DRXB 3CMEF 3RA5A 3HKEA 3P10A 1DBFA 4B46A 3G6EF 4ZOLA 1W41A 3JARB 1Q8RA 3F0FA 2V9YA 1IV1A 4BW0B 1VQLF 1XBIA 2IAFA 3WPXA 3ZP4A 1J7HA 2RHJA 3RYCB 3CC7F 1VQVA 2Z1EA 4I55B 3WJQA 1U40A 4FFBB 4YJ3B 2UYKA 4X3MA 5HP7A 1W5AA 2CVLA 5C8YB 3N2KB 1FSZA 4KWEA 3LYBA 3MCQA 3KIZA 3OONA 4YJ2A 5KMGA 2OTJF 3J80M 4IIJA 2UZHA 4BVRA 3RYCA 5LXTB 3MDOA 4XCQA 3CCQF 2VAPA 1RQ7A 3KHNA 5LOVB 4O4HA 4O2AA 1SZQA 3SIVA 3CC4F 3DDNA 4O2AB 2H8EA 1JFFA 1Q81H 3LFOA 3M84A 3NMUC 1M1KH 2LCAA 3KE1A 5EAZA 3V7QA 1X7OA 3Q8HA 3S02A 5J2TB 4RHAA 3J81M 4DXDA 5KMGB 3G71F 1KD1H 2K1SA 5IJ9A 3QHDA 3VYSC 2BTUA 2CW4A 3CG6A 3N2GA 3WGJA 2OHWA 5IJ0B 3CCRF 1XHOA 3CD6F 3MBMA 3UT5B 4O4IA 3CYPB 4EB6B 1M90H 1FFXB 2FGYA 1X52A 3VOBA 3RYFB 3QTYA 3PAFA 1TVKA 3S0HA 3CCMF 2UYJA 5LP6C 5GONB 4WBNB 1W581 1DT9A 4G4YA 5JQGA 5MN4A 1YQNA 5GAPK 4YJ2B 4LCKA 1GZ0A 1JD1A 5GINC 4EI8A 4G4VA 5J2UB 5HP8A 2ZODA 1FNJA 3KJJA 3S0WA 3NK7A 3RYHB 4B5CA 4NQ3A 3TD3A 3CXCF 5GIPC 2G9IA 3HTNA 4TZZA 3LWOC 2JNBA 5G4VC 1S72F 3LWQC 4EI7A 5JH7A 1NJIH 3IEQA 1CLIA 1TVKB 4X20B 2I6RA 1X25A 2CHSA 4IHJA 3EORA 3IR9A 5CB4B 4LNUA 1T0AA 5EIBC 1K9MH 3I55F 3IKFA 5CA0B 1E7KA 2HRUA 2QA4F 4X1IA 1OFUA 1VQKF 3RYFA 2R751 3ZO8A 5LXTA 2Z1UA 1YHQF 1VQMF 1FFXA 5LYJA 1VQ4F 1RLUA 4U3JB 1VQ7F 1SDSA 1H48A 5J2UA 3CCLF 1VQOF 5IYZA 4G4XA 4R40B 3CPWF 1COMA 3RYIB 4NUTA 3HWUA 1JJ2F 1ODEA 1TUBA 1N8RH 3E20B 2RHHA 3K12A 3RYIA 4PWTA 3TD4A 3ERNA 3V3TA 4ERHA 3CCUF 1RA4A 4RQOA 1NQ3A 2BTQB 2UYNA 3MCAB 3CB2A 4BT6A 4B45A 3WXMB 3WJPA 3KJKA 2B33A 2H8CA 3UT5A 4ZHQA 3R0PA 3JALB 4BT2A 3C9TA 4TUYB 1U3PA 4X3LA 5EYPB 2HS3A 4BT4A 4DRXA 2GLZA 2HQSC 2P6YA 1GO1A 3FD6A 3VMFB 1YJWF 3JALA 1T0KB 3GTZA 4C8GA 4X1YB 4C81A 5IT9M 2YYEA 1ZWZA 5CA1B 2CWJA 3LWRC 3E1YA 3CMAF 1UI9A 2AIFA 1YITF 4B62A 3K14A 2YXZA 3HJWC 2ZVYA 3HKDA 3JASB 5HY1A 1PF5A 2DT4A 4F6RA 1W5EA 4I55A 2KGWA 3CPQA 5LYJB 3M1XA 5G4UC 3JAWB 1UFYA 2F9ZC 5HWEA 3B6NA 2LBXA 1W42A 3C9SA 3D01A 4U39A 4ZHVA 3HKCA 5B8FA 