4G4XA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
108
structure length
108
Chain Sequence
AKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan-associated lipoprotein
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 43
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4xA00
2HQSC 4G4VA 2N48A 3WPXA 4R40B 5EB0A 2LCAA 4PWTA 2MQEA 5EAZA 4B5CA 3CYQA 4ZHWA 2L26A 2LBTA 4G4YA 2ZVZA 3IMPA 2KGWA 3KHNA 2ZOVA 4G4ZA 2AIZP 3TD5A 2ZF8A 3S02A 2W8BC 4ERHA 1OAPA 3OONA 4ZHVA 3CYPB 3S0YA 3TD3A 2K1SA 3S03A 4RHAA 3S0WA 4G4WA 3TD4A 2ZVYA 3WPWA 3S06A 4ZHYB 4G88A 1R1MA 5EB1B 4B62A 4G4XA 3S0HA 3LDTA
chains in the Genus database with same CATH superfamily
1YGYA 1GO1A 1XBIA 5A2QM 3JARB 3KHNA 3ON1A 3CXCF 3RYCA 3G71F 4LNUB 4YJ3A 4X1YA 1FSZA 5EIBD 3CMAF 3MCAB 3VYTC 5J2UB 1CK2A 2RHLA 2BO1A 3CMEF 3SIVA 4FFBA 1YHQF 3WPWA 3OBYA 3O85A 4EB6B 5DCVA 3L7QA 4B62A 2R751 3JATA 2OZBA 1ODEA 4BT6A 4IHJB 3IKEA 5EB0A 4BT5A 5EAZA 2Z1FA 5HY4A 5EYPB 1W5BA 5IJ0A 5KMGA 5GAPK 3T80A 2VGMA 4DXDA 3JAKA 5LXTA 1X7OA 1SDSA 3ZOPA 2GZLA 5J2TA 4EI8A 3RYIA 2H6LA 3VYUC 3K2XA 2VGNA 3HKCB 2RHOA 3MBMA 1E7KA 1R1MA 1VH8A 4C8IA 3Q8HA 4YJ2A 3QUWA 3E22A 4YJ3B 2B33A 1QU9A 1YQNA 2HS3A 5IYZA 2UYJA 4FFBB 3GTZA 3CCUF 1J7HA 3HWUA 4WBNA 2I6RA 2ZOVA 3HTNA 3K14A 4C8GA 3QHDA 2DYYA 3JATB 1XHOA 2K1SA 2VXYA 2P6YA 3KE1A 1Q86H 4BVQA 2YXZA 2GLZA 4X1IA 3CC4F 3V7EA 4O4IB 2IAFA 2CHSA 3LMEA 3DDNA 5KMGB 1H48A 5CA0B 4TV9A 4HNAA 4PWTA 4ZOLA 5LP6C 3VO8A 2L26A 1IV1A 2ZVZA 4X3LA 2VAWA 3OW2F 1DT9A 5HY1A 5GIPC 4YJ2B 3E22B 4C8EA 3F6MA 2Z01A 3WGLA 3JALB 3CB2A 3JARA 4TV8A 4WBNB 2Z1UA 1VQKF 3VOBA 3CCSF 3LWVC 3LDTA 3CC7F 4R40B 2LCAA 1Q8RA 2MQEA 1KD1H 5J2UA 3CYQA 3P0ZA 1VQLF 4EI7A 3DC2A 3QTYA 2HX0A 3D54A 2BTOA 1W40A 2WALA 1NQ3A 2Z1TA 1OAPA 3CYPB 1YITF 4IHJA 4BVSA 3ZP7A 3CCVF 1X7PA 3VIUA 1JY8A 5EYPA 1YJNF 4NUTA 2YYEA 5JVDA 3CCQF 3CPQA 1JFFB 2HP3A 3VCZA 4IIJA 3JVHA 4B5CA 3HKBB 3UT5A 1W55A 3HKCA 2CWJA 5JH7A 1RLGA 4G4ZA 5MN4A 4TV8B 1K73H 3TD5A 3NVIB 1CLIA 1GX1A 2NMUA 1KQSF 5BMVB 2EWCA 3V7QA 3F0FA 3CCRF 3VI6A 3JASA 3NVKE 4C82A 3PAFA 3ZO8A 