4G4XA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
108
structure length
108
Chain Sequence
AKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 43
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4xA00
3KHNA 2KGWA 2LCAA 4G4XA 2K1SA 3LDTA 2W8BC 2L26A 5EB0A 4B5CA 2ZVZA 3S02A 3S0WA 5EAZA 2N48A 3TD3A 2HQSC 2LBTA 3S03A 3S0YA 2MQEA 2ZVYA 3WPWA 3WPXA 4B62A 4ZHYB 5EB1B 3CYPB 4G4WA 1OAPA 3TD5A 4G88A 4PWTA 3S06A 4ZHWA 2ZF8A 3S0HA 3CYQA 4ZHVA 1R1MA 4R40B 3OONA 4G4ZA 4RHAA 2AIZP 3TD4A 4G4YA 3IMPA 4G4VA 4ERHA 2ZOVA
chains in the Genus database with same CATH superfamily
3V7QA 3LWQC 1Z5VA 4O4LA 3ESJA 5CA0A 4BW0B 5FLXM 3S0WA 2HRYA 3HKCB 1W57A 4ZK7A 1YJNF 2UYPA 5KX5B 2NMUA 1GO0A 5EWRA 1Q82H 4BVTA 3CPQA 3WJPA 2BTOA 4O4JA 1IPAA 5IJ0A 4IIJB 1TUBB 3LFOA 1COMA 2UYNB 1W5BA 2VAPA 3JAKB 4ZOLB 1T0AA 3RA6A 3J7AR 1H7MA 3KJJA 2HS0A 3S02A 1J7HA 1FNJA 3KJKA 3RYFA 3WPXA 4X1IB 3LMEA 2BTUA 1U3PA 5KMGB 1UFYA 2R751 5B8FA 1Q81H 2B33A 3RYCB 3K14A 3N4ZA 3JASB 4LNUA 4TV8B 2CHSA 4NUTA 1RQ2A 4ERHA 1W42A 3K0TA 1SDSA 1X7OA 3MCAB 3RE3A 3C9RA 3CCEF 3CCVF 3F0GA 1TUBA 5C8YA 1VQKF 3ZOPA 4EB6B 3V7EA 3JAKA 1NMUB 4ZOLA 1JY8A 2RB9A 1RLGA 1VQ8F 3KE1A 2GZLA 5LP6B 1OAPA 4NQ3A 4X1IA 1VQVA 3CMAF 2Z01A 1W3EX 2CHTA 2LBWA 5ITZB 3CCUF 1W55A 5KMGA 3GHZA 3HJWC 4G4ZA 3WGJA 5LP6C 2HS3A 3RYCA 3F0FA 1JD1A 5EIBC 1YHQF 2BO1A 3OBWA 2HRUA 4X20A 3HTNA 4WBNB 2LCAA 5CB4A 2Z1EA 3AGKA 2HP0B 3D01A 2DYYA 4B5CA 1U3LA 1RQ7A 3I55F 1IV2A 2DT4A 3WGNA 3HAXD 2VGNA 4I4TA 4C4WC 1H47A 3IR9A 5MN4A 5JH7A 4HNAA 4YJ3B 2F9ZC 1GZ0A 3LWPC 3CYPB 3DDNA 1VQ6F 1ONIA 2OTMA 5JCOC 1JJ2F 2I6RA 2QI2A 1VH8A 4I50A 1IV1A 1KD1H 1QVFF 2JNBA 2Q1XA 1K9MH 2R6R1 4O4LB 3VOAA 5EIBD 5CA0B 3D54A 2L26A 4BT3A 2PMPA 2HX0A 1M1KH 1OFUA 5EAZA 3TD3A 2HP0A 3UT5A 3P4EA 1N8RH 3RYHA 5EO3A 3VYSC 4YJ3A 5J2TA 3B6NA 4I55A 1TVKB 1YITF 1KNJA 2YXZA 3N4YA 3G71F 1FFXA 4O4JB 5IJ0B 1U43A 1U40A 2ZOVA 2CVLA 3RYIA 2UYKA 4G4XA 3T80A 3K2XA 2VAMA 3LDTA 5EB0A 3CCQF 2YYEA 1XHOA 5LOVA 4BT4A 3RYFB 4ZI7A 5JVDA 1CK2A 3HWUA 3IKEA 3VIUA 1CLIA 1NQ3A 1M90H 5EB1B 2HS4A 2I6DA 