3OONA

The structure of an outer membrance protein from borrelia burgdorferi b31
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
113
Chain Sequence
NAAIEVEKNNKGINLSFDIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNILIEGHTEQFGLEEEMHELSEKRARAIGNYLIKMKVKDKDQILFKGWGSQKAKNRRVEITILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein (Tpn50)
publication title The structure of an outer membrance protein from Borrelia burgdorferi B31
rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 36
structure length 113
sequence length 123
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3oonA00
2ZVZA 3LDTA 4ERHA 2MQEA 2KGWA 5EB1B 4ZHWA 4G88A 3S06A 2AIZP 2ZOVA 2HQSC 2ZF8A 3TD5A 4B62A 4PWTA 4G4WA 3TD4A 3IMPA 4G4ZA 2N48A 4G4YA 3CYPB 3KHNA 3WPWA 2LCAA 2W8BC 5EAZA 2K1SA 3S02A 2LBTA 2L26A 4RHAA 4G4VA 3WPXA 3S0HA 4ZHYB 4ZHVA 4B5CA 1OAPA 3OONA 3TD3A 5EB0A 3S0WA 1R1MA 3S0YA 4G4XA 4R40B 3CYQA 2ZVYA 3S03A
chains in the Genus database with same CATH superfamily
1QU9A 1VQKF 3FFMA 1H7MA 4G88A 4C81A 1PF5A 1KC8H 3S06A 3JAWB 4I4TA 4BT5A 5LP6A 1TUBB 1W57A 4RQOA 2UYKA 2KG4A 3G71F 5IJ9A 2KTUA 3DC2A 5B8FA 3NMUC 2RHOA 1GO1A 3MDOA 1UI9A 1OFUA 2UZHA 3IEQA 3OONA 1ODEA 1H48A 3JAKA 4TUYA 1U43A 5JVDA 5FNVA 1E7KA 1QVFF 3JALB 2HQSC 2RHHA 2F9ZC 3FBAA 3WGMA 1VQPF 1W40A 4TV9A 4O4LA 1N8RH 4BVQA 1YJWF 1VQ9F 5GIOC 3WXMB 2UYJA 1CN7A 3CYPB 3KHNA 3QHDA 4YJ3B 3JAWA 3VOBA 1TUBA 2HP0B 4X20A 4O4JB 2OTMA 3D01A 1U3PA 3E1YA 3WGJA 5EIBD 1KD1H 3G6EF 3GTZA 5J2UA 3N2GA 3HKEB 3G4SF 4ERHA 3JASA 1Q86H 3HKCA 5EB1B 5HWEA 4X1KA 3F0DA 2HS3A 5LP6C 3M4SA 4PWTA 3I55F 5FJ4C 2RHJA 4U3JB 3UT5A 2VXYA 3J7AR 3P0ZA 2RB9A 1CLIA 3CCVF 4XCQA 3JALA 3B6NA 2LBTA 1SZQA 2H8EA 3S0HA 4BT6A 3U0OA 4NWOB 2ZAUA 1R1MA 4X3MA 3I7TA 2IQQA 1VQ4F 5JCOA 3D00A 1YITF 4X1IA 4YJ2B 5ITZA 2HP0A 3HAXD 3NVIB 4F6RB 3KE1A 3ELCA 2HVYD 1M1KH 1X25A 3VCZA 3KJJA 5A2QM 2H8CA 3CXCF 3HKEA 2Z01A 3O85A 4EI9A 2BTUA 4O2BA 3I3FA 4ZHQA 2I6RA 3MCAB 1XBIA 5GINC 3WGNA 3GHZA 3N4ZA 4G4XA 4R40B 5LP6B 5HXUA 1X7PA 1QD9A 1W59A 3J81M 3J80M 5IJ9B 2VAWA 3F0FA 2LBWA 4TV8A 3ERNA 5C8YA 1W3EX 3VYSC 3RYIB 3IMPA 1VQ8F 2PHNA 