3OONA

The structure of an outer membrance protein from borrelia burgdorferi b31
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
123
structure length
113
Chain Sequence
NAAIEVEKNNKGINLSFDIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNILIEGHTEQFGLEEEMHELSEKRARAIGNYLIKMKVKDKDQILFKGWGSQKAKNRRVEITILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein (Tpn50)
publication title The structure of an outer membrance protein from Borrelia burgdorferi B31
rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 36
structure length 113
sequence length 123
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3oonA00
3S02A 2MQEA 2K1SA 4G4VA 3TD4A 5EB0A 3S0HA 3KHNA 2ZVZA 3LDTA 4G88A 2KGWA 3IMPA 4RHAA 3WPWA 4ZHVA 2ZOVA 1R1MA 2LCAA 4G4ZA 4G4XA 3OONA 2N48A 4PWTA 1OAPA 3TD5A 4G4WA 5EAZA 3S0WA 4B62A 2AIZP 2HQSC 3S0YA 3CYPB 4ZHWA 2L26A 3S06A 4ZHYB 3S03A 3TD3A 2ZVYA 4B5CA 2W8BC 2ZF8A 3WPXA 5EB1B 4ERHA 4R40B 3CYQA 2LBTA 4G4YA
chains in the Genus database with same CATH superfamily
3C9RA 3V3TA 2CSLA 1J7HA 1YHQF 3IKFA 4YJ3B 3LWPC 2BTQB 5KX5B 5LOVB 3CMAF 1VQ4F 1H47A 3F0FA 3JAMM 1OFUA 4ZHVA 5GONA 5HXZA 1W55A 5LP6B 3LWQC 1W5AA 5HY1A 2AIZP 1ODEA 3P4EA 2Z1UA 2L26A 3VMFB 4ZHYB 4F6RA 3UT5A 2VAMA 1H48A 5LYJA 5C8YA 3RYCB 3WJPA 1W57A 2IQQA 1IPAA 3LWVC 3BYQA 2HP0B 2UYKA 1GZ0A 3GYQA 2VGNA 3CCVF 1T0AA 3WGLA 1YITF 1W59A 2UYPA 4HNAA 4C82A 3LYBA 2EWCA 5FLXM 2ZODA 1VQPF 2ZOVA 3RYHA 4BY9D 3KE1A 2AMTA 4DRXA 5HY4A 1PXWA 1VQKF 3JATA 1RQ2A 1UI9A 1VQ7F 3MCAB 1X25A 1FNJA 4C8GA 3KJKA 3JARB 3NMUC 1JD1A 2HS0A 3S02A 2JNBA 4BT2A 2GZLA 3J80M 2HVYD 5LP6A 1VQMF 3IR9A 3G71F 3L7QA 3LDTA 2PHNA 3J81M 4X1YB 2YXZA 3VYSC 3F0DA 2ZAUA 2KG4A 4G4ZA 1Z5WA 1X7PA 4X3MA 5JCOA 4EB6B 1RA4A 3CC7F 3E1YA 1W5EA 3MDOA 1GO0A 1QVGF 3S0YA 3CPQA 1GO1A 3C9TA 1IV2A 2HP0A 2QI2A 5BMVA 1VHAA 3K12A 3DC2A 1YGYA 1COMA 2LBTA 1U43A 3CC4F 3WJQA 2CZWA 1QD9A 2GLZA 4G4VA 1VK3A 3FD6A 4O4IA 4BT5A 1IV3A 4LNUB 3NK7A 3FD5A 3T80A 2LCAA 2Z1TA 4O4JB 4ZI7B 2CWJA 3M4SA 4I4TB 2FGYA 3HTNA 3LWRC 3D54A 4YJ2B 5EYPB 3IEQA 3JCMM 1XHOA 3CC2F 2ZVYA 4NWOB 1W42A 3NVIB 3JALB 1SA0A 4X1YA 3CCLF 3ELCA 3WGNA 