3OONA

The structure of an outer membrance protein from borrelia burgdorferi b31
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
113
Chain Sequence
b'NAAIEVEKNNKGINLSFDIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNILIEGHTEQFGLEEEMHELSEKRARAIGNYLIKMKVKDKDQILFKGWGSQKAKNRRVEITILN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein (Tpn50)
publication title The structure of an outer membrance protein from Borrelia burgdorferi B31
rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 36
structure length 113
sequence length 123
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3oonA00
2ZOVA 3S06A 2N48A 2LCAA 3WPXA 4G88A 2LBTA 2AIZP 4ERHA 4G4WA 3CYQA 4G4VA 3IMPA 2ZVYA 3WPWA 3KHNA 2HQSC 4G4ZA 3LDTA 2MQEA 4RHAA 4ZHVA 4ZHYB 3S03A 5EB1B 3S0HA 2ZVZA 3S02A 3S0WA 3S0YA 2L26A 3CYPB 4B62A 2ZF8A 4ZHWA 2KGWA 4B5CA 4R40B 3TD3A 5EB0A 3OONA 5EAZA 1OAPA 2K1SA 3TD5A 2W8BC 1R1MA 4PWTA 4G4XA 3TD4A 4G4YA
chains in the Genus database with same CATH superfamily
1W3EX 3KIZA 1YIJF 4ERHA 3QTYA 3CD6F 1U3PA 5LA6B 2QI2A 5EIBD 3S0HA 4TUYB 2AIFA 3JARB 3HTNA 5FNVA 2VXYA 3WGNA 3D01A 4B46A 1DBFA 1R1MA 3C9SA 1VQ8F 4PWTA 1RA4A 4X20B 2HP0B 3NK6A 4BVSA 3CCVF 1RQ2A 2PMPA 4O2BA 3V4DA 3M1XA 5B8FA 3Q8HA 4LCKA 4O4IA 3E1YA 1GO1A 1W5AA 1TVKA 5HP7A 1TUBB 4B62A 1JFFB 5LXTB 5GAPK 5C8YA 2KTVA 3CMAF 2VGNA 5CB4A 4O4LA 1XHOA 3VTIC 2GVIA 3HKDB 3J81M 4LNUA 4X1YB 5EYPB 5FLXM 5HY0A 3MBMA 3DC2A 3HKCB 3J7AR 3CC2F 4O4HB 3RYHA 3P10A 3CCUF 1KD1H 3UT5A 1U3LA 3WGLA 2G9IA 5JH7B 1Q7YH 2ZVYA 1YJNF 4U3JA 3KHNA 1NMUB 1N8RH 2YYEA 3VYSC 4FFBB 3FD6A 2LBXA 3S02A 2HS0A 5EZYA 5G4VC 2KGWA 4R40B 3VOBA 4WBNA 2HX0A 3DDNA 2AMTA 3CPQA 3ERNA 1SZQA 1RQ7A 3JATA 4TV9A 2VAPA 3R0PA 3N4ZA 3N4YA 5IYZA 4C8EA 1DT9A 4B45A 3K2XA 5HY1A 1W40A 4C81A 5JVDB 2I6DA 1Q8RA 1W42A 1IV1A 2GZLA 2OHWA 3VYUC 3NVIB 4F6RB 2Z1TA 4IIJB 4M8IA 4ZHWA 2IG8A 4IHJB 3WGMA 4X1IA 1VQ6F 1QU9A 3N2GA 5JCOC 1JD1A 1T0AA 2W8BC 1X52A 2FC3A 5J2TA 1YHQF 5G4UC 3CCLF 4X1KA 2UYPA 3IKFA 4ZHQB 5EIBC 1CK2A 2ALEA 5JQGB 1Q86H 1T0KB 3HKBB 5LOVA 4DRXB 3NK7A 4YJ2B 3CCMF 5EB1B 3S0WA 1KQSF 1KNKA 5J2UB 2HRUA 3CCEF 4B5CA 4U39A 