4IHJB

Crystal structure of tubulin-stathmin-ttl-adp complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 167
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ihjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4ihjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4ihjB01
5LP6B 5JCOC 3RYHB 2RHOA 5JVDB 4X1YA 3VPAA 4LNUA 4X1KB 5GONB 3RYIB 5IJ0B 2BTQA 5M7EA 5KX5A 5EZYB 3JATB 4O4IA 3WGKA 5CA0B 3ZBQA 5CB4A 4DRXA 3JASA 3VOAA 4FFBB 4EB6A 2RHHA 3ZIDA 4O4HB 4ZHQA 3ZBPA 4U3JA 3N2KB 3WGNA 2RHJA 3RB8A 4TUYA 5MN5A 4O2BB 1JFFB 5LOVA 5LP6C 2Q1XA 2VXYA 4O2AA 4XCQA 4YJ2B 4YJ3A 3WGLA 3V3TA 1RQ2A 5ITZB 5J2UA 5C8YA 5EYPB 4I4TA 1FSZA 3HKDA 1TUBA 3HKBA 5MN6A 4LNUB 4B45A 2XKBA 5KX5B 5IYZB 1FFXA 3JARB 3E22A 5CB4B 3HKCA 4IHJB 1W59A 2GVIA 4E6EA 1W5AA 3M89A 3RYFB 4IIJB 4EI8A 4O4JA 2BTOA 4WBNA 5MN4A 4ZOLA 4I50A 5FNVB 5LXTB 5BMVA 4O4LA 4TUYB 2VAWA 4B46A 5LYJA 5LOVB 4I55A 4TV8A 4TV9B 4YJ3B 5KMGB 2VAMA 3UT5B 3R4VA 2R6R1 3RYCA 5EIBC 5C8YB 5IJ9A 4X20A 1SA0B 3HKEB 5LA6A 4F6RA 3JAWB 4KWEA 4HNAA 3JALA 1TVKA 4X1YB 1W5FA 3N2GA 3JAKA 2BTQB 1OFUA 4O4IB 2R751 4O4JB 4DRXB 3JASB 1RQ7A 5EZYA 3JATA 4WBNB 4EB6B 5CA0A 5CA1A 4FFBA 5JQGA 2VAPA 4ZHQB 4U3JB 5J2TA 5JCOA 4ZI7A 5EIBD 3N2KA 4M8IA 3RYCB 4O2AB 4X1IA 2XKAA 1JFFA 3WGJA 5J2UB 5LA6B 4YJ2A 3VOBA 3VO8A 5JH7A 4I4TB 1TUBB 3HKDB 1Z5WA 5EYPA 1Z5VA 3HKBB 3N2GB 1W5EA 3JAKB 1FFXB 5LP6A 3E22B 4EI7A 3HKCB 3RYHA 5IYZA 3JARA 5CA1B 5JVDA 4IHJA 4X1KA 5GONA 3RYIA 5IJ0A 5JQGB 3RYFA 4IIJA 5J2TB 4DXDA 4ZOLB 4ZI7B 4I50B 5BMVB 4O4LB 3VO9A 2Q1YA 5LYJB 4U39A 5FNVA 4I55B 4TV8B 5LXTA 4X1IB 4O4HA 2RHLA 3CB2A 1W5BA 4TV9A 5KMGA 3C8LA 3WGMA 3UT5A 5IJ9B 3M8KA 4O2BA 4X20B 1RLUA 5JH7B 1W581 4F6RB 1SA0A 3HKEA 5ITZA 4EI9A 3JAWA 4HNAB 3JALB 1TVKB
chains in the Genus database with same CATH superfamily
4XGQA 4GC5A 5EIHA 4BR6A 3RYIB 4LPKA 1FFDA 2AI2A 5LHIA 1M2KA 1N2SA 2ZJFA 4LCBA 2GN0A 3GJSA 4FFLA 3UIEA 1YOBA 2P8JA 4HPXB 3TSAA 4YMUA 2REQA 2M2IA 2WFMA 2G0TA 2QUZA 4ZQHA 2ZAGA 3ML0A 3CD6F 2VLIA 2VRCA 1J0EA 1U9YA 2Q3HA 2XRMA 3K09C 3JAKA 3R6GA 4FU0A 4KMMA 2D0OB 3HPLC 4JLVA 4GPIB 3A04A 4FLMA 3C3MA 1OY1A 5JADA 5A5GA 3IRVA 3U39A 1ESDA 1ZWLA 2VHJA 3FX7A 1L4EA 2AA3A 2O23A 3JARA 1Z26A 3PNLA 2GSWA 1DBPA 2FK8A 3OICA 3H1PA 1QVGF 2ZRMA 4L8JA 2VTBB 3D6UA 1D4AA 1MBZA 3OF2A 4PC1A 3UFBA 1HLPA 2C5HA 3PEVA 2BGMA 1MAWA 1ZX1A 3FFBA 5FBQB 2VH1A 4B5CA 2Z5GA 1IEXA 1AQUA 5JAUA 1AVMA 3C74A 1JWAB 2MK3A 3T7KA 3HKDA 3Q2OA 3ZQ4A 4DDWA 4MQBA 2AXEA 3VPXA 3U10A 5HMLA 3LUBA 2HNKA 2PRJA 3E6AA 4OP1A 4K3UA 4M9QA 4U7WA 2QIPA 4V0LA 2H1IA 1EGHA 3NAZA 5A2GA 4O2AB 2CC2A 2ZSJA 2Q4BA 4EHBA 4M8KA 2H9YA 2XWBF 4QL3A 3C3SA 1TO1E 2I78A 5J1SB 5ALSA 4R69A 3DMNA 4KQXA 3VR2D 2MW2B 2Z30A 3PEFA 1C9JA 2AQIA 4Y18A 3T9EA 3WGQA 2GCNA 1CHNA 2OORA 4JB0A 1Q6IA 4B08A 1XOIA 3CEHA 3ONEA 2F4NA 4YI3A 2VDNB 3TNYA 2C2GA 4G5SA 1G21B 2J30A 1UJNA 4Q6GA 1GKYA 4NBRA 3ITNA 4NK4A 4Z1OA 1Q1GA 1YFKA 3GAAA 1FXWF 3U17A 4WN3A 4G0UA 4D4JA 1JHYA 1NKTA 2OESA 4HS9A 3BKWA 2HF8A 1G8JA 2IEZA 2XAUA 4DR3O 1FNNA 1ML3A 4EPRA 5LL6Y 4HWOA 4DYLA 1U3UA 5DYGA 4L5CA 2FEMA 1RA4A 1SVLA 1NBMG 4AYWA 3CF6R 1GPWB 4BEWA 2BBSA 4JLDA 5EBWC 1Y37A 5CD1A 3OUTA 2UZ1B 2FPGB 4FWBA 1QVGU 2ENUA 1E5TA 2BKVA 1K6IA 4C89A 1W3EX 3AEKB 3L72H 4LZJA 2VDKB 4XDKA 3FKQA 4ZPJA 3LFOA 3H2YA 3JQAA 3KDSE 4A0GA 3LHSA 1K6EA 4ZTBA 4O4HB 1NI4A 4P3KA 5I9SA 2ARHA 3RU2A 1XZQA 1SZJG 3LY8A 2VOEA 3ZIAA 4BJ1A 1CY8A 3P2JA 3CUWA 4BMVA 1QMPA 2Z56A 1VCOA 2X77A 3I05A 4GDFA 2I4NA 4MHSA 3HDHA 1EJ2A 3ORHA 1AK1A 3K6RA 1DX4A 3CE6A 4TLAA 4TZ6A 2EGUA 4DSNA 3OFSA 2FUG6 2V9ZA 2O3SA 4PO9A 2IYSA 4PIPA 1V6CA 5HCIA 2LIVA 2J33A 3N8IA 5BWMA 2CGNA 1RXCA 1D2RA 5ECYA 2QL6A 3PKZA 2IYNA 4OLAA 1K3EA 4TS4A 1YTFD 1BX1A 4IG4A 1PK9A 3RC8A 2O8NA 1MSDA 4Y6SA 3G6EF 3D59A 3PSAA 4YT4A 2BDUA 1E64A 4AU1A 5HBRA 5DGDA 1IONA 1ZHOA 3AL2A 3CCCA 1J5EO 1Z62A 4PDMA 4TMWA 4XAQA 2X22A 2XT9A 3SWWA 2L42A 3IULA 3L0DA 4CT0A 3LBHA 1BVHA 5E4JA 2ZB4A 2Y77A 4URWR 1NURA 3MS7A 5B3JC 3AP1A 2GZDA 3F5QA 1GA6A 1GZVA 3JQQA 5ARDA 2PEZA 5AKGA 3UAGA 3TLEA 3SOZA 3EGIA 2RJOA 1YQ9A 1L3CA 1JEYA 4MR7B 1V4NA 1K5HA 1E2JA 2WALA 3LX5A 2VWPA 4B6QA 1POXA 3DAHA 3QMMA 3ZU5A 1Z7EA 2XUZA 1GTJ1 1NVMB 1N2ZA 3HEMA 2X42A 4QO7A 2Q1YA 5CNIA 4CIDA 1S89A 4FFRA 4E13A 5IC4A 2C8JA 3IIIA 2VP0A 1IV1A 5B1HA 2LDBA 1Y6JA 1PTKA 2RB9A 4FEEA 3C5CA 2D5CA 3FPGA 2A5YB 4ZCQA 3ELBA 4FHZA 4FZRA 2HW8A 5BXZA 5BOSB 1CJSA 5TV2A 4TWBA 1VIYA 4GX2A 1PG5A 4LN1A 1D6NA 2P1ZA 1BDMA 4FINA 2QM3A 3SU8A 2AB0A 2HBZA 1QLWA 1D2AA 4X7RA 4IZOA 1XNQO 2YX1A 4U5XA 3DXZA 1XKXA 4RD0A 3X1ZA 3D2BA 3UAVA 2FEOA 5DM0A 1VLJA 4IDCA 3U7QB 1CUEA 3LTEA 2AZ0A 2CLHB 2ZXEA 3OR7C 1N75A 2NTVA 4Y8VA 2ZJ3A 3PFCA 3IOEA 4UTVA 1PV0A 2GBOA 2C5SA 5A3QA 1JB1A 2X9NA 1P7PA 4FZ1A 4F5EA 5BQ3A 2VVTA 3RYFA 1CK2A 1BROA 1WCYA 1L8XA 3JQBC 3KXKA 4KPFC 2RG1A 1DQPA 4ESEA 4MA5A 2RBEA 3D2AA 3OQ1A 2IHZA 4WNIA 4DIOA 4JJ4A 4I4NA 2ZPUA 2PR7A 3LKDA 5KSPA 4G97A 2ILMA 4KMOA 4EYGA 4EM6A 3RB8A 3U6KA 2Z1NA 4KVAA 3CVJA 3C48A 2GDZA 2YVQA 3ICWA 5TPWB 3I2KA 4PN7A 3PFKA 1E92A 5CB4B 2JH8A 4RL6A 3G8DA 5D1NA 2VZLA 1U5BB 2NSHA 