3WGMA 3C9SA 3BYQA 1QU9A 1X25A 4LNUB 3ZP4A 3GTZA 5MN6A 3V4DA 5A2QM 3PAFA 4FFBA 1TVKA 1VQ9F 1Q86H 4BT7A 3VTIC 5GINC 3ELCA 5IYZA 4O2BA 1YJWF 3CG6A 1KC8H 5C8YB 2W8BC 3I3FA 3VO8A 2P6YA 4O4IB 3CCMF 3CCSF 1XV2A 1VQLF 5GAPK 2CWJA 3MDOA 5IJ9A 3JCMM 2QEXF 3JAWA 1W40A 3TD4A 4X20B 2H8EA 2HP3A 5CB4B 2KTVA 4O4HA 3NVKE 5G4VC 3CCRF 2VXYA 2IG8A 4I4TB 2LBTA 3VYTC 3C8LA 3M4SA 5JH7B 1SA0B 3KIZA 3MCQA 4HNAB 5EZYA 3VI6A 3DC2A 1VQ4F 1W5FA 4O4IA 2QTPA 2IQQA 1T0KB 2KG4A 5BMVB 3IEWA 3VYUC 4EI9A 3NK6A 1R1MA 4I50B 4R40B 3CC4F 1Z5WA 4X1KA 4G4YA 4U3JA 2GLZA 1YI2F 3CPWF 3P0ZA 1VQNF 1JFFA 3SIVA 1FSZA 5EYPA 3G6EF 1UI9A 3KHNA 3VCZA 5JQGA 4B46A 2Z1TA 3HKDA 3UT5B 3P10A 3RYHB 5DCVA 3Q8HA 1VK3A 4B45A 4EI7A 4F6RA 2Q1YA 3NK7A 3I56F 1SA0A 4BT2A 3TD5A 5J2TB 4I55B 4G88A 3CB2A 1W5EA 3FPIA 5BMVA 1FFXB 4BVSA 5CA1A 5HXZA 1ODEA 5J2UA 3C9TA 1VQMF 2UZHA 2Z1UA 3WGLA 2CW4A 3RYIB 5GONA 3LWRC 1H48A 1FNKA 3MBMA 5LOVB 4ZI7B 5JVDB 4C81A 3HKEA 2Z1FA 4TV9B 1IV3A 3CCLF 5LXTA 1PXWA 4PWTA 2UYJA 3QTYA 3D00A 3QHDA 3S0HA 3JVHA 2RHLA 4FFBB 3N2GA 5FNVB 1IV4A 4BVQA 1K8AH 5IYZB 2OTJF 4O2BB 4M8IA 4O2AA 1W5AA 3CXCF 3N2KA 1E7KA 3ON1A 4BVRA 2K1SA 3JARA 2KTUA 5HY2A 3CMEF 3WPWA 5IJ9B 3NVIB 2H8CA 3SIUA 4TV9A 3JAWB 3O85A 1VHAA 3WJQA 3FD6A 3G4SF 3M84A 3U0OA 3OW2F 5FNVA 3E22A 4O4HB 5LA6A 4KWEA 5FJ4C 2AIFA 1W59A 4EI8A 1YQNA 4X3MA 2ALEA 1VQOF 5EZYB 1JN1A 2H6LA 1PF5A 3HKBA 3JALB 5GIPC 2OTLF 3WJRA 1X7PA 4BT5A 2HVYD 3CD6F 1Q7YH 5MN5A 4X1KB 5G4UC 3L7QA 2IAFA 4RHAA 5GANK 4U3JB 3GYQA 4X3LA 3F0DA 1JFFB 3CC2F 1NJIH 2AMTA 1VQ5F 4X1YA 5EYPB 3QUWA 5JQGB 5HWEA 3LWVC 2CSLA 4ZHQA 4U39A 3HKDB 3NMUC 4C8IA 2N48A 4F6RB 4XCQA 1RLUA 3VOBA 3HKCA 2FGYA 4ZHYB 3FFMA 3JALA 5IT9M 3ZP7A 4G4WA 5HY4A 3LYBA 5KX5A 3S06A 4ZHWA 5CA1B 2ZF8A 4ZHVA 1QVGF 3K12A 5J2UB 3EORA 4C8GA 1VQ7F 3RA5A 3F6MA 5GONB 1DBFA 1XBIA 3E20B 3J80M 1RA4A 4IIJA 1YIJF 2UYNA 2OZBA 4DXDA 2EWCA 3HKEB 3S03A 1KQSF 5HXUA 1SZQA 5HY1A 4RQOA 2ZVYA 4B62A 1S72F 5LXTB 3I7TA 5HY0A 5LYJB 2BTQB 2G9IA 3PLAC 3V3TA 3J81M 4YJ2B 3JATB 3N2GB 3WXMB 4BY9D 4DRXB 3M1XA 4O2AB 3IKFA 1YGYA 3JASA 3N2KB 4TUYB 