3V7EA 5EIBD 1W40A 1KC8H 3CD6F 2Z1EA 2KGWA 2V9YA 1XRGA 3JVHA 1R1MA 4B46A 3P10A 5AVMA 4EI8A 1VQNF 3WXMB 3WGJA 5IJ9B 5GANK 3ERNA 3ZP7A 4TZZA 2HRYA 4LNUA 2DT4A 1Q81H 1KNKA 4O2AA 4G4YA 4TUYA 3TD4A 1Q8RA 2P6YA 4O4JA 3J7AR 4I4TA 2Q1YA 5DCVA 1QVFF 4YJ2A 2I6RA 5EYPA 4I50B 3VTIC 4BVSA 4C8EA 4TV9B 2LBWA 2BTOA 3ZO8A 4ZHQB 1FFXA 1Q7YH 2UYNB 4IIJB 4X3LA 3WJRA 5FNVA 2Q1XA 3CB2A 2R751 3JASB 3N4ZA 3CMEF 5CA0A 3HWUA 2H8EA 1KNJA 3C9SA 5MN5A 1W5BA 3RYFB 1CN7A 3E20B 2H6LA 4C8IA 2B33A 1JFFB 3RA6A 4B62A 2NMUA 2HP3A 3K2XA 2UYJA 5GAPK 4NQ3A 5IT9M 5JVDB 3LFOA 1W41A 3S03A 1NMUB 3HKBB 5GIPC 3KIZA 4YJ3A 4C4WC 5KX5A 5HXUA 3OW2F 5LOVA 1VQLF 3P0ZA 1PF5A 4FFBB 5KMGB 3CCEF 1RLUA 3D00A 3HKCB 2PMPA 1TUBB 4X1IB 3WGKA 4TV9A 4TV8B 2ZVZA 3IKEA 4ZHQA 2VXYA 1S72F 3V4DA 4B45A 3RYIB 4O2BB 1U3PA 4O4LB 1K9MH 4IIJA 3RYCA 3FPIA 3F0GA 5EO3A 3JASA 2VAPA 3I55F 1XBIA 4B5CA 3DDNA 4EI9A 4DXDA 5GIOC 3F6MA 5G4UC 3VYUC 5EZYB 4U3JB 5G4VC 3EORA 3ZP4A 3I56F 1UFYA 3IMPA 3G4SF 3FFMA 1JN1A 3B6NA 5J2UB 4BVRA 1KD1H 3N2KB 1QAHA 3SIVA 3GTZA 5EWRA 3JARA 4FFBA 3RE3A 4WBNB 5KMGA 5IYZB 4ZOLB 5HP8A 2RHOA 1TVKB 1TUBA 3JAWB 4R40B 5EB1B 4TV8A 3OBYA 5LP6C 1DBFA 2ALEA 1H7MA 2I6DA 3SIUA 2OTJF 2VGMA 3CG6A 1CLIA 1GX1A 2QTPA 3RYIA 2IG8A 4O2BA 3V7QA 4EB6A 5JCOC 5HWEA 5GINC 1ZWZA 3VO8A 3KJJA 3AGKA 5EIBC 3OONA 4G4WA 1SZQA 2UZHA 2VAWA 5GONB 3NVKE 2CW4A 4X1KB 5CA1B 5B8FA 3CCUF 3S06A 4IHJB 5EZYA 4BVQA 4U3JA 2ZF8A 4ERHA 3CCSF 1RLGA 2Z01A 3VOAA 4I55B 5J2UA 1Q86H 4X20B 5LYJB 3CCMF 2QEXF 1ONIA 4G88A 4ZI7A 1X52A 2AIFA 1T0KB 5CB4B 3E22B 4WBNA 1YJWF 5IYZA 4ZOLA 3N2GB 4PWTA 1X7OA 4NUTA 2WALA 1YJ9F 1TVKA 3MCQA 1Q82H 4ZK7A 2OZBA 4E6EA 3VYTC 3JALA 3VCZA 1VQ9F 5HY2A 1JY8A 3OBWA 5MN4A 3QHDA 1VQ5F 3Q8HA 3I3FA 2LBXA 3IEWA 1M90H 1NQ3A 2MQEA 3K14A 2OTMA 4C81A 2Z1FA 3CPWF 2GVIA 3CCRF 4RHAA 3VOBA 1YJNF 4XCQA 3QTYA 4X1KA 5CA1A 3PLAC 5IJ9A 4LCKA 3QUWA 4G4XA 1RQ7A 4IHJA 2N48A 3TD5A 1K8AH 5EAZA 4BT3A 1U3LA 5MN6A 2HQSC 1K73H 2HX0A 5JH7B 4I55A 3ZOPA 1W5FA 3LMEA 4X20A 1VQVA 1M1KH 3VIUA 3U0OA 3WPXA 3G6EF 2H8CA 5LA6B 5BMVB 3NK6A 1DT9A 5EB0A 5CB4A 3E22A 1Z5VA 3N2GA 4I50A 3PAFA 5IJ0B 5J2TB 4O4IB 5LXTB 2R6R1 1YI2F 1VQOF 