4IHJB

Crystal structure of tubulin-stathmin-ttl-adp complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ihjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4ihjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4ihjB01
2XKBA 5BMVA 3JASB 4I4TB 5CA1A 4U3JB 5KX5A 3E22A 4F6RA 4X1IB 5EYPB 3N2GB 4ZHQB 4DXDA 4O2BB 5EIBC 3WGKA 5MN6A 1TUBA 4ZI7B 3JAKA 5ITZB 4O4HB 5IJ9B 3WGMA 5J2UA 3ZBQA 1FFXB 1SA0A 4HNAB 4LNUB 4O4LB 5JQGB 1W5FA 5FNVA 5JH7B 4TV9B 5JVDB 4X1KA 5LA6A 3JARB 4IIJA 5LP6A 2VAMA 4IHJB 3JATB 1W5AA 2RHLA 2Q1XA 3JALB 2XKAA 3UT5A 1W5BA 2VAPA 3WGJA 2R6R1 2BTQB 5LYJA 5EIBD 4EB6B 4EI7A 3RYIB 4YJ2B 4IIJB 3RYIA 4EB6A 4YJ3A 4O2AA 3HKEA 5JCOC 3VO8A 2BTOA 3JAWA 4DRXB 3JALA 3JAWB 3JAKB 5LOVA 3JATA 5MN5A 4TV8B 1TVKB 2R751 5IJ0A 4M8IA 4I50B 4TV8A 4X1KB 5LA6B 5CA0A 2VXYA 2BTQA 5MN4A 4I50A 4X1IA 5IJ0B 3E22B 4O4LA 4YJ2A 1FFXA 1SA0B 4HNAA 5J2TA 4DRXA 3JASA 1W59A 5M7EA 5LOVB 4YJ3B 3UT5B 5LP6B 3RYHB 2GVIA 4IHJA 5CA0B 5LYJB 3RYHA 4U39A 5FNVB 5JH7A 4EI9A 1TVKA 5IJ9A 3HKDA 5JQGA 4ZOLA 5J2TB 3R4VA 4B46A 3JARA 4O2AB 4B45A 4WBNA 3N2KA 3VO9A 4TV9A 3CB2A 3M8KA 3VOAA 5JCOA 5IYZB 4I4TA 5CA1B 4O4HA 2VAWA 3HKEB 3N2GA 2RHOA 4E6EA 3VPAA 3HKCA 4O4IB 4X20B 2Q1YA 2RHJA 1W5EA 4O2BA 5EZYB 5LXTA 4O4JA 5C8YA 3V3TA 5GONB 4LNUA 5J2UB 4KWEA 3RYCA 5LP6C 1JFFA 3RYFA 5BMVB 1TUBB 3RB8A 4TUYB 3M89A 3HKCB 4O4IA 4X20A 4ZHQA 5EYPA 5JVDA 3HKBB 4FFBB 4U3JA 5KX5B 1RQ7A 3VOBA 5CB4A 1Z5WA 4O4JB 4ZI7A 5CB4B 5ITZA 4I55A 4X1YA 4EI8A 4WBNB 3WGNA 5KMGB 3ZIDA 1RQ2A 4I55B 3WGLA 3RYCB 5KMGA 5IYZA 4F6RB 1OFUA 1FSZA 3ZBPA 3HKBA 5C8YB 1W581 2RHHA 5GONA 3N2KB 5EZYA 4FFBA 4XCQA 5LXTB 1RLUA 1JFFB 3RYFB 3C8LA 1Z5VA 4TUYA 4ZOLB 4X1YB 3HKDB
chains in the Genus database with same CATH superfamily
3F5MA 2X1MA 4XEHA 2FPPB 1U98A 2VNJA 5JNUA 3MWDB 1L7BA 4JVNA 1X94A 1IJEA 1ZW6A 2AFHE 3CS5A 2OHWA 1AGYA 3TEJA 2PMPA 1BQEA 2F3QA 2ZBFA 1I7FA 1JU9A 3V4PB 3BMCA 3CRRA 3C98A 3KL4A 3SS9X 4F11A 3KZVA 2XBUA 1WN7A 1Z6QA 1ZN2A 1KAMA 5EAZA 1XZEA 4NYJR 4XGRA 4E2YA 4G1EB 3L0CA 3O31A 3NBXX 5BZBA 1ETUA 1SUIA 2FE1A 