4TZZA 5HP7A 4TV8A 3WGKA 2LBXA 3JAMM 2GVIA 1W2BF 2WALA 1W41A 3JARB 1ZWZA 3OBYA 1VQPF 2VAWA 2CZWA 2RHHA 2ZVZA 5GIOC 2HQSC 3S0YA 3FD5A 4EB6A 2QA4F 2OHWA 3C9UA 1Q8RA 5HP8A 3VMFB 1DT9A 5LYJA 5LP6A 3CYQA 4LCKA 3R0PA 2PHNA 2FC3A 4C82A 5ITZA 3IEQA 3JATA 3MQWA 4YJ2A 1GX1A 4IHJB 1YJ9F 2AIZP 1KNKA 3E22B 3IMPA 1W581 5LA6B 4DRXA 3F0EA 1QAHA 1CN7A 2KGWA 4TUYA 4WBNA 4BT6A 3E1YA 2RHJA 3ERNA 4NWOB 3HKBB 3ZO8A 2MQEA 3CC7F 1QD9A 5AVMA 2VGMA 5JCOA 4E6EA 3FBAA 1K73H 1GO1A 4C8EA 3OONA 2ZAUA 4X1YB 1X52A 1XRGA 2RHOA 4G4VA 3CCJF 3LWOC 4IHJA 4ZHQB 2ZODA 2V9YA
chains in the Genus database with same CATH topology
3KHNA 2KGWA 2LCAA 4G4XA 2K1SA 3LDTA 2W8BC 2L26A 5EB0A 4B5CA 2ZVZA 3S02A 3S0WA 5EAZA 2N48A 3TD3A 2HQSC 2LBTA 3S03A 3S0YA 2MQEA 2ZVYA 3WPWA 3WPXA 4B62A 4ZHYB 5EB1B 3CYPB 4G4WA 1OAPA 3TD5A 4G88A 4PWTA 3S06A 4ZHWA 2ZF8A 3S0HA 3CYQA 4ZHVA 1R1MA 4R40B 3OONA 4G4ZA 4RHAA 2AIZP 3TD4A 4G4YA 3IMPA 4G4VA 4ERHA 2ZOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHN A;  2KGW A;  2LCA A;  4G4X A;  2K1S A;  3LDT A;  2W8B C;  2L26 A;  5EB0 A;  4B5C A;  2ZVZ A;  3S02 A;  3S0W A;  5EAZ A;  2N48 A;  3TD3 A;  2HQS C;  2LBT A;  3S03 A;  3S0Y A;  2MQE A;  2ZVY A;  3WPW A;  3WPX A;  4B62 A;  4ZHY B;  5EB1 B;  3CYP B;  4G4W A;  1OAP A;  3TD5 A;  4G88 A;  4PWT A;  3S06 A;  4ZHW A;  2ZF8 A;  3S0H A;  3CYQ A;  4ZHV A;  1R1M A;  4R40 B;  3OON A;  4G4Z A;  4RHA A;  2AIZ P;  3TD4 A;  4G4Y A;  3IMP A;  4G4V A;  4ERH A;  2ZOV A; 
#chains in the Genus database with same CATH topology
 3V7Q A;  3LWQ C;  1Z5V A;  4O4L A;  3ESJ A;  5CA0 A;  4BW0 B;  5FLX M;  3S0W A;  2HRY A;  3HKC B;  1W57 A;  4ZK7 A;  1YJN F;  2UYP A;  5KX5 B;  2NMU A;  1GO0 A;  5EWR A;  1Q82 H;  4BVT A;  3CPQ A;  3WJP A;  2BTO A;  4O4J A;  1IPA A;  5IJ0 A;  4IIJ B;  1TUB B;  3LFO A;  1COM A;  2UYN B;  1W5B A;  2VAP A;  3JAK B;  4ZOL B;  1T0A A;  3RA6 A;  3J7A R;  1H7M A;  3KJJ A;  2HS0 A;  3S02 A;  1J7H A;  1FNJ A;  3KJK A;  3RYF A;  3WPX A;  4X1I B;  3LME A;  2BTU A;  1U3P A;  5KMG B;  1UFY A;  2R75 1;  5B8F A;  1Q81 