3CD6F 1Q8RA 4F6RA 4I55A 4C8GA 1S72F 1FNKA 3M84A 2Q1YA 3CG6A 3JAKB 4TUYB 4ZK7A 5JVDB 5CA0B 4BT3A 3ZP7A 1OAPA 1VK3A 5FNVB 2GZLA 4EI8A 5JCOC 4O4LB 5LYJA 3JARB 2UYPA 1Z5VA 4ZI7B 2ZOVA 3F0GA 3LYBA 4BY9D 4FFBA 3RYFA 5KX5B 4X20B 5HY0A 3CCQF 5KMGA 3CCMF 1W5AA 2W8BC 3IKFA 5J2UB 2VAPA 1RQ7A 5HXZA 3N2GB 2IG8A 4RHAA 3JASB 2QI2A 3HKCB 3LFOA 4X1KB 3RE3A 3RYIA 1YIJF 3VMFB 2FC3A 3JVHA 3WJRA 3UT5B 2H6LA 1U40A 5CA0A 4TZZA 2CHTA 3JAMM 2DT4A 5EIBC 5GIPC 1Z5WA 3OBYA 4B62A 2BTOA 3FD5A 1QAHA 3D54A 1VQNF 3KJKA 2VAMA 1DT9A 2I6DA 4I50A 5AVMA 3K0TA 4O2AA 5J2TB 1YHQF 2G9IA 3PLAC 2LBXA 4G4YA 3JARA 1JN1A 4ZI7A 2CZWA 5HY1A 4X1IB 1GX1A 5ITZB 5EZYB 5KX5A 5HP8A 3WGKA 2CWJA 2BO1A 2QA4F 2ZVYA 1VQ6F 1W2BF 3MBMA 2BTQB 4WBNB 3ZOPA 4ZHWA 1NJIH 4O2BB 1JY8A 4ZHQB 3N2KA 3LWQC 1IPAA 1NMUB 4BT7A 3MCQA 1H47A 4M8IA 2AMTA 4NQ3A 2JNBA 2N48A 5MN4A 4X1YA 3WPWA 3JATA 3C9SA 4EB6B 1K8AH 1W5EA 3HWUA 4B5CA 1VQ7F 1FNJA 1Q82H 3TD3A 3F0EA 5J2TA 4TV8B 5C8YB 2UYNA 1GO0A 3E20B 3JCMM 2CVLA 3BYQA 4C82A 1SDSA 5EZYA 2QEXF 4I55B 5HY4A 1RLGA 4BVRA 3ZP4A 1SA0A 1K73H 1YJNF 3VYTC 5EO3A 3TD4A 4BW0B 3FD6A 4WBNA 1VQOF 2HX0A 5MN5A 4EI7A 3HKDB 2LCAA 2PMPA 2K1SA 2Q1XA 3LMEA 5LYJB 3NK6A 5IT9M 1M90H 4X3LA 2Z1FA 5JQGA 4NUTA 2Z1UA 4FFBB 3PAFA 4HNAB 3RYFB 1W5BA 2HS0A 3DDNA 2ZVZA 4EB6A 2OZBA 3OBWA 5KMGB 5LA6B 1FSZA 4C4WC 3TD5A 3HKBA 3VIUA 3CCSF 2QTPA 1K9MH 3WGLA 1VQVA 5GAPK 3N4YA 2HS4A 3C9UA 3VO8A 1RQ2A 4DRXA 2L26A 5CB4B 3IEWA 1KNKA 2DYYA 3HKDA 3K14A 4I50B 4O2AB 3CPQA 1JFFB 3K12A 1W581 5JH7B 3P4EA 3C9TA 3P10A 1DBFA 4BT4A 2B33A 2CHSA 5DCVA 4HNAA 2HRYA 3FPIA 4G4ZA 3V4DA 3ZO8A 1T0KB 5LA6A 3KIZA 1ONIA 3WPXA 3HTNA 4ZHYB 4DXDA 2ZODA 5IYZA 4LNUA 1XRGA 3N2KB 1VQLF 1CK2A 3R0PA 3C8LA 4O4HB 5CB4A 2OTLF 4X1YB 3JATB 2ZF8A 3Q8HA 5G4UC 5FLXM 1NQ3A 1VHAA 3IKEA 1IV1A 2FGYA 3LWVC 3K2XA 1JFFA 4B45A 1IV2A 2VGNA 5EAZA 5JH7A 3AGKA 3IR9A 3S02A 1W5FA 2UYNB 3CCLF 2HRUA 2ALEA 4IIJB 3RA5A 4LCKA 2HP3A 3CC7F 3NK7A 1TVKB 5EB0A 5LOVA 3S0YA 1SA0B 1XHOA 5BMVB 5GANK 3L7QA 1U3LA 3HJWC 1YGYA 1ZWZA 2AIZP 3QTYA 1JJ2F 3ON1A 1X52A 1VQ5F 4BVSA 5CA1B 1W55A 5HY2A 5IJ0B 3CCJF 4O4HA 4E6EA 5JQGB 3NVKE 2CSLA 2VGMA 5GONB 2YXZA 4G4VA 