3LCMA 3GGSA 4WNAA 1OAOA 2HA0A 5FULA 4S1NA 4N7RA 2JLVA 1Z62A 3P4EA 1BU5A 2C88A 2JJ2D 3NWBA 1CHDA 3OAAD 4JB0A 4ZP1A 3X2QC 3MMPA 3ROGA 3TPZA 4D5GA 4AJEA 1HDYA 4M22A 5HKLA 2UXDO 4P3YA 3UV6A 5B1BC 4GUDA 4EGQA 3SQNA 3SS7X 3CNNA 3L41A 4RULA 1DXYA 5KJCA 5H4HA 4FOOA 3TS1A 4BBZA 5HUJA 4MW6A 2H06A 1AILA 3DBLB 3FKSG 2WICA 4OD0A 4PYIA 3EA4A 3CCEV 1X7PA 1LSUA 2KX7A 4B08A 2WFMA 3HB0A 3PFKA 4LTNA 3TPFA 3OECA 1B2LA 2HJRA 2IOHA 5GTDA 1M76A 4XX0B 4EUSA 4TMTA 4OH7A 2NSYA 1E98A 2DVMA 4FMBB 4QNRA 4RA6B 4P4NA 2KE5A 3EQ9A 2VT6A 3MFYA 5B7GA 2ZI4A 4PNHA 5LOVB 1XNRB 1RYMA 1G5QA 5DPMA 3SF8A 3ZTTA 2A14A 2PT6A 2ZUWA 3LVQE 4BVAA 4XDJA 4BCDA 2IBTA 1NPTO 3I5AA 4G0ZA 3WRXA 4K9DA 1XMVA 2H1HA 2JLZA 4Z0HO 2WZCA 5HPYB 1UJWB 2D5BA 2YNMD 2RJZA 4WD3A 4D9FA 4IAOA 4NBSA 3ND5A 1WXXA 4QPZA 4MYSA 5CW2A 3P9PA 4TMXA 5EQJB 3MRVA 2Z98A 4TXHA 1K66A 1U0FA 1FFCA 3O0DA 5JO0A 4LMPA 3BGSA 2A0FA 1R5NA 2Q9UA 4WBNA 4X00A 3HCAA 3O91A 4JBHA 1OBVA 5EUBA 2KG4A 1P5JA 3LIPA 3ANTA 2VRCD 1VBNA 5BQPA 4HQOA 1YR3A 1K9MW 1YUMA 3EBOA 1Z7YA 3GEEA 3MN1A 4M37A 4C07A 2I8CA 4ZYYA 5KSYA 1KMMA 3HA2A 4P5EA 3N2IA 1AX9A 4O4JA 1Z5GA 5AVJA 1CQIB 3MDOA 3G5TA 3C8DA 2FDCA 5EBLC 3CJTA 4BX9A 2ZS9A 2IYRA 3U0ZA 3FOAA 3KSMA 4PZ9A 4DMRA 2AIFA 5F2KA 1YV9A 4TUYB 3H4IA 5E6SA 4L8GA 2JEUA 3GRKA 3P2JA 2X2FA 1F2UB 3KALA 2FEPA 3C3YA 4F4DA 2REQB 3K1JA 2YWXA 4DFDA 2O7RA 4ZKDA 2PH5A 2IYVA 2CE2X 4JUBA 4JEHA 3QX7A 2QTHA 4J0QA 4H1VA 2IBZH 1CZHA 4J80A 1FPOA 1KDRA 3OUSA 1CS4C 5COQA 3O4RA 4AW9A 5JUWA 1T8UA 5MFZA 4QBIA 1ODLA 1Z35A 3GP3A 2HWYA 4BKMA 2GCNA 3EIFA 4DADA 3KSUA 4Y2GA 3GJ6A 1ZUWA 4RMIA 1WUYA 2HRCA 4D74A 2D59A 2LCFA 1BXKA 3AYXB 3A32A 4S35A 3CPWU 1LDYA 2ODTX 4ER5A 1FF9A 2Q49A 5KYYA 5GVSA 1T2VA 2ZUVA 4US1R 9GPBA 1OQAA 1OBCA 2CJFA 2HCJB 5CA1A 1FIUA 1QKKA 2ZAGA 4P9PA 3CCSF 1Q16A 4WZ6A 5DNUA 5L3GA 4KR7A 1Q0LA 1LI7A 4DV1O 1HDZA 3A2FA 1WMSA 4G88A 2AJDA 2GPAA 2VPIA 3JPWA 1QOZA 3RRZA 2VPTA 4KHZA 1U43A 1WDWB 4MZXA 3BIOA 2C2WA 3I5UA 4BR6A 3WXBA 1GAWA 1HE5A 1Q7BA 1DQNA 2YWCA 1NE7A 2C8LA 3GJ7A 1RXSA 4W9NA 2JGUA 1R3DA 2EKBA 1ZPDA 2WWIA 1P17A 