4G4XA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
108
structure length
108
Chain Sequence
AKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Peptidoglycan-associated lipoprotein
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
total genus 43
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4xA00
3S0YA 3LDTA 5EB1B 3KHNA 3S06A 1OAPA 2ZVZA 3S02A 2LBTA 3TD3A 4G4VA 4G4WA 3TD5A 4G4XA 3WPXA 5EB0A 2AIZP 4PWTA 4ZHVA 3CYPB 3OONA 4G4ZA 3S0HA 2ZF8A 2W8BC 4B5CA 4G4YA 3WPWA 2ZOVA 3S03A 1R1MA 2K1SA 5EAZA 2LCAA 4ZHYB 4ZHWA 2N48A 3TD4A 4R40B 3CYQA 2ZVYA 4ERHA 4B62A 3S0WA 2MQEA 4G88A 3IMPA 2HQSC 2L26A 4RHAA 2KGWA
chains in the Genus database with same CATH superfamily
3LDTA 1KNJA 3HKBA 2I6RA 3CCVF 5J2UB 2BTOA 4I55B 3VOAA 3MCAB 4X1IA 2ZAUA 3E20B 1RQ2A 1TVKA 2VAWA 3JAKA 4RQOA 2HP3A 1X7PA 3CCEF 3WJQA 3HTNA 4U39A 3RYCB 2MQEA 1GX1A 3N2KA 4F6RA 3CG6A 1M1KH 3U0OA 5HP7A 2H8CA 1Z5VA 1SDSA 3JCMM 3V3TA 3I56F 1VQ6F 1XV2A 5EZYA 3VIUA 2HVYD 1U3PA 3N2GA 2R751 4BT5A 1W3EX 3JALB 3RA5A 2HS3A 5JVDA 1KC8H 1SA0A 1W2BF 2IAFA 3ZOPA 4DRXA 5LP6A 2QTPA 4FFBA 4HNAB 5LA6A 4EI8A 5HY2A 3FBAA 4X1KB 2VGNA 3QTYA 3C9SA 5IJ0A 3JVHA 3RYFA 4TZZA 3CCQF 4C8GA 3S0WA 1ZWZA 3FPIA 2KGWA 3VMFB 1VQMF 3CMAF 1YI2F 4C4WC 4O2AA 4BT7A 3QHDA 1IV1A 4PWTA 4ZI7A 4BVTA 5CA0A 3T80A 3P4EA 1W41A 2OHWA 1Q7YH 3P10A 3UT5B 2BTQB 2OTLF 1X25A 1VQ5F 1VQ9F 3ZO8A 5ITZB 1GZ0A 4ZOLA 5HY0A 3J81M 2IQQA 2VXYA 2AMTA 2HS0A 3I3FA 3N4YA 5IYZB 3HKEB 5BMVB 3SIUA 3TD3A 1Q82H 2Z1FA 3G6EF 5C8YA 3WGNA 2G9IA 2I6DA 2HS4A 1KD1H 2EWCA 2H6LA 3C8LA 3OONA 4IIJB 3R0PA 4IHJB 2Q1XA 2CZWA 3D00A 5JH7B 3V7QA 1XRGA 5LOVB 2QA4F 2GZLA 4YJ3A 1RA4A 4I4TA 4U3JB 5KMGA 2CHSA 1H48A 2CHTA 2NMUA 4LNUB 4RHAA 3OBYA 5HXUA 3JATA 4C8IA 1RQ7A 3V7EA 2Z1EA 4EB6A 1W5FA 4XCQA 2JNBA 2RHLA 3CC2F 4ZHQB 5IJ9A 3RYHB 1YIJF 1K9MH 1VQLF 3SIVA 5FNVB 3RYIA 4EI9A 3KJKA 1W5EA 5HY1A 3FD5A 5EO3A 3S03A 4BVRA 3D54A 3CPWF 3VO8A 5KX5A 3VYUC 5GIPC 1NQ3A 3CYQA 5A2QM 2ZODA 1GO0A 1KNKA 5EYPA 3JAMM 4BT3A 1QU9A 2ALEA 1XBIA 2V9YA 1VQVA 3HJWC 2KG4A 4O4HB 4C81A 4I50A 3F0FA 4G4VA 3HKDB 2H8EA 