H;  2B33 A;  3RYC B;  3K14 A;  3N4Z A;  3JAS B;  4LNU A;  4TV8 B;  2CHS A;  4NUT A;  1RQ2 A;  4ERH A;  1W42 A;  3K0T A;  1SDS A;  1X7O A;  3MCA B;  3RE3 A;  3C9R A;  3CCE F;  3CCV F;  3F0G A;  1TUB A;  5C8Y A;  1VQK F;  3ZOP A;  4EB6 B;  3V7E A;  3JAK A;  1NMU B;  4ZOL A;  1JY8 A;  2RB9 A;  1RLG A;  1VQ8 F;  3KE1 A;  2GZL A;  5LP6 B;  1OAP A;  4NQ3 A;  4X1I A;  1VQV A;  3CMA F;  2Z01 A;  1W3E X;  2CHT A;  2LBW A;  5ITZ B;  3CCU F;  1W55 A;  5KMG A;  3GHZ A;  3HJW C;  4G4Z A;  3WGJ A;  5LP6 C;  2HS3 A;  3RYC A;  3F0F A;  1JD1 A;  5EIB C;  1YHQ F;  2BO1 A;  3OBW A;  2HRU A;  4X20 A;  3HTN A;  4WBN B;  2LCA A;  5CB4 A;  2Z1E A;  3AGK A;  2HP0 B;  3D01 A;  2DYY A;  4B5C A;  1U3L A;  1RQ7 A;  3I55 F;  1IV2 A;  2DT4 A;  3WGN A;  3HAX D;  2VGN A;  4I4T A;  4C4W C;  1H47 A;  3IR9 A;  5MN4 A;  5JH7 A;  4HNA A;  4YJ3 B;  2F9Z C;  1GZ0 A;  3LWP C;  3CYP B;  3DDN A;  1VQ6 F;  1ONI A;  2OTM A;  5JCO C;  1JJ2 F;  2I6R A;  2QI2 A;  1VH8 A;  4I50 A;  1IV1 A;  1KD1 H;  1QVF F;  2JNB A;  2Q1X A;  1K9M H;  2R6R 1;  4O4L B;  3VOA A;  5EIB D;  5CA0 B;  3D54 A;  2L26 A;  4BT3 A;  2PMP A;  2HX0 A;  1M1K H;  1OFU A;  5EAZ A;  3TD3 A;  2HP0 A;  3UT5 A;  3P4E A;  1N8R H;  3RYH A;  5EO3 A;  3VYS C;  4YJ3 A;  5J2T A;  3B6N A;  4I55 A;  1TVK B;  1YIT F;  1KNJ A;  2YXZ A;  3N4Y A;  3G71 F;  1FFX A;  4O4J B;  5IJ0 B;  1U43 A;  1U40 A;  2ZOV A;  2CVL A;  3RYI A;  2UYK A;  4G4X A;  3T80 A;  3K2X A;  2VAM A;  3LDT A;  5EB0 A;  3CCQ F;  2YYE A;  1XHO A;  5LOV A;  4BT4 A;  3RYF B;  4ZI7 A;  5JVD A;  1CK2 A;  3HWU A;  3IKE A;  3VIU A;  1CLI A;  1NQ3 A;  1M90 H;  5EB1 B;  2HS4 A;  2I6D A;  3WGM A;  3C9S A;  3BYQ A;  1QU9 A;  1X25 A;  4LNU B;  3ZP4 A;  3GTZ A;  5MN6 A;  3V4D A;  5A2Q M;  3PAF A;  4FFB A;  1TVK A;  1VQ9 F;  1Q86 H;  4BT7 A;  3VTI C;  5GIN C;  3ELC A;  5IYZ A;  4O2B A;  1YJW F;  3CG6 A;  1KC8 H;  5C8Y B;  2W8B C;  3I3F A;  3VO8 A;  2P6Y A;  4O4I B;  3CCM F;  3CCS F;  1XV2 A;  1VQL F;  5GAP K;  2CWJ A;  3MDO A;  5IJ9 A;  3JCM M;  2QEX F;  3JAW A;  1W40 A;  3TD4 