1ACLA 2Z3VA 1QHNA 1T4GA 3I39X 3O6VA 2VTVA 2JGRA 3JS5A 4TN5A 3RS5A 5KOIA 3EX7C 2H4XA 3L4SO 2FSSA 4GHWA 3VR2A 2XQVA 2HJVA 5DM0A 1VM6A 3WZ2A 4BRWA 2GO7A 1PZMA 4OLFA 3SQOA 3I64A 1YDMA 3CKYA 3ST7A 4FQ7A 1J24A 3B1KA 4Z5XA 4RIIA 3HB5X 4F2PA 2WLSA 1TKBA 1U3UA 3B3GA 4N5DA 5CLQA 2NUAA 3TDKA 4G9EA 3ZU5A 3WO0A 4Z51A 3CW8X 3MAAC 3Q6MA 1K73W 1MO3A 1XQWA 2CVFA 3LHIA 1T2CA 5K09A 4AHCA 3R6GA 4EK9A 4Q48A 3E18A 2YXYA 3WB1A 3QA3E 4IDHA 3OT5A 3PLAE 4HUQA 4FLXA 4B3MB 3RHZA 3GZJA 5TC4A 2XYVA 4FJ1A 1I7QB 1RBZA 1RWVA 1LK7A 4EJ6A 4NKGB 1FP4B 2VHZA 2HLHA 1CW2B 2V98A 2HIHA 2L18A 1WD5A 1HA3A 2KMLA 1SQXH 1RKXA 2ZI3A 1M54A 1J2EA 2B36A 4EI9A 3H2KA 1DK1A 3D1LA 1QTIA 1R6DA 4LF4B 4UOZA 3G6EF 1UM8A 3TE7A 1OFUX 2FXVA 4OV6B 5B7PA 2I3DA 4UXHA 4B82A 1JDBB 5EHQA 2FK8A 5IU6A 4PZEA 3PT9A 1UOEA 1VPDA 5FI3A 1MX9A 1FX0A 4KNVA 3N2KA 1T91A 5HX7A 2Z2ZA 1NUUA 3GDOA 3BA6A 4WX2B 1D1TA 1NU1H 2J7PD 1MW9X 2X4LA 4ZZ2A 4MOWA 3LT1A 3ICXA 1ZMRA 5JADA 1MQ9A 4BE7B 3MHSC 4AZ3A 1PKXA 3RW9A 1IOLA 2G9UA 3A1EA 3MMSA 4CKBB 1CP3A 1IZZA 1X13A 1KYOF 3F4LA 4EG7A 2IYTA 2JH8A 3PKJA 1XL1A 4L2IB 4M87A 2ZR0A 3KWMA 1TQ8A 1TT5A 1UPAA 2Q7XA 3KSBC 2DB3A 2PX8A 5CP8A 3E8HA 2YZKA 1MX1A 1V95A 3EHDA 1MGPA 2ZKIA 3H84A 5JYEA 2HJSA 4U1RA 1L7QA 2CNWD 2P4UA 4LE1A 1KVSA 5I5GA 3DC6A 3CVWA 2C7OA 5CLIA 3IMCA 1PV2A 5JVDA 1UUFA 3VAZA 2H94A 2WLHA 4TWKA 3EAGA 5HA5A 3SOZA 2DQYA 4BNVA 2JBHA 4A1FA 5BVGA 1FE8A 1JQ0A 2EX0A 4QBHA 2VHQA 5J40A 1IAQA 4WBNB 4BWGA 4C4RA 1PF7E 2RHCA 4UV8A 1NRIA 5IKPA 2L17A 2WLIB 1T2FA 2WABA 2WBLC 3EA0A 4QYTA 3H2ZA 5E8RA 3ASNB 4WUTA 3NNDA 3MBOA 3KZMA 4LFCO 2H2IA 3GQBA 4JKOA 2JI4A 4R4JA 2OA0A 2ISCA 3QKWA 5TDHA 2QYSA 3CO0S 2PXXA 3JYOA 3HUUA 4LE2A 5H9CA 1U11A 4BUJA 5CCEA 5BR8B 3GO4A 1WSWA 5IAEA 4AF6A 4DUGA 1P9RA 3F97A 4RA6A 3MAQA 1SC6A 5IM4F 1KAQA 1Z2DA 4D0LB 2V59A 1GTL1 1W6RA 1TCCA 2AVNA 2QX9A 3CINA 3QU4A 3ROXA 3TZEA 4P0QB 3A9UA 4QU0A 3UCXA 1D6SA 3G8CA 4QT4A 1EZJA 3DBLA 3LBAA 2RGAA 1CZOA 3GCWA 3PICA 1J5EO 3AG1B 1QHTA 3E1YA 1KDPA 3BAFA 3BK7A 3MWGA 3FVVA 4TMYA 2CV1A 3WGVA 1BCRA 1F2UA 3GVHA 5L3QB 2QE7A 4L95C 5JSZB 5FPQA 4BMZA 1WZUA 4FR5A 4QICA 2PMDA 1KO4A 2G0AA 4O29A 3BE6A 3COYA 4BVQA 3QE2A 3AL3A 3L7DA 1HDRA 3TQRA 1EBUA 2H0AA 2HX1A 1HF3A 3W04A 1G7CA 2YCBA 4IL6Z 2YWJA 5L45A 3ACBA 3NT2A 1AGPA 4GZ3A 3ASNC 3VR4A 3T7RA 4DAEA 5DGDA 1T25A 4YR9A 2WIDA 3AVQA 3B5JA 1IRIA 3WMWA 2A0XA 4WMLA 4A2PA 3EFBA 5JXHA 3QYAA 4BV2A 4K6MA 1LLCA 3T0GA 4E07A 2J5KA 2VK1A 1TAEA 1JXMA 3OMXA 3S3TA 4Z54A 5I01A 2WSSA 5AHOA 3IB6A 2HCBA 4GOMD 1QLHA 2WU4A 2QAJA 1XRLA 1NUQA 1GITA 1VI5A 1VKOA 2LVBA 4MLPA 2ISQA 3WGOA 3TW8A 8ABPA 5AW4A 2H8KA 4BX2A 1AGNA 2QTOA 1GPAA 3AUAA 3C7CB 4IV8A 2ERCA 3R0QA 3P96A 4IHQA 4PXSA 5AYVA 3R7FA 1QYRA 2AFRA 3A0BZ 4GU5A 1HE8B 4Q6BA 3GLFA 3AVXA 5JIBA 3ISTA 1NRXA 3PEWA 4F38A 5EMJA 1L2TA 2Y99A 3DE7X 3OM8A 4MRVA 2FZ4A 3NBKA 5CEFA 2E85A 2RI6A 3GRYA 2W5UA 4EPYA 4OP3A 3SLGA 3VHRA 3ZS9A 2JCVA 1U31A 3JRWA 4FOPA 3Q2IA 4OPHA 1KEUA 1G6KA 4XH9B 4CF3A 3FNRA 1I51A 3WHLA 3LWBA 4FZJA 4WLNA 1ZL2A 5BMOA 1AZTA 2CL7X 1QE0A 5DLPA 3OIUA 1Q83A 3VNBA 1XFDA 3PYLA 1GFWA 2FE4A 3DBRB 1U2DA 4W7HA 4X20B 2C95A 1E2IA 2YHBA 3E61A 3H11B 3TIXB 1EVQA 5SY4A 2UYOA 2B2NA 3PP8A 2VNKA 4E15A 1WL8A 3D8SA 3MJEA 2R6AA 3GVMA 2G8NA 1JOYA 3OE7G 4Y1RB 2IQ5A 4N6GA 2FPKA 3A4YA 3LT4A 4RXTA 4AWBA 4J7KA 2P90A 3WVNA 3W5DA 4WNAB 4O4IA 3EC1A 2QKAA 2FOIA 2QZ9A 1RAIA 3DFFA 2PK3A 3FCEA 1WCV1 2XTZA 3D0KA 3GVCA 1FJXA 1ND5A 4QUJA 3HGTA 4D2IA 3VOBA 3VAYA 1OTHA 3UW3A 3OF3A 5HVNA 5DSXA 3ZWMA 1Y37A 4R9NA 3WFJA 2QMYA 3Q7PA 4X64B 2CDYA 2Q6OA 3JU3A 5IBRA 4YLYA 4FOLA 4OHXA 3CRAA 1PQWA 2QYTA 1S3JA 2ECKA 4R2IA 5T5QA 3GWOA 1U2GC 2KGWA 1KU0A 2EJWA 3HDVA 1BQZA 1JPVA 1NI5A 4RAOA 1SH7A 2NU6A 4REMA 5JAOA 2MOKA 3VUEA 3TF5A 2XUPA 3RVBA 1DKUA 2AJLI 3EEQA 4KAXA 4DKJA 4DUYO 1FRQA 3TTSA 3HCBA 1Q6UA 3ORYA 3LP6A 4IJKA 5KOJB 4EM6A 5LMNO 1IV2A 4RESA 4NIMA 1N32B 4P6VF 5EIAA 3B6MA 4AWAA 5CDSA 5LD2C 3E22A 3EJWA 4UOQA 4B62A 4A16A 4EFDA 3QWFA 4JZYA 4NNOA 1XL6A 4D02A 3MCWA 4RV9A 2D2IA 2DUMA 3RVPA 2K7ZA 3VAAA 3RVOA 1FY2A 1SU6A 4PLTA 1BHO1 4DA0A 4UCFA 1IHYA 1O8CA 4ZAGA 5BQOA 5LM3A 1DJNA 3I0ZA 1U2PA 3U3KA 2HFJA 1MDBA 3GPBA 1OCRB 2IH3C 3QNMA 4G1FA 