4G4XA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
108
structure length
108
Chain Sequence
b'AKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 43
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4xA00
3KHNA 4G88A 3S0YA 3LDTA 3OONA 1OAPA 2ZF8A 4G4VA 4B62A 4ZHVA 3S0WA 4PWTA 3S06A 2ZOVA 5EB0A 3TD3A 2LBTA 3TD5A 2AIZP 2ZVYA 3IMPA 4G4YA 3WPXA 3WPWA 4ZHYB 4G4WA 2KGWA 1R1MA 3CYPB 3CYQA 2K1SA 5EAZA 2ZVZA 3S02A 2L26A 4B5CA 2N48A 2MQEA 4G4XA 5EB1B 4RHAA 4ERHA 3TD4A 2LCAA 2HQSC 3S0HA 3S03A 4R40B 2W8BC 4ZHWA 4G4ZA
chains in the Genus database with same CATH superfamily
3OBYA 1CN7A 3JALB 4BT4A 5EWRA 1JFFA 3CXCF 3C9RA 2CVLA 2QEXF 4IHJB 1KC8H 3CC7F 1W581 1VQVA 3KJJA 4BT6A 4I4TB 5BMVB 1KNJA 5DCVA 2Z1FA 3MCQA 3TD5A 1CK2A 5FNVA 1JY8A 4U3JA 1NMUB 3QUWA 1QVFF 2CZWA 1M90H 5IT9M 5EIBD 5LP6B 2KGWA 4X3MA 2CWJA 5EZYA 3LFOA 4C81A 3RYHA 3J80M 4X1KB 4BT3A 5GONB 3PAFA 3KHNA 3LWVC 3G71F 5KMGB 3ON1A 3K14A 1YITF 1IV1A 1FNJA 4X20B 1K9MH 3LWOC 2HS3A 2UYPA 3JAWA 4I50A 3JATA 3QHDA 5BMVA 5GIOC 2Z1EA 4C4WC 3C9TA 2R6R1 1JN1A 2PMPA 5IYZB 2BTQB 2MQEA 3HKBB 4EB6B 3M1XA 5LP6A 3CCEF 1YGYA 1W55A 2HQSC 5KX5B 1T0AA 5LYJB 3MCAB 2VXYA 1Q86H 1GO0A 4O4HB 3CD6F 1X7OA 3CG6A 1NJIH 1VQKF 5LXTA 4RQOA 2AMTA 3N2KA 2OTMA 5GONA 1XV2A 2VAPA 3S06A 3VOBA 3VCZA 2QI2A 3OW2F 1SA0B 4X20A 1X52A 3VYTC 1RA4A 5EO3A 3CMAF 3QTYA 2UYKA 1U43A 3CCMF 5IYZA 1XHOA 3HKBA 4EB6A 1SZQA 2DT4A 4G88A 3LWQC 5KX5A 2Q1XA 5LYJA 1YIJF 2ZF8A 2Z01A 4G4VA 5LOVB 1SDSA 1X7PA 2ZODA 1TUBB 2Z1UA 2FGYA 2RHLA 1H48A 1UI9A 3HKDA 5JVDB 4X1IB 3WPWA 3NMUC 3CPWF 2HVYD 3FBAA 4C8GA 1R1MA 1SA0A 1W42A 4ZHQA 5JQGB 1GZ0A 1OFUA 4TV9B 5HXZA 3VIUA 2N48A 2UYNB 3MQWA 3WGMA 3MDOA 3WGJA 4O4IA 1JFFB 2JNBA 3N2GA 2VAWA 3D54A 1JD1A 2P6YA 4BY9D 5B8FA 2Q1YA 3LDTA 1YHQF 1FFXB 5FNVB 4U3JB 5MN4A 1FNKA 4LNUA 4M8IA 2BO1A 5JCOA 1TUBA 1H47A 2VGNA 3J81M 3K0TA 5EZYB 1VQ4F 3RYHB 5C8YB 5JVDA 1Q8RA 3RA6A 1YQNA 3LWRC 3C9SA 1PXWA 2DYYA 1IV3A 2H8EA 3WGNA 3VI6A 2UZHA 3D01A 3NVIB 3JAWB 4I55A 4I50B 4YJ2B 3JATB 5IJ0B 5MN5A 4PWTA 2VGMA 3WXMB 1H7MA 4WBNA 3UT5A 4DRXA 