5GONB 2OZBA 1VQPF 4DXDA 3KE1A 1QVGF 1UI9A 5EWRA 3NVIB 3LMEA 3VOBA 2HP0B 3HAXD 2PMPA 4WBNB 3F6MA 5EAZA 2ZVYA 3HKBB 1H47A 3VI6A 1VQ7F 1W42A 5HWEA 4X1IB 2LBXA 3J80M 1JFFA 2HRUA 1TVKB 3KHNA 3IEQA 3K12A 3CCSF 2Z1UA 3JAKB 4TV8A 3WJPA 3K0TA 5J2TA 3RA6A 3QUWA 3K2XA 1Q86H 2F9ZC 3AGKA 4O4JA 1YJ9F 3MCQA 4G4XA 3VCZA 1VHAA 1N8RH 2CVLA 4X1YA 3CYPB 3M1XA 3O85A 2AIFA 1R1MA 2UYKA 3HKCA 5MN6A 3JALA 4NWOB 5JQGB 2GVIA 1FFXB 1W59A 3CXCF 1SZQA 2WALA 1W5BA 3LWQC 2KTUA 3S0HA 3LYBA 1FSZA 3DDNA 1TUBA 3I55F 1IV3A 5JVDB 4BW0B 4G4WA 1SA0B 3TD5A 1S72F 4DRXB 4X20B 5LP6B 3NK7A 4YJ2A 4FFBB 5LA6B 3LWOC 5GANK 3C9TA 4E6EA 5IJ0B 3PLAC 1U43A 1YGYA 2UYNA 3RYFB 4BT2A 1JJ2F 1QAHA 3I7TA 3V4DA 3EORA 3ERNA 4O2BA 4KWEA 4TUYB 4C8EA 1XHOA 2CSLA 2CW4A 1Q81H 3F0EA 4O2AB 3WGJA 1Z5WA 1QVFF 1VH8A 3UT5A 3JAWA 1JD1A 1W55A 3NVKE 5CA0B 5LXTA 1IV2A 1YJNF 5CA1A 5MN5A 1UFYA 2QI2A 3K14A 5B8FA 4M8IA 3DC2A 4O4IB 2ZOVA 3M84A 4TV9A 3JARA 3CC4F 2K1SA 4BY9D 1E7KA 3VTIC 4IIJA 4NQ3A 4IHJA 3G4SF 1YHQF 3E1YA 2OTJF 5C8YB 5CB4A 4G88A 4B46A 1W40A 2L26A 4ZK7A 5LYJA 2RB9A 4BT6A 3F0DA 3CMEF 2VAPA 2OTMA 2AIZP 4YJ3B 1T0KB 3WGMA 5KMGB 1PF5A 3KIZA 3IKEA 3E22A 3JASA 2N48A 5EIBD 3CPQA 1VQNF 4EB6B 4B45A 5HP8A 5IJ9B 5FJ4C 3RYIB 3S0YA 3GYQA 5EB1B 3CCJF 1CK2A 3HWUA 3MDOA 3WGKA 5FLXM 5G4UC 1U40A 3LWVC 3G71F 2BTUA 3MBMA 1CN7A 2W8BC 5J2UA 5GONA 2P6YA 4I55A 4O4LB 5EYPB 3B6NA 4ZHYB 3ON1A 1RLGA 2CWJA 5HXZA 3LWPC 4B62A 3IEWA 1YQNA 4I50B 1CLIA 3C9RA 5G4VC 2YYEA 2B33A 2UZHA 3VYTC 1RLUA 2UYJA 2KTVA 3RYCA 1K8AH 3Q8HA 3RE3A 3M4SA 3NMUC 1ODEA 1FNKA 4NUTA 3CCLF 2Q1YA 3FFMA 2PHNA 2VGMA 3NK6A 3WXMB 4G4YA 5GIOC 2R6R1 1VQKF 1JFFB 3N2KB 2Z01A 4F6RB 1ONIA 4TV8B 1NMUB 1W5AA 5J2TB 5DCVA 5MN4A 4O4JB 3ESJA 3LFOA 1VK3A 1GO1A 4HNAA 5EZYB 5JQGA 3C9UA 3N2GB 4X1YB 1OAPA 4X1KA 1FFXA 3WGLA 3J7AR 2IG8A 2LBTA 3HKCB 1OFUA 1NJIH 4ZHVA 4C82A 5JCOC 4G4ZA 2ZF8A 4LCKA 4X20A 2GLZA 2LCAA 3OBWA 2VAMA 1TUBB 3FD6A 3WJRA 1X52A 3CD6F 1QD9A 1DBFA 2HRYA 2QEXF 4YJ2B 4TUYA 1DT9A 2HX0A 3IR9A 5EIBC 2ZVZA 4ZI7B 4X3MA 3S02A 2UYNB 2BO1A 5ITZA 1VQ4F 3ELCA 3P0ZA 4O2BB 5EB0A 1VQ8F 5IYZA 3HKEA 