3OONA

The structure of an outer membrance protein from borrelia burgdorferi b31
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
113
Chain Sequence
NAAIEVEKNNKGINLSFDIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNILIEGHTEQFGLEEEMHELSEKRARAIGNYLIKMKVKDKDQILFKGWGSQKAKNRRVEITILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Outer membrane protein (Tpn50)
publication title The structure of an outer membrance protein from Borrelia burgdorferi B31
rcsb
source organism Borrelia burgdorferi
total genus 36
structure length 113
sequence length 123
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3oonA00
3LDTA 3S0HA 3WPWA 5EB1B 1R1MA 2ZF8A 3CYPB 5EAZA 3WPXA 3S0YA 2K1SA 2ZOVA 2W8BC 5EB0A 3TD5A 3TD3A 3S03A 3OONA 2N48A 4G4WA 2ZVYA 3S02A 3CYQA 4B5CA 3S0WA 2HQSC 3S06A 2ZVZA 2AIZP 4G4YA 2L26A 4RHAA 2LBTA 2MQEA 4G4VA 2KGWA 4G4ZA 3TD4A 2LCAA 1OAPA 4R40B 4G4XA 4ERHA 4ZHWA 4PWTA 4G88A 3IMPA 3KHNA 4B62A 4ZHYB 4ZHVA
chains in the Genus database with same CATH superfamily
3NK6A 2DT4A 2VAPA 3VCZA 3FBAA 5LYJA 5AVMA 3J7AR 3CYPB 5EAZA 1XBIA 3DDNA 1GO0A 1T0AA 2ZOVA 5JVDB 3CCJF 1SZQA 2ZVYA 5HP7A 1Q81H 3P0ZA 4O4JB 1UI9A 2HQSC 3JAWA 5JH7A 3I55F 5DCVA 1XRGA 4O4IB 5LP6A 3MCAB 3C8LA 4R40B 3ERNA 4ZHQA 1VH8A 2HRYA 3FD6A 3HKBA 4C81A 1VQ4F 5LA6A 2Z1EA 4YJ2A 1W5FA 2HX0A 4G4WA 1Q86H 1QD9A 2Q1YA 5HWEA 4U3JB 3SIUA 3N4ZA 3HKEB 4BT5A 4O4JA 4B45A 3RYFA 3V7EA 3E20B 4G88A 1JY8A 3KHNA 5LXTB 1VQ8F 1PF5A 3ON1A 3I3FA 2YYEA 4X3LA 3FFMA 3KE1A 2VAMA 3JAKB 3WXMB 4ZK7A 3S0YA 4TV8A 3VMFB 3PAFA 2AIFA 5IJ9B 3J81M 3F0FA 2IG8A 3K12A 2Z1FA 4G4YA 1H48A 1W59A 5HY1A 1YJNF 1W42A 4NQ3A 1OAPA 3D54A 2FC3A 5IT9M 3KJJA 3RE3A 3WGNA 3C9RA 3JVHA 3WGKA 3F0EA 3ZO8A 3E22B 3MDOA 2IQQA 4ZHYB 3GYQA 5MN4A 4BT4A 1K73H 3OBYA 4NWOB 1X7OA 1X52A 5LXTA 3TD3A 3ZP4A 5GONB 1KNKA 2OTMA 4FFBA 4IHJB 2CHTA 1RQ7A 4XCQA 3JAKA 2HRUA 3PLAC 2MQEA 3KJKA 1FSZA 4G4ZA 3LWOC 3CCSF 1VQ6F 1TVKB 3WJQA 5IJ9A 1OFUA 4EI7A 1QAHA 3IEWA 4ZHWA 3NK7A 3WGJA 1YITF 3NVKE 1GO1A 1W5AA 5J2UB 3FPIA 2KTUA 4X1KB 3QTYA 5HY4A 1J7HA 1Z5WA 5HP8A 1FFXB 3S0HA 2UYNB 1TUBB 5KX5B 5EB1B 4X1IA 5CA0B 1CLIA 3E22A 2N48A 3N2GA 4RQOA 3K2XA 3S06A 2HP3A 3JASB 2VAWA 3GTZA 3IKEA 3JATB 5GONA 3WGMA 4IHJA 1IPAA 5JQGB 2Z1UA 5BMVA 3VYUC 4TUYB 3C9SA 3CG6A 3CCUF 2NMUA 1TVKA 3G6EF 1S72F 4O4HA 4ZOLB 4I4TB 2HP0B 5C8YA 4I50A 1R1MA 2BTUA 2ZF8A 1H47A 4I55B 3MCQA 1KQSF 2W8BC 3L7QA 1W5EA 3S02A 2KTVA 1X7PA 1FFXA 5EWRA 3RYIA 4C82A 1KC8H 1TUBA 3GHZA 2R6R1 3E1YA 3CPWF 5CA0A 3TD4A 1Q82H 5FLXM 3IKFA 3CMEF 4BVSA 2RHOA 3RA5A 4C8IA 5KMGB 1X25A 3OBWA 4EB6B 4PWTA 3JARB 3CCMF 3P10A 5JCOA 4B62A 1T0KB 3JATA 3VYSC 1YJ9F 1SDSA 4BT2A 3KIZA 3M1XA 1U43A 4TUYA 1IV2A 4EI9A 5EZYB 3N2KB 3JALB 3I7TA 4ZOLA 4I4TA 3CYQA 1COMA 2PMPA 5HY0A 4I55A 1VQVA 3IR9A 2GVIA 5HXUA 1W57A 2HS3A 5JVDA 2ALEA 3MQWA 3LYBA 1QVFF 2CW4A 4E6EA 3MBMA 4X1YB 1PXWA 4O2AB 2OTLF 2RHLA 2EWCA 4O4IA 3LWRC 3LMEA 5KMGA 1KNJA 3CD6F 1W581 4EB6A 5MN5A 1DBFA 2CSLA 5JCOC 2AIZP 3V7QA 4LCKA 3QHDA 2QA4F 5EZYA 2KGWA 5CB4B 2UYKA 3JALA 3HAXD 1JJ2F 3VYTC 2Z1TA 3RYCB 4U3JA 4BT3A 3IMPA 3CCRF 1JFFB 3LWQC 1SA0B 3WGLA 1M1KH 3HKEA 4BVQA 4X1YA 2I6DA 3G71F 2UYJA 1VQ9F 2RB9A 1YQNA 3P4EA 5MN6A 3VOBA 2CHSA 3J80M 2HS4A 3HKDB 2JNBA 5IYZB 1GZ0A 5GAPK 3CC4F 5J2TB 1U3LA 1UFYA 1H7MA 1Z5VA 1VQMF 3ELCA 2LBXA 1W2BF 3RYCA 5LOVB 1QVGF 1CN7A 3VIUA 2CWJA 1IV3A 2V9YA 2CZWA 1YGYA 4B5CA 3HJWC 1DT9A 5ITZB 5FNVB 3AGKA 3VO8A 4ERHA 3IEQA 1VHAA 1YI2F 3D00A 3JAWB 5JH7B 4LNUB 4X20B 1CK2A 5LP6B 5EB0A 1FNJA 3HKCB 3T80A 5J2UA 1GX1A 5J2TA 3O85A 4F6RB 3CMAF 1VQOF 4X1KA 3WJRA 1K9MH 3EORA 3WJPA 3NVIB 3LFOA 2HS0A 2LBWA 4ZHQB 2UYNA 3ZP7A 2BTOA 2LBTA 5KX5A 5LOVA 3N4YA 3OW2F 2R751 3F0GA 2BTQB 3K14A 1JN1A 3HKBB 3CPQA 5HY2A 2H8CA 3CCVF 4YJ2B 5ITZA 4C8EA 4C8GA 5FNVA 3DC2A 3JASA 5B8FA 5GIOC 4ZI7B 3QUWA 4BVTA 5EYPB 5HXZA 3F6MA 1RA4A 1NMUB 5JQGA 3WPXA 1E7KA 2IAFA 2BO1A 4EI8A 3ZOPA 3S03A 3NMUC 3OONA 3LWPC 2VXYA 4U39A 3RYFB 3V3TA 2QI2A 2HP0A 2ZVZA 4LNUA 4X20A 2QEXF 5EIBD 1M90H 4RHAA 3HKCA 4BT7A 1U40A 4F6RA 2H6LA 2P6YA 3G4SF 4TV8B 3RYHB 3F0DA 1VQNF 3B6NA 2PHNA 5G4UC 3VI6A 1RLGA 1RQ2A 5CA1B 3JARA 1JD1A 4ZI7A 5EYPA 2Q1XA 1XV2A 3V4DA 3S0WA 4DRXB 4TZZA 2DYYA 5GIPC 4O2BB 2YXZA 3N2KA 4HNAB 4BY9D 4BW0B 5GANK 3C9TA 1RLUA 2OHWA 2VGNA 2H8EA 1VQ5F 2G9IA 4FFBB 1YHQF 2WALA 