4G4XA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
108
structure length
108
Chain Sequence
AKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
molecule keywords Peptidoglycan-associated lipoprotein
total genus 43
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4xA00
3WPXA 2K1SA 4G4WA 2ZVZA 5EAZA 4B62A 2KGWA 2ZF8A 3IMPA 4ZHWA 3LDTA 2HQSC 1R1MA 4R40B 3CYPB 3CYQA 2MQEA 4ZHYB 3TD3A 2AIZP 2L26A 2LCAA 4G4XA 4G88A 3S02A 3OONA 5EB1B 2ZOVA 3S0WA 3S03A 4RHAA 4G4VA 3S0HA 3WPWA 2ZVYA 3KHNA 4B5CA 3S0YA 2W8BC 3S06A 5EB0A 4PWTA 1OAPA 2LBTA 3TD5A 3TD4A 4ERHA 4G4ZA 4ZHVA 4G4YA 2N48A
chains in the Genus database with same CATH superfamily
3MCQA 2KGWA 4ZHWA 1VHAA 3WJPA 1K8AH 2HQSC 1FFXA 4X3MA 1UI9A 2RHLA 1W2BF 3G6EF 4XCQA 2IAFA 3K12A 1VQKF 2Z1TA 3HKBA 3CCEF 4C4WC 3VI6A 1IV3A 5IJ0B 1RA4A 2H8EA 4EB6A 4BVRA 1Q8RA 1S72F 3E1YA 3JATA 5HP8A 3CCVF 3M4SA 3IKFA 5IYZB 3JARB 4C8EA 5LP6B 3CCLF 3WPXA 3B6NA 2ZODA 5EZYB 1U40A 3LWQC 4M8IA 1J7HA 5EIBD 5LP6A 1M90H 5JQGA 2L26A 1W5FA 2ZAUA 2EWCA 3GYQA 3OONA 4I50A 1X7OA 3KHNA 5LXTA 3RYFB 1W5AA 3S0YA 3NK7A 1N8RH 1QVGF 2JNBA 3LWOC 1U43A 2HX0A 2LBTA 2VAWA 3HKEB 3F0EA 4G4ZA 4C81A 3V7EA 3M1XA 2HS0A 3P0ZA 1FFXB 2QTPA 2UZHA 5LYJA 3LDTA 4C8GA 1QVFF 4BT2A 3VMFB 3J81M 4ZHQA 3E20B 5AVMA 1ONIA 4G88A 5C8YA 3JAWB 3V4DA 2ZVYA 3CCRF 1VQ6F 2UYKA 3ESJA 3IR9A 3VIUA 4TV8B 3OBYA 4X20B 3ELCA 4ZHVA 2KTUA 4G4YA 4DRXA 4F6RB 4O2BA 4IIJA 3WGMA 3QUWA 1W41A 2B33A 3C9UA 5KMGB 3Q8HA 5GONB 3I55F 1VH8A 3WGLA 5FJ4C 3HJWC 3FPIA 1SZQA 3D54A 3S02A 3ZP4A 1NQ3A 5A2QM 3F0FA 1CN7A 3N2GA 5B8FA 1IPAA 5GAPK 1Q86H 4IHJB 1PF5A 4O2BB 3TD4A 3JATB 4O2AB 3HKDA 3DDNA 2K1SA 3DC2A 3IMPA 1VK3A 5HY1A 2DYYA 1VQMF 4BW0B 1W3EX 1XRGA 2CVLA 3VTIC 4YJ2A 3LWVC 1VQ4F 1QU9A 1VQ5F 4NWOB 5JCOC 1H7MA 1QD9A 3P10A 5GIPC 1VQVA 1YQNA 4NQ3A 1GO0A 2LBXA 3C9TA 3KIZA 2UYNA 3VO8A 3WJQA 1DBFA 3EORA 2VAPA 3CC4F 2R6R1 1QAHA 3MBMA 3CCUF 1KD1H 3RYCA 1TUBA 4X1IB 2UYPA 4BVSA 1CK2A 4LNUB 3GHZA 1Q82H 3UT5B 3K14A 2AIZP 2LCAA 4I50B 5ITZA 1UFYA 4F6RA 3RYHB 3G71F 2YXZA 4TV8A 4ZOLA 1YJNF 1JFFA 3CCMF 3S06A 2OHWA 