1TVKB 2QA4F 1PF5A 2GVIA 2UYKA 3C9RA 3ERNA 1KNJA 5KX5A 1YJ9F 1K8AH 2N48A 2ZODA 3C9SA 4M8IA 1IV3A 3RA5A 1QVGF 1FFXB 1H47A 4DRXA 3SIUA 1COMA 1RA4A 2AIZP 2R6R1 4O4IA 5AVMA 5GONA 3IEQA 1U43A 3GHZA 5JVDB 1W581 3KJJA 5CA0A 4IIJB 4X1KB 3N4ZA 3UT5B 1ONIA 1ZWZA 3LWQC 5JH7B 1K9MH 3VOAA 3K0TA 3LFOA 1KC8H 4C4WC 2KTUA 4G4VA 3M4SA 1DBFA 3MCQA 3N4YA 5LP6A 3JASB 2LBTA 4G4YA 5FNVB 3JALA 1JD1A 3FD6A 2HRUA 2ZAUA 3VTIC 1W42A 2W8BC 2HRYA 3OONA 5KX5B 1KNKA 4B45A 4BT3A 5GIOC 4ZK7A 2QTPA 4KWEA 2UZHA 1M90H 3FD5A 3S0WA 5HY2A 1SA0A 3G4SF 1IV2A 4NWOB 4DRXB 1TUBA 3GYQA 4I4TB 3IEWA 4O4HA 4O4JA 1VQ6F 1U3LA 3FBAA 5GONB 3NK6A 3ESJA 3VMFB 5ITZB 3FPIA 1W5EA 3WGKA 1RLUA 5HP8A 3RYFB 2H8EA 2HP0B 5JQGB 3ELCA 3IMPA 3WXMB 2V9YA 1W3EX 3D01A 3RE3A 3JAMM 1JFFA 3TD3A 4O4LB 4RHAA 1RQ2A 3HKBA 1NMUB 5LP6B 3NK7A 4BVTA 4BT4A 3MDOA 1U3PA 5HP7A 3NMUC 3I3FA 3E1YA 5LA6B 2FC3A 2Q1XA 2OTMA 2FGYA 5BMVA 4X20B 1UFYA 4O2BA 4O2AB 1SA0B 5IT9M 2AIFA 5FLXM 2UYNB 1TUBB 1TVKA 1UI9A 2AMTA 5GINC 2G9IA 3JAWA 4O4HB 4O4JB 5FJ4C 3C9UA 1VQ7F 4TUYA 1FFXA 1Z5WA 5MN5A 4BVRA 3HKEB 1OFUA 1W57A 2PHNA 5EB1B 3RA6A 4BT2A 1GO0A 2VAMA 3S0HA 2CZWA 5B8FA 5LYJB 1QAHA 2LBXA 1W5FA 2CW4A 4X1KA 5C8YA 1Q82H 4X3MA 4ZI7B 3LWOC 4TZZA 1PXWA 3I55F 5EZYA 3WGMA 2RHJA 1VQOF 4O2BB 4F6RA 1W5AA 5FNVA 4BW0B 3JAWB 3CCJF 2IG8A 2LBWA 2HQSC 2Q1YA 3ZP4A 1QD9A 5CA1A 2QEXF 1H7MA 2RHHA 3EORA 4TUYB 1YIJF 3M84A 1XRGA 5CB4A 5LOVB 4I55B 4ZHQA 4I4TA 1GZ0A 5G4UC 1CN7A 3S02A 4ZHVA 3WGJA 3IR9A 3J81M 1X52A 1VQ4F 3WJPA 5ITZA 1QVFF 2CSLA 3S03A 2KG4A 1VQ9F 4G4WA 5C8YB 2CHTA 3RYFA 1XV2A 2HP0A 5JCOC 5JQGA 4BY9D 2DT4A 4ZHYB 1M1KH 1VQ5F 2I6DA 2ALEA 3B6NA 3BYQA 4G4XA 2HVYD 4EI9A 2Z1EA 3K12A 5EZYB 1S72F 3FFMA 2F9ZC 4BT7A 3CPWF 4O4LA 3HAXD 3WGNA 3HJWC 1FNKA 4F6RB 3LYBA 3P10A 1SZQA 3R0PA 1Q7YH 1VHAA 3N2GB 2ZF8A 2KTVA 3VYSC 5LA6A 3CCEF 5HXZA 2HS4A 2BTUA 5G4VC 3AGKA 5CA1B 5HY0A 2BTQB 5EO3A 4X20A 5EWRA 4O2AA 5HWEA 1VQNF 1Z5VA 2UYNA 3WJQA 1RQ7A 5CB4B 3HKDA 4ZHQB 3CC2F 3RYCB 3V3TA 3I7TA 2HS0A 4X1YB 3P4EA 4C81A 3F0GA 4ZHWA 3OBWA 2OTJF 1YI2F 2KGWA 4NQ3A 5GANK 3V4DA 3HKEA 3RYHA 1X25A 1VQ8F 