5BMVA 3CCRF 3L7QA 1PXWA 3JAWB 4ZOLB 1W581 1IV4A 1JN1A 5LXTB 4O4IA 1Q8RA 5CA1B 5JH7A 5LOVA 3IMPA 2HQSC 1K73H 3VYSC 3S06A 3CC7F 1IPAA 4BVQA 4U3JA 1H7MA 3OW2F 3ZP7A 5LP6C 4TV9B 1T0AA 3JARB 3CCUF 4LNUA 1U3LA 3WPXA 3ZP4A 5GINC 1J7HA 2RHHA 4I4TB 4B5CA 3D01A 5CB4B 3F0GA 5IT9M 1M90H 2RHOA 3MQWA 4X3LA 4ZHQA 3RYHA 3TD4A 5FNVA 5LYJB 4BVSA 3JATB 1JY8A 5HY4A 3GHZA 2Z1TA 3IKFA 5GAPK 3LWRC 3CB2A 3N4ZA 2DT4A 1FNJA 5AVMA 1KQSF 3GTZA 1YJWF 2FC3A 1W57A 3E22B 3JASB 4BT4A 5KX5B 2YXZA 2RHJA 4O4HA 3WPWA 3KJJA 3HKDA 3CCMF 3PAFA 1VQOF 4ZHWA 1X7OA 2LBWA 4EI7A 4R40B 4ERHA 2DYYA 4O4LA 2HP0A 5JCOA 4WBNA 3BYQA 2UYPA 1COMA 1YITF 2FGYA
chains in the Genus database with same CATH topology
3S0YA 3LDTA 5EB1B 3KHNA 3S06A 1OAPA 2ZVZA 3S02A 2LBTA 3TD3A 4G4VA 4G4WA 3TD5A 4G4XA 3WPXA 5EB0A 2AIZP 4PWTA 4ZHVA 3CYPB 3OONA 4G4ZA 3S0HA 2ZF8A 2W8BC 4B5CA 4G4YA 3WPWA 2ZOVA 3S03A 1R1MA 2K1SA 5EAZA 2LCAA 4ZHYB 4ZHWA 2N48A 3TD4A 4R40B 3CYQA 2ZVYA 4ERHA 4B62A 3S0WA 2MQEA 4G88A 3IMPA 2HQSC 2L26A 4RHAA 2KGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0Y A;  3LDT A;  5EB1 B;  3KHN A;  3S06 A;  1OAP A;  2ZVZ A;  3S02 A;  2LBT A;  3TD3 A;  4G4V A;  4G4W A;  3TD5 A;  4G4X A;  3WPX A;  5EB0 A;  2AIZ P;  4PWT A;  4ZHV A;  3CYP B;  3OON A;  4G4Z A;  3S0H A;  2ZF8 A;  2W8B C;  4B5C A;  4G4Y A;  3WPW A;  2ZOV A;  3S03 A;  1R1M A;  2K1S A;  5EAZ A;  2LCA A;  4ZHY B;  4ZHW A;  2N48 A;  3TD4 A;  4R40 B;  3CYQ A;  2ZVY A;  4ERH A;  4B62 A;  3S0W A;  2MQE A;  4G88 A;  3IMP A;  2HQS C;  2L26 A;  4RHA A;  2KGW A; 
#chains in the Genus database with same CATH topology
 3LDT A;  1KNJ A;  3HKB A;  2I6R A;  3CCV F;  5J2U B;  2BTO A;  4I55 B;  3VOA A;  3MCA B;  4X1I A;  2ZAU A;  3E20 B;  1RQ2 A;  1TVK A;  2VAW A;  3JAK A;  4RQO A;  2HP3 A;  1X7P A;  3CCE F;  3WJQ A;  3HTN A;  4U39 A;  3RYC B;  2MQE A;  1GX1 A;  3N2K A;  4F6R A;  3CG6 A;  1M1K H;  3U0O A;  5HP7 A;  2H8C A;  1Z5V A;  1SDS A;  3JCM M;  3V3T A;  3I56 F;  1VQ6 F;  1XV2 A;  5EZY A;  3VIU A;  2HVY D;  1U3P A;  3N2G A;  2R75 1;  4BT5 A;  1W3E X;  3JAL B;  3RA5 A;  