1M1KH 1JJ2F 4PWTA 1OAPA 3AGKA 2CW4A 1VQOF 2BTOA 5CA0B 4ERHA 4X1YB 1KQSF 5EB1B 2Z1FA 4EB6B 2QI2A 3V7QA 3GTZA 4B45A 3CXCF 2MQEA 5LYJB 3SIVA 1W55A 5LP6C 4I55A 4O4LA 3JAMM 1COMA 1JY8A 1W40A 2Z1UA 4ZI7B 5MN6A 3ZO8A 4U3JA 4BT7A 3RYFA 5BMVA 1YIJF 5CA1B 4TV9A 2CSLA 1TVKB 1E7KA 3J80M 5HY2A 1Z5WA 3N4ZA 4G4WA 2ZVZA 4TUYB 5JQGB 5HY0A 5JH7A 4O4JA 1ODEA 4U39A 5IJ9B 3CYQA 2AMTA 5EZYA 2IQQA 4NUTA 4HNAA 1JFFB 1XHOA 4LCKA 3CMEF 5GIOC 1YITF 5MN4A 3RA5A 3CD6F 5FNVA 3VYUC 1RQ7A 3VYTC 3U0OA 2QEXF 3S0WA 2H8CA 3NVKE 1XV2A 3OBWA 4X1KB 1H48A 4KWEA 3CPQA 2CWJA 5LOVA 3RYCB 2VGMA 1CLIA 2ZF8A 4I55B 4YJ3B 3CYPB 1GO1A 1VQ7F 1RQ2A 3KE1A 3PLAC 3NMUC 1NJIH 3CCJF 1YJWF 1SA0A 2HRUA 2RB9A 2V9YA 3RYIB 4BT4A 4YJ3A 1W57A 3ZOPA 4WBNA 2HP0A 4FFBA 4X1KA 2OTLF 3JAKA 1YGYA 2HRYA 3CG6A 2VGNA 3CPWF 1YHQF 3TD5A 4O4HA 5EYPA 4BT5A 3IKEA 3N2KB 2OZBA 3J7AR 3RYHA 1YI2F 3JVHA 5KX5B 3N2KA 5ITZB 4RQOA 2IG8A 4IHJA 4BT3A 4BY9D 2Q1YA 1H47A 5MN5A 1T0AA 4RHAA 3WGJA 5G4VC 3VCZA 2LBWA 3RYIA 3E22B 3ON1A 5EIBC 3F0GA 3IEQA 2G9IA 4TZZA 2RHHA 1NMUB 3OW2F 2NMUA 1U3PA 5BMVB 3D00A 3VYSC 5FLXM 4C8IA 5GINC 2OTMA 4O4IA 5LA6A 5JVDA 3N4YA 3MQWA 4R40B 1U3LA 2GZLA 5EYPB 1W59A 3TD3A 4E6EA 4EI9A 3HKCB 2ZOVA 3S03A 1PXWA 3FBAA 3I3FA 1VQ8F 1T0KB 3S0HA 3C9SA 3HKDB 2WALA 5HXUA 4O4IB 4O2AA 5C8YB 2KG4A 4X3LA 3LYBA 3PAFA 4WBNB 1FNJA 1X7PA 3D01A 3JALB 1SA0B 3NVIB 1KNJA 5HWEA 1W5EA 1GX1A 4ZK7A 2R751 4ZOLB 1KC8H 1SDSA 2P6YA 2CHSA 3R0PA 3VOAA 3HTNA 3VOBA 3WGNA 4BT6A 5LOVB 2I6DA 3CMAF 5EWRA 1TVKA 5KMGA 5CA1A 3CB2A 1KNKA 1X25A 3LFOA 2KTVA 4LNUA 4EI7A 4I4TB 4DRXB 5J2TA 2W8BC 3SIUA 3CC2F 3IEWA 3CC7F 3RE3A 5EB0A 4O4HB 2HP3A 1DT9A 3K2XA 2I6RA 4B46A 3JASA 2HS3A 4B62A 3JAKB 3ZP7A 3JARA 3JAWA 5IYZA 1YJ9F 3FD6A 3M84A 4X1YA 2HS4A 4YJ2B 5CA0A 2Q1XA 2BTUA 3FD5A 3JASB 3FFMA 1Q7YH 1GZ0A 4U3JB 2UYJA 4B5CA 5JVDB 5LA6B 5J2TB 4I4TA 2Z01A 3CCSF 2OTJF 2DT4A 4EI8A 2N48A 3KJKA 5HXZA 2HVYD 3N2GB 1VQLF 1W42A 3C9RA 5HY4A 2PHNA 3E22A 3JCMM 1X52A 1Z5VA 3WJRA 2VAMA 1VQNF 4HNAB 4G4XA 2Z1EA 3LMEA 5EO3A 3WPWA 5IJ9A 3HAXD 3JALA 4O4JB 1K9MH 1RLGA 3NK6A 3LWPC 3ERNA 3I56F 