1KI6B 2J0UB 3AINA 3I8SA 2QY9A 3U44A 4TSFG 4LFBB 1NRJB 3MTIA 1P61B 3L4SO 1CR0A 2VRZA 3TR5A 3DPSA 4RJ2A 1IQPA 3V6MA 1B42A 4S3MA 2IHJA 4PZAA 4WLUA 4Q01A 4BMCA 4POOA 5JNTA 5J40A 2OQVA 1GRVA 4NBNA 2QV7A 4AXBA 4YV7A 1N5IA 4UCQA 3IAEA 3OX1A 5E6SB 2F23A 2BH9A 1ZRHA 2DQSA 4DNPA 1Q15A 5I9MA 4BAGA 1FRFS 2XXAA 3Q3VA 2XE7A 2WOJA 2ZIGA 1WDKA 2ZBRA 3FXAA 3DYVA 4KQFA 2AFIE 4U63A 3HJRA 2WUVA 3G9XA 2IW3A 4CU5A 1EUZA 1QYCA 2EIKC 4LC9A 1UJ2A 4RKRA 4DLWA 4WRRA 2G9RA 1D5AA 2FGKA 3VSAA 4QT0A 1EUYA 2JFOA 1EVLA 6ABPA 2P7TC 1ZI6A 2P9EA 2ZP1A 4TMTA 3U1VA 1SKUA 4IHJF 1MC5A 4N9WA 1SIUA 1YDWA 2ZU6A 1LF0A 2QWOB 3GQBB 2EARA 3LNNA 5ALZA 5F7ZA 4ARSA 4LZNA 4E03A 1WUIS 3V9AA 3KOMA 2VF7A 4B8YA 3K57A 4DQUA 3UV7A 1D2DA 4BFCA 1E4OA 1GUAA 4MUIA 3SOPA 4MW3A 2QQ5A 4EYKA 5IMBA 1V95A 3KYIB 5HSGA 1FMLA 3LDUA 3OONA 1JNXX 1PJCA 4NJMA 2EFEB 1LY1A 4IDAA 3QF4A 5AM5A 3ZKWA 4A3SA 2DPXA 4CQMD 3K9GA 1SUDA 1DQSA 1CSEE 5TLSA 4KXNA 3NWBA 2CF6A 2UVQA 5IFKA 1KKUA 2VATA 3KU1A 4BRSA 1GVNB 2YIMA 1UJBA 2FUEA 3K0FA 3BXPA 3ENZA 3D7LA 2AFHE 3DC2A 2NV2B 1M34B 2VCEA 3K9WA 3DEYX 1GFIA 5D86A 1NWCA 2F8MA 2XUHA 2IYEA 1E0DA 2AUTA 1QRDA 3ZE2B 3VR0A 3L07A 4CF7A 1U2RA 4G4YA 5KNLA 5A7FA 1P4JA 2PUFA 4PCLA 3CEJA 4XCVA 3DT8A 4HNSA 1WB8A 3TLGA 1ZOSA 2CNBA 7YASA 1A97A 4C5AA 2E74B 1VSTA 4AJ1A 1L5MA 3P4XA 3KQSA 2ZS8A 4WUVA 5NLLA 1OAAA 2BN4A 1YR6A 1E7QA 1A9ZA 3ABMB 3CLTD 1Y1LA 5HFLA 4PTZA 1SVUA 4MVJD 3PCRB 4CM7A 1XREA 3K9SA 4BIOA 1VF7A 2NW6A 3JD2A 2AJLI 1WZEA 3CCJF 4WCEV 1DMSA 4QNHB 1P6XA 1XFDA 5F5LA 2HOQA 3PRKE 3QFTA 2F1JA 1KMIZ 2JGDA 3A9UA 1WDWB 2CYCA 5CDUA 3MUEA 4KI0A 5CW1A 1GRQA 4MWGA 1Z6PA 3SC2B 2FPKA 1KZ4A 2MSEB 1UFVA 3SG0A 1H23A 1MW9X 1IV3A 3F3MA 2N46A 4GZMA 3IP3A 1P9OA 4MUAA 2ZI3A 4IRMA 2ZKLA 3ASUA 1XF9A 1PR0A 2WU3A 4IP0A 2CLKB 4JI1B 1AV6A 4JX8A 3X2QB 4O2AA 2G36A 3PB3A 1YVDA 2XDWA 2UYCA 2I66A 1MX1A 4R1OA 4FDMA 2NPFA 1IK4A 4ONEA 4PZZA 4FEYA 1CP9A 4E4RA 4DIDA 4DC9A 4Q21A 5BR4A 2CHEA 4DV1B 3N87A 4ZQCB 5KKAA 4RGVA 3MJHA 1GN8A 3WFZA 5K0FA 3N0WA 1V5FA 4NMHA 3D7MA 4D4IA 1IZYA 4RHFA 3WK6A 3WDKA 5B66Z 1SHZA 1R8JA 1QIGA 2DJIA 4OJKA 1KAHA 4JI6B 4HH1A 4BFWA 5C81A 1GG8A 4BLOA 2E0IA 4KX5A 5TMBA 4MEAA 1GUYA 3OUUA 1KD1H 2OO3A 4UCRA 3SCZA 5EHZA 1T3SA 1LI4A 3WBFA 4KN8A 3IT3A 1SC1A 2NUBA 1U4NA 3AVUA 1IZ8A 4P3PA 4BO7A 4D02A 3DW1X 1FRVA 2P3SA 2VSYA 4RABA 2V1XA 2YICA 3F8WA 4L95C 1VKRA 2H48A 1ZIOA 1LNSA 1RKBA 1MHPA 2A0YA 5HNKA 1Z12A 3LCJA 3A58B 4WK6A 4MVZA 4BLQA 2QKYA 2Y99A 2K4MA 3TEJA 1U1DA 2C1ZA 4ER3A 2HO5A 3ABLB 1NJSA 2G5GX 1Y3DE 3O1LA 4ESVA 1EZ1A 1WD5A 2UZ1A 2JGUA 4H4CA 3Q8HA 2Z6AA 1VBFA 1K5GA 1W0JG 4NXMO 3K5WA 2QAGA 1WS6A 3B7GA 1D4FA 4FNOA 4FR5A 3B9QA 5ERYA 2XAAA 3DVQX 1Y7TA 2WF8A 1BS9A 3MFYA 1B74A 5DI3A 3SPJA 2IK8A 4PYQA 2NV6A 4KUEA 1MC4A 3UMRA 1ES9A 3FOAA 1W5EA 1A3CA 4O4LF 3WYBA 1RI1A 4PGHA 1PNQA 1W94A 2PUHA 4N8SA 3A1SA 2C4WA 5CJPA 3DDNA 3SS7X 4DLAA 1TC2A 3UWKA 4RYDA 2HLDG 1WETA 3PNVA 4NUTA 3LXXA 4QPCA 2XTJA 4NQRA 3LCCA 3KEOA 4MH0R 4URHA 4CCYA 5KAMA 1RZRD 3QWAA 2QSAA 1I2AA 3LPCA 5JSKA 3FGNA 3UJ3X 5BUQA 2IBMA 1OFUX 5CVVA 1VLLA 3U26A 2E49A 1G63A 1U04A 4UUNA 4B6SA 4RD4A 2AD1A 4JZYA 3PGA1 3O73A 2Q3CA 2BCGY 4FILA 2CXHA 3NKLA 2W11A 2AMJA 4MVJH 3F5MA 5SZHB 4CL0A 2BSQA 4Z6KA 2PE5A 4FOPA 3WPXA 1KFBB 2ZAYA 1KERA 5IVDA 2MU1A 4PCAA 4R50A 3K3WA 1ONOA 3WJ1A 4U02A 5LB4A 1X9HA 2O6HA 4D5GA 7AT1A 5AOBA 2AYZA 1IN5A 3U49A 1WCWA 3CUUA 1XZJA 2RGYA 2EAUA 2IIQA 4DEXA 3JQ8B 4Y6RA 4D80A 2VP2A 5M3BA 4WJLA 1MQAA 4NAHA 1BT8A 4XQ0A 3B77A 1L5OA 1G18A 1SUSA 3QX9A 4I66A 4IQ0A 5EJEA 2Z9DA 2ZTSA 1QG4A 5IM5A 2ZYUX 2OO7A 3QNUA 5TJHA 2C5EA 4RA6B 2HSWA 1C50A 3WAJA 1IY8A 1EUCB 3QUAA 2EP5A 3KPWA 4CV2A 2PUTA 2KGWA 3NVKI 4TSFD 4YT5A 3C3CA 5BOSA 4EENA 1OU0A 1Z5WA 2A3NA 3LDFA 1JF8A 1FP7A 2TMGA 1TK3A 1MOSA 1OZGA 4N39A 1BWQA 4M55A 5C1DA 2OHIA 3GJYA 4DMHA 2CTRA 5HY0A 3OFKA 5BY1A 2YRXA 3L7BA 3CVUA 1ESMA 2CDAA 3M9LA 1UXHA 5SY9A 1FE8A 4LF6B 1HORA 1VI5A 3ONFA 1EFCA 3IH5A 3Q4HA 1U2DC 1A88A 2OWDA 3PRJA 5D00A 4CFYA 1DLJA 1O08A 3QEJA 4Y2HA 3Q2KA 3GYGA 3KUCA 4ALIA 2YQ4A 2WTNA 3APQA 5H83A 3P94A 4A5OA 3KP1A 1RPRA 4H3HB 3IAAA 2ZIZA 4AG5A 2IEDA 3LCUA 2E1PA 1WEHA 4N6OA 1SCQA 4ENPA 3RRBA 4HRXA 5T67A 1EVJA 4MGYR 1WUYA 4J2HA 1X7WA 3EQ2A 2ZWAA 5BQ5A 1EFDN 2QRHA 4NI5A 1E18A 2IIPA 1E3LA 4U7JA 4GI1A 5DCWA 4F5DA 1SQPH 1CRPA 1H5NA 1S8NA 3K71B 3G17A 1NQXA 2JCYA 2IYLD 3UQZA 1IATA 3W4IA 4A0FA 1U5BA 4MB2A 4HSGA 3X0DA 3FFXA 2J0UA 1I6KA 1N6NA 1KI6A 1ZN2A 2X13A 2C78A 3TIXB 2AKAB 3HR8A 3K35A 2Q3DA 1UZAA 3U61B 2HZ7A 3CC2V 1P3Y1 4UCFA 1PT8A 4LNUA 3LBAA 3COYA 2VS0A 3EK2A 3SYPA 2WAOA 4F4FA 2DQ0A 5DCUA 3N39C 4BZPA 4EB0A 4R5HA 1UQUA 5GJWC 3BTSA 3OQHA 3OM3B 2Z9CA 5H5NA 3UHJA 3B52X 4HVTA 2JHAA 3G02A 2AR7A 4QDKA 2I8CA 5TF4A 4JMPA 5AQEA 1AJPA 3VZCA 4DAEA 3WNBA 4MQ4A 3CCQF 1AQNA 3RFVA 1A71A 1YHQV 3VU8A 4L16A 3L18A 5C1OA 1XA3A 3O4VA 1WB6A 4NV0A 3X2EA 5EHQA 2LBXA 3LRTA 1Z4JA 2CF5A 4LHVA 3IT0A 4DPLA 5KYKA 4O4JF 1KS9A 4ZK7A 1A1VA 2OZPA 5B36A 4GMKA 1IBKO 1IV2A 3H3FA 3FVWA 1TYCA 2GYVA 4M6WB 2YH2A 1CIVA 3F6EX 2A86A 2IWHA 1QU3A 1TGYA 1BEUB 4QUDA 2GBLA 4P0TA 1NU6A 4H1VA 1JZQA 