4BT7A 1U43A 5EB0A 2H6LA 2HS4A 3ESJA 4C4WC 1W57A 1VQ8F 4YJ3A 1W3EX 3P4EA 3GYQA 4O2BA 5EIBD 4G4ZA 3S0YA 1NMUB 2BO1A 1KQSF 2R6R1 4BVQA 5KX5A 3M4SA 5MN5A 1Z5WA 2W8BC 3JATA 3ELCA 3HKEB 2LBWA 3JAWA 1R1MA 4BT5A 3RYHA 4HNAA 3J7AR 2GZLA 2UYNB 3IEWA 1JFFB 5IJ0A 4G88A 2HX0A 2I6DA 5JVDB 2AMTA 3RA6A 3V4DA 3WJRA 4FFBA 3I7TA 3D54A 5J2TA 1W2BF 1VK3A 2N48A 4U3JA 3OBWA 3D00A 1KNKA 5ITZA 3VOAA 3HAXD 2HP0A 3K2XA 2ZAUA 5EWRA 3HKDB 3JASA 2GVIA 3JATB 3E22B 3HKBA 3N2GB 2L26A 1IPAA 4C8IA 3E22A 1U3LA 2Z1FA 4TV8B 2VAMA 4BY9D 3NVKE 4BVSA 3N4YA 5LP6A 3MQWA 5CA1A 1W40A 3DC2A 4O4LB 1RQ2A 4O2BB 2CSLA 2HVYD 2KG4A 2MQEA 3FBAA 4ZHWA 3WPWA 2RB9A 1Q7YH 4ZOLB 4E6EA 2LBTA 1CN7A 3I56F 3NK6A 5C8YA 3HKBB 3G4SF 3WGLA 5EO3A 3LMEA 4BVTA 5JCOA 1GO0A 2FC3A 2PHNA 2QEXF 4IIJB 3CCVF 3VYTC 1SA0B 1RLGA 5AVMA 4M8IA 3AGKA 5EZYA 1PXWA 2ZOVA 3WGNA 2PMPA 1GX1A 1JY8A 1SA0A 4O4JA 4ZI7A 2IG8A 1H7MA 4X1KB 3VCZA 5GANK 1CK2A 1QAHA 4I50A 2ALEA 2NMUA 1XV2A 1VQPF 3LWPC 3OW2F 3F6MA 3JCMM 4I4TB 4ZHYB 4TV9B 1ONIA 3S03A 1VQ9F 3I3FA 3JAMM 3IMPA 4LNUB 2OTMA 3F0DA 5HY2A 3JVHA 1OAPA 1QVGF 3C9UA 2KTUA 5GONA 4WBNA 1K73H 3PLAC 4IHJB 5JCOC 5LA6B 3LWVC 5GIOC 2OTLF 2ZVZA 5FNVA 4O4IB 2WALA 4O4JB 4ZI7B 1H47A 3JAKA 3VO8A 2VGMA 3C9RA 3T80A 3WGMA 2HS0A 3U0OA 5BMVB 4O4HB 5IJ9B 4NWOB 5HXZA 1IV2A 2AIZP 4ZHQB 5JQGB 2QI2A 3CCEF 1VQ6F 3CYQA 3FFMA 4I4TA 1YJNF 1KNJA 5MN6A 1JN1A 3OBYA 1KC8H 5FJ4C 1W59A 5CA0A 3WGKA 2VAWA 5HXUA 2VXYA 1VHAA 2DYYA 1Q86H 2BTOA 4ZK7A 1TUBB 5EYPA 2CZWA 3FD5A 5CB4A 1IV3A 2HRYA 2RHOA 1VQ5F 3V7EA 3QUWA 3TD5A 3C8LA 5LOVA 1W5BA 5FNVB 2VGNA 2Z01A 4HNAB 1YI2F 4X20A 3ZOPA 4BT3A 1W5FA 2ZF8A 4X1YA 2Q1YA 4EB6A 3ON1A 5JH7B 3VI6A 3CCSF 1W55A 2Z1TA 3VTIC 1FNKA 3JARA 3VIUA 3S06A 2CHTA 5EB1B 2RHLA 4TUYA 3O85A 3IKEA 3GHZA 3CCJF 5HY4A 2HP0B 3SIUA 1QVFF 5LA6A 3L7QA 3LDTA 4X1IB 5HY0A 1YIJF 5LP6B 3N4ZA 1IV4A 3F0GA 4TV8A 5DCVA 2EWCA 5EZYB 3P0ZA 5JVDA 1VQNF 2UYPA 3FPIA 3NVIB 5IYZB 4TV9A 3K0TA 4I50B 4G4WA 5ITZB 4X1KA 1XRGA