2HS3 A;  5JVD A;  1KC8 H;  1SA0 A;  1W2B F;  2IAF A;  3ZOP A;  4DRX A;  5LP6 A;  2QTP A;  4FFB A;  4HNA B;  5LA6 A;  4EI8 A;  5HY2 A;  3FBA A;  4X1K B;  2VGN A;  3QTY A;  3C9S A;  5IJ0 A;  3JVH A;  3RYF A;  4TZZ A;  3CCQ F;  4C8G A;  3S0W A;  1ZWZ A;  3FPI A;  2KGW A;  3VMF B;  1VQM F;  3CMA F;  1YI2 F;  4C4W C;  4O2A A;  4BT7 A;  3QHD A;  1IV1 A;  4PWT A;  4ZI7 A;  4BVT A;  5CA0 A;  3T80 A;  3P4E A;  1W41 A;  2OHW A;  1Q7Y H;  3P10 A;  3UT5 B;  2BTQ B;  2OTL F;  1X25 A;  1VQ5 F;  1VQ9 F;  3ZO8 A;  5ITZ B;  1GZ0 A;  4ZOL A;  5HY0 A;  3J81 M;  2IQQ A;  2VXY A;  2AMT A;  2HS0 A;  3I3F A;  3N4Y A;  5IYZ B;  3HKE B;  5BMV B;  3SIU A;  3TD3 A;  1Q82 H;  2Z1F A;  3G6E F;  5C8Y A;  3WGN A;  2G9I A;  2I6D A;  2HS4 A;  1KD1 H;  2EWC A;  2H6L A;  3C8L A;  3OON A;  4IIJ B;  3R0P A;  4IHJ B;  2Q1X A;  2CZW A;  3D00 A;  5JH7 B;  3V7Q A;  1XRG A;  5LOV B;  2QA4 F;  2GZL A;  4YJ3 A;  1RA4 A;  4I4T A;  4U3J B;  5KMG A;  2CHS A;  1H48 A;  2CHT A;  2NMU A;  4LNU B;  4RHA A;  3OBY A;  5HXU A;  3JAT A;  4C8I A;  1RQ7 A;  3V7E A;  2Z1E A;  4EB6 A;  1W5F A;  4XCQ A;  2JNB A;  2RHL A;  3CC2 F;  4ZHQ B;  5IJ9 A;  3RYH B;  1YIJ F;  1K9M H;  1VQL F;  3SIV A;  5FNV B;  3RYI A;  4EI9 A;  3KJK A;  1W5E A;  5HY1 A;  3FD5 A;  5EO3 A;  3S03 A;  4BVR A;  3D54 A;  3CPW F;  3VO8 A;  5KX5 A;  3VYU C;  5GIP C;  1NQ3 A;  3CYQ A;  5A2Q M;  2ZOD A;  1GO0 A;  1KNK A;  5EYP A;  3JAM M;  4BT3 A;  1QU9 A;  2ALE A;  1XBI A;  2V9Y A;  1VQV A;  3HJW C;  2KG4 A;  4O4H B;  4C81 A;  4I50 A;  3F0F A;  4G4V A;  3HKD B;  2H8E A;  5GON B;  2OZB A;  1VQP F;  4DXD A;  3KE1 A;  1QVG F;  1UI9 A;  5EWR A;  3NVI B;  3LME A;  3VOB A;  2HP0 B;  3HAX D;  2PMP A;  4WBN B;  3F6M A;  5EAZ A;  2ZVY A;  3HKB B;  1H47 A;  3VI6 A;  1VQ7 F;  1W42 A;  5HWE A;  4X1I B;  2LBX A;  3J80 M;  1JFF A;  2HRU A;  1TVK B;  3KHN A;  3IEQ A;  3K12 A;  3CCS F;  2Z1U A;  3JAK B;  4TV8 A;  3WJP A;  3K0T A;  5J2T A;  3RA6 A;  3QUW A;  3K2X A;  1Q86 H;  2F9Z C;  3AGK A;  4O4J A;  1YJ9 F;  3MCQ A;  4G4X A;  3VCZ A;  1VHA A;  1N8R H;  2CVL