4EY5A 3KAKA 1L0BA 2VZLA 3L0OA 1WUIS 5LYJF 2NXJA 3IQWA 2VWHA 5DTQA 4F6CA 3C3SA 1NA5A 1DC3A 2G4CA 3DEHA 1I7LA 2IZ6A 3G2QA 3K0KA 3O92A 3SZRA 3JQGB 3W4JA 2F55A 1LFDB 1Y5RA 2Z8ZA 4A91A 4EI7A 2DPGA 1VE7A 2J0SA 4KJZA 5HY0A 3FUVA 3Q3HA 4FQ8A 3PS9A 3S2GA 3C4JA 3J81N 2WD7B 1NP6A 1J1IA 4DRXB 1YB5A 1YCGA 1YE3A 3DVRX 1M1NA 2MK3A 2YL2A 3T7EA 3V34A 2VZ9A 1W0KD 3E3NA 1HNZB 5FUVA 5M29A 2IS6A 1RP7A 4UJ3A 5K0SA 2COUA 1JQDA 1Y63A 3BHMA 3PQ8A 1K3TA 3A0RA 4TV8A 1BKYA 1Q1NA 2XVAA 2BTQA 3EWSA 4KO1S 4LXXA 2W2KA 4UUPA 3ZWWA 1OIVA 3EWIA 5IKEA 4GGOA 1GUAA 3OWHA 2BE9A 4IH4A 4KH1A 4PYOA 3R0XA 5J23A 4URZR 5HYVA 3ESZA 1IEQA 4QUAA 3HWRA 1CJKC 5D3QA 1A8UA 2H3EA 2XIQA 1SEPA 4J6EA 4YEDA 2QTNA 2R7AA 3IIEA 4NF2A 3QE3A 4YQEA 3OTFA 3ZE8A 1TK9A 3QNEA 1CP9A 4PG6A 4PZPA 4IFIA 5CD1A 5LZ7A 4I14A 3EXHC 5G0WA 3MTDA 3TNLA 4A8JB 2IIVA 3G9QA 2W6ZA 3I1JA 2MSDB 3JVUA 5DHRA 5G02A 3NTOA 2CT8A 1PFGA 2P9ZA 5DGIA 4E22A 1HDEA 4WZBB 4ZPXA 4QTXA 3O1JC 2QWOB 3A4VA 2OY0A 4INAA 4XJSA 1YC2A 3VO9A 3FTPA 1JF8A 3HZZA 4AKIA 1F5SA 2YJ3A 3QF7A 1O95A 3ADKA 4JWKA 4XB2A 3GH3A 2DT5A 4J1SA 1UMBB 4DZTA 1C4WA 3Q4GA 4CKYA 4E6EA 4NE2A 4IF6A 4HZUB 4ASUD 2QN8A 3QG1A 1SRRA 2BLNA 2VNIA 3PNSA 4MVJG 1QAQA 4WDQA 2ICAA 2XBMA 1WLSA 4ZYUA 2FY8A 2XXBA 1EUDA 3PUKA 1GQYA 5HOQA 4ZIRA 3MHPA 1RYHA 4IDOA 5AUOB 5C5EA 4IEFB 4UATA 2BEKA 4V3CA 1C3VA 1QONA 3NDJA 1T5OA 3RIEA 3MLEA 1DGSA 3T1YO 2AFIE 2XB8A 3D2BA 3DXZA 3A1TA 4HGOA 3FI0A 4QQKA 3K5NA 4J0JA 1FP2A 4Q6GA 2G9QA 1EQAA 3M9XA 3RC2A 1K2WA 4UU7A 5A9SA 3EA5A 3LYUA 3TOVA 4Z4QA 1PTKA 1GMGA 1XVIA 3FCOA 1RYFA 1LLQA 1HDJA 3G71V 1MN6A 2DR2A 3TIIA 2AF4C 5DCYA 1U8YA 1KKMA 3CSXA 5G2OA 3HGQA 3BWYA 3M84A 2GEJA 3QJYA 2PRSA 4JAVC 5E3JA 4INOA 2MYNA 3U39A 1G3RA 1T8SA 2W4MA 4G0MA 4J07A 2F8SA 1EM8B 5E6RA 4NNJA 1ZG3A 4N76A 1PNVA 1HTTA 2PYZA 2DY0A 2W2TA 4XA8A 3KVRA 1BX1A 2JFQA 2ZJ6A 4JC4A 1Z6YA 4JENA 5GM1A 3U4CA 4AD8A 2VK2A 3PJEA 2NSDA 1Z5PA 4OKSA 3DHNA 5HZKA 3UUEA 3G02A 1QKJA 4M0MA 1ZIXA 3WYEA 3SWWA 5HDQA 1RIIA 3CRQA 4Z0NA 4LHXA 4LPKA 4BQIA 1GGJA 3NVMB 3FR8A 3PPWA 4L5BA 4MWEA 1VE1A 4WPGA 1DT9A 