chains in the Genus database with same CATH topology
4ZHWA 4RHAA 2ZVZA 3WPWA 2W8BC 2K1SA 4G4VA 3TD4A 4PWTA 4ERHA 2LBTA 3WPXA 3KHNA 4ZHVA 3S0WA 3LDTA 3TD5A 1R1MA 4B5CA 5EB0A 4ZHYB 3TD3A 2L26A 3CYPB 3S03A 2ZF8A 2AIZP 4B62A 3IMPA 2ZVYA 3CYQA 4G4ZA 3S0HA 4G88A 3S0YA 3OONA 1OAPA 4G4YA 3S06A 5EB1B 2KGWA 2LCAA 5EAZA 4G4WA 2HQSC 2MQEA 4G4XA 4R40B 2N48A 3S02A 2ZOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHW A;  4RHA A;  2ZVZ A;  3WPW A;  2W8B C;  2K1S A;  4G4V A;  3TD4 A;  4PWT A;  4ERH A;  2LBT A;  3WPX A;  3KHN A;  4ZHV A;  3S0W A;  3LDT A;  3TD5 A;  1R1M A;  4B5C A;  5EB0 A;  4ZHY B;  3TD3 A;  2L26 A;  3CYP B;  3S03 A;  2ZF8 A;  2AIZ P;  4B62 A;  3IMP A;  2ZVY A;  3CYQ A;  4G4Z A;  3S0H A;  4G88 A;  3S0Y A;  3OON A;  1OAP A;  4G4Y A;  3S06 A;  5EB1 B;  2KGW A;  2LCA A;  5EAZ A;  4G4W A;  2HQS C;  2MQE A;  4G4X A;  4R40 B;  2N48 A;  3S02 A;  2ZOV A; 
#chains in the Genus database with same CATH topology
 4F6R B;  1YGY A;  2QTP A;  1QU9 A;  3BYQ A;  3CC2 F;  2OZB A;  1VH8 A;  4C8E A;  5FLX M;  5BMV A;  3ZP7 A;  1K8A H;  3F0E A;  4C82 A;  3HKC B;  5KX5 B;  2IQQ A;  3N2K A;  3RE3 A;  4EI9 A;  1QD9 A;  3JAK B;  5A2Q M;  1X7P A;  4O4L A;  1YJ9 F;  2KTV A;  3VYU C;  2Q1X A;  1Z5V A;  1Q82 H;  2HP3 A;  4DRX B;  3CME F;  3RA5 A;  3HKE A;  3P10 A;  1DBF A;  4B46 A;  3G6E F;  4ZOL A;  1W41 A;  3JAR B;  1Q8R A;  3F0F A;  2V9Y A;  1IV1 A;  4BW0 B;  1VQL F;  1XBI A;  2IAF A;  3WPX A;  3ZP4 A;  1J7H A;  2RHJ A;  3RYC B;  3CC7 F;  1VQV A;  2Z1E A;  4I55 B;  3WJQ A;  1U40 A;  4FFB B;  4YJ3 B;  2UYK A;  4X3M A;  5HP7 A;  1W5A A;  2CVL A;  5C8Y B;  3N2K B;  1FSZ A;  4KWE A;  3LYB A;  3MCQ A;  3KIZ A;  3OON A;  4YJ2 A;  5KMG A;  2OTJ F;  3J80 M;  4IIJ A;  2UZH A;  4BVR A;  3RYC A;  5LXT B;  3MDO A;  4XCQ A;  3CCQ F;  2VAP A;  1RQ7 A;  3KHN A;  5LOV B;  4O4H A;  4O2A A;  1SZQ A;  3SIV A;  3CC4 F;  3DDN