1NNUA 1YK1A 4YAWA 2JFHA 2COKA 3BRQA 3P19A 4RX1A 1E58A 5DXFA 1IQRA 4OD0A 3CT4A 1ZLZA 2C9DA 5EXEA 1PNRA 4YEDA 4WFBV 1C4WA 1SZTA 1H2RS 4PXAA 1KI9A 1QIMA 4TKLA 4DLPA 1DDGA 2I9PA 3AK3A 4L15A 3BFJA 3QTBA 3W8EA 4KO8A 2FTKE 1QCEA 5IXSA 1KAGA 2AFRA 1WXHA 3WWDA 1VLQA 1CRLA 4J10A 2CW5A 1L4BA 4JEHA 4DEVA 3ZGVA 5CURA 4D6PA 3QY9A 4OL9A 3ZWPA 5KWEA 2FMUA 5FPOA 3K8QA 5BVHB 2JHFA 4TRNA 4LR3A 4BU0A 5FI0B 4QOJA 1M34A 3I37X 5KTNA 5DLYA 1J0DA 5DLEA 2QU7A 4MTLA 1D6MA 4X1KB 5KSOA 3DNFA 2H1VA 3FMVA 4GMFA 1J1UA 4S0ZA 4ETNA 2BGRA 2PGJA 4OP2A 2HHJA 5A1JA 3UGQA 4TRMA 1LSUA 3L7DA 3B53X 1PBTA 1EINA 2G70A 4N12A 2P7HA 2EG9A 5GV7A 2A57A 3SR3A 4YO8A 1Z2AA 1I7DA 1E3EA 3W3AA 3UT0A 2GD0A 5BR1A 2NNLD 5K1PA 3ZWAA 3IC7A 1VBMA 4R8CA 3RLIA 5CFQA 3I5XA 4DCJA 1CDZA 4YUWA 2BHTA 1TM2A 2PD6A 2BE7A 3TLMA 2WVJA 4P5EA 3NBFA 3CTMA 1M0EA 3PAFA 4NJOA 5TPZA 2O52A 3K30A 5JRZA 2OG1A 2HA6A 2W6MA 4B85A 2GJSA 2VP6A 1NP6A 2WIGA 4N3NA 5JPDA 5LBTA 3AYZB 4DJJA 2OBBA 3O91A 3GV0A 4E11A 5JBNA 4LNAA 1QGUA 5DM4A 3S0JA 3P97A 1YQTA 2R11A 1H2ZA 4U8HA 4TLBA 1BKSB 1PP9H 1U94A 3HCDA 3FGOA 1A98A 1QAMA 3PEUA 3SC2A 1CEYA 4D9NA 3V32A 2JEZA 3B1XA 1XYVA 1UPFA 3LG2A 3I6ZA 3GPCA 3CNHA 2JLYA 5CPBA 3DF7A 1U9ZA 5L7WA 2DWEC 1OWNA 3H75A 4I8IA 3K0KA 4B3SB 1U90A 4C7BA 2BKAA 3F47A 1OBFO 1RYHA 3JAKB 1Z3CA 4NDNE 2Q0SA 3GWOA 4R7TA 4X8AA 4JC5A 2A9RA 2JLAA 4R2IA 3U9LA 1RPJA 3E5RA 4F6LA 3BEHA 2Q9UA 1XHXA 4H6XA 1MJNA 4HAWA 1QF7A 3SLRA 2IHNA 3CH6A 3KNZA 4OOEA 1ZWKA 3B78A 4KMSA 2W4IA 1LRLA 3E5NA 4FUTA 1X70A 3ENQA 5LP6C 4RFLA 5EC2C 3L73H 4UCXA 3RVKA 2ZBQA 1JXQA 2V0GA 4IQ8A 4FYKA 4M0MA 3GDGA 2ZE5A 4PI0A 4L3WA 4EJFA 2JGFA 4M0DA 3A7EA 3PHJA 2NZJA 3FD5A 1QC5B 3TD5A 3VR5D 4J4TA 1WLSA 1WP9A 3C8ZA 5KX5F 2VYFA 1IMJA 5LBUA 5T6MA 1SC9A 2NYRA 1E5VA 2W6NA 3UJPA 3S81A 1O5TA 1TEXA 4L76A 4P93A 4K9RA 3BMNA 3H8WA 1L7AA 4ZQEA 4UNQA 3P9RA 4ZBMA 4FOTA 1EXNA 1QDUA 3DSQA 4D9CA 2IH3C 2V7TA 3KKQA 3CCBA 2QJFA 2EBFX 2FF5A 2PT7A 1OHHG 3IODA 3NTRA 3QSYA 1QQBA 1F51A 2ZRDA 2BM9A 1FB5A 3LIPA 4C0LA 4LMRA 4NFHA 2WWYA 5HRUA 3OHPA 3PQ5A 2MWMA 3QTYA 1IHOA 4BT6A 4UQPA 1F12A 3I92A 1T3HA 2B82A 1VIBA 4C4YA 2WWIA 3AEQB 4G86A 2COUA 5LHGA 5ABPA 3HSYA 1XZNA 1QTQA 1PJZA 3AUKA 2ZIFA 1B76A 4P92A 2B69A 4HNTA 5A2QN 2HBRA 2WUWE 5KAIZ 4GW3A 4U7OA 1VHWA 3C6YA 3OD1A 1QGOA 2COEA 1PTJA 1PYDA 1NFRA 3B09A 1QK4A 3TTSA 1JI3A 4B7EA 2NUAA 2DHRA 1BVUA 3SQOA 3DTVB 1YMUA 1N33O 3RKSA 4JYBA 3TYXA 1G8FA 2PXCA 4NDAA 2ZS7A 2M6RA 1QFYA 1QLHA 2IIBA 2HS3A 3FUTA 3SXJA 4P7BA 4BVQA 4O08A 2DBVO 5K6AA 3AVWA 5JQWA 3QJ5A 5CLLA 2W2TA 3DEHA 4F56A 1JECA 1R9MA 1JAZA 2PLWA 3KHSA 2PWYA 1SZXA 5T41A 2BM8A 1QR6A 1W581 2QIOA 4J07A 2NZYA 3L8EA 2ZKIA 1XUOA 1O0SA 2P06A 3LBNA 5JMTA 2PR2A 4IDQA 1U40A 1XQ1A 3KVVA 2JIBA 4UBNA 3IO3A 5HUQA 3FGZA 1E8NA 1XTRA 1TA8A 1YR9A 2GHYA 2OIGA 3FROA 3JQAB 4MZDA 4JV5B 1QFMA 3Q3CA 1HF3A 3R6TA 1ZOLA 4RANA 3CVOA 2XMPA 3RTEA 3L1JA 1K1EA 4INJA 4OGLA 1QVRA 3JQ8A 5DZSA 5CM8B 1UEJA 2DRIA 2RC6A 3BEOA 4Y9UA 1OFUA 1AU9A 4QJIA 2E37A 1G38A 4DQ0A 2OVFA 3BAZA 2OYSA 1ZH2A 2XLBA 1CUIA 2XTNA 4JI4O 2PNFA 3L3BA 3O8NA 2A0UA 5K3OA 3SYTA 2BEWA 4AK9A 3DR3A 1YMQA 4QODA 3TSZA 3OX4A 4MW0A 1IRIA 4ZI3A 1RQXA 4C6RA 4TYYA 4Q6BA 4POAA 2IJJA 1FFBA 1ZCZA 1CIJA 3GY0A 2QSUA 1W4BA 4ZJYA 4CDRA 4PQRA 2VDQB 1GM9A 1O9BA 3ABZA 2NXNA 4ZAGA 3HWX1 4DSUA 5JHGB 5L6MB 2QNBA 1T2AA 5AFSA 2RFLA 4FMPA 3TQHA 3VSCA 3JSXA 4Y2TA 2DE0X 1Y5MA 2HY7A 3ABKC 3P2YA 5IK2A 3RVYA 2JF0A 1D1SA 2XZLA 3U0VA 4QM6A 4MYUA 4TXNA 1W36D 2RGXA 5CIQA 2LKDA 1ZA2A 2I2DA 1K7XB 2EKLA 1SXJC 1T5DX 2P4HX 4GSKA 4GC9A 1NRXA 4JXJA 4NG5A 3LL7A 5DTIA 5ILGA 4B3TO 5HUHA 4AMYA 2IH5A 2GJ9A 4OG2A 3BOSA 4QLOA 1LW7A 1OI3A 4PLPA 3LFTA 1FU7A 3QG1A 3UA4A 1UJ6A 2R66A 3U7FB 3MK31 2BGNA 1FF9A 5JXIA 1JAIA 2HS0A 4L8LA 2GXSA 2OTLF 1RC1A 4XDGA 4ZVUA 3ROMA 3K06A 1TUEA 2QN8A 1CUDA 2INGX 2Q0XA 4QYXA 2NUTB 2IDMA 3GLFE 1C9EA 1J0BA 4JBYA 3CXHF 4FMCF 4I1PA 3MMPA 5FUMA 4AY6A 4DQLA 2WNHA 4NCJA 3DFIA 2AFIB 2VQFB 1AMOA 3QE3A 2H4YA 1RLTA 2A3QA 4LE0A 1X52A 5IY5C 3OLZA 1AHPA 3TZ6A 5DNEA 3C7DB 1G5QA 2JAXA 1T6YA 3KTOA 2JK1A 5GGYA 2UXDB 3GA7A 1U96A 4BMYA 1G59A 2NO7A 1XLVA 4OFBA 2C96A 1LV8A 4P84A 2SNIE 3RADC 2YBDA 1AB3A 3DZHA 3P9IA 3HCFA 3BULA 5IUKC 4HNAB 1BDIA 3BFKA 3Q7SA 2C0CA 3HYTA 3BGSA 1V7CA 4XR9A 1Q90D 3VYWA 3HN7A 2W2XA 1CU1A 1IB6A 4UDXX 3IUYA 1YCGA 2ZBFA 1NATA 2O3JA 4INPA 1DAKA 3BIOA 5LMUO 4L9SA 1RWXA 3NEAA 4XWYA 4J9ZB 1DRUA 2FK7A 1S0VA 1AUPA 3SX4A 4K9DA 1SHLA 4DABA 1H4VB 4QPJC 5LDHA 4KFMA 1PEYA 2HJFC 3ZX5A 1WAZA 1H2HA 2W2QA 5D85A 1IBRA 1X1RA 4Q20A 5JJIA 1MF7A 3U44B 1D04A 2QTTA 4JXXA 5JO0A 4PELA 1U1FA 1EK6A 2CFIA 3PHLA 4RV4A 1K27A 4OQDA 2QRJA 3I1JA 1QHEA 3GHHA 1JHMA 2AFHB 4PVDA 1SD1A 3U16A 2O8DB 2DYYA 4AQYB 1R4AA 1OJLA 1QIDA 4XUEA 1V9LA 3MWFA 4FKZA 1UQTA 3KELA 2GF9A 1E5QA 5EKDA 4GGPA 4P3NA 5DDIP 1E9DA 1FPMA 1ULHA 1XWWA 1ZCJA 1YCHA 1EIZA 4DRYA 1S8AA 2O48X 2H8PC 5BVHA 4N03A 2EILB 1PHPA 4QTTB 3IUBA 3M7MX 2VAMA 1QAQA 1CJMA 3DOOA 1FUUA 1Z0JA 4OHVA 1EN6A 3CV3A 1CY4A 2XD9A 1M93A 4F9EA 2FWMX 1JGTA 4NHOA 5DHQA 3E0XA 5IU6A 1RQ7A 2BGGA 2OBLA 1MPTA 2AJTA 1I01A 4OYYA 5HX7A 1EZ4A 2XUIA 1YUMA 3NI2A 3PA8A 1N36B 1FCJA 4K9SA 1B6TA 2XGSA 3UMJA 4M0PA 4C9BA 3PWTA 2BHLA 3QHDA 4TVKA 4O2BA 2QRGA 2ZYAA 2HA2A 4BV3A 1Z83A 3JALB 4NV3A 5J23A 4NCKA 4Z8YA 4HBNA 2O3QA 2NOAA 1NE2A 1JEEA 4PQFA 2ATIA 2ZDIA 1MG1A 1E63A 1IV4A 4HWTA 4JX9A 4XVUA 3TVDA 2BKEA 1E66A 4EUKA 4YNBA 4LFAO 5IWCA 4C6TA 5DKFA 4HNHA 3ZD6A 4IKEA 5I9BA 1V3VA 3W7XA 4YRKA 4HFRA 3QF4B 4FFNA 4L7QA 3DZ8A 2FZWA 4Z3KA 5KNBH 5ESWA 4LJ8A 1XRGA 1LZLA 2GBGA 1V8FA 5BMOA 3QKWA 4OLJA 4RVCA 2PWZA 3C1AA 3G82C 4ZO4A 4QC2A 3UB2A 5E1BA 3GMDA 1IXRC 4QUEA 2HNAA 1VLHA 5EBMC 2ITCC 1T8PA 3BWYA 3LBFA 1QHFA 4LK3A 2QS9A 3HWRA 4DR7O 3QLUC 3RUPA 1Q7YH 1YACA 1JXAA 5DHSA 1WQ1R 3TQTA 3ZZMA 1GZ6A 2A0KA 1OHHD 3R66A 1J9GA 4H37A 2EFCB 1RHUA 4M88A 3ZQKA 1A4RA 3LX8A 1CEXA 4WXRA 3CSSA 4NYIR 3VNVA 4JJ6A 3O7WA 2G9VA 3AFHA 4LE2A 1M3SA 1NVKA 3TLGB 1RYFA 5KTKA 5DNVA 2FUCA 4HC4A 3VBBA 1NLYA 2WM2A 2R00C 2PIAA 4E94A 1E5XA 3IP5A 3U1BA 3QEBZ 2ZG6A 4A8JC 3QVJA 1IXBA 1Z82A 2H63A 4EF4A 2P4EA 3RAJA 2QK4A 3THXB 2FSVC 2HUPA 3K0CA 1Z4KA 4UM7A 4FNGA 2EX1A 3PIIA 1AKNA 3P9PA 5GZ6A 3SYMA 1J7JA 1PYOA 3LXRA 1QTNA 3TRKA 3WL6A 2ZUEA 3IO5A 2YWDA 1DEOA 4R5MA 5BMVF 4UBLA 4XX0B 1AROP 1H8HG 1RCFA 2XJ4A 4PEVA 2JK0A 1QC5A 3DBRB 3NHKA 1JX9A 3AG3B 4S0XA 1QNFA 4LGCA 3GWKC 3RANA 2JGDB 3ET5A 1FBNA 2V7UA 1XEWX 2Z2KA 3ETQA 4PLVA 1C1DB 1GNQA 4FGJA 2GYWA 3OTOO 2YZKA 3GBVA 3O3CA 5IYBO 3RVNA 1A4XA 3OQBA 1FQKA 4GXQA 1QLEC 4BWYA 1M75A 1YITF 5K8LA 1ECLA 5BQPA 1KEZA 2VWKA 5EJ7A 3G5AA 1VB3A 4DN6A 5EB0A 2WK1A 1QU2A 3P1JA 5CCEA 3EORA 1Q21A 3AEQA 2QWQB 3OLCX 4S24A 4PHZA 4RW0A 3U9SA 2QV0A 3NVDA 1DKOA 2H4FA 3FZNA 2LDXA 3BE5A 3SPXA 1KQSU 3ZN1A 5CT4A 4OA5A 5DH9A 2JZOA 3DTVA 1QCDA 3WO0A 3JCMM 3ORRA 1GQ2A 4CRWB 2SKDA 1SZCA 4B35A 5FJIA 4E46A 1NUHA 1SWVA 1KTVA 1MP0A 3EWIA 3LNMB 4HGPA 3I72A 1A8SA 3TAUA 2FHSA 5TY0A 4LQDA 5HIKA 1DHTA 1EP1B 1SVWA 3K9AA 4MUNA 5TF0A 4JL8A 4YCNA 1QRTA 5DLDA 4UBMA 3O4HA 4WD3A 4PYRA 1U3GA 5JARA 3VA7A 2AN9A 4FE7A 3A6HA 1GG5A 2DWDC 5AI4A 2X5KO 3KWMA 3RFXA 2XA2A 1OAPA 5C32A 4MV3A 3OMNB 3DFMA 4G4ZA 1N57A 3UYKA 4G0PA 4HN9A 3ZXUB 2QAGB 3L77A 4ZRDA 5I3ZA 1WP7A 3AEYA 4G8BA 1GPMA 5DI3B 1KXJA 1PF7E 4HRVA 3IOMA 4MQLA 5FWDA 3WLNA 5FDFA 3EXG2 3DEFA 4AKIA 4AI8A 3S99A 2J9YB 5BWNA 3IR9A 4YUAA 4RLSA 2R9VA 5IZCC 3VHQA 3L6EA 1Z0ZA 1J70A 3G2PA 5D3KA 2ASVA 2QTMA 1EWYA 1HRDA 3AL0C 4RZQA 2GRUA 2Z43A 1MB3A 3B2NA 4BUZA 5CDYA 3H2GA 1J5XA 9ATCA 1BFDA 2C42A 4UTXA 3C4QA 1WQ3A 5CH3A 1QK3A 1MJGM 1PD1A 3ON1A 3KEGA 5HKOA 4CCYB 2AG8A 4TXJA 1SOMA 2V6FA 1UBSB 4BMSA 2PS9A 1JD1A 1RLOA 4P36A 4PGAA 3KG2A 5JSYA 1DBWA 2DBYA 2VNIA 3ADKA 3F97A 2OOSA 5SICE 1VL5A 4HDNB 5F9HA 1YB7A 2HLPA 5BV2P 2CJYA 4U1RA 2OYRA 1U98A 3P9NA 4DV2B 3ZY6A 2KM1A 3SJBA 3PTZA 1QM5A 5FWYA 1IL0A 2BFMA 3QTLA 4FLUA 1SBYA 3H9EO 1ZXBA 4RIFA 1MRSA 3I4FA 1G0NA 4CETA 2ZULA 4ALJA 4RL4A 2OZEA 3ZU3A 3NBYC 1VEWA 4QHYA 1KORA 1QRSA 3QI7A 2X8WA 3KKPA 3OU6A 3EUAA 4UMDA 4JU9A 2WSSA 3GJ0A 1Y1RA 2ZK7A 1EVIA 4DUPA 2A4MA 1JDBB 3D4PA 3Q0TA 4B9AA 2IU4A 3RC3A 1L7QA 4J0JA 5D2CA 2G63A 1JJFA 3DAYA 4UD2A 5F77A 4NARA 1EDBA 4PPQA 1TGOA 2XAFA 3ENVA 1E2PA 4IDFA 3CNLA 2GHRA 3IRUA 2YRWA 2BFEB 3ZWBA 1IURA 4MV9A 4OHBA 3HKBB 2NUTA 3STZC 1JEQB 3DGEC 2Y1FA 4A0RA 1PYGA 2G40A 4E12A 2W2VA 1B6SA 2BCEA 2ZUDA 1HDCA 1NLZA 1JIIA 4OJQA 3RRJA 3W7SA 1XZMA 3ONVA 3FYUA 1B8VA 4IICA 2AFIA 2I1VB 4ZI7F 1QWOA 1ODIA 4XUDA 5DULA 5DGXA 4N6GA 4R6WA 3EC1A 4JGSA 3F5TA 2JFQA 1E5LA 2A4KA 5BWOA 2LPMA 3ZHYA 3HNRA 4A2WA 4M7OA 1FXVA 3I5AA 5B1DA 3DQZA 1GCGA 3OZXA 5CDTA 3IUEA 4KR7A 4X6LA 4YDSA 4B34A 1E2DA 2B20A 4G84A 3M0EA 3Q4HB 3LWZA 4YDRA 5C4GB 1M0WA 3K2EA 4KN5A 2X0LA 4BBAA 2Q9LA 1ZNZA 2H8EA 1VKOA 4HNAA 4JI5O 4YXWA 5I9LA 2RE8A 3L1VA 1KYOF 4YRNA 4U3JB 1PDOA 3DEKA 3L46A 4BLSA 2V7XA 4DA9A 4FFVA 3K8YA 4OHMA 4I4LA 1K0UA 1NSFA 1C1XB 1S2MA 4C5CA 1CNMA 2QN1A 1OIVA 3OEEA 3H9VA 2FPPB 4HY3A 1X7WB 2F1MA 3ANNA 4FHFA 4QXQA 3J81k 4RSMA 4N18A 3U7HB 1QRUA 5C1IA 5CH5A 3B2QA 3DB1A 1ZM3A 3DCNA 2IYFA 2JJ8A 2R25B 3CW9A 4LRXA 4R1LA 4DW1A 2PT9A 3EE6A 5IS2A 4YCJA 1I1OA 1SUFA 1GPUA 3KVOA 1AO3A 4LNUB 3WJ7A 2AFHA 2ZIXA 4C4PA 3PUHA 5CCXA 5IAGA 2WYVA 4FLEA 3BICA 2AGAA 2PWAA 4CMEA 3KTDA 4PANA 4D9MA 2AN4A 4XSVA 2DHQA 1KP3A 3K5MA 4HQ6A 2O8DA 1UZNA 1GDHA 1E7RA 5HQTA 5CDFE 1UXOA 2GPAA 3EXAA 2BEJA 2VK8A 1GM8A 1Y66A 5TMDA 4UKDA 5LZ7A 1XR3A 2O3RA 1FLAA 1YZKA 2XAGA 4KR0A 5JH7A 3ZHBA 2YV2A 3DVAB 2OCGA 5JMOA 4PQEA 3IKEA 2EW1A 2AHYA 3MQFA 4AYXA 1G66A 4G5FA 5IAOA 2FUKA 3NIWA 3ON5A 2PAFA 1EWRA 3CPQA 3DM9B 2XHZA 1WABA 3ILYA 3N5CA 4J03A 2WM8A 4JOCA 2WG1A 4KWCA 2P30A 4XJSA 4DG9A 2QDOA 5EJ5A 4NH0A 3HZOA 2UYHA 3AUTA 2PY6A 1ISGA 4P53A 3K15A 2BOVA 3JU3A 4BB6A 2ZI7A 1N0HA 2QQGA 3K9HA 1EK5A 3JALA 3UC9A 3NWEA 3AUAA 3B6JA 3EUWA 4MCAA 2A5FA 5J2TA 3FM9A 1F0YA 4L57A 4MUEA 4HPJB 1RP3B 2OBFA 1WW8A 4NY1A 1IZ7A 3FPCA 2VKTA 4YP5A 4GL4A 4I9UA 1FXHA 1PZHA 3ZH2A 1KBQA 3K53A 4ZU6X 3AIOA 1IOWA 1LBIA 3NBZC 4AICA 2E1RA 1W19A 4C82A 1HL7A 2WLNA 4PLCA 3NHSA 3NPAA 4YC7A 4E5KA 4FMTA 4BO6A 2ZYDA 1SCBA 2QX4A 3IEWA 2A0FA 1OGJA 3QQPA 4GR9A 2W8ZA 3JSNA 2QR4A 2P65A 1DV1A 4KAAA 5JVDF 4IYJA 4D8VA 3QEAZ 3TSYA 