4HL6A 1YB2A 3VTFA 1NP3A 2VRBA 3QUAA 1VQ9F 2V7TA 3THOA 2DHEA 1SGWA 1R5JA 4FU0A 2FPRA 4MKRA 4PCVA 4KNYA 5FA8A 3L01A 2W8BC 3W6PA 5K5EA 2Y93A 4K88A 1VPWA 4DZZA 1U3FA 3GHHA 3J7TA 2OYRA 1A76A 4QPJA 1UWVA 1VE9A 1SXJD 2FPWA 4F12A 1GL6A 2EKQA 4FLWA 2ZAMA 3X0DA 2JAHA 2JJ1D 1Q22A 1THMA 3K9GA 1J90A 3KT6A 4P8RA 4DBVO 2WLLB 1EJ6A 3I83A 4Y2TA 3WBKA 4X61A 1CB0A 4IVRA 4JBNA 1M8JA 2AGVA 2E4AA 2IH4A 1RHUA 2ZQ5A 3U10A 1QCDA 3ER6A 3IC9A 5LBQA 3BM5A 2HJ9A 4Z99A 3M83A 4MI9A 2R9RB 3ROTA 4HLQB 4OHMA 1G7SA 4DUZB 4A8JA 1Q82W 3X43A 3OEHD 3RSQA 1L5SA 1V9SA 3D0RA 3FPLA 4RLSA 3OMAB 3ZWKA 1WHTA 2EINB 4JLJA 4M53A 1BGXT 1EFUA 5FX2A 2HLDG 1QANA 2IXFA 4EH1A 1KZ6A 5IX8A 3I12A 4LX8A 2IS2A 4C1NA 2A9PA 5FPOA 5LP6B 1KDTA 1KRXA 1J33A 3FFXA 3HHPA 5KCMA 2NN4A 4BO4A 3KOOA 4D5EA 1DT5A 3T7IA 4EJ0A 3HACA 1T4DA 1P62B 4PGMA 3TG8A 4HDQB 2NU9A 3LOUA 2DT8A 1XUQA 1UOOA 3SN6A 4J10A 2CXXA 3O7MA 3L82B 1Q5OA 4G4GA 1VE3A 3D2CA 2J5BA 1ZSYA 1JTVA 3UT0A 3WYAA 1L4YA 2IUUA 4P3PA 5KBYA 2JH9A 5BN3B 1PX0A 2WF9A 2ZNIA 3OY7A 2JHAA 4Z0PA 4MYRA 4I5SA 3H75A 2PVSA 3AGQA 4YP5A 3CH7A 3RVKA 3WMXA 4PYMA 1KYVA 4EJMA 1DWOA 4YRBA 5C1BA 2C0QA 4KMMA 1NU8A 1FXKC 2J3LA 1K1EA 3KL2A 1X19A 5K8IA 4AKGA 2ZJOA 4EZBA 1V16B 1JEQA 4MUAA 2JL1A 2QHXA 3LBYA 3DP7A 1CY1A 4KXFB 3M6VA 3QPBA 3B3AA 1C7FA 5AICA 3MT8A 1Q74A 5AVOA 1MQAA 4RGQA 4L3WA 1ZR4A 1S5LZ 3TBKA 4RVHA 2IH1C 4H3VA 4QOSA 3CF4A 1QLWA 4ALMA 3ILYA 3RS7A 2NO0A 5EIHA 2ZDIC 2CHGA 4LF5O 3R1IA 5CH8A 4GWKA 2CFRA 3I61A 5GGYA 4FOSA 1DI0A 3P97A 3T9EA 2ZR3A 4DW0A 1ZGZA 3LM8A 4MVJH 5DWVA 2DKNA 2WF6A 2OUKA 3OOEA 4H1HA 1KECA 1VQVA 3ABRB 3E5RA 3HC7A 3SX0A 4E4YA 1KUQA 3CMEF 4BIZA 5C8YB 1QCZA 1FDOA 1AJPA 2I2FA 2OVFA 2X7HA 3Q3CA 4BNHA 4BKRA 2UXXA 2O54A 1KC1A 3U6KA 2QVLA 5AKEA 4TT3G 5EXEA 1UMBA 3LUAA 5IF3A 1TRHA 1IIRA 2D1RA 1C5KA 3L9DA 1J39A 1EMDA 2PGNA 3F6EX 1H2YA 1I7SB 4LWSA 2W2LA 3MOGA 3IJPA 4QE9A 1W1UA 4G9BA 2NYAA 1KI7A 2W2KB 2D5CA 4E5YA 3NONA 1GNVA 2H5IA 2PT7A 2CKDA 2Z1MA 4GE0A 4R40B 2H9YA 4AF8A 3NDBB 3I55V 1KH3A 4R2XA 2BZ1A 3N2ZB 3KE8A 4BFCA 3OTOB 3GNLA 2BJVA 1OLXB 4C4WC 1Z0ZA 