1GZ0A 2UYNB 5IJ0B 2HS3A 2R6R1 3GHZA 4BT7A 1ONIA 5KMGB 3HKEB 5ITZA 5CA0B 3C9UA 3P4EA 2BO1A 4G4YA 1VQ4F 4C8GA 2CWJA 1IV3A 5LP6A 4NUTA 2BTQB 1IPAA 2HQSC 4O2BB 4BT4A 4X3MA 1VQKF 5GINC 3CG6A 1JN1A 1QD9A 4I55B 2NMUA 5KX5B 5GIPC 3ESJA 3LWRC 3WGJA 2Q1XA 3OONA 3U0OA 2H6LA 5C8YB 3C8LA 2I6RA 4TV8A 1VQLF 1H47A 2IAFA 1VQPF 3CB2A 2H8EA 3WJPA 3ZP4A 2B33A 3CCJF 4O4JB 1GO0A 2LCAA 4I50A 3FPIA 4EI8A 2LBTA 1RLUA 3LWVC 3SIVA 3P0ZA 1XV2A 4RQOA 2UZHA 1YQNA 1Z5WA 3EORA 3ON1A 1H48A 2ZVZA 5IJ9A 2L26A 2OTLF 2ZF8A 1VK3A 4EB6B 1SA0A 3WJQA 1VHAA 3OBYA 3E22B 2HRYA 4ZI7B 1YJWF 2VAMA 1X7OA 3LWPC 5CA1A 3PLAC 3JAKB 2Z1UA 2Z01A 1KNJA 5LA6A 3G6EF 3D54A 2RHHA 4TUYA 4ZOLB 3JARA 3RYCB 5A2QM 1W5BA 3BYQA 1YITF 4RHAA 4BVQA 5HWEA 3CCQF 3VO8A 3NVKE 5BMVB 2VAWA 5LYJB 1CLIA 4YJ3B 2CW4A 3VCZA 2ZAUA 1U43A 5MN6A 2OZBA 3JALB 3GYQA 4I4TB 1NQ3A 2FGYA 2QEXF 3JASB 1W55A 2KTUA 3L7QA 3RYFB 4E6EA 1W59A 4G4XA 5GONB 2F9ZC 1S72F 3CC4F 4BT5A 4O2AB 3AGKA 2ZOVA 3FD5A 1W5FA 3RYIB 3S06A 3WPXA 3CPWF 4X1KB 1TUBA 2R751 3IR9A 4KWEA 3CXCF 1JFFA 3K0TA 5LXTA 2BTUA 1FNJA 1CN7A 1X25A 3N2KB 3HKDA 5EWRA 1M90H 1W2BF 3KJKA 4X1YA 3HKCA 2LBWA 3V7QA 2CZWA 1FFXA 3IEQA 4HNAA 1ODEA 2OTMA 3LYBA 1K9MH 4FFBA 3PAFA 1VQ7F 4ZHYB 3OW2F 3CMEF 3CCSF 4NQ3A 3J80M 3JVHA 3LWQC 1K8AH 4BT3A 4BY9D 5HXZA 1NJIH 2RHJA 4NWOB 5FNVB 1JJ2F 1FNKA 1X7PA 3TD5A 1FSZA 2CHTA 2P6YA 3VMFB 1QAHA 5EO3A 1H7MA 1E7KA 3I56F 3G4SF 4C8IA 3WPWA 3QHDA 3CCRF 1XRGA 2DT4A 5IT9M 4F6RA 2VGMA 4IHJA 3WJRA 3GTZA 3VOAA 1UFYA 4O4IB 1W5EA 5HY2A 3MCAB 3RA5A 5JCOA 3ZP7A 1TVKB 3K12A 4ZK7A 3M84A 5DCVA 4BW0B 3E20B 5JQGA 3LMEA 5CB4B 4O4LB 1YJ9F 3HKBA 4DRXA 3NMUC 4BT6A 3JAWA 4LNUB 2QA4F 5CA1B 1YGYA 4G88A 4YJ2A 3F0FA 4C82A 3RYHB 5J2UA 2HS4A 3UT5B 1ZWZA 3ELCA 4X3LA 2UYNA 3IEWA 5IJ0A 1XBIA 4U3JB 5KMGA 3HKEA 5EB0A 5CA0A 2UYJA 4BT2A 1UI9A 3WGKA 5GIOC 5EZYB 1J7HA 2JNBA 4WBNB 2V9YA 2Q1YA 3TD4A 3JATB 4TV9B 3M4SA 1KC8H 2UYKA 5IYZB 1IV4A 1COMA 1VQVA 2Z1FA 3LFOA 5KX5A 4I55A 5HP8A 2QTPA 3SIUA 3RA6A 3ZO8A 2DYYA 3TD3A 3IKEA 3C9TA 3HWUA 2HVYD 3VYTC 2K1SA 4BVRA 1K73H 4X20A 4X1IB 2HP0A 4O4JA 1W57A 1FFXB 3N2GB 4HNAB 2PHNA 3ZOPA 2IQQA 5J2TB 3CC7F 2WALA 3B6NA 