5LYJA 3N2KA 4I50A 2H8CA 3JCMM 3IKFA 3CG6A 3S06A 4U3JA 2OTLF 4LCKA 4ZI7A 5IJ0B 4G88A 3WJRA 3I56F 4RQOA 3JAKB 5LXTB 5J2TB 1W41A 3MQWA 3RYIB 1FNJA 5IJ9A 1T0KB 2CVLA 3E20B 3D00A 1JN1A 1T0AA 1W2BF 3HKDB 2VAPA 1IV4A 5MN6A 1VK3A 1Q81H 3U0OA 1IPAA 3KIZA 1VQMF 5IYZB 3TD4A 1YJWF 2ZVYA 3G6EF 5LOVA 1W59A 4XCQA 4I55A 1VQPF 2PMPA 3RYHB 4LNUA 4B46A 1N8RH 3WPXA 2IQQA 3N2KB 4I50B 4E6EA 4X1IB 2RB9A 3F0EA 3M1XA 4EB6A 1JJ2F 4U3JB 1NJIH 4U39A 3CCLF 3J7AR 3KJKA 1VQVA 3C9TA 4HNAB 4TV9B 4ERHA 3J80M 3S0YA 4ZOLB 3LWPC 2OHWA 3LWRC 2UYPA 3CCMF 5HXUA 3PLAC 5IJ9B 2JNBA 3C8LA 1U40A 3F0DA 5EIBC 5JCOA 2QI2A 3N2GA 3CD6F
chains in the Genus database with same CATH topology
2HQSC 4G4VA 2N48A 3WPXA 4R40B 5EB0A 2LCAA 4PWTA 2MQEA 5EAZA 4B5CA 3CYQA 4ZHWA 2L26A 2LBTA 4G4YA 2ZVZA 3IMPA 2KGWA 3KHNA 2ZOVA 4G4ZA 2AIZP 3TD5A 2ZF8A 3S02A 2W8BC 4ERHA 1OAPA 3OONA 4ZHVA 3CYPB 3S0YA 3TD3A 2K1SA 3S03A 4RHAA 3S0WA 4G4WA 3TD4A 2ZVYA 3WPWA 3S06A 4ZHYB 4G88A 1R1MA 5EB1B 4B62A 4G4XA 3S0HA 3LDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQS C;  4G4V A;  2N48 A;  3WPX A;  4R40 B;  5EB0 A;  2LCA A;  4PWT A;  2MQE A;  5EAZ A;  4B5C A;  3CYQ A;  4ZHW A;  2L26 A;  2LBT A;  4G4Y A;  2ZVZ A;  3IMP A;  2KGW A;  3KHN A;  2ZOV A;  4G4Z A;  2AIZ P;  3TD5 A;  2ZF8 A;  3S02 A;  2W8B C;  4ERH A;  1OAP A;  3OON A;  4ZHV A;  3CYP B;  3S0Y A;  3TD3 A;  2K1S A;  3S03 A;  4RHA A;  3S0W A;  4G4W A;  3TD4 A;  2ZVY A;  3WPW A;  3S06 A;  4ZHY B;  4G88 A;  1R1M A;  5EB1 B;  4B62 A;  4G4X A;  3S0H A;  3LDT A; 
#chains in the Genus database with same CATH topology
 1YGY A;  1GO1 A;  1XBI A;  5A2Q M;  3JAR B;  3KHN A;  3ON1 A;  3CXC F;  3RYC A;  3G71 F;  4LNU B;  4YJ3 A;  4X1Y A;  1FSZ A;  5EIB D;  3CMA F;  3MCA B;  3VYT C;  5J2U B;  1CK2 A;  2RHL A;  2BO1 A;  3CME F;  3SIV A;  4FFB A;  1YHQ F;  3WPW A;  3OBY A;  3O85 A;  4EB6 B;  5DCV A;  3L7Q A;  4B62 A;  2R75 1;  3JAT A;  2OZB A;  1ODE A;  4BT6 A;  4IHJ B;  3IKE A;  5EB0 A;  4BT5 A;  5EAZ A;  2Z1F A;  5HY4 A;  5EYP B;  1W5B A;  5IJ0 A;  5KMG A;  5GAP K;  3T80 A;  2VGM A;  