2ZVYA 1FFXA 2OHWA 3R0PA 3FPIA 3CYPB 5G4UC 3FFMA 3V4DA 1QAHA 5CA0A 5C8YA 3V7EA 2IAFA 1ONIA 4O2BA 5JH7B 5LXTB 3N2KB 1TVKA 5MN6A 4BVSA 1Q81H 2ALEA 3OONA 1K8AH 2H8CA 4O2AB 2OZBA 4IIJA 3K12A 2YXZA 3JARB 4EI7A 3HKEA 3M84A 4YJ2A 5IJ0A 1W59A 3RYIA 3CCRF 4KWEA 3CB2A 2UYJA 4TUYA 2FC3A 2LBWA 2ZVZA 1VQMF 3ERNA 1GX1A 3V3TA 1VQ8F 5HWEA 4ZK7A 3SIVA 2HP0B 3CCVF 3CCQF 2HRUA 3WGKA 5A2QM 4G4ZA 2F9ZC 1PF5A 2HS0A 3CC2F 5JH7A 1RQ7A 2QA4F 3S0WA 4ZI7B 3HKDB 3ZO8A 2CHTA 2AIZP 2I6DA 3JAKA 4O2AA 4G4YA 4ZHQB 1VHAA 2EWCA 3LMEA 4ZHYB 1VQPF 4TV8A 3JARA 2BTUA 1COMA 5AVMA 1T0KB 4O4IB 3N4ZA 2IG8A 3I7TA 3E22A 5J2TA 3N2GB 3Q8HA 3S03A 1RLUA 4O4LA 1VQ5F 3VTIC 3VYUC 1W5FA 1JJ2F 4YJ3A 3E20B 2HP0A 2HX0A 5EYPB 3BYQA 3O85A 2RB9A 4LNUB 1IV4A 4ZHVA 3IKEA 2NMUA 3RYFB 5J2UB 2HP3A 3B6NA 5LA6A 5FLXM 2GZLA 1DBFA 4ZI7A 1DT9A 2G9IA 2CW4A 3CYQA 5ITZB 3S02A 3F0EA 4B5CA 5FJ4C 2I6RA 3TD4A 3HJWC 4BVTA 5HY0A 5HP8A 3EORA 3U0OA 3NVKE 4BT5A 4XCQA 4I55B 4WBNB 3VYSC 1W2BF 3UT5B 3NK6A 4DRXB 3CCLF 2LBXA 1N8RH 5EYPA 1FSZA 1XBIA 3RA5A 3WPXA 1Q82H 3RYFA 5HY4A 5J2UA 2H6LA 1QD9A 5LP6C 5CA0B 2KTVA 1CLIA 5CA1A 3G6EF 4G4XA 4O2BB 3D00A 3V7QA 2OTJF 2PHNA 5ITZA 1W5EA 4O4JB 1TVKB 4BT2A 2HRYA 5GIPC 3CCSF 1VK3A 5G4VC 3DC2A 1VQ9F 4IIJB 2ZAUA 2Z1TA 3WJQA 3HKEB 1NQ3A 3C9UA 3HKCA 1UFYA 3RYIB 3AGKA 4TUYB 1RLGA 3J7AR 3IMPA 2QTPA 2AIFA 3ESJA 5CB4A 3KE1A 4HNAB 3T80A 3WGLA 3VOAA 1W3EX 2HS4A 3JASA 3CCJF 2RHJA 2W8BC 3RE3A 1Q7YH 3LWPC 1M1KH 4O4JA 1VQ6F 3JVHA 4B45A 3JAKB 5IJ9A 3OBWA 5HY1A 3NK7A 4TV8B 4LCKA 2VAMA 3F0FA 5HXUA 1YI2F 1YJWF 4X1YA 4NUTA 1W5BA 3E22B 4BVRA 5HY2A 5J2TB 1ODEA 4O4LB 3HAXD 1IV2A 3IR9A 4B46A 1ZWZA 4YJ3B 3P10A 2V9YA 3MBMA 5GINC 4ZHWA 3KIZA 3P0ZA 4HNAA 1RQ2A 3HTNA 4C82A 3C8LA 1KQSF 1VH8A 3HWUA 5LA6B 3JALA 5JCOC 3L7QA 2B33A 2GVIA 2RHOA 4DXDA 4IHJA 3N4YA 1W40A 4I4TA 3JCMM 3KJKA 2R751 3I56F 4BVQA 4RHAA 4ERHA 3S0HA 1U40A 3GHZA 2LBTA 4X1KA 1KD1H 2KG4A 1VQLF 3S0YA 3GYQA 4NQ3A 4NWOB 3I55F 3F0GA 3IEQA 4U39A 5KMGA 1XRGA 3CMEF 5CA1B 3ZP7A 3I3FA 4G4WA 1VQ7F 3WJPA 3GTZA 1E7KA 5GANK 1K73H 1KNKA 4R40B 1VQNF 4EI8A 1J7HA 