A;  4X1Y A;  3CYP B;  3M1X A;  3O85 A;  2AIF A;  1R1M A;  2UYK A;  3HKC A;  5MN6 A;  3JAL A;  4NWO B;  5JQG B;  2GVI A;  1FFX B;  1W59 A;  3CXC F;  1SZQ A;  2WAL A;  1W5B A;  3LWQ C;  2KTU A;  3S0H A;  3LYB A;  1FSZ A;  3DDN A;  1TUB A;  3I55 F;  1IV3 A;  5JVD B;  4BW0 B;  4G4W A;  1SA0 B;  3TD5 A;  1S72 F;  4DRX B;  4X20 B;  5LP6 B;  3NK7 A;  4YJ2 A;  4FFB B;  5LA6 B;  3LWO C;  5GAN K;  3C9T A;  4E6E A;  5IJ0 B;  3PLA C;  1U43 A;  1YGY A;  2UYN A;  3RYF B;  4BT2 A;  1JJ2 F;  1QAH A;  3I7T A;  3V4D A;  3EOR A;  3ERN A;  4O2B A;  4KWE A;  4TUY B;  4C8E A;  1XHO A;  2CSL A;  2CW4 A;  1Q81 H;  3F0E A;  4O2A B;  3WGJ A;  1Z5W A;  1QVF F;  1VH8 A;  3UT5 A;  3JAW A;  1JD1 A;  1W55 A;  3NVK E;  5CA0 B;  5LXT A;  1IV2 A;  1YJN F;  5CA1 A;  5MN5 A;  1UFY A;  2QI2 A;  3K14 A;  5B8F A;  4M8I A;  3DC2 A;  4O4I B;  2ZOV A;  3M84 A;  4TV9 A;  3JAR A;  3CC4 F;  2K1S A;  4BY9 D;  1E7K A;  3VTI C;  4IIJ A;  4NQ3 A;  4IHJ A;  3G4S F;  1YHQ F;  3E1Y A;  2OTJ F;  5C8Y B;  5CB4 A;  4G88 A;  4B46 A;  1W40 A;  2L26 A;  4ZK7 A;  5LYJ A;  2RB9 A;  4BT6 A;  3F0D A;  3CME F;  2VAP A;  2OTM A;  2AIZ P;  4YJ3 B;  1T0K B;  3WGM A;  5KMG B;  1PF5 A;  3KIZ A;  3IKE A;  3E22 A;  3JAS A;  2N48 A;  5EIB D;  3CPQ A;  1VQN F;  4EB6 B;  4B45 A;  5HP8 A;  5IJ9 B;  5FJ4 C;  3RYI B;  3S0Y A;  3GYQ A;  5EB1 B;  3CCJ F;  1CK2 A;  3HWU A;  3MDO A;  3WGK A;  5FLX M;  5G4U C;  1U40 A;  3LWV C;  3G71 F;  2BTU A;  3MBM A;  1CN7 A;  2W8B C;  5J2U A;  5GON A;  2P6Y A;  4I55 A;  4O4L B;  5EYP B;  3B6N A;  4ZHY B;  3ON1 A;  1RLG A;  2CWJ A;  5HXZ A;  3LWP C;  4B62 A;  3IEW A;  1YQN A;  4I50 B;  1CLI A;  3C9R A;  5G4V C;  2YYE A;  2B33 A;  2UZH A;  3VYT C;  1RLU A;  2UYJ A;  2KTV A;  3RYC A;  1K8A H;  3Q8H A;  3RE3 A;  3M4S A;  3NMU C;  1ODE A;  1FNK A;  4NUT A;  3CCL F;  2Q1Y A;  3FFM A;  2PHN A;  2VGM A;  3NK6 A;  3WXM B;  4G4Y A;  5GIO C;  2R6R 1;  1VQK F;  1JFF B;  3N2K B;  2Z01 A;  4F6R B;  1ONI A;  4TV8 B;  1NMU B;  1W5A A;  5J2T B;  5DCV A;  5MN4 A;  4O4J B;  3ESJ A;  3LFO A;  1VK3 A;  1GO1 A;  4HNA