3MCAB 4BVQA 1XBIA 4TV9B 3F6MA 3MDOA 3HKCA 3UT5A 5IJ0A 5HP7A 5EAZA 2RHOA 3HKBB 2VXYA 3G4SF 2RHJA 3O85A 1IV1A 1JN1A 4ZI7A 3CCQF 2QA4F 2FGYA 1TUBB 1R1MA 3QTYA 4X1IA 5GANK 2HP0B 4O4LB 4ZHYB 5CB4A 1FNKA 1W581 1VQ9F 2GVIA 1K73H 3RA6A 2AIFA 3K0TA 5CB4B 4BVTA 3HKEA 5J2UB 2H6LA 5GONA 2PMPA 1IV2A 1ZWZA 3L7QA 4DXDA 5IT9M 4IIJB 5LXTB 2F9ZC 2GLZA 5FNVB 3QHDA 2YYEA 1IV4A 3KJJA 3V3TA 5KX5A 2BO1A 5G4UC 1RLUA 1OFUA 3F0DA 3I7TA 3P4EA 4X20A 5JCOA 2CZWA 4C82A 2FC3A 3LWRC 1Q81H 4G4VA 3BYQA 3HWUA 5DCVA 3WXMB 2BTQB 5J2UA 3WGKA 2CHTA 4FFBB 1JD1A 3T80A 5JH7B 1VQPF 1W5BA 1FSZA 4TUYA 4ZHQB 2UYNB 3C8LA 2ALEA
chains in the Genus database with same CATH topology
3WPXA 2K1SA 4G4WA 2ZVZA 5EAZA 4B62A 2KGWA 2ZF8A 3IMPA 4ZHWA 3LDTA 2HQSC 1R1MA 4R40B 3CYPB 3CYQA 2MQEA 4ZHYB 3TD3A 2AIZP 2L26A 2LCAA 4G4XA 4G88A 3S02A 3OONA 5EB1B 2ZOVA 3S0WA 3S03A 4RHAA 4G4VA 3S0HA 3WPWA 2ZVYA 3KHNA 4B5CA 3S0YA 2W8BC 3S06A 5EB0A 4PWTA 1OAPA 2LBTA 3TD5A 3TD4A 4ERHA 4G4ZA 4ZHVA 4G4YA 2N48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPX A;  2K1S A;  4G4W A;  2ZVZ A;  5EAZ A;  4B62 A;  2KGW A;  2ZF8 A;  3IMP A;  4ZHW A;  3LDT A;  2HQS C;  1R1M A;  4R40 B;  3CYP B;  3CYQ A;  2MQE A;  4ZHY B;  3TD3 A;  2AIZ P;  2L26 A;  2LCA A;  4G4X A;  4G88 A;  3S02 A;  3OON A;  5EB1 B;  2ZOV A;  3S0W A;  3S03 A;  4RHA A;  4G4V A;  3S0H A;  3WPW A;  2ZVY A;  3KHN A;  4B5C A;  3S0Y A;  2W8B C;  3S06 A;  5EB0 A;  4PWT A;  1OAP A;  2LBT A;  3TD5 A;  3TD4 A;  4ERH A;  4G4Z A;  4ZHV A;  4G4Y A;  2N48 A; 
#chains in the Genus database with same CATH topology
 3MCQ A;  2KGW A;  4ZHW A;  1VHA A;  3WJP A;  1K8A H;  2HQS C;  1FFX A;  4X3M A;  1UI9 A;  2RHL A;  1W2B F;  3G6E F;  4XCQ A;  2IAF A;  3K12 A;  1VQK F;  2Z1T A;  3HKB A;  3CCE F;  4C4W C;  3VI6 A;  1IV3 A;  5IJ0 B;  1RA4 A;  2H8E A;  4EB6 A;  4BVR A;  1Q8R A;  1S72 F;  3E1Y A;  3JAT A;  5HP8 A;  3CCV F;  3M4S A;  3IKF A;  5IYZ B;  3JAR B;  4C8E A;  5LP6 B;  3CCL F;  3WPX A;  3B6N A;  2ZOD A;  5EZY B;  1U40 A;  3LWQ C;  4M8I A;  1J7H A;  5EIB D;  5LP6 A;  1M90 H;  5JQG