A;  4O2A B;  2H8E A;  1JFF A;  1Q81 H;  3LFO A;  3M84 A;  3NMU C;  1M1K H;  2LCA A;  3KE1 A;  5EAZ A;  3V7Q A;  1X7O A;  3Q8H A;  3S02 A;  5J2T B;  4RHA A;  3J81 M;  4DXD A;  5KMG B;  3G71 F;  1KD1 H;  2K1S A;  5IJ9 A;  3QHD A;  3VYS C;  2BTU A;  2CW4 A;  3CG6 A;  3N2G A;  3WGJ A;  2OHW A;  5IJ0 B;  3CCR F;  1XHO A;  3CD6 F;  3MBM A;  3UT5 B;  4O4I A;  3CYP B;  4EB6 B;  1M90 H;  1FFX B;  2FGY A;  1X52 A;  3VOB A;  3RYF B;  3QTY A;  3PAF A;  1TVK A;  3S0H A;  3CCM F;  2UYJ A;  5LP6 C;  5GON B;  4WBN B;  1W58 1;  1DT9 A;  4G4Y A;  5JQG A;  5MN4 A;  1YQN A;  5GAP K;  4YJ2 B;  4LCK A;  1GZ0 A;  1JD1 A;  5GIN C;  4EI8 A;  4G4V A;  5J2U B;  5HP8 A;  2ZOD A;  1FNJ A;  3KJJ A;  3S0W A;  3NK7 A;  3RYH B;  4B5C A;  4NQ3 A;  3TD3 A;  3CXC F;  5GIP C;  2G9I A;  3HTN A;  4TZZ A;  3LWO C;  2JNB A;  5G4V C;  1S72 F;  3LWQ C;  4EI7 A;  5JH7 A;  1NJI H;  3IEQ A;  1CLI A;  1TVK B;  4X20 B;  2I6R A;  1X25 A;  2CHS A;  4IHJ A;  3EOR A;  3IR9 A;  5CB4 B;  4LNU A;  1T0A A;  5EIB C;  1K9M H;  3I55 F;  3IKF A;  5CA0 B;  1E7K A;  2HRU A;  2QA4 F;  4X1I A;  1OFU A;  1VQK F;  3RYF A;  2R75 1;  3ZO8 A;  5LXT A;  2Z1U A;  1YHQ F;  1VQM F;  1FFX A;  5LYJ A;  1VQ4 F;  1RLU A;  4U3J B;  1VQ7 F;  1SDS A;  1H48 A;  5J2U A;  3CCL F;  1VQO F;  5IYZ A;  4G4X A;  4R40 B;  3CPW F;  1COM A;  3RYI B;  4NUT A;  3HWU A;  1JJ2 F;  1ODE A;  1TUB A;  1N8R H;  3E20 B;  2RHH A;  3K12 A;  3RYI A;  4PWT A;  3TD4 A;  3ERN A;  3V3T A;  4ERH A;  3CCU F;  1RA4 A;  4RQO A;  1NQ3 A;  2BTQ B;  2UYN A;  3MCA B;  3CB2 A;  4BT6 A;  4B45 A;  3WXM B;  3WJP A;  3KJK A;  2B33 A;  2H8C A;  3UT5 A;  4ZHQ A;  3R0P A;  3JAL B;  4BT2 A;  3C9T A;  4TUY B;  1U3P A;  4X3L A;  5EYP B;  2HS3 A;  4BT4 A;  4DRX A;  2GLZ A;  2HQS C;  2P6Y A;  1GO1 A;  3FD6 A;  3VMF B;  1YJW F;  3JAL A;  1T0K B;  3GTZ A;  4C8G A;  4X1Y B;  4C81 A;  5IT9 M;  2YYE A;  1ZWZ A;  5CA1 B;  2CWJ A;  3LWR C;  3E1Y