A;  5EZY B;  5JQG A;  3C9U A;  3N2G B;  4X1Y B;  1OAP A;  4X1K A;  1FFX A;  3WGL A;  3J7A R;  2IG8 A;  2LBT A;  3HKC B;  1OFU A;  1NJI H;  4ZHV A;  4C82 A;  5JCO C;  4G4Z A;  2ZF8 A;  4LCK A;  4X20 A;  2GLZ A;  2LCA A;  3OBW A;  2VAM A;  1TUB B;  3FD6 A;  3WJR A;  1X52 A;  3CD6 F;  1QD9 A;  1DBF A;  2HRY A;  2QEX F;  4YJ2 B;  4TUY A;  1DT9 A;  2HX0 A;  3IR9 A;  5EIB C;  2ZVZ A;  4ZI7 B;  4X3M A;  3S02 A;  2UYN B;  2BO1 A;  5ITZ A;  1VQ4 F;  3ELC A;  3P0Z A;  4O2B B;  5EB0 A;  1VQ8 F;  5IYZ A;  3HKE A;  5BMV A;  3CCR F;  3L7Q A;  1PXW A;  3JAW B;  4ZOL B;  1W58 1;  1IV4 A;  1JN1 A;  5LXT B;  4O4I A;  1Q8R A;  5CA1 B;  5JH7 A;  5LOV A;  3IMP A;  2HQS C;  1K73 H;  3VYS C;  3S06 A;  3CC7 F;  1IPA A;  4BVQ A;  4U3J A;  1H7M A;  3OW2 F;  3ZP7 A;  5LP6 C;  4TV9 B;  1T0A A;  3JAR B;  3CCU F;  4LNU A;  1U3L A;  3WPX A;  3ZP4 A;  5GIN C;  1J7H A;  2RHH A;  4I4T B;  4B5C A;  3D01 A;  5CB4 B;  3F0G A;  5IT9 M;  1M90 H;  2RHO A;  3MQW A;  4X3L A;  4ZHQ A;  3RYH A;  3TD4 A;  5FNV A;  5LYJ B;  4BVS A;  3JAT B;  1JY8 A;  5HY4 A;  3GHZ A;  2Z1T A;  3IKF A;  5GAP K;  3LWR C;  3CB2 A;  3N4Z A;  2DT4 A;  1FNJ A;  5AVM A;  1KQS F;  3GTZ A;  1YJW F;  2FC3 A;  1W57 A;  3E22 B;  3JAS B;  4BT4 A;  5KX5 B;  2YXZ A;  2RHJ A;  4O4H A;  3WPW A;  3KJJ A;  3HKD A;  3CCM F;  3PAF A;  1VQO F;  4ZHW A;  1X7O A;  2LBW A;  4EI7 A;  4R40 B;  4ERH A;  2DYY A;  4O4L A;  2HP0 A;  5JCO A;  4WBN A;  3BYQ A;  2UYP A;  1COM A;  1YIT F;  2FGY A; 
#chains in the Genus database with same CATH homology
 3S0Y A;  3LDT A;  5EB1 B;  3KHN A;  3S06 A;  1OAP A;  2ZVZ A;  3S02 A;  2LBT A;  3TD3 A;  4G4V A;  4G4W A;  3TD5 A;  4G4X A;  3WPX A;  5EB0 A;  2AIZ P;  4PWT A;  4ZHV A;  3CYP B;  3OON A;  4G4Z A;  3S0H A;  2ZF8 A;  2W8B C;  4B5C A;  4G4Y A;  3WPW A;  2ZOV A;  3S03 A;  1R1M A;  2K1S A;  5EAZ A;  2LCA A;  4ZHY B;  4ZHW A;  2N48 A;  3TD4 A;  4R40 B;  3CYQ A;  2ZVY A;  4ERH A;  4B62 A;  3S0W A;  2MQE A;  4G88 A;  3IMP A;  2HQS C;  2L26 A;  4RHA A;  2KGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...