3C9RA 3JAMM 4XCQA 1VQ9F 2RB9A 3LDTA 1RLGA 1PXWA 3F0EA 3I3FA 1Z5VA 3F6MA 3WXMB 4EB6A 5MN5A 1PF5A 5LOVB 3S0YA 3F0DA 2ZODA 5MN4A 1Q81H 3QUWA 3E22A 4ZI7A 5EYPA 2OTJF 3JAKA 2YXZA 2Z1EA 4O4HA 1OFUA 5FJ4C 1IV2A 4ZOLA 5ITZB 3RYCA 5JH7A 2N48A 1GX1A 2KG4A 4G4WA 3FBAA 4G4VA 3IMPA 5BMVA 5LYJA 3LWOC 4G4ZA 4YJ3A 5LP6C 3HAXD 4TZZA 3S03A 2CSLA 5LP6B 1VQOF 3I55F 3I7TA 3CYPB 1Q82H 3JALA 4I4TA 1W581 1JY8A 3MDOA 5GANK 3JASA 2HP3A 3RYFA 2CVLA 5GONA 1OAPA 4O2AA 2EWCA 4C4WC 3RYIA 4DXDA 3JCMM 3KE1A 4TV8B 5HXUA 3O85A 1M1KH 5JVDA 2AIZP 3V3TA 3F0GA 1YI2F 3V7EA 3CYQA 3JAWB 3MCQA 4EI7A 2RHOA 3N2KA 3T80A 2MQEA 4BVTA 4I50B 4ZHVA 3G71F 4IIJA 3D00A 2CHSA 2BTOA 3VIUA 1VQMF 1W41A 4EI9A 3KJJA 1QVFF 3HJWC 3FFMA 3K14A 1SDSA 1VH8A 5IJ9B 5EAZA 5AVMA 2H8CA 3OBWA 3RE3A 2GLZA 1SA0B 5HY4A 1U40A 4ZHQA 1VQNF 3VI6A 1QVGF 3MQWA 1VQ5F 2RHLA
chains in the Genus database with same CATH topology
2ZOVA 3S06A 2N48A 2LCAA 3WPXA 4G88A 2LBTA 2AIZP 4ERHA 4G4WA 3CYQA 4G4VA 3IMPA 2ZVYA 3WPWA 3KHNA 2HQSC 4G4ZA 3LDTA 2MQEA 4RHAA 4ZHVA 4ZHYB 3S03A 5EB1B 3S0HA 2ZVZA 3S02A 3S0WA 3S0YA 2L26A 3CYPB 4B62A 2ZF8A 4ZHWA 2KGWA 4B5CA 4R40B 3TD3A 5EB0A 3OONA 5EAZA 1OAPA 2K1SA 3TD5A 2W8BC 1R1MA 4PWTA 4G4XA 3TD4A 4G4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOV A;  3S06 A;  2N48 A;  2LCA A;  3WPX A;  4G88 A;  2LBT A;  2AIZ P;  4ERH A;  4G4W A;  3CYQ A;  4G4V A;  3IMP A;  2ZVY A;  3WPW A;  3KHN A;  2HQS C;  4G4Z A;  3LDT A;  2MQE A;  4RHA A;  4ZHV A;  4ZHY B;  3S03 A;  5EB1 B;  3S0H A;  2ZVZ A;  3S02 A;  3S0W A;  3S0Y A;  2L26 A;  3CYP B;  4B62 A;  2ZF8 A;  4ZHW A;  2KGW A;  4B5C A;  4R40 B;  3TD3 A;  5EB0 A;  3OON A;  5EAZ A;  1OAP A;  2K1S A;  3TD5 A;  2W8B C;  1R1M A;  4PWT A;  4G4X A;  3TD4 A;  4G4Y A; 
#chains in the Genus database with same CATH topology
 1W3E X;  3KIZ A;  1YIJ F;  4ERH A;  3QTY A;  3CD6 F;  1U3P A;  5LA6 B;  2QI2 A;  5EIB D;  3S0H A;  4TUY B;  2AIF A;  3JAR B;  3HTN A;  5FNV A;  2VXY A;  3WGN A;  3D01 A;  4B46 A;  1DBF A;  1R1M A;  3C9S A;  1VQ8 F;  4PWT A;  1RA4 A;  4X20 B;  2HP0 B;  3NK6 A;  4BVS A;  3CCV F;  1RQ2 A;  2PMP A;  4O2B A;  3V4D