A;  3CMA F;  1UI9 A;  2AIF A;  1YIT F;  4B62 A;  3K14 A;  2YXZ A;  3HJW C;  2ZVY A;  3HKD A;  3JAS B;  5HY1 A;  1PF5 A;  2DT4 A;  4F6R A;  1W5E A;  4I55 A;  2KGW A;  3CPQ A;  5LYJ B;  3M1X A;  5G4U C;  3JAW B;  1UFY A;  2F9Z C;  5HWE A;  3B6N A;  2LBX A;  1W42 A;  3C9S A;  3D01 A;  4U39 A;  4ZHV A;  3HKC A;  5B8F A;  4BT7 A;  1U43 A;  5EB0 A;  2H6L A;  2HS4 A;  3ESJ A;  4C4W C;  1W57 A;  1VQ8 F;  4YJ3 A;  1W3E X;  3P4E A;  3GYQ A;  4O2B A;  5EIB D;  4G4Z A;  3S0Y A;  1NMU B;  2BO1 A;  1KQS F;  2R6R 1;  4BVQ A;  5KX5 A;  3M4S A;  5MN5 A;  1Z5W A;  2W8B C;  3JAT A;  3ELC A;  3HKE B;  2LBW A;  3JAW A;  1R1M A;  4BT5 A;  3RYH A;  4HNA A;  3J7A R;  2GZL A;  2UYN B;  3IEW A;  1JFF B;  5IJ0 A;  4G88 A;  2HX0 A;  2I6D A;  5JVD B;  2AMT A;  3RA6 A;  3V4D A;  3WJR A;  4FFB A;  3I7T A;  3D54 A;  5J2T A;  1W2B F;  1VK3 A;  2N48 A;  4U3J A;  3OBW A;  3D00 A;  1KNK A;  5ITZ A;  3VOA A;  3HAX D;  2HP0 A;  3K2X A;  2ZAU A;  5EWR A;  3HKD B;  3JAS A;  2GVI A;  3JAT B;  3E22 B;  3HKB A;  3N2G B;  2L26 A;  1IPA A;  4C8I A;  3E22 A;  1U3L A;  2Z1F A;  4TV8 B;  2VAM A;  4BY9 D;  3NVK E;  4BVS A;  3N4Y A;  5LP6 A;  3MQW A;  5CA1 A;  1W40 A;  3DC2 A;  4O4L B;  1RQ2 A;  4O2B B;  2CSL A;  2HVY D;  2KG4 A;  2MQE A;  3FBA A;  4ZHW A;  3WPW A;  2RB9 A;  1Q7Y H;  4ZOL B;  4E6E A;  2LBT A;  1CN7 A;  3I56 F;  3NK6 A;  5C8Y A;  3HKB B;  3G4S F;  3WGL A;  5EO3 A;  3LME A;  4BVT A;  5JCO A;  1GO0 A;  2FC3 A;  2PHN A;  2QEX F;  4IIJ B;  3CCV F;  3VYT C;  1SA0 B;  1RLG A;  5AVM A;  4M8I A;  3AGK A;  5EZY A;  1PXW A;  2ZOV A;  3WGN A;  2PMP A;  1GX1 A;  1JY8 A;  1SA0 A;  4O4J A;  4ZI7 A;  2IG8 A;  1H7M A;  4X1K B;  3VCZ A;  5GAN K;  1CK2 A;  1QAH A;  4I50 A;  2ALE A;  2NMU A;  1XV2 A;  1VQP F;  3LWP C;  3OW2 F;  3F6M A;  3JCM M;  4I4T B;  4ZHY B;  4TV9 B;  1ONI A;  3S03 A;  1VQ9 F;  3I3F A;  3JAM M;  3IMP A;  4LNU B;  2OTM A;  3F0D A;  5HY2 A;  