4ZHVA 3LDTA 2FGYA 1YJWF 3D01A 2GZLA 3R0PA 5EIBC 5LP6C 3UT5B 2K1SA 4O2AA 2B33A 3RYHA 1VQKF 4O4LB 3CCLF 4KWEA 2L26A 1Q8RA 5CA1A 2LCAA 4IIJB 5IJ0B 4TV9B 2ZODA 4G4XA 4DRXA 3K0TA 1IV4A 2I6RA 4X1IB 5EO3A 3CC2F 4BVRA 3N2GB 1VQLF 1U3PA 4YJ3B 4O2BA 5CB4A 5G4VC 4C4WC 4HNAA 3CC7F 3RA6A 2CVLA 2Z01A 3HTNA 3WPWA 1IV1A 3CB2A 2GLZA 3Q8HA 2VGMA 1FNKA 2AMTA 3M84A 5GINC 3VTIC 2RHJA 3BYQA 1W5BA 1JFFA 5BMVB 2RHHA 1SA0A 3UT5A 3SIVA 3VOAA 4M8IA 4WBNB 4O4HB 5C8YB 1W41A 4I50B 4O4LA 1QU9A 4BT6A 2OZBA 5LYJB 1W40A 2HVYD 3I56F 3U0OA 1KD1H 4IIJA 5IJ0A 3RYIB 3CCQF 4TV9A 1VQPF 3HKDA 1W3EX 1VQ7F 3CXCF 5IYZA 1XHOA 3TD5A 3CCEF 4YJ3A 1YIJF 4NUTA 1NJIH 3LWVC 2QTPA 2ZAUA 3FD5A 3HWUA 4DXDA 1ZWZA 3C9UA 1ONIA 4G4VA 5FJ4C 1ODEA 3M4SA 3ESJA 3JCMM 4B46A 1Q7YH 2UYPA 4X3MA 5A2QM 3JAMM 2KG4A 5LA6B 2F9ZC 2OTJF 2UZHA 1NQ3A 1W55A 4WBNA 1N8RH 1VK3A 1K8AH
chains in the Genus database with same CATH topology
3LDTA 3S0HA 3WPWA 5EB1B 1R1MA 2ZF8A 3CYPB 5EAZA 3WPXA 3S0YA 2K1SA 2ZOVA 2W8BC 5EB0A 3TD5A 3TD3A 3S03A 3OONA 2N48A 4G4WA 2ZVYA 3S02A 3CYQA 4B5CA 3S0WA 2HQSC 3S06A 2ZVZA 2AIZP 4G4YA 2L26A 4RHAA 2LBTA 2MQEA 4G4VA 2KGWA 4G4ZA 3TD4A 2LCAA 1OAPA 4R40B 4G4XA 4ERHA 4ZHWA 4PWTA 4G88A 3IMPA 3KHNA 4B62A 4ZHYB 4ZHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDT A;  3S0H A;  3WPW A;  5EB1 B;  1R1M A;  2ZF8 A;  3CYP B;  5EAZ A;  3WPX A;  3S0Y A;  2K1S A;  2ZOV A;  2W8B C;  5EB0 A;  3TD5 A;  3TD3 A;  3S03 A;  3OON A;  2N48 A;  4G4W A;  2ZVY A;  3S02 A;  3CYQ A;  4B5C A;  3S0W A;  2HQS C;  3S06 A;  2ZVZ A;  2AIZ P;  4G4Y A;  2L26 A;  4RHA A;  2LBT A;  2MQE A;  4G4V A;  2KGW A;  4G4Z A;  3TD4 A;  2LCA A;  1OAP A;  4R40 B;  4G4X A;  4ERH A;  4ZHW A;  4PWT A;  4G88 A;  3IMP A;  3KHN A;  4B62 A;  4ZHY B;  4ZHV A; 
#chains in the Genus database with same CATH topology
 3NK6 A;  2DT4 A;  2VAP A;  3VCZ A;  3FBA A;  5LYJ A;  5AVM A;  3J7A R;  3CYP B;  5EAZ A;  1XBI A;  3DDN A;  1GO0 A;  1T0A A;  2ZOV A;  5JVD B;  3CCJ F;  1SZQ A;  2ZVY A;  5HP7 A;  1Q81 H;  3P0Z A;  4O4J B;  1UI9 A;  2HQS C;  3JAW A;  5JH7 A;  3I55 F;  5DCV A;  1XRG A;  4O4I B;  5LP6 A;  3MCA B;  3C8L A;  