A;  3M1X A;  5B8F A;  3Q8H A;  4LCK A;  4O4I A;  3E1Y A;  1GO1 A;  1W5A A;  1TVK A;  5HP7 A;  1TUB B;  4B62 A;  1JFF B;  5LXT B;  5GAP K;  5C8Y A;  2KTV A;  3CMA F;  2VGN A;  5CB4 A;  4O4L A;  1XHO A;  3VTI C;  2GVI A;  3HKD B;  3J81 M;  4LNU A;  4X1Y B;  5EYP B;  5FLX M;  5HY0 A;  3MBM A;  3DC2 A;  3HKC B;  3J7A R;  3CC2 F;  4O4H B;  3RYH A;  3P10 A;  3CCU F;  1KD1 H;  3UT5 A;  1U3L A;  3WGL A;  2G9I A;  5JH7 B;  1Q7Y H;  2ZVY A;  1YJN F;  4U3J A;  3KHN A;  1NMU B;  1N8R H;  2YYE A;  3VYS C;  4FFB B;  3FD6 A;  2LBX A;  3S02 A;  2HS0 A;  5EZY A;  5G4V C;  2KGW A;  4R40 B;  3VOB A;  4WBN A;  2HX0 A;  3DDN A;  2AMT A;  3CPQ A;  3ERN A;  1SZQ A;  1RQ7 A;  3JAT A;  4TV9 A;  2VAP A;  3R0P A;  3N4Z A;  3N4Y A;  5IYZ A;  4C8E A;  1DT9 A;  4B45 A;  3K2X A;  5HY1 A;  1W40 A;  4C81 A;  5JVD B;  2I6D A;  1Q8R A;  1W42 A;  1IV1 A;  2GZL A;  2OHW A;  3VYU C;  3NVI B;  4F6R B;  2Z1T A;  4IIJ B;  4M8I A;  4ZHW A;  2IG8 A;  4IHJ B;  3WGM A;  4X1I A;  1VQ6 F;  1QU9 A;  3N2G A;  5JCO C;  1JD1 A;  1T0A A;  2W8B C;  1X52 A;  2FC3 A;  5J2T A;  1YHQ F;  5G4U C;  3CCL F;  4X1K A;  2UYP A;  3IKF A;  4ZHQ B;  5EIB C;  1CK2 A;  2ALE A;  5JQG B;  1Q86 H;  1T0K B;  3HKB B;  5LOV A;  4DRX B;  3NK7 A;  4YJ2 B;  3CCM F;  5EB1 B;  3S0W A;  1KQS F;  1KNK A;  5J2U B;  2HRU A;  3CCE F;  4B5C A;  4U39 A;  1GZ0 A;  2UYN B;  5IJ0 B;  2HS3 A;  2R6R 1;  3GHZ A;  4BT7 A;  1ONI A;  5KMG B;  3HKE B;  5ITZ A;  5CA0 B;  3C9U A;  3P4E A;  2BO1 A;  4G4Y A;  1VQ4 F;  4C8G A;  2CWJ A;  1IV3 A;  5LP6 A;  4NUT A;  2BTQ B;  1IPA A;  2HQS C;  4O2B B;  4BT4 A;  4X3M A;  1VQK F;  5GIN C;  3CG6 A;  1JN1 A;  1QD9 A;  4I55 B;  2NMU A;  5KX5 B;  5GIP C;  3ESJ A;  3LWR C;  3WGJ A;  2Q1X A;  3OON A;  3U0O A;  2H6L A;  5C8Y B;  3C8L A;  2I6R A;  4TV8 A;  1VQL F;  1H47 A;  2IAF A;  1VQP F;  3CB2 A;  2H8E A;  3WJP A;  3ZP4 A;  2B33 A;  3CCJ F;  4O4J B;  1GO0 A;  2LCA A;  4I50 A;  3FPI A;  4EI8 A;  2LBT A;  1RLU A;  3LWV C;  3SIV A;  3P0Z A;  1XV2 A;  4RQO A;  2UZH A;  1YQN A;  1Z5W A;  3EOR A;  3ON1 A;  1H48 A;  2ZVZ A;  5IJ9 A;  2L26 A;  2OTL F;  2ZF8 A;  1VK3 A;  