4X93A 1GRRA 3U3MA 1ETUA 5IMSA 3CCRV 3IGAC 4A2PA 3IVAA 3MHHC 4EG4A 1BNCA 4ALNA 1U2EA 3NTOA 2I0FA 2ZB2A 3IC9A 2ZYHA 4ZOBA 1TFUA 2O0MA 4R8SA 1TZKA 3I4LA 1GH6A 3H65A 2GFHA 4RY0A 3BCUA 4X1IA 4FOOA 4RIGA 3KCNA 4KRFA 1PGOA 2ZRQA 1Z5PA 3F5SA 2UZIR 5BWCA 4LWZA 2D54A 1ZJJA 4RH1A 3WLJA 3LK6A 3FHJA 3Q5EA 3JYPA 3GRZA 3KYBA 2AX4A 2VHZA 3HWSA 4R1QA 5K1ZA 3PQ8A 3H1GA 5CA3A 2HK6A 5BQXA 2EZ9A 5CLGA 2P3OA 4B6JA 1K9SA 3THXA 3RI3A 3EA4A 3VZDA 5DBIA 2V7EA 1HLDA 1OV6A 3V34A 1LDEA 2Q5HA 5B3AA 1V9PA 3Q9NA 1JVMA 1RPAA 3PHGA 1NLUA 1I3OA 2ZSAA 1FYFA 3W9SA 1QGUB 3FWPA 4XX0A 4BFVA 4BO1A 4AJPA 4M46A 2JNBA 3R40A 3ZJYA 3TKLA 4RMIA 3HYNA 2F8LA 3DBRA 2IS6A 4MVWA 4UVAA 4QQKA 2IEBA 1PL6A 5DYTA 3M4XA 4LHEA 1LDMA 3R0IA 5H82A 2YYEA 3DE3X 3FAKA 3G71V 2Q1SA 1C1DA 5DB4A 1P44A 4YCCA 1NBMD 2QY6A 3FX2A 1DWQA 3CHXA 4EJMA 5FPYA 5H4HA 4BP3A 4RM3A 3PUJA 5AVRA 4CTNA 1Y67A 5DK4A 1MQ8B 4LCKA 1U4OA 1PK7A 3QV1A 3MERA 2VK4A 3IUJA 3KR2A 3GGSA 4TGLA 3B9BA 3F8SA 1WBJB 3K4QA 5KREA 4TL7A 1T2FA 3FZGA 4MA4A 4UASA 3TI7A 5I7AA 3CF2A 1XVLA 4CR7A 2GK7A 2R8OA 3ZHTA 5C1BA 2H2AA 3LYAA 4MRPA 3UATA 4DVJA 3EOZA 1Q86H 4C7MA 3Q3IA 4IJ5A 3LWVC 3N76A 3G0OA 3FRHA 1ISIA 2IWRA 4WEQA 1COWG 1WSWA 2G9IA 4HS4A 1XRNA 2IU0A 1GILA 3J7AU 3JAMN 1R4MB 2DUMA 3KUKA 2QPOA 2AE1A 4MCHA 3NUQA 3A9RA 4RCYA 5I9TA 1EB9A 5B1BB 4QUJA 4KIFA 3ZBUA 1WCV1 4LAFA 1GWNA 2GETA 2HUNA 1L4GA 1QE0A 2WD8A 3H18A 2FFHA 3BMNB 1MNGA 4WBSA 3FTCA 1PR1A 1ZN8A 3HUDA 3FZYA 2C2BA 1M57B 1Y1PA 2EJRA 3L7AA 2R3SA 2F59A 1FXWA 4JI0O 1UF9A 5C80A 4D56A 3HEAA 4Z1MA 3ZJZA 1GNTA 1YKGA 4C6HA 2VRWA 1V11A 5L4NA 2GLXA 5JJ5A 3J7AR 3PI7A 3HBJA 4OJTA 4HNQA 4KITB 1VQKF 2WJ6A 3PL1A 3OD5A 3HL0A 4N7JA 5AHWA 3WFIA 4PGGA 2PZAA 1OIWA 3C3AA 1DNPA 3T3GA 1UZMA 1HYEA 1OKKA 3DAPA 1ZVQA 2NUAB 3V33A 3LOQA 4X8OA 1K0FA 1JKFA 3EVNA 4ILEA 1Q7EA 1KSJA 1GZSA 5BZBA 1NF8A 2JCVA 4EEXA 5AKJA 1Z9BA 3KSAC 1JALA 2DJVA 2PZEA 1GCIA 3OCUA 2QRVB 2YVKA 4O4LB 2EWVA 1YS9A 4EO4A 2F6RA 4DA8A 3AONB 1FW8A 2NPOA 1ZCFA 3MT7A 4LF5B 1Y8AA 2MSCB 4MUGA 4QU9A 2HBQA 4RVHA 4HDNA 4JLKA 2WSLA 1HFEL 5AJZA 4FN5A 4J6FA 4XIIA 4U7TB 1J2RA 4Z9FA 2ONKA 3DLTA 2XVYA 4WINA 4L4ZA 1AXGA 1QJCA 3KM0A 3RSGA 3CRCA 3VH3A 3OX2A 3IJ5A 3V1KA 4F4UA 1Z6YA 3BM5A 3QLTA 5LOVF 5ILOA 8GPBA 2O7VA 4JZKA 4UVGA 3A6FA 3B13B 2ACVA 1VMKA 4Q3OA 4G1CA 3GLFB 2L35A 1X1CA 3RIYA 4P7FA 3OE5A 1BGXT 3QPDA 1RQNA 4CJXA 3R3XA 2IHYA 4Y7DA 4BUJA 1FRZA 3WICA 3ZJ5A 4EEQA 3MWDB 1IXMA 2BEWB 2IE0A 3CKMA 2X0DA 3SHWA 1MORA 3REGA 4XRRA 2HRCA 1DE0A 5EMNA 3L93A 3QZUA 4CG2A 1TIPA 3H1EA 3WRXC 4WDRA 4CUZA 2BFEA 3JVIA 1E1NA 1AQJA 1U7OA 3HKBA 2KBEA 2JVIA 1JEQA 3ABOB 5FYQA 5T8KA 1Y1QA 1C81A 2JD1A 4JC0A 2PLFA 3WWOA 3AFIA 3B1ZA 3Q7TA 3B1JA 4RF2A 2Q6LA 5A5DA 2FR1A 3HWWA 3AWDA 4M8LA 2G04A 3FOFC 3W0LB 3PXCX 4YJFB 2D5LA 3N3AC 1HLFA 3RU3A 1DQZA 3GJ8A 4F4CA 1OH5A 1SBQA 3ZXIA 1FW6A 4XR4A 1W85A 5DI9A 3OE7G 4X66B 4AJ4A 4CXMA 3VHXA 3RJ9A 4YQEA 3CH5A 2PZGA 4UNIA 4ZCLA 3VKHA 3U7RA 4BRWA 2CKDA 3GRVA 3O9OA 1RXYA 3EPPA 2VQ6A 1Z7BA 2HU7A 3KU4A 2PL1A 1AI5A 5LYYA 4U3JA 3THOA 4MVJF 4V0SA 5ERXA 1YASA 2WWRA 1C1XA 4MLDA 4MUYA 1SU7A 3NDJA 1GGJA 4WCDA 2JH3A 1X59A 2FPPA 5IN5A 3KOWA 4RKEA 2A5GA 3CZMA 1Z88A 3ESCA 2PL5A 5B1OA 4WL0A 1TUEB 1CCWA 2PYLA 2FTKA 2GZMA 1VJGA 4RVSA 3CIOA 4O1MA 2ZREA 4ZVMA 3ZD8A 1FS6A 1PNMA 3DAGA 1P77A 7REQB 1LUVA 3THSA 3GLTA 3U0BA 3TMYA 2F48A 2GVZC 3P30A 4FYXA 3MWEA 3K04A 2P75A 1CQZA 1PJSA 5TGZA 3OTWA 3T99A 2HV9A 4PHGA 1P1KA 4CTJA 4AY5A 1YI2F 4Y2GA 5FTJA 2FE4A 4CEJA 3U5ZB 5GJVC 3H3JA 1YR1A 2HCJB 1L4NA 2QA4V 2HT6A 2GPSA 3DVAA 3SIXA 4TTSA 4DUZO 3RABA 1J2TA 4DO2A 1T2UA 3N2IA 5F4BA 1D2CA 1O5IA 4HLDA 2CJPA 1GZ7A 1JG7A 2BHRA 4DCMA 3LW8A 4Q7JB 3A6LA 2FN8A 5LR6A 5IW8A 3AERA 4NYKA 5H3CA 2WIKA 2ZRBA 2ZVQX 1Y48E 3KQPA 4NG4A 4JUAA 1E94E 5FPRA 1ULSA 1SERA 2B99A 4X3LA 1JH9A 3H1JH 3OIUA 5EY5B 2XTZA 1V1RA 3G8BA 2PLNA 4KO2S 2W7TA 5JZ9A 1NM5C 3B3AA 1NTRA 3LW7A 3GBPA 3HJFA 2G4LA 4B80A 3QNWA 3SGLA 4FW8A 3CYFA 3M1AA 5LQNA 4R7ZA 3UA3A 2QVGA 4NQ3A 3HBMA 4LHZA 3FJYA 2IHTA 2KLHA 4FDTA 3F6PA 4FNAA 3K5NA 3HR4A 3CVVA 2WPDA 4Z4EA 3AK1A 1F2UB 2NMUA 2CLCX 2Q2OA 5HY4A 1VL0A 2PEYA 4DANA 4ERXA 1NI3A 4WCFB 3GRAA 3O26A 2VHCA 3INNA 4Y1RB 1E2BA 5IE9A 2R4TA 4MVJM 4QWWA 4HEA1 3SYKA 2CUNA 4IGAA 1CYEA 4ZV4A 3FWHA 5JNLA 2QXTA 1Y7HA 3WQBA 4DLXA 4E5UA 4II2A 2KB1A 3OOSA 3ZE8A 3PGXA 3ZWQA 2GARA 4O2BB 2V96A 3T9AA 1WVIA 4MAMA 1TDJA 3L7CA 3O31A 2FMFA 4BQSA 4JK3A 3HCNA 3DAFA 3A7DA 3LS2A 4K3VA 3AR7A 4OKNA 2QGNA 5E6UA 3QXJA 3ER9A 2GN1A 3K0DA 2C4HA 1JYEA 5KNCA 3MOGA 4C6TB 1KI8A 3WHLA 5HQJA 1CEZA 3NHLA 4WT7A 3KB2A 1BN6A 2R8BA 3MJVA 1E4EA 5ECWA 5KOYA 1ILEA 3O6VA 2DEUA 1ZNWA 1G17A 3PNYA 1SBCA 3OMAB 2IPNA 2XGJA 4FYWA 4JUIA 3JS5A 1RWWA 1L7VC 2GTAA 2V98A 1SRYA 2PQ6A 4OMCA 1I94O 4PZEA 1N77A 5LJIA 1JJ7A 5AWFC 1F6DA 1JHOA 4PINA 3RAPR 1AZLA 3K5PA 2DR3A 1T35A 2Q3BA 1ZX3A 1XO1A 1G8KA 5K0GA 2YYSA 3N74A 1O9HA 1RIIA 2BF4A 2ATKC 4K6FA 3F6YA 1W0JD 1TAHA 2B7LA 3B89A 1EEXB 2E4ZA 4ZWNA 2ZJ2A 5H80A 3BHIA 3E84A 2G17A 3FLAA 3PX7A 1HDJA 2OECA 2CZQA 1R0SA 1VGVA 3KWLA 1VKJA 3BRWA 3NG1A 1VQ5F 2P4QA 2CN1A 3GBSA 1R6VA 1XB2A 4HWSA 