A;  2L26 A;  1W5F A;  2ZAU A;  2EWC A;  3GYQ A;  3OON A;  4I50 A;  1X7O A;  3KHN A;  5LXT A;  3RYF B;  1W5A A;  3S0Y A;  3NK7 A;  1N8R H;  1QVG F;  2JNB A;  3LWO C;  1U43 A;  2HX0 A;  2LBT A;  2VAW A;  3HKE B;  3F0E A;  4G4Z A;  4C81 A;  3V7E A;  3M1X A;  2HS0 A;  3P0Z A;  1FFX B;  2QTP A;  2UZH A;  5LYJ A;  3LDT A;  4C8G A;  1QVF F;  4BT2 A;  3VMF B;  3J81 M;  4ZHQ A;  3E20 B;  5AVM A;  1ONI A;  4G88 A;  5C8Y A;  3JAW B;  3V4D A;  2ZVY A;  3CCR F;  1VQ6 F;  2UYK A;  3ESJ A;  3IR9 A;  3VIU A;  4TV8 B;  3OBY A;  4X20 B;  3ELC A;  4ZHV A;  2KTU A;  4G4Y A;  4DRX A;  4F6R B;  4O2B A;  4IIJ A;  3WGM A;  3QUW A;  1W41 A;  2B33 A;  3C9U A;  5KMG B;  3Q8H A;  5GON B;  3I55 F;  1VH8 A;  3WGL A;  5FJ4 C;  3HJW C;  3FPI A;  1SZQ A;  3D54 A;  3S02 A;  3ZP4 A;  1NQ3 A;  5A2Q M;  3F0F A;  1CN7 A;  3N2G A;  5B8F A;  1IPA A;  5GAP K;  1Q86 H;  4IHJ B;  1PF5 A;  4O2B B;  3TD4 A;  3JAT B;  4O2A B;  3HKD A;  3DDN A;  2K1S A;  3DC2 A;  3IMP A;  1VK3 A;  5HY1 A;  2DYY A;  1VQM F;  4BW0 B;  1W3E X;  1XRG A;  2CVL A;  3VTI C;  4YJ2 A;  3LWV C;  1VQ4 F;  1QU9 A;  1VQ5 F;  4NWO B;  5JCO C;  1H7M A;  1QD9 A;  3P10 A;  5GIP C;  1VQV A;  1YQN A;  4NQ3 A;  1GO0 A;  2LBX A;  3C9T A;  3KIZ A;  2UYN A;  3VO8 A;  3WJQ A;  1DBF A;  3EOR A;  2VAP A;  3CC4 F;  2R6R 1;  1QAH A;  3MBM A;  3CCU F;  1KD1 H;  3RYC A;  1TUB A;  4X1I B;  2UYP A;  4BVS A;  1CK2 A;  4LNU B;  3GHZ A;  1Q82 H;  3UT5 B;  3K14 A;  2AIZ P;  2LCA A;  4I50 B;  5ITZ A;  1UFY A;  4F6R A;  3RYH B;  3G71 F;  2YXZ A;  4TV8 A;  4ZOL A;  1YJN F;  1JFF A;  3CCM F;  3S06 A;  2OHW A;  1M1K H;  1JJ2 F;  4PWT A;  1OAP A;  3AGK A;  2CW4 A;  1VQO F;  2BTO A;  5CA0 B;  4ERH A;  4X1Y B;  1KQS F;  5EB1 B;  2Z1F A;  4EB6 B;  2QI2 A;  3V7Q A;  3GTZ A;  4B45 A;  3CXC F;  2MQE A;  5LYJ B;  3SIV A;  1W55 A;  5LP6 C;  4I55 A;  4O4L A;  3JAM M;  1COM A;  1JY8 A;  1W40 A;  2Z1U A;  4ZI7 B;  5MN6 A;  3ZO8 A;  4U3J A;  4BT7 A;  3RYF A;  5BMV A;  1YIJ F;  5CA1 B;  4TV9 A;  2CSL A;  1TVK B;  1E7K A;  3J80 M;  5HY2 A;  1Z5W A;  3N4Z A;  4G4W A;  