3HKDB 2UYNA 3MBMA 1CK2A 1IV1A 3ON1A 2RHLA 4EI7A 3JAKB 5ITZB 3CXCF 2KTVA 5FJ4C 5HP7A 3N4YA 2F9ZC 1VQ6F 1E7KA 2FC3A 3RYFA 3S0HA 3CCJF 3KHNA 1QU9A 1SA0B 5JQGB 1JFFA 2HRUA 1N8RH 5HY0A 3HKEB 5JH7A 1U40A 2RHJA 1FNKA 5JVDA 1SDSA 3HKBA 1JJ2F 4O4HB 5LA6A 3VI6A 2KTUA 3O85A 2RB9A 2CHSA 3M1XA 3HKCA 3CYQA 3HJWC 4X1IA 3WGMA 3MQWA 5IJ0A 5J2TA 2OTLF 2BTUA 2YYEA 5LXTA 1W2BF 1NJIH 4O2AB 1VQ8F 1IV4A 3HKDA 2OHWA 4TUYB 4KWEA 4O4LA 4BVTA 3WPWA 2IAFA 2DYYA 3GHZA 2HS4A 3JAKA 3M84A 4U39A 5ITZA 1OAPA 3HAXD 3S0WA 1YIJF 1YQNA 4ZHWA 2BO1A 4RQOA 3TD3A 1FSZA 3FBAA 2W8BC 2G9IA 2HS3A 1FFXB 3RA5A 5A2QM 2CVLA 5JQGA 3C9UA 1KQSF 3R0PA 2K1SA 3UT5B 3HKEA 4F6RB 2RHHA 3N2KA 5FNVB 5C8YB 3CCQF 1VH8A 3I7TA 5CA0B 4M8IA 4O4HA 1XV2A 3K0TA 2QA4F 4HNAB 4BT6A 4BT4A 3LWOC 3CYPB 3JAWA 1W3EX 3C8LA 3ESJA 2CHTA 3RYHB 4DRXB 4BW0B 3D01A 3F0EA 3JATB 4BT7A 1W581
chains in the Genus database with same CATH topology
3S02A 2MQEA 2K1SA 4G4VA 3TD4A 5EB0A 3S0HA 3KHNA 2ZVZA 3LDTA 4G88A 2KGWA 3IMPA 4RHAA 3WPWA 4ZHVA 2ZOVA 1R1MA 2LCAA 4G4ZA 4G4XA 3OONA 2N48A 4PWTA 1OAPA 3TD5A 4G4WA 5EAZA 3S0WA 4B62A 2AIZP 2HQSC 3S0YA 3CYPB 4ZHWA 2L26A 3S06A 4ZHYB 3S03A 3TD3A 2ZVYA 4B5CA 2W8BC 2ZF8A 3WPXA 5EB1B 4ERHA 4R40B 3CYQA 2LBTA 4G4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S02 A;  2MQE A;  2K1S A;  4G4V A;  3TD4 A;  5EB0 A;  3S0H A;  3KHN A;  2ZVZ A;  3LDT A;  4G88 A;  2KGW A;  3IMP A;  4RHA A;  3WPW A;  4ZHV A;  2ZOV A;  1R1M A;  2LCA A;  4G4Z A;  4G4X A;  3OON A;  2N48 A;  4PWT A;  1OAP A;  3TD5 A;  4G4W A;  5EAZ A;  3S0W A;  4B62 A;  2AIZ P;  2HQS C;  3S0Y A;  3CYP B;  4ZHW A;  2L26 A;  3S06 A;  4ZHY B;  3S03 A;  3TD3 A;  2ZVY A;  4B5C A;  2W8B C;  2ZF8 A;  3WPX A;  5EB1 B;  4ERH A;  4R40 B;  3CYQ A;  2LBT A;  4G4Y A; 
#chains in the Genus database with same CATH topology