4RC9A 2BUAA 2AOXA 1SXJD 1PSWA 3WKBA 4UCTA 4QFMA 3WJQA 1SOAA 2HLDD 2POCA 3Q98A 4IIHA 4WKPA 1X1BA 1Z6GA 1RYYA 3G9ZA 1R4MA 4ZVLA 1JHRA 4GP9A 4D6YA 4BV9A 4QUIA 3G23A 1TU0A 5DP1A 2FPIB 2Q4PA 3PJDA 3HQ4O 1DTSA 3B36A 4WGFA 1LDYA 3IB6A 4IJVA 1KHHA 2UYOA 4KGXA 2JW5A 1YIJF 1R6DA 2AJDA 2FG6C 2QZPA 1XRLA 2Z9BA 1L0LH 4JEIA 2VR1A 5CJ2A 1ZRNA 4B46A 2IDZA 4EYQA 1WUKS 3I9MA 3QUQA 1NAIA 3ONWA 5KWJA 3D8HA 2PTHA 3TZHA 4Z7OB 3IAUA 2ZYTX 3E58A 3B1VA 3PGMA 1R3JC 4M1WA 2DQZA 1X7GA 4K1XA 1LBSA 4Y6LA 3PQ4A 2PD4A 2F43A 5FOQA 5LMNO 4DZTA 2YIBD 4GEGA 4LSWA 2ESRA 1M2VA 1UKYA 5HXZA 3AOEC 5ES3A 4L4SA 1W7AA 1HDGO 2MIIA 5F52A 4H1WA 1E9SA 2BR4A 4UQLA 3HYRA 1E2FA 3TLXA 2R8RA 3TE7A 1Q6UA 1P75A 3FLEA 1OIXA 4FJCC 3BSFA 4YMTA 3SEAA 5FUBA 2HDHA 1H3EA 4M3NA 4EY8A 3O9MA 2RI6A 3NK6A 3K92A 4FOLA 2DERA 4RD3A 1MJHA 4GMGA 3AY7A 2E2WA 3W6PA 3HCCA 3P20A 5FCDA 2WTAA 1IBCA 2QRVA 4O4LA 1J39A 3FR7A 3RRFA 3BILA 4EF5A 5L51A 2ETVA 1J1ZA 4QXRA 3WGOA 1BFKA 5CIWA 1XNRB 3IR5A 5JLJA 1HPLA 1FMJA 2HMSA 1N8TA 2ZDHA 4DV3O 5ALIA 2DT4A 4JYMA 1XL6A 5AVKA 1JJBA 3UCXA 4XUGB 2BP7A 1Q3HA 3L9WA 5I8ZA 1K8YB 4U7PB 2RDCA 3A3PA 1WM1A 1BGWA 2CWWA 1KO5A 5H2FZ 2HC9A 4G9GA 2O8FA 4GVXA 5M2QA 2Z1UA 3CLUC 3GGDA 3SGIA 5FFNA 3W7WA 4WX2B 2VK2A 3TOXA 4B2LA 3MT8A 1AZTA 4NLLA 3E2PA 2JIZG 2RNBA 4Z9BA 2UU9B 1KVQA 4OI0A 3GLFA 4KR9A 5JS1A 3ND7A 3HP1A 4ZQIA 2ADQB 3T9FA 2QP9X 1LD3A 1A50B 5FOUA 2C7BA 2QTRA 1KJJA 4E5YA 2ZXWB 4YN3A 4Q1VA 2BR3A 3KCQA 3MWDA 1DXOA 1TK2A 4MKFA 1H2SB 5DIFA 1H2FA 1NVAA 4O8ZA 1U8UA 4HEA6 3ISJA 3SF0A 3WC4A 1T1JA 2QPLA 3SD7A 3ONDA 4E31A 4RY9A 1KO1A 3L06A 1G8SA 3CUYA 2RGNC 3N2EA 6YASA 2Y6VA 3OQPA 1A82A 2O1WA 1EVYA 3L0SA 3RVZA 4DWJA 3STVA 1N8NA 5K0NA 2UAGA 5FWYB 2XVXA 3WWYA 1DJPA 4HWPA 4YJFA 5BXQC 2FWNA 3V6LA 4XJTA 1XAGA 3K4PA 3V8RA 2Q69A 3CPHA 4YJ2F 2PHZA 3L92A 2J9RA 5JNVA 3THRA 2ET6A 3GAMA 4NZOA 3ZS8A 3E3OA 2IEGA 4Z51A 3OBBA 3N8HA 2PKYX 3QNEA 1B15A 2QSYA 4EPWA 2JAPA 3BWBA 2ITDC 4FDAA 2OFOA 4IO1A 4RAQA 2IUFA 2NVBA 1Z4NA 3ZLTA 4ZK6A 1THGA 1GTVA 1TKBA 2PSHA 4L3OA 5AW5A 1IULA 3TRFA 1SG6A 2W2OA 1ZH4A 4JGIA 4XVCA 2M98A 4U2DA 2ZE7A 4S1VA 2CTWA 2IIVA 1DQRA 3QIVA 3E3AA 4FIZA 4CBCA 1OAKA 4ERHA 3SM9A 5KNBD 4Z9XA 5KC9A 1MV8A 1ZM4A 1XTVA 2PS0A 4BV8A 1CZKA 1T5HX 1AUXA 4II7A 3OLXA 4YCMA 2AN5A 3GP5A 3U56A 2YHUA 3OIGA 3C8UA 4F1JA 1NVFA 1JQLB 1IPAA 3C9RA 2A1TR 1GY8A 1ITZA 5IBRA 3VZBA 4DR5B 3OSUA 2EQ5A 1GAJA 3FYUB 4L9WA 7REQA 2QTHA 2ZSHA 1YZLA 5DCLA 2A7WA 3FVTA 5K3AA 3LM8A 3FNEA 2PZBA 1L5ZA 5DWVA 1A9PA 5A9GA 3H01A 3D7SA 3QLVA 3QELA 5HJEA 2BIFA 3NYRA 3L9XA 2KS6A 5BNIA 3RYCA 3PDUA 4FMCB 1NVPB 4NTWA 4IH4A 4CU2A 2HCTA 4Z99A 4FTWA 2F66C 1P2DA 8LDHA 3AC0A 2HXGA 1WN7A 3DVRX 3TO5A 4JVLA 1L9XA 3KIZA 4C2TA 4HNRA 3QKRB 2A9FA 1XIVA 4E08A 1EDEA 3R09A 1JLHA 4CMGA 3DCJA 3OX3A 3STXA 3JTEA 3IMFA 5CIYA 1F2TB 4JB2A 1Y5RA 4CHGA 1CR1A 3FKSG 2ZPTX 2EG5A 3Q3EA 1DG3A 1QIHA 3I0MA 4E5MA 1Y89A 4EH1A 1PL8A 2CHFA 5LNK1 3GPIA 4K26A 3VXKA 1UXIA 1GRJA 3GH1A 1ENZA 3WE7A 1ZJ6A 3UHAA 3IDQA 4O4JA 1HZZA 3K3PA 1LPBB 2JCXA 1IQ0A 4L6IA 1FDUA 4KRYA 4TT3G 3CX4A 1PSZA 3GVHA 3ZWDA 1AI7A 2WJ3A 1KC8H 2IDKA 2ZIXB 4UEQA 1US6A 1Z73A 4GZ3A 2G7MC 3SZLA 4F6CA 1Y7IA 2XDAA 3PXDA 4A23A 1ZD1A 2PZSA 3DQQA 3OOJA 1HOTA 4Q93A 4LFCB 3E7DA 1Z5VA 1QH1B 3VVBA 1VPEA 3EPLA 1YB5A 3AG6A 3RBAA 2BEVB 3GXBA 4MVJE 3OZTA 4NKRA 1WJGA 1SHJA 3ZXYA 3MJCA 5JH7B 1L6RA 4NCXA 1EUQA 4MRRA 3TAHA 1KIFA 2I5PO 2E3CA 1TMKA 3PGLA 1J2YA 4AG3A 3AF2A 1H2LA 1F2UA 5K0CA 3KFLA 3EY4A 4FZ5A 4HSEA 3STLC 2MMCA 1G20E 3DOFA 4KZPA 1VPTA 2FQWA 3WWEA 4WCFA 3I2JA 3MJDA 4RUKA 3B1FA 4Y1RA 1JEJA 1J2JA 3BPSA 4LA4A 1A0OA 4GI5A 2DQKA 1QVVA 5F1PA 1JVBA 4PG7A 4CGYA 3OJOA 2OGTA 3ECAA 2PSJA 1O0CA 4JU8A 4BPBA 3T7TA 2XYGA 1J21A 1T5LA 3HM9A 4JT2A 4TWRA 1JDSA 2H29A 3FNHA 1QUFA 5LVAA 3IESA 2ZVDA 5A4KA 4BNMA 1VHAA 4OQQA 2CHUA 2PKRA 5J2TB 1ENPA 3D1LA 1UFIA 2E82A 5ENDA 4F97A 3SVLA 2WSBA 2F1IA 4B3IA 3K9LA 3UV3A 4M9UA 3RG8A 2WMNB 5B4UA 3OR6C 4JB8A 4ZZ3A 1LLQA 1RYNA 3GLKA 3M6IA 5KAFZ 1ULZA 2ZRPA 2BHNA 2QGZA 3EHBB 4TS1A 1U7DA 4W1PA 1WDTA 4MQUA 3WV5A 1FFAA 4IWXA 3T0FA 3U48A 4HATA 3VVLA 4G9BA 2QLTA 3DNMA 4D0GA 3HGMA 2XAJA 3HA7A 3WXBA 1JR3E 2AKYA 1Z45A 3I09A 4GQAA 1KQSF 4ZOCA 3AG1C 3GIDA 3TR0A 1Q1BA 3JQCA 2KG7A 5JS2A 4K6KA 2JJYA 1OB5A 2LGQA 3A6GA 4G01B 3Q1KA 3K9CA 3P5BA 1BDHA 4AWBA 4DV7B 4OLHA 5C53B 1EVKA 2D5IA 5HXUA 1NZJA 2QW8A 4HTFB 4X1IB 4J43A 2XCIA 3SX2A 1N5RA 1E2HA 3NUZA 4TYWA 1Y76A 3R5JA 1HOXA 2XASA 3DE1X 3VQVA 3EQ7A 2YXYA 1I5XA 1RJWA 3TZQA 3D01A 1FQWA 1FVOA 3H2IA 2PTMA 4U7GA 4IBOA 1YRYE 3IPLA 3PWSA 4I5EA 1DJLA 4NS1A 2D2EA 2QM4A 1T8YA 4JGBA 3SZOA 3FDZA 2O6LA 2PH3A 2OMKA 2XOKG 2J07A 2GSMB 1Z75A 2P11A 1R74A 4ISBA 4JYCA 4NEQA 4RTKA 3UMGA 4E1BA 1N92A 1J7HA 1FS5A 2PVPA 2NGRA 1JG4A 1EE1A 2PQ2A 2ZBVA 1DFIA 3A4VA 1H5QA 3TECE 1L5NA 5K8VA 2FPIA 4G1MB 1S5PA 4B73A 3CCLV 3M2TA 5FBKA 3GK3A 5CU7A 2YC4C 5BMVB 1LH0A 4G0YA 2BKUA 2Y0BA 1QBKC 3G1WA 4MVJP 3HJTA 1PFVA 4W8OA 5LQRA 4KWTA 2P6RA 1XRQA 4JKIA 3OPMA 3O4RA 5KX5A 3CKKA 2KKWA 3A2FA 5JOQA 3EEFA 2IY8A 3C5EA 1MLDA 4U7FA 2O7QA 1FSPA 3KJNA 4Q18A 2VHVA 3EQ9A 1LCIA 1Y4ZA 