A;  4X20 B;  2H8E A;  2HP3 A;  5CB4 B;  2KTV A;  4O4H A;  3NVK E;  5G4V C;  3CCR F;  2VXY A;  2IG8 A;  4I4T B;  2LBT A;  3VYT C;  3C8L A;  3M4S A;  5JH7 B;  1SA0 B;  3KIZ A;  3MCQ A;  4HNA B;  5EZY A;  3VI6 A;  3DC2 A;  1VQ4 F;  1W5F A;  4O4I A;  2QTP A;  2IQQ A;  1T0K B;  2KG4 A;  5BMV B;  3IEW A;  3VYU C;  4EI9 A;  3NK6 A;  1R1M A;  4I50 B;  4R40 B;  3CC4 F;  1Z5W A;  4X1K A;  4G4Y A;  4U3J A;  2GLZ A;  1YI2 F;  3CPW F;  3P0Z A;  1VQN F;  1JFF A;  3SIV A;  1FSZ A;  5EYP A;  3G6E F;  1UI9 A;  3KHN A;  3VCZ A;  5JQG A;  4B46 A;  2Z1T A;  3HKD A;  3UT5 B;  3P10 A;  3RYH B;  5DCV A;  3Q8H A;  1VK3 A;  4B45 A;  4EI7 A;  4F6R A;  2Q1Y A;  3NK7 A;  3I56 F;  1SA0 A;  4BT2 A;  3TD5 A;  5J2T B;  4I55 B;  4G88 A;  3CB2 A;  1W5E A;  3FPI A;  5BMV A;  1FFX B;  4BVS A;  5CA1 A;  5HXZ A;  1ODE A;  5J2U A;  3C9T A;  1VQM F;  2UZH A;  2Z1U A;  3WGL A;  2CW4 A;  3RYI B;  5GON A;  3LWR C;  1H48 A;  1FNK A;  3MBM A;  5LOV B;  4ZI7 B;  5JVD B;  4C81 A;  3HKE A;  2Z1F A;  4TV9 B;  1IV3 A;  3CCL F;  5LXT A;  1PXW A;  4PWT A;  2UYJ A;  3QTY A;  3D00 A;  3QHD A;  3S0H A;  3JVH A;  2RHL A;  4FFB B;  3N2G A;  5FNV B;  1IV4 A;  4BVQ A;  1K8A H;  5IYZ B;  2OTJ F;  4O2B B;  4M8I A;  4O2A A;  1W5A A;  3CXC F;  3N2K A;  1E7K A;  3ON1 A;  4BVR A;  2K1S A;  3JAR A;  2KTU A;  5HY2 A;  3CME F;  3WPW A;  5IJ9 B;  3NVI B;  2H8C A;  3SIU A;  4TV9 A;  3JAW B;  3O85 A;  1VHA A;  3WJQ A;  3FD6 A;  3G4S F;  3M84 A;  3U0O A;  3OW2 F;  5FNV A;  3E22 A;  4O4H B;  5LA6 A;  4KWE A;  5FJ4 C;  2AIF A;  1W59 A;  4EI8 A;  1YQN A;  4X3M A;  2ALE A;  1VQO F;  5EZY B;  1JN1 A;  2H6L A;  1PF5 A;  3HKB A;  3JAL B;  5GIP C;  2OTL F;  3WJR A;  1X7P A;  4BT5 A;  2HVY D;  3CD6 F;  1Q7Y H;  5MN5 A;  4X1K B;  5G4U C;  3L7Q A;  2IAF A;  4RHA A;  5GAN K;  4U3J B;  3GYQ A;  4X3L A;  3F0D A;  1JFF B;  3CC2 F;  1NJI H;  2AMT A;  1VQ5 F;  4X1Y A;  5EYP B;  3QUW A;  5JQG B;  5HWE A;  3LWV C;  2CSL A;  4ZHQ A;  4U39 A;  3HKD B;  3NMU C;  4C8I A;  2N48 A;  4F6R B;  4XCQ A;  1RLU A;  3VOB A;  3HKC A;  2FGY