3SIUA 2CHSA 3K2XA 3M4SA 4FFBB 3CCUF 3HKCB 2KTUA 4O4HA 4B62A 1YJNF 4F6RB 5EB0A 1U3LA 1X25A 3IEWA 3IKFA 4ZOLB 3WJRA 2OTLF 3CC4F 5GAPK 5CB4B 1W57A 3PLAC 2K1SA 5EAZA 5HP7A 2BTOA 3RYCB 2GLZA 3JASB 1QU9A 3FD6A 4TZZA 3ELCA 3CPQA 3DDNA 3E1YA 3F0DA 3F6MA 1Z5WA 4BW0B 4E6EA 5IJ9B 2CSLA 1GO1A 1OAPA 3G4SF 3LYBA 1Z5VA 4FFBA 1W5AA 2ZOVA 3TD3A 3VMFB 4BT7A 4X3LA 1W41A 4X1YB 1VQOF 1U3PA 5LOVA 4F6RA 5EIBC 3VO8A 1S72F 4EI9A 1YJ9F 3ZP4A 2IQQA 4C8IA 4X1IA 2YYEA 2RHHA 4ZOLA 2L26A 3P4EA 4C8EA 1IPAA 2LCAA 5JQGA 4TV9A 1QVGF 3RYCA 2UYNA 2WALA 3ZOPA 3JAMM 5EB1B 3FD5A
chains in the Genus database with same CATH topology
3KHNA 4G88A 3S0YA 3LDTA 3OONA 1OAPA 2ZF8A 4G4VA 4B62A 4ZHVA 3S0WA 4PWTA 3S06A 2ZOVA 5EB0A 3TD3A 2LBTA 3TD5A 2AIZP 2ZVYA 3IMPA 4G4YA 3WPXA 3WPWA 4ZHYB 4G4WA 2KGWA 1R1MA 3CYPB 3CYQA 2K1SA 5EAZA 2ZVZA 3S02A 2L26A 4B5CA 2N48A 2MQEA 4G4XA 5EB1B 4RHAA 4ERHA 3TD4A 2LCAA 2HQSC 3S0HA 3S03A 4R40B 2W8BC 4ZHWA 4G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHN A;  4G88 A;  3S0Y A;  3LDT A;  3OON A;  1OAP A;  2ZF8 A;  4G4V A;  4B62 A;  4ZHV A;  3S0W A;  4PWT A;  3S06 A;  2ZOV A;  5EB0 A;  3TD3 A;  2LBT A;  3TD5 A;  2AIZ P;  2ZVY A;  3IMP A;  4G4Y A;  3WPX A;  3WPW A;  4ZHY B;  4G4W A;  2KGW A;  1R1M A;  3CYP B;  3CYQ A;  2K1S A;  5EAZ A;  2ZVZ A;  3S02 A;  2L26 A;  4B5C A;  2N48 A;  2MQE A;  4G4X A;  5EB1 B;  4RHA A;  4ERH A;  3TD4 A;  2LCA A;  2HQS C;  3S0H A;  3S03 A;  4R40 B;  2W8B C;  4ZHW A;  4G4Z A; 
#chains in the Genus database with same CATH topology
 3OBY A;  1CN7 A;  3JAL B;  4BT4 A;  5EWR A;  1JFF A;  3CXC F;  3C9R A;  2CVL A;  2QEX F;  4IHJ B;  1KC8 H;  3CC7 F;  1W58 1;  1VQV A;  3KJJ A;  4BT6 A;  4I4T B;  5BMV B;  1KNJ A;  5DCV A;  2Z1F A;  3MCQ A;  3TD5 A;  1CK2 A;  5FNV A;  1JY8 A;  4U3J A;  1NMU B;  3QUW A;  1QVF F;  2CZW A;  1M90 H;  5IT9 M;  5EIB D;  5LP6 B;  2KGW A;  4X3M A;  2CWJ A;  5EZY A;  3LFO A;  4C81 A;  3RYH A;  3J80 M;  4X1K B;  4BT3 A;  5GON B;  3PAF A;  3KHN A;  3LWV C;  3G71 F;  5KMG B;  3ON1 A;  3K14 A;  1YIT F;  1IV1 A;  1FNJ A;  4X20 B;  1K9M H;  3LWO C;  2HS3 A;  2UYP A;  3JAW A;  4I50 A;  3JAT A;  3QHD A;  5BMV A;  5GIO C;  2Z1E A;  4C4W C;  3C9T A;  2R6R 1;  1JN1 A;  2PMP A;  5IYZ B;  2BTQ B;  2MQE A;  3HKB B;  4EB6 B;  3M1X A;  5LP6 A;  3CCE F;  1YGY A;  1W55 A;  2HQS C;  5KX5 B;  1T0A A;  5LYJ B;  3MCA B;  2VXY A;  1Q86 H;  1GO0 A;  4O4H B;  3CD6 F;  1X7O A;  3CG6 A;  1NJI H;  1VQK F;  5LXT A;  4RQO A;  2AMT A;  3N2K A;  2OTM A;  5GON A;  1XV2 A;  2VAP A;  3S06 A;  3VOB A;  3VCZ A;  2QI2 A;  3OW2 F;  1SA0 B;  4X20 A;  1X52 A;  3VYT C;  1RA4 A;  5EO3 A;  3CMA F;  3QTY A;  2UYK A;  1U43 A;  3CCM F;  5IYZ A;  1XHO A;  3HKB A;  4EB6 A;  1SZQ A;  2DT4 A;  4G88 A;  3LWQ C;  5KX5 A;  2Q1X A;  5LYJ A;  1YIJ F;  2ZF8 A;  2Z01 A;  4G4V A;  5LOV B;  1SDS A;  1X7P A;  2ZOD A;  1TUB B;  2Z1U A;  2FGY A;  2RHL A;  1H48 A;  1UI9 A;  3HKD A;  5JVD B;  4X1I B;  3WPW A;  3NMU C;  3CPW F;  2HVY D;  3FBA A;  4C8G A;  1R1M A;  1SA0 A;  1W42 A;  4ZHQ A;  5JQG B;  1GZ0 A;  1OFU A;  4TV9 B;  5HXZ A;  3VIU A;  2N48 A;  2UYN B;  3MQW A;  3WGM A;  3MDO A;  3WGJ A;  4O4I A;  1JFF B;  2JNB A;  3N2G A;  2VAW A;  3D54 A;  1JD1 A;  2P6Y A;  4BY9 D;  5B8F A;  2Q1Y A;  3LDT A;  1YHQ F;  1FFX B;  5FNV B;  4U3J B;  5MN4 A;  1FNK A;  4LNU A;  4M8I A;  2BO1 A;  5JCO A;  1TUB A;  1H47 A;  2VGN A;  3J81 M;  3K0T A;  5EZY B;  1VQ4 F;  3RYH B;  5C8Y B;  5JVD A;  1Q8R A;  3RA6 A;  1YQN A;  3LWR C;  3C9S A;  1PXW A;  2DYY A;  1IV3 A;  2H8E A;  3WGN A;  3VI6 A;  2UZH A;  3D01 A;  3NVI B;  3JAW B;  4I55 A;  4I50 B;  4YJ2 B;  3JAT B;  5IJ0 B;  5MN5 A;  4PWT A;  2VGM A;  3WXM B;  1H7M A;  4WBN A;  3UT5 A;  4DRX A;  2ZVY A;  1FFX A;  2OHW A;  3R0P A;  3FPI A;  3CYP B;  5G4U C;  3FFM A;  3V4D A;  1QAH A;  5CA0 A;  5C8Y A;  3V7E A;  2IAF A;  1ONI A;  4O2B A;  5JH7 B;  5LXT B;  3N2K B;  1TVK A;  5MN6 A;  4BVS A;  1Q81 H;  2ALE A;  3OON A;  1K8A H;  2H8C A;  4O2A B;  2OZB A;  4IIJ A;  3K12 A;  2YXZ A;  3JAR B;  4EI7 A;  3HKE A;  3M84 A;  4YJ2 A;  5IJ0 A;  1W59 A;  3RYI A;  3CCR F;  4KWE A;  3CB2 A;  2UYJ A;  4TUY A;  2FC3 A;  2LBW A;  2ZVZ A;  1VQM F;  3ERN A;  1GX1 A;  3V3T A;  1VQ8 F;  5HWE A;  4ZK7 A;  3SIV A;  2HP0 B;  3CCV F;  3CCQ F;  2HRU A;  3WGK A;  5A2Q M;  4G4Z A;  2F9Z C;  1PF5 A;  2HS0 A;  3CC2 F;  5JH7 A;  1RQ7 A;  2QA4 F;  3S0W A;  4ZI7 B;  3HKD B;  3ZO8 A;  2CHT A;  2AIZ P;  2I6D A;  3JAK A;  4O2A A;  4G4Y A;  4ZHQ B;  1VHA A;  2EWC A;  3LME A;  4ZHY B;  1VQP F;  4TV8 A;  3JAR A;  2BTU A;  1COM A;  5AVM A;  1T0K B;  4O4I B;  3N4Z A;  2IG8 A;  3I7T A;  3E22 A;  5J2T A;  3N2G B;  3Q8H A;  3S03 A;  1RLU A;  4O4L A;  1VQ5 F;  3VTI C;  3VYU C;  1W5F A;  1JJ2 F;  4YJ3 A;  3E20 B;  2HP0 A;  2HX0 A;  5EYP B;  3BYQ A;  3O85 A;  2RB9 A;  4LNU B;  1IV4 A;  4ZHV A;  3IKE A;  2NMU A;  3RYF B;  5J2U B;  2HP3 A;  3B6N A;  5LA6 A;  5FLX M;  2GZL A;  1DBF A;  4ZI7 A;  1DT9 A;  2G9I A;  2CW4 A;  3CYQ A;  5ITZ B;  3S02 A;  3F0E A;  4B5C A;  5FJ4 C;  2I6R A;  3TD4 A;  3HJW C;  4BVT A;  5HY0 A;  5HP8 A;  3EOR A;  3U0O A;  3NVK E;  4BT5 A;  4XCQ A;  4I55 B;  4WBN B;  3VYS C;  1W2B F;  3UT5 B;  3NK6 A;  4DRX B;  3CCL F;  2LBX A;  1N8R H;  5EYP A;  1FSZ A;  1XBI A;  3RA5 A;  3WPX A;  1Q82 H;  3RYF A;  5HY4 A;  5J2U A;  2H6L A;  1QD9 A;  5LP6 C;  5CA0 B;  2KTV A;  1CLI A;  5CA1 A;  3G6E F;  4G4X A;  4O2B B;  3D00 A;  3V7Q A;  2OTJ F;  2PHN A;  5ITZ A;  1W5E A;  4O4J B;  1TVK B;  4BT2 A;  2HRY A;  5GIP C;  3CCS F;  1VK3 A;  5G4V C;  3DC2 A;  1VQ9 F;  4IIJ B;  2ZAU A;  2Z1T A;  3WJQ A;  3HKE B;  1NQ3 A;  3C9U A;  3HKC A;  1UFY A;  3RYI B;  3AGK A;  4TUY B;  1RLG A;  3J7A R;  3IMP A;  2QTP A;  2AIF A;  3ESJ A;  5CB4 A;  3KE1 A;  4HNA B;  3T80 A;  3WGL A;  3VOA A;  1W3E X;  2HS4 A;  3JAS A;  3CCJ F;  2RHJ A;  2W8B C;  3RE3 A;  1Q7Y H;  3LWP C;  1M1K H;  4O4J A;  1VQ6 F;  3JVH A;  4B45 A;  3JAK B;  5IJ9 A;  3OBW A;  5HY1 A;  3NK7 A;  4TV8 B;  4LCK A;  2VAM A;  3F0F A;  5HXU A;  1YI2 F;  1YJW F;  4X1Y A;  4NUT A;  1W5B A;  3E22 B;  4BVR A;  5HY2 A;  5J2T B;  1ODE A;  4O4L B;  3HAX D;  1IV2 A;  3IR9 A;  4B46 A;  1ZWZ A;  4YJ3 B;  3P10 A;  2V9Y A;  3MBM