2V9YA 3MQWA 1J7HA 1XV2A 3VYUC 3V3TA 3S0WA 3HKBB 2NMUA 3F6MA 3QUWA 3CMEF 1RA4A 3RYHB 4ZOLB 3CCEF 3GYQA 4IIJA 1PXWA 1FFXB 5EYPB 1YJ9F 1YI2F 1T0AA 2EWCA 1TVKA 4DRXB 5MN6A 2AIFA 3T80A 5BMVA 4KWEA 3CCUF 3M1XA 2OTJF 3RA6A 3CC4F 2R751 1GZ0A 1IV3A 3SIVA 1IV4A 2R6R1 4ZHVA 3LWOC 3CC2F 1VQMF 4B46A 3CB2A 2RHLA 1YQNA 5CA1A 1Q7YH 5IJ0A 3CYQA 4O4IB 4YJ3A 3WJPA 1VH8A 2IAFA 2YYEA 5GONA 3LDTA 3RYCB 2MQEA 4O4JA 3I56F 3LWRC 4C8IA 3LWPC 1JD1A 3E22B 5LXTB 3RYHA 1COMA 4IHJB 4ZOLA 4C8EA 5IYZB 3ESJA 3V7EA 2GVIA 4LNUB 5HP7A 5EYPA 1FFXA 1W42A 3OW2F 2Z1TA 2P6YA 4U3JA 2WALA 2GLZA 1W41A 1QVGF 4I4TB 4BVTA 3EORA 1KNJA 3S03A 5G4VC 3V7QA 3VI6A 1X7OA 2KGWA 3SIUA 1UFYA 3WJQA 4G4WA 3CCRF 1KQSF 4O4IA 4BT2A 2OHWA 3VTIC 2CW4A 3RYCA 4YJ2A 1RLUA 1Q81H 5LOVB 4U39A 3VOAA 5EWRA 3CMAF 3E22A 5LXTA 4IHJA 3CPWF 3C9RA 2KTVA 4TV9B 2Z1EA
chains in the Genus database with same CATH topology
2ZVZA 3LDTA 4ERHA 2MQEA 2KGWA 5EB1B 4ZHWA 4G88A 3S06A 2AIZP 2ZOVA 2HQSC 2ZF8A 3TD5A 4B62A 4PWTA 4G4WA 3TD4A 3IMPA 4G4ZA 2N48A 4G4YA 3CYPB 3KHNA 3WPWA 2LCAA 2W8BC 5EAZA 2K1SA 3S02A 2LBTA 2L26A 4RHAA 4G4VA 3WPXA 3S0HA 4ZHYB 4ZHVA 4B5CA 1OAPA 3OONA 3TD3A 5EB0A 3S0WA 1R1MA 3S0YA 4G4XA 4R40B 3CYQA 2ZVYA 3S03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVZ A;  3LDT A;  4ERH A;  2MQE A;  2KGW A;  5EB1 B;  4ZHW A;  4G88 A;  3S06 A;  2AIZ P;  2ZOV A;  2HQS C;  2ZF8 A;  3TD5 A;  4B62 A;  4PWT A;  4G4W A;  3TD4 A;  3IMP A;  4G4Z A;  2N48 A;  4G4Y A;  3CYP B;  3KHN A;  3WPW A;  2LCA A;  2W8B C;  5EAZ A;  2K1S A;  3S02 A;  2LBT A;  2L26 A;  4RHA A;  4G4V A;  3WPX A;  3S0H A;  4ZHY B;  4ZHV A;  4B5C A;  1OAP A;  3OON A;  3TD3 A;  5EB0 A;  3S0W A;  1R1M A;  3S0Y A;  4G4X A;  4R40 B;  3CYQ A;  2ZVY A;  3S03 A; 
#chains in the Genus database with same CATH topology
 1QU9 A;  1VQK F;  3FFM A;  1H7M A;  4G88 A;  4C81 A;  1PF5 A;  1KC8 H;  3S06 A;  3JAW B;  4I4T A;  4BT5 A;  5LP6 A;  1TUB B;  1W57 A;  4RQO A;  2UYK A;  2KG4 A;  3G71 F;  5IJ9 A;  2KTU A;  3DC2 A;  5B8F A;  3NMU C;  2RHO A;  1GO1 A;  3MDO A;  1UI9 A;  1OFU A;  2UZH A;  3IEQ A;  3OON A;  1ODE A;  1H48 A;  3JAK A;  