3JVH A;  1OAP A;  1QVG F;  3C9U A;  2KTU A;  5GON A;  4WBN A;  1K73 H;  3PLA C;  4IHJ B;  5JCO C;  5LA6 B;  3LWV C;  5GIO C;  2OTL F;  2ZVZ A;  5FNV A;  4O4I B;  2WAL A;  4O4J B;  4ZI7 B;  1H47 A;  3JAK A;  3VO8 A;  2VGM A;  3C9R A;  3T80 A;  3WGM A;  2HS0 A;  3U0O A;  5BMV B;  4O4H B;  5IJ9 B;  4NWO B;  5HXZ A;  1IV2 A;  2AIZ P;  4ZHQ B;  5JQG B;  2QI2 A;  3CCE F;  1VQ6 F;  3CYQ A;  3FFM A;  4I4T A;  1YJN F;  1KNJ A;  5MN6 A;  1JN1 A;  3OBY A;  1KC8 H;  5FJ4 C;  1W59 A;  5CA0 A;  3WGK A;  2VAW A;  5HXU A;  2VXY A;  1VHA A;  2DYY A;  1Q86 H;  2BTO A;  4ZK7 A;  1TUB B;  5EYP A;  2CZW A;  3FD5 A;  5CB4 A;  1IV3 A;  2HRY A;  2RHO A;  1VQ5 F;  3V7E A;  3QUW A;  3TD5 A;  3C8L A;  5LOV A;  1W5B A;  5FNV B;  2VGN A;  2Z01 A;  4HNA B;  1YI2 F;  4X20 A;  3ZOP A;  4BT3 A;  1W5F A;  2ZF8 A;  4X1Y A;  2Q1Y A;  4EB6 A;  3ON1 A;  5JH7 B;  3VI6 A;  3CCS F;  1W55 A;  2Z1T A;  3VTI C;  1FNK A;  3JAR A;  3VIU A;  3S06 A;  2CHT A;  5EB1 B;  2RHL A;  4TUY A;  3O85 A;  3IKE A;  3GHZ A;  3CCJ F;  5HY4 A;  2HP0 B;  3SIU A;  1QVF F;  5LA6 A;  3L7Q A;  3LDT A;  4X1I B;  5HY0 A;  1YIJ F;  5LP6 B;  3N4Z A;  1IV4 A;  3F0G A;  4TV8 A;  5DCV A;  2EWC A;  5EZY B;  3P0Z A;  5JVD A;  1VQN F;  2UYP A;  3FPI A;  3NVI B;  5IYZ B;  4TV9 A;  3K0T A;  4I50 B;  4G4W A;  5ITZ B;  4X1K A;  1XRG A; 
#chains in the Genus database with same CATH homology
 4ZHW A;  4RHA A;  2ZVZ A;  3WPW A;  2W8B C;  2K1S A;  4G4V A;  3TD4 A;  4PWT A;  4ERH A;  2LBT A;  3WPX A;  3KHN A;  4ZHV A;  3S0W A;  3LDT A;  3TD5 A;  1R1M A;  4B5C A;  5EB0 A;  4ZHY B;  3TD3 A;  2L26 A;  3CYP B;  3S03 A;  2ZF8 A;  2AIZ P;  4B62 A;  3IMP A;  2ZVY A;  3CYQ A;  4G4Z A;  3S0H A;  4G88 A;  3S0Y A;  3OON A;  1OAP A;  4G4Y A;  3S06 A;  5EB1 B;  2KGW A;  2LCA A;  5EAZ A;  4G4W A;  2HQS C;  2MQE A;  4G4X A;  4R40 B;  2N48 A;  3S02 A;  2ZOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...