4R40 B;  3ERN A;  4ZHQ A;  1VH8 A;  2HRY A;  3FD6 A;  3HKB A;  4C81 A;  1VQ4 F;  5LA6 A;  2Z1E A;  4YJ2 A;  1W5F A;  2HX0 A;  4G4W A;  1Q86 H;  1QD9 A;  2Q1Y A;  5HWE A;  4U3J B;  3SIU A;  3N4Z A;  3HKE B;  4BT5 A;  4O4J A;  4B45 A;  3RYF A;  3V7E A;  3E20 B;  4G88 A;  1JY8 A;  3KHN A;  5LXT B;  1VQ8 F;  1PF5 A;  3ON1 A;  3I3F A;  2YYE A;  4X3L A;  3FFM A;  3KE1 A;  2VAM A;  3JAK B;  3WXM B;  4ZK7 A;  3S0Y A;  4TV8 A;  3VMF B;  3PAF A;  2AIF A;  5IJ9 B;  3J81 M;  3F0F A;  2IG8 A;  3K12 A;  2Z1F A;  4G4Y A;  1H48 A;  1W59 A;  5HY1 A;  1YJN F;  1W42 A;  4NQ3 A;  1OAP A;  3D54 A;  2FC3 A;  5IT9 M;  3KJJ A;  3RE3 A;  3WGN A;  3C9R A;  3JVH A;  3WGK A;  3F0E A;  3ZO8 A;  3E22 B;  3MDO A;  2IQQ A;  4ZHY B;  3GYQ A;  5MN4 A;  4BT4 A;  1K73 H;  3OBY A;  4NWO B;  1X7O A;  1X52 A;  5LXT A;  3TD3 A;  3ZP4 A;  5GON B;  1KNK A;  2OTM A;  4FFB A;  4IHJ B;  2CHT A;  1RQ7 A;  4XCQ A;  3JAK A;  2HRU A;  3PLA C;  2MQE A;  3KJK A;  1FSZ A;  4G4Z A;  3LWO C;  3CCS F;  1VQ6 F;  1TVK B;  3WJQ A;  5IJ9 A;  1OFU A;  4EI7 A;  1QAH A;  3IEW A;  4ZHW A;  3NK7 A;  3WGJ A;  1YIT F;  3NVK E;  1GO1 A;  1W5A A;  5J2U B;  3FPI A;  2KTU A;  4X1K B;  3QTY A;  5HY4 A;  1J7H A;  1Z5W A;  5HP8 A;  1FFX B;  3S0H A;  2UYN B;  1TUB B;  5KX5 B;  5EB1 B;  4X1I A;  5CA0 B;  1CLI A;  3E22 A;  2N48 A;  3N2G A;  4RQO A;  3K2X A;  3S06 A;  2HP3 A;  3JAS B;  2VAW A;  3GTZ A;  3IKE A;  3JAT B;  5GON A;  3WGM A;  4IHJ A;  1IPA A;  5JQG B;  2Z1U A;  5BMV A;  3VYU C;  4TUY B;  3C9S A;  3CG6 A;  3CCU F;  2NMU A;  1TVK A;  3G6E F;  1S72 F;  4O4H A;  4ZOL B;  4I4T B;  2HP0 B;  5C8Y A;  4I50 A;  1R1M A;  2BTU A;  2ZF8 A;  1H47 A;  4I55 B;  3MCQ A;  1KQS F;  2W8B C;  3L7Q A;  1W5E A;  3S02 A;  2KTV A;  1X7P A;  1FFX A;  5EWR A;  3RYI A;  4C82 A;  1KC8 H;  1TUB A;  3GHZ A;  2R6R 1;  3E1Y A;  3CPW F;  5CA0 A;  3TD4 A;  1Q82 H;  5FLX M;  3IKF A;  3CME F;  4BVS A;  2RHO A;  3RA5 A;  4C8I A;  5KMG B;  1X25 A;  3OBW A;  4EB6 B;  4PWT A;  3JAR B;  3CCM F;  3P10 A;  5JCO A;  4B62 A;  1T0K B;  3JAT A;  3VYS C;  1YJ9 F;  1SDS A;  4BT2 A;  3KIZ A;  3M1X A;  1U43 A;  4TUY