4TUY A;  1U43 A;  5JVD A;  5FNV A;  1E7K A;  1QVF F;  3JAL B;  2HQS C;  2RHH A;  2F9Z C;  3FBA A;  3WGM A;  1VQP F;  1W40 A;  4TV9 A;  4O4L A;  1N8R H;  4BVQ A;  1YJW F;  1VQ9 F;  5GIO C;  3WXM B;  2UYJ A;  1CN7 A;  3CYP B;  3KHN A;  3QHD A;  4YJ3 B;  3JAW A;  3VOB A;  1TUB A;  2HP0 B;  4X20 A;  4O4J B;  2OTM A;  3D01 A;  1U3P A;  3E1Y A;  3WGJ A;  5EIB D;  1KD1 H;  3G6E F;  3GTZ A;  5J2U A;  3N2G A;  3HKE B;  3G4S F;  4ERH A;  3JAS A;  1Q86 H;  3HKC A;  5EB1 B;  5HWE A;  4X1K A;  3F0D A;  2HS3 A;  5LP6 C;  3M4S A;  4PWT A;  3I55 F;  5FJ4 C;  2RHJ A;  4U3J B;  3UT5 A;  2VXY A;  3J7A R;  3P0Z A;  2RB9 A;  1CLI A;  3CCV F;  4XCQ A;  3JAL A;  3B6N A;  2LBT A;  1SZQ A;  2H8E A;  3S0H A;  4BT6 A;  3U0O A;  4NWO B;  2ZAU A;  1R1M A;  4X3M A;  3I7T A;  2IQQ A;  1VQ4 F;  5JCO A;  3D00 A;  1YIT F;  4X1I A;  4YJ2 B;  5ITZ A;  2HP0 A;  3HAX D;  3NVI B;  4F6R B;  3KE1 A;  3ELC A;  2HVY D;  1M1K H;  1X25 A;  3VCZ A;  3KJJ A;  5A2Q M;  2H8C A;  3CXC F;  3HKE A;  2Z01 A;  3O85 A;  4EI9 A;  2BTU A;  4O2B A;  3I3F A;  4ZHQ A;  2I6R A;  3MCA B;  1XBI A;  5GIN C;  3WGN A;  3GHZ A;  3N4Z A;  4G4X A;  4R40 B;  5LP6 B;  5HXU A;  1X7P A;  1QD9 A;  1W59 A;  3J81 M;  3J80 M;  5IJ9 B;  2VAW A;  3F0F A;  2LBW A;  4TV8 A;  3ERN A;  5C8Y A;  1W3E X;  3VYS C;  3RYI B;  3IMP A;  1VQ8 F;  2PHN A;  3CD6 F;  1Q8R A;  4F6R A;  4I55 A;  4C8G A;  1S72 F;  1FNK A;  3M84 A;  2Q1Y A;  3CG6 A;  3JAK B;  4TUY B;  4ZK7 A;  5JVD B;  5CA0 B;  4BT3 A;  3ZP7 A;  1OAP A;  1VK3 A;  5FNV B;  2GZL A;  4EI8 A;  5JCO C;  4O4L B;  5LYJ A;  3JAR B;  2UYP A;  1Z5V A;  4ZI7 B;  2ZOV A;  3F0G A;  3LYB A;  4BY9 D;  4FFB A;  3RYF A;  5KX5 B;  4X20 B;  5HY0 A;  3CCQ F;  5KMG A;  3CCM F;  1W5A A;  2W8B C;  3IKF A;  5J2U B;  2VAP A;  1RQ7 A;  5HXZ A;  3N2G B;  2IG8 A;  4RHA A;  3JAS B;  2QI2 A;  3HKC B;  3LFO A;  4X1K B;  3RE3 A;  3RYI A;  1YIJ F;  3VMF B;  2FC3 A;  3JVH A;  3WJR A;  3UT5 B;  2H6L A;  1U40 A;  5CA0 A;  4TZZ A;  2CHT A;  3JAM M;  2DT4 A;  5EIB C;  5GIP C;  1Z5W A;  3OBY A;  4B62 A;  2BTO A;  3FD5 A;  1QAH A;  3D54 A;  1VQN F;  3KJK A;  2VAM A;  