4EB6 B;  1SA0 A;  3WJQ A;  1VHA A;  3OBY A;  3E22 B;  2HRY A;  4ZI7 B;  1YJW F;  2VAM A;  1X7O A;  3LWP C;  5CA1 A;  3PLA C;  3JAK B;  2Z1U A;  2Z01 A;  1KNJ A;  5LA6 A;  3G6E F;  3D54 A;  2RHH A;  4TUY A;  4ZOL B;  3JAR A;  3RYC B;  5A2Q M;  1W5B A;  3BYQ A;  1YIT F;  4RHA A;  4BVQ A;  5HWE A;  3CCQ F;  3VO8 A;  3NVK E;  5BMV B;  2VAW A;  5LYJ B;  1CLI A;  4YJ3 B;  2CW4 A;  3VCZ A;  2ZAU A;  1U43 A;  5MN6 A;  2OZB A;  3JAL B;  3GYQ A;  4I4T B;  1NQ3 A;  2FGY A;  2QEX F;  3JAS B;  1W55 A;  2KTU A;  3L7Q A;  3RYF B;  4E6E A;  1W59 A;  4G4X A;  5GON B;  2F9Z C;  1S72 F;  3CC4 F;  4BT5 A;  4O2A B;  3AGK A;  2ZOV A;  3FD5 A;  1W5F A;  3RYI B;  3S06 A;  3WPX A;  3CPW F;  4X1K B;  1TUB A;  2R75 1;  3IR9 A;  4KWE A;  3CXC F;  1JFF A;  3K0T A;  5LXT A;  2BTU A;  1FNJ A;  1CN7 A;  1X25 A;  3N2K B;  3HKD A;  5EWR A;  1M90 H;  1W2B F;  3KJK A;  4X1Y A;  3HKC A;  2LBW A;  3V7Q A;  2CZW A;  1FFX A;  3IEQ A;  4HNA A;  1ODE A;  2OTM A;  3LYB A;  1K9M H;  4FFB A;  3PAF A;  1VQ7 F;  4ZHY B;  3OW2 F;  3CME F;  3CCS F;  4NQ3 A;  3J80 M;  3JVH A;  3LWQ C;  1K8A H;  4BT3 A;  4BY9 D;  5HXZ A;  1NJI H;  2RHJ A;  4NWO B;  5FNV B;  1JJ2 F;  1FNK A;  1X7P A;  3TD5 A;  1FSZ A;  2CHT A;  2P6Y A;  3VMF B;  1QAH A;  5EO3 A;  1H7M A;  1E7K A;  3I56 F;  3G4S F;  4C8I A;  3WPW A;  3QHD A;  3CCR F;  1XRG A;  2DT4 A;  5IT9 M;  4F6R A;  2VGM A;  4IHJ A;  3WJR A;  3GTZ A;  3VOA A;  1UFY A;  4O4I B;  1W5E A;  5HY2 A;  3MCA B;  3RA5 A;  5JCO A;  3ZP7 A;  1TVK B;  3K12 A;  4ZK7 A;  3M84 A;  5DCV A;  4BW0 B;  3E20 B;  5JQG A;  3LME A;  5CB4 B;  4O4L B;  1YJ9 F;  3HKB A;  4DRX A;  3NMU C;  4BT6 A;  3JAW A;  4LNU B;  2QA4 F;  5CA1 B;  1YGY A;  4G88 A;  4YJ2 A;  3F0F A;  4C82 A;  3RYH B;  5J2U A;  2HS4 A;  3UT5 B;  1ZWZ A;  3ELC A;  4X3L A;  2UYN A;  3IEW A;  5IJ0 A;  1XBI A;  4U3J B;  5KMG A;  3HKE A;  5EB0 A;  5CA0 A;  2UYJ A;  4BT2 A;  1UI9 A;  3WGK A;  5GIO C;  5EZY B;  1J7H A;  2JNB A;  4WBN B;  2V9Y A;  2Q1Y A;  3TD4 A;  3JAT B;  4TV9 B;  3M4S A;  1KC8 H;  2UYK A;  5IYZ B;  1IV4 A;  1COM A;  1VQV A;  2Z1F A;  3LFO A;  5KX5 A;  4I55 A;  5HP8 