 3C9R A;  3V3T A;  2CSL A;  1J7H A;  1YHQ F;  3IKF A;  4YJ3 B;  3LWP C;  2BTQ B;  5KX5 B;  5LOV B;  3CMA F;  1VQ4 F;  1H47 A;  3F0F A;  3JAM M;  1OFU A;  4ZHV A;  5GON A;  5HXZ A;  1W55 A;  5LP6 B;  3LWQ C;  1W5A A;  5HY1 A;  2AIZ P;  1ODE A;  3P4E A;  2Z1U A;  2L26 A;  3VMF B;  4ZHY B;  4F6R A;  3UT5 A;  2VAM A;  1H48 A;  5LYJ A;  5C8Y A;  3RYC B;  3WJP A;  1W57 A;  2IQQ A;  1IPA A;  3LWV C;  3BYQ A;  2HP0 B;  2UYK A;  1GZ0 A;  3GYQ A;  2VGN A;  3CCV F;  1T0A A;  3WGL A;  1YIT F;  1W59 A;  2UYP A;  4HNA A;  4C82 A;  3LYB A;  2EWC A;  5FLX M;  2ZOD A;  1VQP F;  2ZOV A;  3RYH A;  4BY9 D;  3KE1 A;  2AMT A;  4DRX A;  5HY4 A;  1PXW A;  1VQK F;  3JAT A;  1RQ2 A;  1UI9 A;  1VQ7 F;  3MCA B;  1X25 A;  1FNJ A;  4C8G A;  3KJK A;  3JAR B;  3NMU C;  1JD1 A;  2HS0 A;  3S02 A;  2JNB A;  4BT2 A;  2GZL A;  3J80 M;  2HVY D;  5LP6 A;  1VQM F;  3IR9 A;  3G71 F;  3L7Q A;  3LDT A;  2PHN A;  3J81 M;  4X1Y B;  2YXZ A;  3VYS C;  3F0D A;  2ZAU A;  2KG4 A;  4G4Z A;  1Z5W A;  1X7P A;  4X3M A;  5JCO A;  4EB6 B;  1RA4 A;  3CC7 F;  3E1Y A;  1W5E A;  3MDO A;  1GO0 A;  1QVG F;  3S0Y A;  3CPQ A;  1GO1 A;  3C9T A;  1IV2 A;  2HP0 A;  2QI2 A;  5BMV A;  1VHA A;  3K12 A;  3DC2 A;  1YGY A;  1COM A;  2LBT A;  1U43 A;  3CC4 F;  3WJQ A;  2CZW A;  1QD9 A;  2GLZ A;  4G4V A;  1VK3 A;  3FD6 A;  4O4I A;  4BT5 A;  1IV3 A;  4LNU B;  3NK7 A;  3FD5 A;  3T80 A;  2LCA A;  2Z1T A;  4O4J B;  4ZI7 B;  2CWJ A;  3M4S A;  4I4T B;  2FGY A;  3HTN A;  3LWR C;  3D54 A;  4YJ2 B;  5EYP B;  3IEQ A;  3JCM M;  1XHO A;  3CC2 F;  2ZVY A;  4NWO B;  1W42 A;  3NVI B;  3JAL B;  1SA0 A;  4X1Y A;  3CCL F;  3ELC A;  3WGN A;  3V7E A;  5EIB D;  1W40 A;  1KC8 H;  3CD6 F;  2Z1E A;  2KGW A;  2V9Y A;  1XRG A;  3JVH A;  1R1M A;  4B46 A;  3P10 A;  5AVM A;  4EI8 A;  1VQN F;  3WXM B;  3WGJ A;  5IJ9 B;  5GAN K;  3ERN A;  3ZP7 A;  4TZZ A;  2HRY A;  4LNU A;  2DT4 A;  1Q81 H;  1KNK A;  4O2A A;  4G4Y A;  4TUY A;  3TD4 A;  1Q8R A;  2P6Y A;  4O4J A;  3J7A R;  4I4T A;  2Q1Y A;  5DCV A;  1QVF F;  4YJ2 A;  2I6R A;  5EYP A;  4I50 B;  3VTI C;  4BVS A;  4C8E A;  4TV9 B;  2LBW A;  2BTO A;  3ZO8 A;  4ZHQ B;  1FFX A;  1Q7Y H;  2UYN B;  4IIJ B;  4X3L A;  3WJR A;  5FNV A;  2Q1X A;  3CB2 A;  2R75 1;  3JAS B;  3N4Z A;  3CME F;  5CA0 A;  3HWU A;  2H8E A;  1KNJ A;  3C9S A;  5MN5 A;  1W5B A;  3RYF B;  1CN7 A;  3E20 B;  2H6L A;  4C8I A;  2B33 A;  1JFF B;  3RA6 A;  4B62 A;  2NMU A;  2HP3 A;  3K2X A;  2UYJ A;  5GAP