1DT9 A;  2I6D A;  4I50 A;  5AVM A;  3K0T A;  4O2A A;  5J2T B;  1YHQ F;  2G9I A;  3PLA C;  2LBX A;  4G4Y A;  3JAR A;  1JN1 A;  4ZI7 A;  2CZW A;  5HY1 A;  4X1I B;  1GX1 A;  5ITZ B;  5EZY B;  5KX5 A;  5HP8 A;  3WGK A;  2CWJ A;  2BO1 A;  2QA4 F;  2ZVY A;  1VQ6 F;  1W2B F;  3MBM A;  2BTQ B;  4WBN B;  3ZOP A;  4ZHW A;  1NJI H;  4O2B B;  1JY8 A;  4ZHQ B;  3N2K A;  3LWQ C;  1IPA A;  1NMU B;  4BT7 A;  3MCQ A;  1H47 A;  4M8I A;  2AMT A;  4NQ3 A;  2JNB A;  2N48 A;  5MN4 A;  4X1Y A;  3WPW A;  3JAT A;  3C9S A;  4EB6 B;  1K8A H;  1W5E A;  3HWU A;  4B5C A;  1VQ7 F;  1FNJ A;  1Q82 H;  3TD3 A;  3F0E A;  5J2T A;  4TV8 B;  5C8Y B;  2UYN A;  1GO0 A;  3E20 B;  3JCM M;  2CVL A;  3BYQ A;  4C82 A;  1SDS A;  5EZY A;  2QEX F;  4I55 B;  5HY4 A;  1RLG A;  4BVR A;  3ZP4 A;  1SA0 A;  1K73 H;  1YJN F;  3VYT C;  5EO3 A;  3TD4 A;  4BW0 B;  3FD6 A;  4WBN A;  1VQO F;  2HX0 A;  5MN5 A;  4EI7 A;  3HKD B;  2LCA A;  2PMP A;  2K1S A;  2Q1X A;  3LME A;  5LYJ B;  3NK6 A;  5IT9 M;  1M90 H;  4X3L A;  2Z1F A;  5JQG A;  4NUT A;  2Z1U A;  4FFB B;  3PAF A;  4HNA B;  3RYF B;  1W5B A;  2HS0 A;  3DDN A;  2ZVZ A;  4EB6 A;  2OZB A;  3OBW A;  5KMG B;  5LA6 B;  1FSZ A;  4C4W C;  3TD5 A;  3HKB A;  3VIU A;  3CCS F;  2QTP A;  1K9M H;  3WGL A;  1VQV A;  5GAP K;  3N4Y A;  2HS4 A;  3C9U A;  3VO8 A;  1RQ2 A;  4DRX A;  2L26 A;  5CB4 B;  3IEW A;  1KNK A;  2DYY A;  3HKD A;  3K14 A;  4I50 B;  4O2A B;  3CPQ A;  1JFF B;  3K12 A;  1W58 1;  5JH7 B;  3P4E A;  3C9T A;  3P10 A;  1DBF A;  4BT4 A;  2B33 A;  2CHS A;  5DCV A;  4HNA A;  2HRY A;  3FPI A;  4G4Z A;  3V4D A;  3ZO8 A;  1T0K B;  5LA6 A;  3KIZ A;  1ONI A;  3WPX A;  3HTN A;  4ZHY B;  4DXD A;  2ZOD A;  5IYZ A;  4LNU A;  1XRG A;  3N2K B;  1VQL F;  1CK2 A;  3R0P A;  3C8L A;  4O4H B;  5CB4 A;  2OTL F;  4X1Y B;  3JAT B;  2ZF8 A;  3Q8H A;  5G4U C;  5FLX M;  1NQ3 A;  1VHA A;  3IKE A;  1IV1 A;  2FGY A;  3LWV C;  3K2X A;  1JFF A;  4B45 A;  1IV2 A;  2VGN A;  5EAZ A;  5JH7 A;  3AGK A;  3IR9 A;  3S02 A;  1W5F A;  2UYN B;  3CCL F;  2HRU A;  2ALE A;  4IIJ B;  3RA5 A;  4LCK A;  2HP3 A;  3CC7 F;  3NK7 A;  1TVK B;  5EB0 A;  5LOV A;  3S0Y