1T8TA 4O33A 5LQSA 4LRUA 4HWGA 4BX3A 2JIDA 3LWDA 8AT1A 3VBCA 2EZ4A 2J8ZA 3HBNA 1UEIA 2NVUA 1CVRA 4MJ7A 2BONA 1IV3A 1XU7A 4GQAA 3RUIA 4I9WA 4ENSA 3B5IA 2FFHA 4GLFA 2GK7A 3FIUA 1EA7A 3ZIAA 5LQJA 2XEXA 3EW7A 4OPAA 5AVTA 2VTBB 4PYRA 4G5GA 4F5ZA 3S2UA 2G5CA 4LI3X 1SVLA 4G41A 4MXDA 4YALA 3U7EB 1VB3A 2PSFA 1K6EA 4CT4B 1AMOA 3RBAA 3K35A 3QW2A 3GBSA 3H1JH 3RPEA 4F9EA 3EYAA 3QLJA 3UPDA 4BRZA 2VDUE 2OXFA 3I2JA 4BS9A 4D4GA 3WK6A 4ZEWA 5AM2A 3OZFA 4TRMA 1UIMA 4I7EA 2FNAA 2H57A 4FUQA 1R12A 4I50B 4JROA 4BY9D 1MV5A 2BMEA 1E3SA 2OFXA 3HU3A 1X8JA 4FMCB 1P6UA 1QWSA 5F2EA 4G81A 1Y6JA 2YEVA 4MV0A 4PTZA 1W30A 5AJUA 4IYIA 1D4ZA 4KU4A 3DEAA 4YUZA 1CN7A 1CS0A 3P9RA 3Q87B 4KFTA 4QATA 4R8KA 5FFFA 1JG1A 4NONA 4MQFA 5TS2A 3H6KA 3KLNA 4X91A 6ABPA 1YB7A 3AM1A 4XWYA 1P7WA 3V8NA 1ZSNA 1YACA 1BFDA 2CDNA 3ZRWB 2I3AA 4ON9A 5FFMA 1GRQA 5A5EA 4MDYA 5K3AA 2B30A 3R3XA 3CC2V 2J9ZB 4I5DA 4UMVA 3VR5D 4OIMA 4UTNA 3CCUF 2ZB4A 3SNHA 5H0IA 4G37A 3A0HZ 1CRLA 4BP9A 3GRCA 3ZBTA 4E5DA 1T9AA 3SJ7A 4CIYA 1FDSA 5E9JA 1DC8A 3HLKA 1AS3A 1NJ2A 2H7VA 3TUIC 3UC5A 3UJ8A 1U5BA 2HC9A 2QN7A 3LL4A 1RRVA 3CUEF 4LV5B 4QPPA 4YDSA 3WA7A 1QG4A 1NPYA 5E0KB 8ATCA 4MIEA 1US8A 4DSUA 3OKCA 2CWJA 2OT3B 3QTBA 5AR1A 1T4CB 1YHZA 1CT9A 3PGVA 4A6EA 1PP9H 2WA3A 3OZSA 3PQDA 4LAFA 1H4SA 2HT6A 1PUXA 2K2QB 5H5NA 3V6LA 5AD1A 1LLFA 4FDVA 4HPXB 4Y18A 1CRWG 1DKQA 2KWIA 2HSJA 1W48A 4JDUA 1VP7A 3D8TA 1M10A 4X20A 4GD3Q 4MV4A 1SKYB 1VZ2A 4XB1A 2P3LA 2O52A 3O1IC 4NV3A 3SAJA 5DN6D 1YAJA 1B16A 1Y1QA 3ZO8A 3F7NA 5KYXA 1JL3A 1A5TA 2AR0A 2KLBA 4MO2A 2RAPA 4MP6A 1DAMA 5D3MB 1UH5A 2AEMA 3K0DA 4CFYA 1N36O 2QMQA 1KFJB 2H2AA 4AKTA 1CTQA 3CPEA 6LDHA 3QPUA 1QDEA 4MV9A 2HKIA 3H65A 1LF0A 3BMOB 5ALKA 3F7OA 5I7VA 2H00A 5IT9A 4MUYA 4W8OA 3L8FA 4OB7A 5L3DA 2RN9A 1G9XA 2C4VA 1QV6A 3HWX1 4LY0A 4TQ9A 2WJPA 2OTLF 1Z6TA 3FSRA 3T3NA 2G1JA 3EMKA 1TF5A 4A03A 4GRDA 2E4ZA 2JLCA 5EE0A 4W5JA 5DM60 1AG9A 3NMUC 2O8DB 2E74B 1CJTC 5BYKA 3HAXD 1E2GA 1HT1E 1N5LA 3EUWA 4K6CA 3QUCA 3QM1A 4G5YA 4RK0A 4GLJA 2BFFA 1HE3A 5KJ1A 4CS4A 3HLYA 2J3IA 3UNXA 4B3HA 2HHCA 