A;  2QTP A;  3SIU A;  3RA6 A;  3ZO8 A;  2DYY A;  3TD3 A;  3IKE A;  3C9T A;  3HWU A;  2HVY D;  3VYT C;  2K1S A;  4BVR A;  1K73 H;  4X20 A;  4X1I B;  2HP0 A;  4O4J A;  1W57 A;  1FFX B;  3N2G B;  4HNA B;  2PHN A;  3ZOP A;  2IQQ A;  5J2T B;  3CC7 F;  2WAL A;  3B6N A;  3C9R A;  3JAM M;  4XCQ A;  1VQ9 F;  2RB9 A;  3LDT A;  1RLG A;  1PXW A;  3F0E A;  3I3F A;  1Z5V A;  3F6M A;  3WXM B;  4EB6 A;  5MN5 A;  1PF5 A;  5LOV B;  3S0Y A;  3F0D A;  2ZOD A;  5MN4 A;  1Q81 H;  3QUW A;  3E22 A;  4ZI7 A;  5EYP A;  2OTJ F;  3JAK A;  2YXZ A;  2Z1E A;  4O4H A;  1OFU A;  5FJ4 C;  1IV2 A;  4ZOL A;  5ITZ B;  3RYC A;  5JH7 A;  2N48 A;  1GX1 A;  2KG4 A;  4G4W A;  3FBA A;  4G4V A;  3IMP A;  5BMV A;  5LYJ A;  3LWO C;  4G4Z A;  4YJ3 A;  5LP6 C;  3HAX D;  4TZZ A;  3S03 A;  2CSL A;  5LP6 B;  1VQO F;  3I55 F;  3I7T A;  3CYP B;  1Q82 H;  3JAL A;  4I4T A;  1W58 1;  1JY8 A;  3MDO A;  5GAN K;  3JAS A;  2HP3 A;  3RYF A;  2CVL A;  5GON A;  1OAP A;  4O2A A;  2EWC A;  4C4W C;  3RYI A;  4DXD A;  3JCM M;  3KE1 A;  4TV8 B;  5HXU A;  3O85 A;  1M1K H;  5JVD A;  2AIZ P;  3V3T A;  3F0G A;  1YI2 F;  3V7E A;  3CYQ A;  3JAW B;  3MCQ A;  4EI7 A;  2RHO A;  3N2K A;  3T80 A;  2MQE A;  4BVT A;  4I50 B;  4ZHV A;  3G71 F;  4IIJ A;  3D00 A;  2CHS A;  2BTO A;  3VIU A;  1VQM F;  1W41 A;  4EI9 A;  3KJJ A;  1QVF F;  3HJW C;  3FFM A;  3K14 A;  1SDS A;  1VH8 A;  5IJ9 B;  5EAZ A;  5AVM A;  2H8C A;  3OBW A;  3RE3 A;  2GLZ A;  1SA0 B;  5HY4 A;  1U40 A;  4ZHQ A;  1VQN F;  3VI6 A;  1QVG F;  3MQW A;  1VQ5 F;  2RHL A; 
#chains in the Genus database with same CATH homology
 2ZOV A;  3S06 A;  2N48 A;  2LCA A;  3WPX A;  4G88 A;  2LBT A;  2AIZ P;  4ERH A;  4G4W A;  3CYQ A;  4G4V A;  3IMP A;  2ZVY A;  3WPW A;  3KHN A;  2HQS C;  4G4Z A;  3LDT A;  2MQE A;  4RHA A;  4ZHV A;  4ZHY B;  3S03 A;  5EB1 B;  3S0H A;  2ZVZ A;  3S02 A;  3S0W A;  3S0Y A;  2L26 A;  3CYP B;  4B62 A;  2ZF8 A;  4ZHW A;  2KGW A;  4B5C A;  4R40 B;  3TD3 A;  5EB0 A;  3OON A;  5EAZ A;  1OAP A;  2K1S A;  3TD5 A;  2W8B C;  1R1M A;  4PWT A;  4G4X A;  3TD4 A;  4G4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...