A;  1IV2 A;  4EI9 A;  5EZY B;  3N2K B;  3JAL B;  3I7T A;  4ZOL A;  4I4T A;  3CYQ A;  1COM A;  2PMP A;  5HY0 A;  4I55 A;  1VQV A;  3IR9 A;  2GVI A;  5HXU A;  1W57 A;  2HS3 A;  5JVD A;  2ALE A;  3MQW A;  3LYB A;  1QVF F;  2CW4 A;  4E6E A;  3MBM A;  4X1Y B;  1PXW A;  4O2A B;  2OTL F;  2RHL A;  2EWC A;  4O4I A;  3LWR C;  3LME A;  5KMG A;  1KNJ A;  3CD6 F;  1W58 1;  4EB6 A;  5MN5 A;  1DBF A;  2CSL A;  5JCO C;  2AIZ P;  3V7Q A;  4LCK A;  3QHD A;  2QA4 F;  5EZY A;  2KGW A;  5CB4 B;  2UYK A;  3JAL A;  3HAX D;  1JJ2 F;  3VYT C;  2Z1T A;  3RYC B;  4U3J A;  4BT3 A;  3IMP A;  3CCR F;  1JFF B;  3LWQ C;  1SA0 B;  3WGL A;  1M1K H;  3HKE A;  4BVQ A;  4X1Y A;  2I6D A;  3G71 F;  2UYJ A;  1VQ9 F;  2RB9 A;  1YQN A;  3P4E A;  5MN6 A;  3VOB A;  2CHS A;  3J80 M;  2HS4 A;  3HKD B;  2JNB A;  5IYZ B;  1GZ0 A;  5GAP K;  3CC4 F;  5J2T B;  1U3L A;  1UFY A;  1H7M A;  1Z5V A;  1VQM F;  3ELC A;  2LBX A;  1W2B F;  3RYC A;  5LOV B;  1QVG F;  1CN7 A;  3VIU A;  2CWJ A;  1IV3 A;  2V9Y A;  2CZW A;  1YGY A;  4B5C A;  3HJW C;  1DT9 A;  5ITZ B;  5FNV B;  3AGK A;  3VO8 A;  4ERH A;  3IEQ A;  1VHA A;  1YI2 F;  3D00 A;  3JAW B;  5JH7 B;  4LNU B;  4X20 B;  1CK2 A;  5LP6 B;  5EB0 A;  1FNJ A;  3HKC B;  3T80 A;  5J2U A;  1GX1 A;  5J2T A;  3O85 A;  4F6R B;  3CMA F;  1VQO F;  4X1K A;  3WJR A;  1K9M H;  3EOR A;  3WJP A;  3NVI B;  3LFO A;  2HS0 A;  2LBW A;  4ZHQ B;  2UYN A;  3ZP7 A;  2BTO A;  2LBT A;  5KX5 A;  5LOV A;  3N4Y A;  3OW2 F;  2R75 1;  3F0G A;  2BTQ B;  3K14 A;  1JN1 A;  3HKB B;  3CPQ A;  5HY2 A;  2H8C A;  3CCV F;  4YJ2 B;  5ITZ A;  4C8E A;  4C8G A;  5FNV A;  3DC2 A;  3JAS A;  5B8F A;  5GIO C;  4ZI7 B;  3QUW A;  4BVT A;  5EYP B;  5HXZ A;  3F6M A;  1RA4 A;  1NMU B;  5JQG A;  3WPX A;  1E7K A;  2IAF A;  2BO1 A;  4EI8 A;  3ZOP A;  3S03 A;  3NMU C;  3OON A;  3LWP C;  2VXY A;  4U39 A;  3RYF B;  3V3T A;  2QI2 A;  2HP0 A;  2ZVZ A;  4LNU A;  4X20 A;  2QEX F;  5EIB D;  1M90 H;  4RHA A;  3HKC A;  4BT7 A;  1U40 A;  4F6R A;  2H6L A;  2P6Y A;  3G4S F;  4TV8 B;  3RYH B;  3F0D A;  1VQN F;  3B6N A;  2PHN A;  5G4U C;  3VI6 A;  1RLG A;  1RQ2 A;  5CA1 B;  3JAR A;  