2XAQA 1EK0A 2HB6A 5DSTA 2HK9A 4NECA 1FNBA 2YZNA 3O92A 1NI8A 4C4RA 2ODTX 3KS9A 2FPWA 5IYDO 4E7OA 4MARA 4LBYA 3CJTA 5AUNB 2X1VA 1AGXA 2R7AA 1JSRA 3CS3A 1BU8A 4BW5A 1U7TA 5ALOA 2LRHA 5JI2E 3E8BA 5GJCA 1Z68A 3K0HA 3VV3A 4ER5A 3V97A 4G4JA 4M86A 4ZARA 4D41A 3FHCB 1QIKA 5AJHA 1EX6A 1W0CA 2IQ5A 4Q03A 4CKBA 5LNK6 3HBLA 4PYMA 2PV7A 1QBGA 4YJHA 1YWGO 1ULUA 1T91A 4NWIA 4AWAA 4KTVE 5CNJA 5KU7A 3B82A 2JI7A 5JWPA 4A27A 3IIEA 4CR6A 2BSKB 5KBYA 2YY7A 2W0SA 1BMFA 1XBTA 3E2IA 4BIMA 4NZNA 2CMDA 1H2MA 3I45A 4LOKA 3BD9A 1C2TA 4XTCS 3OMIB 4TTQA 4BBZA 5AW9A 1J8QA 5EIWA 2IKSA 2H52A 2GZ2A 1XMOO 4K9OA 1SA0B 1V11B 2WKQA 4RXTA 1UXKA 3ASOB 1VFNA 1QYIA 1Z08A 4N49A 4ZJPA 4PSKA 2D1FA 3GUUA 1GA4A 3EBOA 4ASUG 1EVEA 3S1LA 3PJEA 4LF9B 1XWFA 4X91A 3UW3A 1X1AA 1R37A 4EG3A 4TYQA 2HA3A 3M1XA 5DX0A 2OPHA 4H4DA 1IM2A 4DMUB 2GCGA 3IVXA 3NC1C 2PBZA 1T26A 2Q0QA 3PF8A 4ZOAA 2W0XA 4DR2B 4E30A 1L8OA 1SZPA 5AM0A 3DOCA 4C2UA 1SHTX 4UHCA 3OE4A 3S68A 5C5EA 3U37A 3HNPA 2ZTMA 4R2MA 4E3WA 4XWWA 1Z37A 4ON9A 4K46A 3BJRA 4U3FH 5AM3A 1LQ2A 3EWAA 1Z5ZA 4KNWA 3OIWA 3SR0A 1U9IC 1C3XA 3UT5B 4FEGA 3NVMB 2AI1A 4AKTA 1HGXA 1KZ9A 5EBLC 4YP1A 4HH3C 1VF6A 1ZVJA 1ANKA 2R8ZA 3H2JA 1G9TA 1OZFA 4J16A 4AMGA 4OCZA 4OX9B 3PPIA 4Q9IA 5TT1A 4KWIA 5HS4A 1L1FA 5LGTA 3DTNA 1FJHA 1ZM9A 1TAGA 1V6AA 3FPBA 3QY0A 3QBDA 4RPCA 3RJZA 3V8NA 4GR5A 3GRPA 4FD2A 3UKJA 3C16C 2R6ZA 4Q9JA 5KDLA 2OXIA 4KHZA 3E5MA 3ZOZA 1E6CA 5HGXA 4AB1A 1LVGA 1U7WA 3QEKA 3GL9A 2B0CA 3TBKA 3EVFA 1OJHA 3FKSD 1R7RA 2FR8C 1RMTA 3K1YA 5ALHA 1XRRA 3ASNB 3BFRA 5C8VA 2Q5IA 5IUNC 4PLYA 1VYHA 4Y2SA 1LDNA 3KQMA 1ZUD1 2JJ2G 1L5LA 3EDRA 3QKTA 1M5RA 3VNRA 4KWEA 4YMSA 4DCNA 1RKVA 3WGVA 1H9CA 5CDFA 4DAOA 3G2HA 1JMVA 1JSLA 5DN9A 2AXNA 1B04A 2G83A 3ZWNA 4XIYA 4TROA 2GLZA 1T0BA 1JJ2F 2H8GA 4HFMA 3U19A 2VYVA 3OP1A 3U4HA 4C03A 1IZZA 3FB7C 1W85B 3N3BC 3WG9A 2QN7A 5HFJA 4W9RA 1CZRA 3GNTA 3VHXB 3G5TA 3ZG6A 3U0ZA 3MCWA 1U0JA 1OCZC 4XSGA 1AHIA 1P6QA 2VEOA 3R8FA 1APBA 4MKHA 3FPAA 3BWCA 3OHSX 2FB5A 1JHUA 4KRGA 1FTSA 4AZVA 1MG5A 5EWMB 2R8XA 4DR4B 3M3HA 3OOHA 2XHBA 3TTWA 1V9CA 3C39A 2AMLA 3QKRA 2BKLA 4JFRA 3LYBA 3R0VA 4RVDA 1I4TD 5JFTA 1PG0A 2QSZA 4M76B 4O6VA 1F2TA 1H2XA 2QUIA 2YN2A 3SKYA 5KOIA 2Z3WA 5GP1A 1XTKA 1K89A 4IY1A 4W9NA 2JJMA 2QTZA 4B3HA 1D5CA 2R44A 3DOIA 3AXTA 1PEAA 4J3FA 1QSGA 2CMGA 2WAYA 5ALJA 3T7CA 4G24A 4BFYA 2GTIA 1E6LA 1RBYA 3ANYB 4X5OA 1NRIA 5E2BA 2WVAA 2ONCA 2ARKA 1JR9A 2I3ZA 2J5QA 1JN1A 1YRQA 2X5JO 2XOEA 3FHOA 4TWIA 5FBWB 2MJLA 2XBUA 2OYQA 5LSAA 1ISSA 1EG7A 3K2IA 3MWEB 1MZFA 2E9SA 2JEUA 3ZU2A 4JL6A 3IYLW 4G88A 2PZLA 1T0HB 3CYOA 2OCCB 3DF9A 4DXWA 4F2PA 1QH1A 4B44A 2YHSA 2NM0A 2UXNA 4CEJB 4D3XA 4MW1A 2OT3B 4TL8A 2BEVA 1WOMA 3LX6A 1JSCA 3FPIA 4EZEA 2PUBA 4G07A 5GY7A 4GMDA 1TZCA 4GXNA 4PGFA 1GNLA 4TMXA 1E79G 4C0BA 1NFQA 4Y6QA 1JJ2U 1XDUA 2H3OA 1T3GA 3QPBA 4AS2A 5AICA 3C3KA 4DUYB 1N6PA 3NATA 4CL3A 4YAUA 3L43A 2LBTA 2ODWA 3AERB 1T9GR 4FHDA 4PZUA 2QEXV 3ZTYA 3OUFA 3OESA 5C18A 3OIFA 1KRXA 1MKYA 4QPDA 4HB4A 5ITZA 1SH7A 1JJVA 4PLZA 2KI5A 2RHCA 3K8ZA 3VTFA 2G7ZA 1BHJA 3OM8A 3I23A 1VQ4V 3IAHA 1WD7A 2WEKA 4OPAA 1KARA 4YA6A 3AVXA 1E9AA 1VSQA 4QXMA 3UOAB 3USCS 1V1RB 2P3LA 5BSVA 4JP2A 3WHPA 4GLFA 4UQOA 2HM7A 4IHJB 3QM1A 1CJVC 1L5SA 2H1RA 4X6UA 3N4YA 4ND6A 5LDGA 4R6XA 3AIKA 4KNYA 3S2SA 4RTOA 1N7GA 1PZEA 3QK7A 4HRYA 2VSNA 3RUIA 1R4NB 1QQ7A 4M1ZA 4XGNA 4EL0A 1RPNA 4FN4A 2C5AA 3H84A 4H3VA 4JT9A 1I0ZA 4D7AA 1CTQA 3K05A 1AKUA 1H8HD 3A6DA 1AJQA 4EG7A 2XMGA 3I30X 3KUXA 4F38A 1IDOA 5B8FA 2Y8EA 3TXYA 3RSLA 1U7PA 3ZV4A 1SUPA 1U0SY 3QJGA 4Q1AA 5LMZA 1I0HA 3C5VA 1K7YA 5U4XA 1Z2NX 1NDHA 1QYWA 3GUVA 4F11A 3TCUA 4KAFA 4IG9A 3LLSA 1YC2A 1RPOA 3VR3D 1TU4A 2NG1A 4FM9A 2D8MA 3AG7A 1RBMA 2VCYA 4TZKA 2ZM6O 3GLQA 4XDLA 4KIWA 2M6KA 1NU8A 4PLWA 2EKBA 1Z0SA 1W4LA 4JF3A 1C7QA 1QGDA 4ZT4A 5JCJA 3MPOA 4HTFA 2RKOA 1FU4A 2BYTA 4LCJA 3RHFA 1B00A 1HLGA 2HKOA 3GGOA 3EBLA 4JWTA 4KB5A 4NCBA 1U80A 3M6WA 1M6WA 4XFKA 1QH8B 1IBMB 5E6UB 1S5JA 3MZ0A 1S1CA 4WXEA 4JJKA 2X23A 5FEUA 3JRNA 4ND5A 4IXMA 1ZS9A 2BZ1A 1H0RA 3KD2A 1FUEA 3QO8A 2X0RA 4LDZA 1CLIA 4CIXA 1OFIA 2HX0A 1E4EB 3KLPX 4YRPA 4KEAA 4BYMA 1DP4A 1ZISA 1F17A 3CLSC 2LKCA 4TTTS 1J1IA 4BQNA 4FKBA 2GCOB 3OWOA 2QZ9A 3UQ8A 4OREX 2WA3A 5L3CA 3WK5A 4ER0A 1Y74B 2WUDA 2CLSA 1XFAA 4MOWA 2JAWA 1SD2A 5C93A 2GERA 2QB5A 1MJGA 1WPGA 3QBJA 2J5XA 5EWLB 4NYJQ 4CNQA 2C77A 4P4LA 3C1TA 3ESJA 1QHGA 5BMVA 1FZTA 1YL7A 5TARA 4HEJA 2QTLA 4AP6A 5L3QA 4N82A 4EAAA 4O5OA 2DYSC 3BJEA 2HR3A 3QE0A 3HL4A 2V4DA 4MIEA 3IMKA 3MAGA 3DMTC 3ZGLA 1JL3A 4J94A 2N1BA 4DHWA 3FE2A 1KSHA 4XOIA 4N23A 5B3LA 4ASUD 2O7RA 1RWBA 2Z57A 3ZZ1A 1ISJA 2GSDA 2R65A 1PR2A 4ML3A 5SYMA 1OFHA 4QGGA 1GEEA 3AR9A 3F98A 2AX3A 5CA1F 4XQGA 3CW2A 4HQFA 2OHOA 3EVBA 2VJCA 1OREA 2P0EA 3GOHA 4GBMA 3HP4A 5A9SA 3TTTA 1FRNA 2X8AA 4B74A 4EKWA 2ZJ5A 3I1YA 5DM1A 4G27B 4MW2A 2AQ8A 5CB6A 4RD1A 5G4LA 1TCVA 1BXZA 5LQJA 4PO1A 5C8DA 4BRUA 5C7LO 5ITSA 1PUJA 3BK1A 2AEMA 4DSAA 4BEVA 2BSKA 3IC5A 1I2BA 2IYTA 2O1SA 1EXWA 2YV3A 4JNKA 2A9QA 4DV6B 2CWDA 1SQXH 3ZRVA 3GZNA 3TGPA 2BD0A 4M0KA 1Z56C 5KYWA 1S5LZ 