K;  4NQ3 A;  5IT9 M;  5JVD B;  3LFO A;  1W41 A;  3S03 A;  1NMU B;  3HKB B;  5GIP C;  3KIZ A;  4YJ3 A;  4C4W C;  5KX5 A;  5HXU A;  3OW2 F;  5LOV A;  1VQL F;  3P0Z A;  1PF5 A;  4FFB B;  5KMG B;  3CCE F;  1RLU A;  3D00 A;  3HKC B;  2PMP A;  1TUB B;  4X1I B;  3WGK A;  4TV9 A;  4TV8 B;  2ZVZ A;  3IKE A;  4ZHQ A;  2VXY A;  1S72 F;  3V4D A;  4B45 A;  3RYI B;  4O2B B;  1U3P A;  4O4L B;  1K9M H;  4IIJ A;  3RYC A;  3FPI A;  3F0G A;  5EO3 A;  3JAS A;  2VAP A;  3I55 F;  1XBI A;  4B5C A;  3DDN A;  4EI9 A;  4DXD A;  5GIO C;  3F6M A;  5G4U C;  3VYU C;  5EZY B;  4U3J B;  5G4V C;  3EOR A;  3ZP4 A;  3I56 F;  1UFY A;  3IMP A;  3G4S F;  3FFM A;  1JN1 A;  3B6N A;  5J2U B;  4BVR A;  1KD1 H;  3N2K B;  1QAH A;  3SIV A;  3GTZ A;  5EWR A;  3JAR A;  4FFB A;  3RE3 A;  4WBN B;  5KMG A;  5IYZ B;  4ZOL B;  5HP8 A;  2RHO A;  1TVK B;  1TUB A;  3JAW B;  4R40 B;  5EB1 B;  4TV8 A;  3OBY A;  5LP6 C;  1DBF A;  2ALE A;  1H7M A;  2I6D A;  3SIU A;  2OTJ F;  2VGM A;  3CG6 A;  1CLI A;  1GX1 A;  2QTP A;  3RYI A;  2IG8 A;  4O2B A;  3V7Q A;  4EB6 A;  5JCO C;  5HWE A;  5GIN C;  1ZWZ A;  3VO8 A;  3KJJ A;  3AGK A;  5EIB C;  3OON A;  4G4W A;  1SZQ A;  2UZH A;  2VAW A;  5GON B;  3NVK E;  2CW4 A;  4X1K B;  5CA1 B;  5B8F A;  3CCU F;  3S06 A;  4IHJ B;  5EZY A;  4BVQ A;  4U3J A;  2ZF8 A;  4ERH A;  3CCS F;  1RLG A;  2Z01 A;  3VOA A;  4I55 B;  5J2U A;  1Q86 H;  4X20 B;  5LYJ B;  3CCM F;  2QEX F;  1ONI A;  4G88 A;  4ZI7 A;  1X52 A;  2AIF A;  1T0K B;  5CB4 B;  3E22 B;  4WBN A;  1YJW F;  5IYZ A;  4ZOL A;  3N2G B;  4PWT A;  1X7O A;  4NUT A;  2WAL A;  1YJ9 F;  1TVK A;  3MCQ A;  1Q82 H;  4ZK7 A;  2OZB A;  4E6E A;  3VYT C;  3JAL A;  3VCZ A;  1VQ9 F;  5HY2 A;  1JY8 A;  3OBW A;  5MN4 A;  3QHD A;  1VQ5 F;  3Q8H A;  3I3F A;  2LBX A;  3IEW A;  1M90 H;  1NQ3 A;  2MQE A;  3K14 A;  2OTM A;  4C81 A;  2Z1F A;  3CPW F;  2GVI A;  3CCR F;  4RHA A;  3VOB A;  1YJN F;  4XCQ A;  3QTY A;  4X1K A;  5CA1 A;  3PLA C;  5IJ9 A;  4LCK A;  3QUW A;  4G4X A;  1RQ7 A;  4IHJ A;  2N48 A;  3TD5 A;  1K8A H;  5EAZ A;  4BT3 A;  1U3L A;  5MN6 A;  2HQS C;  1K73 H;  2HX0 A;  5JH7 B;  4I55 A;  3ZOP A;  