2ZVZ A;  4TUY B;  5JQG B;  5HY0 A;  5JH7 A;  4O4J A;  1ODE A;  4U39 A;  5IJ9 B;  3CYQ A;  2AMT A;  5EZY A;  2IQQ A;  4NUT A;  4HNA A;  1JFF B;  1XHO A;  4LCK A;  3CME F;  5GIO C;  1YIT F;  5MN4 A;  3RA5 A;  3CD6 F;  5FNV A;  3VYU C;  1RQ7 A;  3VYT C;  3U0O A;  2QEX F;  3S0W A;  2H8C A;  3NVK E;  1XV2 A;  3OBW A;  4X1K B;  1H48 A;  4KWE A;  3CPQ A;  2CWJ A;  5LOV A;  3RYC B;  2VGM A;  1CLI A;  2ZF8 A;  4I55 B;  4YJ3 B;  3CYP B;  1GO1 A;  1VQ7 F;  1RQ2 A;  3KE1 A;  3PLA C;  3NMU C;  1NJI H;  3CCJ F;  1YJW F;  1SA0 A;  2HRU A;  2RB9 A;  2V9Y A;  3RYI B;  4BT4 A;  4YJ3 A;  1W57 A;  3ZOP A;  4WBN A;  2HP0 A;  4FFB A;  4X1K A;  2OTL F;  3JAK A;  1YGY A;  2HRY A;  3CG6 A;  2VGN A;  3CPW F;  1YHQ F;  3TD5 A;  4O4H A;  5EYP A;  4BT5 A;  3IKE A;  3N2K B;  2OZB A;  3J7A R;  3RYH A;  1YI2 F;  3JVH A;  5KX5 B;  3N2K A;  5ITZ B;  4RQO A;  2IG8 A;  4IHJ A;  4BT3 A;  4BY9 D;  2Q1Y A;  1H47 A;  5MN5 A;  1T0A A;  4RHA A;  3WGJ A;  5G4V C;  3VCZ A;  2LBW A;  3RYI A;  3E22 B;  3ON1 A;  5EIB C;  3F0G A;  3IEQ A;  2G9I A;  4TZZ A;  2RHH A;  1NMU B;  3OW2 F;  2NMU A;  1U3P A;  5BMV B;  3D00 A;  3VYS C;  5FLX M;  4C8I A;  5GIN C;  2OTM A;  4O4I A;  5LA6 A;  5JVD A;  3N4Y A;  3MQW A;  4R40 B;  1U3L A;  2GZL A;  5EYP B;  1W59 A;  3TD3 A;  4E6E A;  4EI9 A;  3HKC B;  2ZOV A;  3S03 A;  1PXW A;  3FBA A;  3I3F A;  1VQ8 F;  1T0K B;  3S0H A;  3C9S A;  3HKD B;  2WAL A;  5HXU A;  4O4I B;  4O2A A;  5C8Y B;  2KG4 A;  4X3L A;  3LYB A;  3PAF A;  4WBN B;  1FNJ A;  1X7P A;  3D01 A;  3JAL B;  1SA0 B;  3NVI B;  1KNJ A;  5HWE A;  1W5E A;  1GX1 A;  4ZK7 A;  2R75 1;  4ZOL B;  1KC8 H;  1SDS A;  2P6Y A;  2CHS A;  3R0P A;  3VOA A;  3HTN A;  3VOB A;  3WGN A;  4BT6 A;  5LOV B;  2I6D A;  3CMA F;  5EWR A;  1TVK A;  5KMG A;  5CA1 A;  3CB2 A;  1KNK A;  1X25 A;  3LFO A;  2KTV A;  4LNU A;  4EI7 A;  4I4T B;  4DRX B;  5J2T A;  2W8B C;  3SIU A;  3CC2 F;  3IEW A;  3CC7 F;  3RE3 A;  5EB0 A;  4O4H B;  2HP3 A;  1DT9 A;  3K2X A;  2I6R A;  4B46 A;  3JAS A;  2HS3 A;  4B62 A;  3JAK B;  3ZP7 A;  3JAR A;  3JAW A;  5IYZ A;  1YJ9 F;  3FD6 A;  3M84 A;  4X1Y A;  2HS4 A;  4YJ2 B;  5CA0 A;  2Q1X A;  2BTU A;  3FD5 A;  3JAS B;  3FFM A;  1Q7Y H;  1GZ0 A;  4U3J B;  2UYJ A;  4B5C A;  5JVD B;  5LA6 B;  5J2T B;  4I4T A;  2Z01 A;  3CCS F;  2OTJ F;  2DT4 A;  4EI8 A;  2N48 A;  3KJK A;  5HXZ A;  2HVY D;  3N2G B;  1VQL F;  1W42 A;  3C9R A;  5HY4 A;  2PHN A;  3E22 A;  3JCM M;  1X52 A;  1Z5V A;  3WJR A;  2VAM A;  1VQN F;  4HNA B;  4G4X A;  2Z1E A;  3LME A;  5EO3 A;  3WPW A;  5IJ9 A;  3HAX D;  3JAL A;  4O4J B;  1K9M H;  1RLG A;  3NK6 A;  3LWP C;  3ERN A;  3I56 F;  3MCA B;  4BVQ A;  1XBI A;  4TV9 B;  3F6M A;  3MDO A;  3HKC A;  3UT5 A;  5IJ0 A;  5HP7 A;  5EAZ A;  2RHO A;  3HKB B;  2VXY A;  3G4S F;  2RHJ A;  3O85 A;  1IV1 A;  1JN1 A;  4ZI7 A;  3CCQ F;  2QA4 F;  2FGY A;  1TUB B;  1R1M A;  3QTY A;  4X1I A;  5GAN K;  2HP0 B;  4O4L B;  4ZHY B;  5CB4 A;  1FNK A;  1W58 1;  1VQ9 F;  2GVI A;  1K73 H;  3RA6 A;  2AIF A;  3K0T A;  5CB4 B;  4BVT A;  3HKE A;  5J2U B;  2H6L A;  5GON A;  2PMP A;  1IV2 A;  1ZWZ A;  3L7Q A;  4DXD A;  5IT9 M;  4IIJ B;  5LXT B;  2F9Z C;  2GLZ A;  5FNV B;  3QHD A;  2YYE A;  1IV4 A;  3KJJ A;  3V3T A;  5KX5 A;  2BO1 A;  5G4U C;  1RLU A;  1OFU A;  3F0D A;  3I7T A;  3P4E A;  4X20 A;  5JCO A;  2CZW A;  4C82 A;  2FC3 A;  3LWR C;  1Q81 H;  4G4V A;  3BYQ A;  3HWU A;  5DCV A;  3WXM B;  2BTQ B;  5J2U A;  3WGK A;  2CHT A;  4FFB B;  1JD1 A;  3T80 A;  5JH7 B;  1VQP F;  1W5B A;  1FSZ A;  4TUY A;  4ZHQ B;  2UYN B;  3C8L A;  2ALE A; 
#chains in the Genus database with same CATH homology
 3WPX A;  2K1S A;  4G4W A;  2ZVZ A;  5EAZ A;  4B62 A;  2KGW A;  2ZF8 A;  3IMP A;  4ZHW A;  3LDT A;  2HQS C;  1R1M A;  4R40 B;  3CYP B;  3CYQ A;  2MQE A;  4ZHY B;  3TD3 A;  2AIZ P;  2L26 A;  2LCA A;  4G4X A;  4G88 A;  3S02 A;  3OON A;  5EB1 B;  2ZOV A;  3S0W A;  3S03 A;  4RHA A;  4G4V A;  3S0H A;  3WPW A;  2ZVY A;  3KHN A;  4B5C A;  3S0Y A;  2W8B C;  3S06 A;  5EB0 A;  4PWT A;  1OAP A;  2LBT A;  3TD5 A;  3TD4 A;  4ERH A;  4G4Z A;  4ZHV A;  4G4Y A;  2N48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...