A;  5GIN C;  4ZHW A;  3KIZ A;  3P0Z A;  4HNA A;  1RQ2 A;  3HTN A;  4C82 A;  3C8L A;  1KQS F;  1VH8 A;  3HWU A;  5LA6 B;  3JAL A;  5JCO C;  3L7Q A;  2B33 A;  2GVI A;  2RHO A;  4DXD A;  4IHJ A;  3N4Y A;  1W40 A;  4I4T A;  3JCM M;  3KJK A;  2R75 1;  3I56 F;  4BVQ A;  4RHA A;  4ERH A;  3S0H A;  1U40 A;  3GHZ A;  2LBT A;  4X1K A;  1KD1 H;  2KG4 A;  1VQL F;  3S0Y A;  3GYQ A;  4NQ3 A;  4NWO B;  3I55 F;  3F0G A;  3IEQ A;  4U39 A;  5KMG A;  1XRG A;  3CME F;  5CA1 B;  3ZP7 A;  3I3F A;  4G4W A;  1VQ7 F;  3WJP A;  3GTZ A;  1E7K A;  5GAN K;  1K73 H;  1KNK A;  4R40 B;  1VQN F;  4EI8 A;  1J7H A;  3SIU A;  2CHS A;  3K2X A;  3M4S A;  4FFB B;  3CCU F;  3HKC B;  2KTU A;  4O4H A;  4B62 A;  1YJN F;  4F6R B;  5EB0 A;  1U3L A;  1X25 A;  3IEW A;  3IKF A;  4ZOL B;  3WJR A;  2OTL F;  3CC4 F;  5GAP K;  5CB4 B;  1W57 A;  3PLA C;  2K1S A;  5EAZ A;  5HP7 A;  2BTO A;  3RYC B;  2GLZ A;  3JAS B;  1QU9 A;  3FD6 A;  4TZZ A;  3ELC A;  3CPQ A;  3DDN A;  3E1Y A;  3F0D A;  3F6M A;  1Z5W A;  4BW0 B;  4E6E A;  5IJ9 B;  2CSL A;  1GO1 A;  1OAP A;  3G4S F;  3LYB A;  1Z5V A;  4FFB A;  1W5A A;  2ZOV A;  3TD3 A;  3VMF B;  4BT7 A;  4X3L A;  1W41 A;  4X1Y B;  1VQO F;  1U3P A;  5LOV A;  4F6R A;  5EIB C;  3VO8 A;  1S72 F;  4EI9 A;  1YJ9 F;  3ZP4 A;  2IQQ A;  4C8I A;  4X1I A;  2YYE A;  2RHH A;  4ZOL A;  2L26 A;  3P4E A;  4C8E A;  1IPA A;  2LCA A;  5JQG A;  4TV9 A;  1QVG F;  3RYC A;  2UYN A;  2WAL A;  3ZOP A;  3JAM M;  5EB1 B;  3FD5 A; 
#chains in the Genus database with same CATH homology
 3KHN A;  4G88 A;  3S0Y A;  3LDT A;  3OON A;  1OAP A;  2ZF8 A;  4G4V A;  4B62 A;  4ZHV A;  3S0W A;  4PWT A;  3S06 A;  2ZOV A;  5EB0 A;  3TD3 A;  2LBT A;  3TD5 A;  2AIZ P;  2ZVY A;  3IMP A;  4G4Y A;  3WPX A;  3WPW A;  4ZHY B;  4G4W A;  2KGW A;  1R1M A;  3CYP B;  3CYQ A;  2K1S A;  5EAZ A;  2ZVZ A;  3S02 A;  2L26 A;  4B5C A;  2N48 A;  2MQE A;  4G4X A;  5EB1 B;  4RHA A;  4ERH A;  3TD4 A;  2LCA A;  2HQS C;  3S0H A;  3S03 A;  4R40 B;  2W8B C;  4ZHW A;  4G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...