1JD1 A;  4ZI7 A;  5EYP A;  2Q1X A;  1XV2 A;  3V4D A;  3S0W A;  4DRX B;  4TZZ A;  2DYY A;  5GIP C;  4O2B B;  2YXZ A;  3N2K A;  4HNA B;  4BY9 D;  4BW0 B;  5GAN K;  3C9T A;  1RLU A;  2OHW A;  2VGN A;  2H8E A;  1VQ5 F;  2G9I A;  4FFB B;  1YHQ F;  2WAL A;  4ZHV A;  3LDT A;  2FGY A;  1YJW F;  3D01 A;  2GZL A;  3R0P A;  5EIB C;  5LP6 C;  3UT5 B;  2K1S A;  4O2A A;  2B33 A;  3RYH A;  1VQK F;  4O4L B;  3CCL F;  4KWE A;  2L26 A;  1Q8R A;  5CA1 A;  2LCA A;  4IIJ B;  5IJ0 B;  4TV9 B;  2ZOD A;  4G4X A;  4DRX A;  3K0T A;  1IV4 A;  2I6R A;  4X1I B;  5EO3 A;  3CC2 F;  4BVR A;  3N2G B;  1VQL F;  1U3P A;  4YJ3 B;  4O2B A;  5CB4 A;  5G4V C;  4C4W C;  4HNA A;  3CC7 F;  3RA6 A;  2CVL A;  2Z01 A;  3HTN A;  3WPW A;  1IV1 A;  3CB2 A;  2GLZ A;  3Q8H A;  2VGM A;  1FNK A;  2AMT A;  3M84 A;  5GIN C;  3VTI C;  2RHJ A;  3BYQ A;  1W5B A;  1JFF A;  5BMV B;  2RHH A;  1SA0 A;  3UT5 A;  3SIV A;  3VOA A;  4M8I A;  4WBN B;  4O4H B;  5C8Y B;  1W41 A;  4I50 B;  4O4L A;  1QU9 A;  4BT6 A;  2OZB A;  5LYJ B;  1W40 A;  2HVY D;  3I56 F;  3U0O A;  1KD1 H;  4IIJ A;  5IJ0 A;  3RYI B;  3CCQ F;  4TV9 A;  1VQP F;  3HKD A;  1W3E X;  1VQ7 F;  3CXC F;  5IYZ A;  1XHO A;  3TD5 A;  3CCE F;  4YJ3 A;  1YIJ F;  4NUT A;  1NJI H;  3LWV C;  2QTP A;  2ZAU A;  3FD5 A;  3HWU A;  4DXD A;  1ZWZ A;  3C9U A;  1ONI A;  4G4V A;  5FJ4 C;  1ODE A;  3M4S A;  3ESJ A;  3JCM M;  4B46 A;  1Q7Y H;  2UYP A;  4X3M A;  5A2Q M;  3JAM M;  2KG4 A;  5LA6 B;  2F9Z C;  2OTJ F;  2UZH A;  1NQ3 A;  1W55 A;  4WBN A;  1N8R H;  1VK3 A;  1K8A H; 
#chains in the Genus database with same CATH homology
 3LDT A;  3S0H A;  3WPW A;  5EB1 B;  1R1M A;  2ZF8 A;  3CYP B;  5EAZ A;  3WPX A;  3S0Y A;  2K1S A;  2ZOV A;  2W8B C;  5EB0 A;  3TD5 A;  3TD3 A;  3S03 A;  3OON A;  2N48 A;  4G4W A;  2ZVY A;  3S02 A;  3CYQ A;  4B5C A;  3S0W A;  2HQS C;  3S06 A;  2ZVZ A;  2AIZ P;  4G4Y A;  2L26 A;  4RHA A;  2LBT A;  2MQE A;  4G4V A;  2KGW A;  4G4Z A;  3TD4 A;  2LCA A;  1OAP A;  4R40 B;  4G4X A;  4ERH A;  4ZHW A;  4PWT A;  4G88 A;  3IMP A;  3KHN A;  4B62 A;  4ZHY B;  4ZHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...