A;  4ZHY B;  3FFM A;  3JAL A;  5IT9 M;  3ZP7 A;  4G4W A;  5HY4 A;  3LYB A;  5KX5 A;  3S06 A;  4ZHW A;  5CA1 B;  2ZF8 A;  4ZHV A;  1QVG F;  3K12 A;  5J2U B;  3EOR A;  4C8G A;  1VQ7 F;  3RA5 A;  3F6M A;  5GON B;  1DBF A;  1XBI A;  3E20 B;  3J80 M;  1RA4 A;  4IIJ A;  1YIJ F;  2UYN A;  2OZB A;  4DXD A;  2EWC A;  3HKE B;  3S03 A;  1KQS F;  5HXU A;  1SZQ A;  5HY1 A;  4RQO A;  2ZVY A;  4B62 A;  1S72 F;  5LXT B;  3I7T A;  5HY0 A;  5LYJ B;  2BTQ B;  2G9I A;  3PLA C;  3V3T A;  3J81 M;  4YJ2 B;  3JAT B;  3N2G B;  3WXM B;  4BY9 D;  4DRX B;  3M1X A;  4O2A B;  3IKF A;  1YGY A;  3JAS A;  3N2K B;  4TUY B;  4TZZ A;  5HP7 A;  4TV8 A;  3WGK A;  2LBX A;  3JAM M;  2GVI A;  1W2B F;  2WAL A;  1W41 A;  3JAR B;  1ZWZ A;  3OBY A;  1VQP F;  2VAW A;  2CZW A;  2RHH A;  2ZVZ A;  5GIO C;  2HQS C;  3S0Y A;  3FD5 A;  4EB6 A;  2QA4 F;  2OHW A;  3C9U A;  1Q8R A;  5HP8 A;  3VMF B;  1DT9 A;  5LYJ A;  5LP6 A;  3CYQ A;  4LCK A;  3R0P A;  2PHN A;  2FC3 A;  4C82 A;  5ITZ A;  3IEQ A;  3JAT A;  3MQW A;  4YJ2 A;  1GX1 A;  4IHJ B;  1YJ9 F;  2AIZ P;  1KNK A;  3E22 B;  3IMP A;  1W58 1;  5LA6 B;  4DRX A;  3F0E A;  1QAH A;  1CN7 A;  2KGW A;  4TUY A;  4WBN A;  4BT6 A;  3E1Y A;  2RHJ A;  3ERN A;  4NWO B;  3HKB B;  3ZO8 A;  2MQE A;  3CC7 F;  1QD9 A;  5AVM A;  2VGM A;  5JCO A;  4E6E A;  3FBA A;  1K73 H;  1GO1 A;  4C8E A;  3OON A;  2ZAU A;  4X1Y B;  1X52 A;  1XRG A;  2RHO A;  4G4V A;  3CCJ F;  3LWO C;  4IHJ A;  4ZHQ B;  2ZOD A;  2V9Y A; 
#chains in the Genus database with same CATH homology
 3KHN A;  2KGW A;  2LCA A;  4G4X A;  2K1S A;  3LDT A;  2W8B C;  2L26 A;  5EB0 A;  4B5C A;  2ZVZ A;  3S02 A;  3S0W A;  5EAZ A;  2N48 A;  3TD3 A;  2HQS C;  2LBT A;  3S03 A;  3S0Y A;  2MQE A;  2ZVY A;  3WPW A;  3WPX A;  4B62 A;  4ZHY B;  5EB1 B;  3CYP B;  4G4W A;  1OAP A;  3TD5 A;  4G88 A;  4PWT A;  3S06 A;  4ZHW A;  2ZF8 A;  3S0H A;  3CYQ A;  4ZHV A;  1R1M A;  4R40 B;  3OON A;  4G4Z A;  4RHA A;  2AIZ P;  3TD4 A;  4G4Y A;  3IMP A;  4G4V A;  4ERH A;  2ZOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...