A;  1SA0 B;  1XHO A;  5BMV B;  5GAN K;  3L7Q A;  1U3L A;  3HJW C;  1YGY A;  1ZWZ A;  2AIZ P;  3QTY A;  1JJ2 F;  3ON1 A;  1X52 A;  1VQ5 F;  4BVS A;  5CA1 B;  1W55 A;  5HY2 A;  5IJ0 B;  3CCJ F;  4O4H A;  4E6E A;  5JQG B;  3NVK E;  2CSL A;  2VGM A;  5GON B;  2YXZ A;  4G4V A;  2V9Y A;  3MQW A;  1J7H A;  1XV2 A;  3VYU C;  3V3T A;  3S0W A;  3HKB B;  2NMU A;  3F6M A;  3QUW A;  3CME F;  1RA4 A;  3RYH B;  4ZOL B;  3CCE F;  3GYQ A;  4IIJ A;  1PXW A;  1FFX B;  5EYP B;  1YJ9 F;  1YI2 F;  1T0A A;  2EWC A;  1TVK A;  4DRX B;  5MN6 A;  2AIF A;  3T80 A;  5BMV A;  4KWE A;  3CCU F;  3M1X A;  2OTJ F;  3RA6 A;  3CC4 F;  2R75 1;  1GZ0 A;  1IV3 A;  3SIV A;  1IV4 A;  2R6R 1;  4ZHV A;  3LWO C;  3CC2 F;  1VQM F;  4B46 A;  3CB2 A;  2RHL A;  1YQN A;  5CA1 A;  1Q7Y H;  5IJ0 A;  3CYQ A;  4O4I B;  4YJ3 A;  3WJP A;  1VH8 A;  2IAF A;  2YYE A;  5GON A;  3LDT A;  3RYC B;  2MQE A;  4O4J A;  3I56 F;  3LWR C;  4C8I A;  3LWP C;  1JD1 A;  3E22 B;  5LXT B;  3RYH A;  1COM A;  4IHJ B;  4ZOL A;  4C8E A;  5IYZ B;  3ESJ A;  3V7E A;  2GVI A;  4LNU B;  5HP7 A;  5EYP A;  1FFX A;  1W42 A;  3OW2 F;  2Z1T A;  2P6Y A;  4U3J A;  2WAL A;  2GLZ A;  1W41 A;  1QVG F;  4I4T B;  4BVT A;  3EOR A;  1KNJ A;  3S03 A;  5G4V C;  3V7Q A;  3VI6 A;  1X7O A;  2KGW A;  3SIU A;  1UFY A;  3WJQ A;  4G4W A;  3CCR F;  1KQS F;  4O4I A;  4BT2 A;  2OHW A;  3VTI C;  2CW4 A;  3RYC A;  4YJ2 A;  1RLU A;  1Q81 H;  5LOV B;  4U39 A;  3VOA A;  5EWR A;  3CMA F;  3E22 A;  5LXT A;  4IHJ A;  3CPW F;  3C9R A;  2KTV A;  4TV9 B;  2Z1E A; 
#chains in the Genus database with same CATH homology
 2ZVZ A;  3LDT A;  4ERH A;  2MQE A;  2KGW A;  5EB1 B;  4ZHW A;  4G88 A;  3S06 A;  2AIZ P;  2ZOV A;  2HQS C;  2ZF8 A;  3TD5 A;  4B62 A;  4PWT A;  4G4W A;  3TD4 A;  3IMP A;  4G4Z A;  2N48 A;  4G4Y A;  3CYP B;  3KHN A;  3WPW A;  2LCA A;  2W8B C;  5EAZ A;  2K1S A;  3S02 A;  2LBT A;  2L26 A;  4RHA A;  4G4V A;  3WPX A;  3S0H A;  4ZHY B;  4ZHV A;  4B5C A;  1OAP A;  3OON A;  3TD3 A;  5EB0 A;  3S0W A;  1R1M A;  3S0Y A;  4G4X A;  4R40 B;  3CYQ A;  2ZVY A;  3S03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...