2F43B 3WB9A 5AM4A 1SCDA 1ICEA 1SKAA 1M2VB 1Q0TA 1WUTA 2GO7A 1SA0A 4L8FA 2O2GA 2OAP1 3WYNA 1N2HA 4J49A 5F1KA 3BABA 1OYVA 2P6UA 4CVNA 2XKKA 3IXLA 4NR1A 5A05A 1ISPA 2AMYA 1QVFF 3BRCA 1BVYF 2NQ8A 5ED4A 4BZXA 1GTZA 2P6PA 4GZLA 4O0MA 5ALPA 3UB4A 2HWXA 2VTKA 1E1LA 3DEJA 1Q8IA 3ABIA 4DJTA 1H9BA 2ZUBA 2YXZA 4HAZA 2V7QA 4X63A 3LC0A 2C8LA 3RTAA 4EX6A 4HXYA 2ZANA 2EWMA 4TMYA 1STOA 1PL0A 2VJOA 3HMKA 4HDMB 3S5JA 1QX3A 1Q82H 1HP8A 5E9AA 4HNUA 2JLVA 2D1YA 5CLQA 4MSWC 5A7GA 3ZRWA 2XPCA 3E03A 1HDXA 4CF4A 2PKQO 1SIBE 3KZKA 1MW8X 4ZAVA 1HNZB 3QKUA 2N42A 2K87A 1ST2A 4E32A 3TINA 2II6A 5CBHA 4WFEA 3NC4A 5TQ2A 1B3RA 2BP7B 3DWEX 3UT5A 3B1YA 3VQYA 3ZMSA 3R7DA 2YHAA 1MABG 1NBOA 3OP4A 1F06A 4LJ7A 4G37A 3U9TA 2O8FB 3C7AA 4MUKA 3B40A 2B30A 3WISA 1NHGA 4C0KA 1YZ3A 4MR8B 4G4IA 4D4LA 2Q1XA 3GW8A 3EGOA 1P8JA 3IAM1 2OHWA 2ZRCA 5ARCA 3RFUA 2F4VB 1VGQA 2OYCA 3FCOA 4DZRA 3WKAA 4OMUA 1CUBA 4CV1A 3LFUA 4NV1A 1DBVO 4Y2UA 1HSOA 2IW5A 4COKA 3B9RA 5CCDA 4AKHA 2PJUA 5GZ1A 2I7TA 2JIOA 3IVRA 1XTPA 2W6JG 2ADFA 1KD1W 4QDXA 2I6XA 2VSOA 2HRRA 1X8LA 5HTOA 2OGSA 4L2IA 2R7KA 3NNSA 2ETNA 1HY3A 2MT9A 2YI8A 3UF0A 4WUTA 4FE4A 1T8UA 1RP7A 2A30A 1BN7A 4OHCA 3E86A 4N3AA 4X6XA 1QVFU 4CQMB 4BLUA 2ZTHA 2DAPA 2ZF8A 3VI6A 3OCCA 2XQKA 5DYYA 2FVXA 1KIAA 4HGRA 4MQFA 2GKSA 2IY9A 3TQIA 3ER8A 1P39A 4I8XA 1T2DA 2I2FA 3T5GA 4WA7A 2XVZA 1ZIPA 4QARA 5F1OA 1PLKA 4CF3A 2FW0A 4JEUA 4OKSA 1RQRA 4GQIA 2J41A 5GAPK 2OXCA 3RS9A 3QXCA 2HN9A 1PNKA 3LBIA 4ZI7A 5ARBA 4MI6A 5AXCA 2JBAB 3AMVA 4QRIA 3SHOA 4C43A 1T36B 4GI7A 5EWMA 5I4BA 4YV2A 4I9FA 5EQJB 4MAAA 4D2IA 4O5AA 1GO3F 3MC1A 3MJRA 1ESZA 1I2CA 1VL8A 5B57C 2UVPA 5E7JA 5DJ5A 4S2UA 5FUXA 1KYQA 3R3ZA 4N7RA 3HPRA 1UH5A 1TMGE 3FTPA 1VQ6V 4MQ6A 5CNKA 3SJCA 1KU6A 5A0FA 5BNTA 1KBZA 1ZH6A 5FLKA 4G5XA 5IWAO 4WXPA 2VT6A 3PHHA 3GDOA 4UZSA 1QONA 1IM5A 3R4VA 4FFOA 5EXDA 4HB0A 1G3MA 3FBTA 1O77A 4J90A 4RWZA 3KKLA 5A04A 2VBFA 1E8MA 4PAQA 3AJ8A 3TTYA 1I33A 5JZVA 4CN8A 3S1AA 1JDZA 3IDOA 5JCPA 3QELB 1G20B 2GAOA 1N2OA 3BVPA 3RYCB 1NKSA 3TDMA 4EBFA 4IGKA 1EU1A 2H3EA 4MTFA 3FBAA 5FL7G 1NLFA 2L2QA 1RM1C 2BBTA 3GEMA 5ALRA 2QUKA 4PO8A 4CKWB 1VRWA 4GE0A 3UMSA 3TGUH 1ACMA 5L9AA 1CFJA 4HBZA 5DN6G 4B4OA 3RQIA 1NUTA 2FYTA 1V8DA 5AIBA 1YRHA 5TB5A 1KYIA 3G5LA 2AJCA 2H08A 4QE7A 1IJFA 4E88A 1B06A 4NABA 1CR6A 4RENA 1IMOA 1DTWA 1NVVQ 1IAVA 5DW0A 4EARA 5HR5A 1XK7A 4KFUA 3ESBA 4BVEA 3HUFA 2QX9A 4QAQA 3TH5A 4IIEA 3FWNA 1JVNA 4LG1A 2WTBA 2G9ZA 1L7PA 4XI9A 4C4XA 4RZIA 4E07A 3CLRC 4K8OA 2R6JA 5JXHA 4O4JB 1XA4A 3C3WA 1DTEA 1HQDA 3HXTA 2OILA 5HY2A 2AW3A 1PLJA 1DHRA 4MV4A 3OD4A 2P68A 1N1EA 5DFAA 4BZZA 3R5KA 3SC6A 1F0KA 3G79A 4IHJA 4LWQA 2XB4A 4ZHWA 2DSNA 5ES4B 3DOEA 5LQAA 5DNYB 2Z01A 4LHXA 1N9KA 3IFSA 3TL3A 3WGTA 1NVUQ 3BQNB 2QXYA 3DP7A 3GFOA 4IHKA 1R4NA 4ZO7A 1MFPA 1MN6A 4L5JA 1GZDA 5SV2A 1TECE 1X38A 4I7ZB 1WWKA 2AHRA 1B1AA 1LJUA 2GQ0A 1NR7A 1HNXB 1DK1A 2PZMA 2B2XA 5SZKB 4ZVRA 3WGYA 1UFYA 4ZPXA 2CVHA 4WVFA 1N6KA 5EB1B 5DX8A 3KL2A 3EPHA 4JYZA 2O2SA 1R0RE 1ZJYA 3QG5A 1JQ3A 4IEFB 1Q0UA 2XGMA 1GAXA 2HP0B 1FDTA 3AGKA 2X4GA 1ZN7A 2Q7DA 4BE4A 2O2JA 4Q02A 4KKVA 5CG1A 3CG6A 1FYJA 3WDSA 1KDYA 5TC4A 4EB3A 3H9GA 3WLFA 1L8QA 1JG6A 1B73A 5JVDA 1JKXA 3I5YA 2ZE6A 3IAM6 2BOBC 1RJGA 3W78A 2QPAA 2GHTA 3GJ5A 4I5FA 3QPAA 5JQGF 2GM3A 2XBMA 3IT1A 2VAVA 1Y3AA 4JAVA 3GU3A 1AILA 1TCAA 3MD9A 1QH8A 3CLUD 3EWNA 2H1SA 2A6PA 2CNNA 5TNXA 4EMBA 2OK7A 4AYTA 3QVVA 4F8JA 4X65O 4YR9A 4TLEA 3KOOA 1I6LA 3P52A 1COWD 2IXTA 4MQEB 1U3CA 3G0DA 3KWJA 3LYHA 5EJGA 3QTTA 4GZRB 3P0ZA 3NCHA 1MEJA 4F96A 3HBAA 1V25A 3RRZA 1GPNA 1UT8A 5AW1A 1P2FA 2O2XA 1QF9A 4ZEMA 2GCOA 1EEHA 3A1UA 2MCFA 5KNDA 1Y74A 5BQFA 1KZ1A 1P1JA 4P1ZA 2ORVA 2HRYA 5E95A 5EWLA 4C7VA 4JL5A 1QIEA 1F1JA 2WWWA 3A2NA 4RD6A 3B5JA 2KG7B 4B79A 3IHLA 3S40A 2PS3A 4GKJO 4BOYA 3FW1A 3ED5A 4ME6A 4G4XA 2A1IA 3I8XA 1UODA 4U2BA 5CVEA 4O33A 4Y6PA 5F64A 4OI1A 1C8BA 1ID8A 1LTKA 3TOCA 5K09A 1EWTA 1Y76B 2W8BC 3WKDA 4XGRA 3FTFA 4G26A 4BNNA 4C7UA 4QPZA 3FOWA 1E9BA 2NZ8A 4MP6A 1QLNA 1YDFA 4QX6A 2W58A 2Y4UA 2B36A 2LIPA 4X94A 3RUHA 4Y1EA 5AVQA 3HHPA 4G09A 3C7CB 3FDZB 5C9ZA 2GNOA 1E0SA 4Q6WA 3F6CA 7GPBA 4DR1O 3T1HB 5A3RA 1O9GA 1OXMA 1PQUA 5CHYA 2FXIA 1SKYE 2PTGA 3VDQA 2AXTZ 3V46A 3DDSA 5CK5A 4FP9A 1R66A 1BE8A 2QTSA 3ELYA 1IHYA 5CEJA 3Q8MA 3FCCA 3KEMA 1JQDA 3CG0A 5SZIA 1II9A 3IP1A 2ZJOA 4W7HA 1A4UA 2OAGA 1GA1A 4RHUA 4PYOA 1JDPA 1VG0B 2W83A 3RVDA 4ACBA 1E5DA 4HDQB 4C3VA 5AKEA 3F5WC 5KX5B 4LMAA 2CFOA 2QG9A 5ADVA 1YUBA 1TPZA 5IT5A 3BYQA 2FWAA 2IBSA 3ZDCA 2HFEC 4PG5A 4I0WB 1PS9A 3NJ8A 3SQXA 1D1QA 4WTOA 4ESHA 2O5VA 3CZPA 1X4TA 4MYCA 1YI1A 4F3CA 1A8PA 1DCMA 4CG3A 2VGMA 1TJ5A 4UXNA 3AG4B 4A9AA 3LC2O 1Z2PX 4PF1A 3D54A 4UHFA 2BMVA 2LTAA 4HLUC 3NIGB 1JKMA 3C8LA 3BK2A 4H7HA 5KQRA 3NKFA 1E3TA 1PWZA 4HDMA 4CKBB 3AIIA 4QYIA 3P9XA 1GLNA 1YIAA 5B6IA 3HC7A 2EP7A 3D3WB 4YJHB 5A62A 5LP6F 2FB9A 4RDXA 5AHXA 2OCHA 4KV7A 2CLLB 1XVTA 3H42B 4DY6A 3C15C 4E6EA 3A1TA 2YWXA 3ZJVA 3VPBA 2M6LA 1M56C 1F14A 2VYNA 3DXYA 3ETLA 3FAZA 3RODA 4R84A 4ARAA 3LXMA 4QREA 3FMGA 1KQNA 4B84A 3OE7D 3UQYS 3WYAA 3JPWA 5KDDA 2GS9A