4DXD A;  3JAK A;  5LXT A;  1X7O A;  1SDS A;  3ZOP A;  2GZL A;  5J2T A;  4EI8 A;  3RYI A;  2H6L A;  3VYU C;  3K2X A;  2VGN A;  3HKC B;  2RHO A;  3MBM A;  1E7K A;  1R1M A;  1VH8 A;  4C8I A;  3Q8H A;  4YJ2 A;  3QUW A;  3E22 A;  4YJ3 B;  2B33 A;  1QU9 A;  1YQN A;  2HS3 A;  5IYZ A;  2UYJ A;  4FFB B;  3GTZ A;  3CCU F;  1J7H A;  3HWU A;  4WBN A;  2I6R A;  2ZOV A;  3HTN A;  3K14 A;  4C8G A;  3QHD A;  2DYY A;  3JAT B;  1XHO A;  2K1S A;  2VXY A;  2P6Y A;  3KE1 A;  1Q86 H;  4BVQ A;  2YXZ A;  2GLZ A;  4X1I A;  3CC4 F;  3V7E A;  4O4I B;  2IAF A;  2CHS A;  3LME A;  3DDN A;  5KMG B;  1H48 A;  5CA0 B;  4TV9 A;  4HNA A;  4PWT A;  4ZOL A;  5LP6 C;  3VO8 A;  2L26 A;  1IV1 A;  2ZVZ A;  4X3L A;  2VAW A;  3OW2 F;  1DT9 A;  5HY1 A;  5GIP C;  4YJ2 B;  3E22 B;  4C8E A;  3F6M A;  2Z01 A;  3WGL A;  3JAL B;  3CB2 A;  3JAR A;  4TV8 A;  4WBN B;  2Z1U A;  1VQK F;  3VOB A;  3CCS F;  3LWV C;  3LDT A;  3CC7 F;  4R40 B;  2LCA A;  1Q8R A;  2MQE A;  1KD1 H;  5J2U A;  3CYQ A;  3P0Z A;  1VQL F;  4EI7 A;  3DC2 A;  3QTY A;  2HX0 A;  3D54 A;  2BTO A;  1W40 A;  2WAL A;  1NQ3 A;  2Z1T A;  1OAP A;  3CYP B;  1YIT F;  4IHJ A;  4BVS A;  3ZP7 A;  3CCV F;  1X7P A;  3VIU A;  1JY8 A;  5EYP A;  1YJN F;  4NUT A;  2YYE A;  5JVD A;  3CCQ F;  3CPQ A;  1JFF B;  2HP3 A;  3VCZ A;  4IIJ A;  3JVH A;  4B5C A;  3HKB B;  3UT5 A;  1W55 A;  3HKC A;  2CWJ A;  5JH7 A;  1RLG A;  4G4Z A;  5MN4 A;  4TV8 B;  1K73 H;  3TD5 A;  3NVI B;  1CLI A;  1GX1 A;  2NMU A;  1KQS F;  5BMV B;  2EWC A;  3V7Q A;  3F0F A;  3CCR F;  3VI6 A;  3JAS A;  3NVK E;  4C82 A;  3PAF A;  3ZO8 A;  1TVK B;  2QA4 F;  1PF5 A;  2GVI A;  2UYK A;  3C9R A;  3ERN A;  1KNJ A;  5KX5 A;  1YJ9 F;  1K8A H;  2N48 A;  2ZOD A;  3C9S A;  4M8I A;  1IV3 A;  3RA5 A;  1QVG F;  1FFX B;  1H47 A;  4DRX A;  3SIU A;  1COM A;  1RA4 A;  2AIZ P;  2R6R 1;  4O4I A;  5AVM A;  5GON A;  3IEQ A;  1U43 A;  3GHZ A;  5JVD B;  1W58 1;  3KJJ A;  5CA0 A;  4IIJ B;  4X1K B;  3N4Z A;  3UT5 B;  1ONI A;  1ZWZ A;  3LWQ C;  5JH7 B;  1K9M H;  3VOA A;  3K0T A;  3LFO A;  1KC8 H;  4C4W C;  2KTU A;  4G4V