1W5F A;  3LME A;  4X20 A;  1VQV A;  1M1K H;  3VIU A;  3U0O A;  3WPX A;  3G6E F;  2H8C A;  5LA6 B;  5BMV B;  3NK6 A;  1DT9 A;  5EB0 A;  5CB4 A;  3E22 A;  1Z5V A;  3N2G A;  4I50 A;  3PAF A;  5IJ0 B;  5J2T B;  4O4I B;  5LXT B;  2R6R 1;  1YI2 F;  1VQO F;  3HKD B;  2UYN A;  3MBM A;  1CK2 A;  1IV1 A;  3ON1 A;  2RHL A;  4EI7 A;  3JAK B;  5ITZ B;  3CXC F;  2KTV A;  5FJ4 C;  5HP7 A;  3N4Y A;  2F9Z C;  1VQ6 F;  1E7K A;  2FC3 A;  3RYF A;  3S0H A;  3CCJ F;  3KHN A;  1QU9 A;  1SA0 B;  5JQG B;  1JFF A;  2HRU A;  1N8R H;  5HY0 A;  3HKE B;  5JH7 A;  1U40 A;  2RHJ A;  1FNK A;  5JVD A;  1SDS A;  3HKB A;  1JJ2 F;  4O4H B;  5LA6 A;  3VI6 A;  2KTU A;  3O85 A;  2RB9 A;  2CHS A;  3M1X A;  3HKC A;  3CYQ A;  3HJW C;  4X1I A;  3WGM A;  3MQW A;  5IJ0 A;  5J2T A;  2OTL F;  2BTU A;  2YYE A;  5LXT A;  1W2B F;  1NJI H;  4O2A B;  1VQ8 F;  1IV4 A;  3HKD A;  2OHW A;  4TUY B;  4KWE A;  4O4L A;  4BVT A;  3WPW A;  2IAF A;  2DYY A;  3GHZ A;  2HS4 A;  3JAK A;  3M84 A;  4U39 A;  5ITZ A;  1OAP A;  3HAX D;  3S0W A;  1YIJ F;  1YQN A;  4ZHW A;  2BO1 A;  4RQO A;  3TD3 A;  1FSZ A;  3FBA A;  2W8B C;  2G9I A;  2HS3 A;  1FFX B;  3RA5 A;  5A2Q M;  2CVL A;  5JQG A;  3C9U A;  1KQS F;  3R0P A;  2K1S A;  3UT5 B;  3HKE A;  4F6R B;  2RHH A;  3N2K A;  5FNV B;  5C8Y B;  3CCQ F;  1VH8 A;  3I7T A;  5CA0 B;  4M8I A;  4O4H A;  1XV2 A;  3K0T A;  2QA4 F;  4HNA B;  4BT6 A;  4BT4 A;  3LWO C;  3CYP B;  3JAW A;  1W3E X;  3C8L A;  3ESJ A;  2CHT A;  3RYH B;  4DRX B;  4BW0 B;  3D01 A;  3F0E A;  3JAT B;  4BT7 A;  1W58 1; 
#chains in the Genus database with same CATH homology
 3S02 A;  2MQE A;  2K1S A;  4G4V A;  3TD4 A;  5EB0 A;  3S0H A;  3KHN A;  2ZVZ A;  3LDT A;  4G88 A;  2KGW A;  3IMP A;  4RHA A;  3WPW A;  4ZHV A;  2ZOV A;  1R1M A;  2LCA A;  4G4Z A;  4G4X A;  3OON A;  2N48 A;  4PWT A;  1OAP A;  3TD5 A;  4G4W A;  5EAZ A;  3S0W A;  4B62 A;  2AIZ P;  2HQS C;  3S0Y A;  3CYP B;  4ZHW A;  2L26 A;  3S06 A;  4ZHY B;  3S03 A;  3TD3 A;  2ZVY A;  4B5C A;  2W8B C;  2ZF8 A;  3WPX A;  5EB1 B;  4ERH A;  4R40 B;  3CYQ A;  2LBT A;  4G4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...