A;  3M4S A;  1DBF A;  3MCQ A;  3N4Y A;  5LP6 A;  3JAS B;  2LBT A;  4G4Y A;  5FNV B;  3JAL A;  1JD1 A;  3FD6 A;  2HRU A;  2ZAU A;  3VTI C;  1W42 A;  2W8B C;  2HRY A;  3OON A;  5KX5 B;  1KNK A;  4B45 A;  4BT3 A;  5GIO C;  4ZK7 A;  2QTP A;  4KWE A;  2UZH A;  1M90 H;  3FD5 A;  3S0W A;  5HY2 A;  1SA0 A;  3G4S F;  1IV2 A;  4NWO B;  4DRX B;  1TUB A;  3GYQ A;  4I4T B;  3IEW A;  4O4H A;  4O4J A;  1VQ6 F;  1U3L A;  3FBA A;  5GON B;  3NK6 A;  3ESJ A;  3VMF B;  5ITZ B;  3FPI A;  1W5E A;  3WGK A;  1RLU A;  5HP8 A;  3RYF B;  2H8E A;  2HP0 B;  5JQG B;  3ELC A;  3IMP A;  3WXM B;  2V9Y A;  1W3E X;  3D01 A;  3RE3 A;  3JAM M;  1JFF A;  3TD3 A;  4O4L B;  4RHA A;  1RQ2 A;  3HKB A;  1NMU B;  5LP6 B;  3NK7 A;  4BVT A;  4BT4 A;  3MDO A;  1U3P A;  5HP7 A;  3NMU C;  3I3F A;  3E1Y A;  5LA6 B;  2FC3 A;  2Q1X A;  2OTM A;  2FGY A;  5BMV A;  4X20 B;  1UFY A;  4O2B A;  4O2A B;  1SA0 B;  5IT9 M;  2AIF A;  5FLX M;  2UYN B;  1TUB B;  1TVK A;  1UI9 A;  2AMT A;  5GIN C;  2G9I A;  3JAW A;  4O4H B;  4O4J B;  5FJ4 C;  3C9U A;  1VQ7 F;  4TUY A;  1FFX A;  1Z5W A;  5MN5 A;  4BVR A;  3HKE B;  1OFU A;  1W57 A;  2PHN A;  5EB1 B;  3RA6 A;  4BT2 A;  1GO0 A;  2VAM A;  3S0H A;  2CZW A;  5B8F A;  5LYJ B;  1QAH A;  2LBX A;  1W5F A;  2CW4 A;  4X1K A;  5C8Y A;  1Q82 H;  4X3M A;  4ZI7 B;  3LWO C;  4TZZ A;  1PXW A;  3I55 F;  5EZY A;  3WGM A;  2RHJ A;  1VQO F;  4O2B B;  4F6R A;  1W5A A;  5FNV A;  4BW0 B;  3JAW B;  3CCJ F;  2IG8 A;  2LBW A;  2HQS C;  2Q1Y A;  3ZP4 A;  1QD9 A;  5CA1 A;  2QEX F;  1H7M A;  2RHH A;  3EOR A;  4TUY B;  1YIJ F;  3M84 A;  1XRG A;  5CB4 A;  5LOV B;  4I55 B;  4ZHQ A;  4I4T A;  1GZ0 A;  5G4U C;  1CN7 A;  3S02 A;  4ZHV A;  3WGJ A;  3IR9 A;  3J81 M;  1X52 A;  1VQ4 F;  3WJP A;  5ITZ A;  1QVF F;  2CSL A;  3S03 A;  2KG4 A;  1VQ9 F;  4G4W A;  5C8Y B;  2CHT A;  3RYF A;  1XV2 A;  2HP0 A;  5JCO C;  5JQG A;  4BY9 D;  2DT4 A;  4ZHY B;  1M1K H;  1VQ5 F;  2I6D A;  2ALE A;  3B6N A;  3BYQ A;  4G4X A;  2HVY D;  4EI9 A;  2Z1E A;  3K12 A;  5EZY B;  1S72 F;  3FFM A;  2F9Z C;  4BT7 A;  3CPW F;  4O4L A;  3HAX D;  3WGN A;  3HJW C;  1FNK A;  4F6R B;  3LYB A;  3P10 A;  1SZQ A;  3R0P A;  1Q7Y H;  1VHA A;  3N2G B;  2ZF8 A;  2KTV A;  3VYS C;  5LA6 A;  3CCE F;  5HXZ A;  2HS4 A;  2BTU A;  5G4V C;  3AGK A;  5CA1 B;  5HY0 A;  2BTQ B;  5EO3 A;  4X20 A;  5EWR A;  4O2A A;  5HWE A;  1VQN F;  1Z5V A;  2UYN A;  3WJQ A;  1RQ7 A;  5CB4 B;  3HKD A;  4ZHQ B;  3CC2 F;  3RYC B;  3V3T A;  3I7T A;  2HS0 A;  4X1Y B;  3P4E A;  4C81 A;  3F0G A;  4ZHW A;  3OBW A;  2OTJ F;  1YI2 F;  2KGW A;  4NQ3 A;  5GAN K;  3V4D A;  3HKE A;  3RYH A;  1X25 A;  1VQ8 F;  5LYJ A;  3N2K A;  4I50 A;  2H8C A;  3JCM M;  3IKF A;  3CG6 A;  3S06 A;  4U3J A;  2OTL F;  4LCK A;  4ZI7 A;  5IJ0 B;  4G88 A;  3WJR A;  3I56 F;  4RQO A;  3JAK B;  5LXT B;  5J2T B;  1W41 A;  3MQW A;  3RYI B;  1FNJ A;  5IJ9 A;  1T0K B;  2CVL A;  3E20 B;  3D00 A;  1JN1 A;  1T0A A;  1W2B F;  3HKD B;  2VAP A;  1IV4 A;  5MN6 A;  1VK3 A;  1Q81 H;  3U0O A;  1IPA A;  3KIZ A;  1VQM F;  5IYZ B;  3TD4 A;  1YJW F;  2ZVY A;  3G6E F;  5LOV A;  1W59 A;  4XCQ A;  4I55 A;  1VQP F;  2PMP A;  3RYH B;  4LNU A;  4B46 A;  1N8R H;  3WPX A;  2IQQ A;  3N2K B;  4I50 B;  4E6E A;  4X1I B;  2RB9 A;  3F0E A;  3M1X A;  4EB6 A;  1JJ2 F;  4U3J B;  1NJI H;  4U39 A;  3CCL F;  3J7A R;  3KJK A;  1VQV A;  3C9T A;  4HNA B;  4TV9 B;  4ERH A;  3J80 M;  3S0Y A;  4ZOL B;  3LWP C;  2OHW A;  3LWR C;  2UYP A;  3CCM F;  5HXU A;  3PLA C;  5IJ9 B;  2JNB A;  3C8L A;  1U40 A;  3F0D A;  5EIB C;  5JCO A;  2QI2 A;  3N2G A;  3CD6 F; 
#chains in the Genus database with same CATH homology
 2HQS C;  4G4V A;  2N48 A;  3WPX A;  4R40 B;  5EB0 A;  2LCA A;  4PWT A;  2MQE A;  5EAZ A;  4B5C A;  3CYQ A;  4ZHW A;  2L26 A;  2LBT A;  4G4Y A;  2ZVZ A;  3IMP A;  2KGW A;  3KHN A;  2ZOV A;  4G4Z A;  2AIZ P;  3TD5 A;  2ZF8 A;  3S02 A;  2W8B C;  4ERH A;  1OAP A;  3OON A;  4ZHV A;  3CYP B;  3S0Y A;  3TD3 A;  2K1S A;  3S03 A;  4RHA A;  3S0W A;  4G4W A;  3TD4 A;  2ZVY A;  3WPW A;  3S06 A;  4ZHY B;  4G88 A;  1R1M A;  5EB1 B;  4B62 A;  4G4X A;  3S0H A;  3LDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...