1O96B 1S8NA 3B20A 4OKNA 4A27A 3OGCC 5KHAA 5LJIA 1YRQA 1BTOA 1GZVA 2PA3A 4NKRA 2KBFA 2DPHA 2DFNA 2TMDA 1GUZA 1XEAA 5CVJA 1U2EA 2YMQA 4HQNA 4LHSA 4HAMA 4LTDA 3RE1A 4N7BA 3ZCUA 3OQIB 5E4YA 1TKAA 2QIOA 3JATB 3TW8B 4DMGA 4AUEA 5EJ7A 5KYTA 2EKPA 2PYLA 1US6A 3S70A 4F06A 4QELA 2GK4A 3ZI4A 2I7DA 4BYMA 2CUGA 3VMMA 4DNPA 4ZEVA 1XMQO 1UC4B 2HNKA 3EAQA 3HFRA 3ZN0A 1H85A 1ODEA 4CV2A 2CNLA 4BMVA 2QR5A 1MX3A 3AMVA 3OPQA 4X85A 1XCMA 1VQ5V 1UFVA 1GA4A 1XROA 1KEWA 2BZSA 4LZLA 4NU8X 3ZRXA 1SERA 1VH8A 1ZX3A 2WK1A 3H1FA 2P22C 1TU0A 3M9WA 1X1EA 1WXWA 3C8ZA 5FA6A 3TX6A 3HO1A 3V8RA 4DJFC 1RQPA 4ZBMA 4CT0A 4ZV4A 3I72A 2Q0OC 2R4UA 2LFSA 4DRXA 5FJ4C 2A8YA 4GSKA 4OA8A 5E1DA 4DTIA 2O1WA 3HU5A 3FWKA 4C8IA 1U8TA 4H31A 3RYTC 3UJ9A 1MC1A 3S3WA 1HFWA 2AFIB 2NZJA 2QEQA 2Z2YA 5T4BA 5K20A 1J1UA 1J1ZA 2WSIA 1PV4A 2ET6A 3M9LA 3TCXB 2AG1A 1A7UA 1STOA 3HS3A 4TMVA 3VV3A 4OGKA 2ZTSA 4QNNA 1QNFA 2HQ1A 4YP0A 5TVGA 4CM7A 2PUHA 3L75H 3IDAA 4F4IA 3T1YB 2H2GA 5EEHA 4EA9A 2BH2A 3PKIA 2WFZA 1D1SA 1QHXA 1EK0A 1TFRA 2PWAA 4BNIA 3GB9A 3GEMA 4C7XA 1ELOA 2JEYA 2JZOA 2NUTB 3WAKA 1A9XA 2PH7A 2QRHA 3RE3A 4I55F 5DP1A 4EYKA 1QU7A 5K0CA 5L6MB 2PFGA 3W2HA 4EB0A 1R4MB 1Z0JA 2AZTA 2LXNA 2NAFA 3UMCA 3A6JA 5LHIA 1PD0A 2WSSD 4MGHA 4EF5A 3K14A 3PQEA 3VPAA 1ZH2A 1NW4A 2XNDD 3IPLA 3D54A 4J7JA 1DG1G 3MWKA 1L8AA 3ZV6A 3ITDA 3CZ5A 4NZZA 2QAGC 2VLBA 3KQUA 2DHCA 2G5PA 3UPTA 3ZHSA 5FUBA 1RW4A 4CHTA 4L2IA 1DX6A 2ZEJA 3DZBA 4QFMA 1M7GA 2JLXA 2QNIA 2VUHB 4RIGA 3PEFA 4BE4A 3HKCB 1P8JA 2QIPA 4ESHA 3EZNA 3ZWXA 3AKZA 2WP8J 5TQ0A 4YPFA 3UK1A 1XDCA 1W8DA 4BXOA 3EFEA 1FFYA 3AVUA 3SEQA 3HY4A 3ONDA 4JLDA 3R3YA 3ZJ4A 4EVIA 3QSYA 3KKPA 4XIGS 3WAJA 3MOSA 5U1PA 4CCSA 3UZUA 5HFLA 3RYCB 2WF5A 3RBXA 2JIRA 2D3TA 4YV0A 3O82A 1PJLA 4HQFA 3TKYA 3GT7A 3IPXA 3RVJA 1E1RG 2QM4A 2XGOA 3IAS6 3RVZA 3L40A 1NUPA 2WNHA 3I55F 1X1SA 3DH0A 3CHYA 3OPYI 4D7SA 2HF2A 3PL1A 1LPSA 1U9ZA 4ITRC 3R7BA 3E2IA 3OOWA 3WPXA 3S4YA 3T4UA 5IHXA 3PX7A 3TLGA 2YMLA 4QVKA 1NIPA 4RKWA 5JSKA 2Z9DA 1FP4A 3AERB 2NO1A 1GAEO 2P9EA 4R9SA 3N7AA 1Y1RA 1E9CA 2FQWA 2O6LA 4AJ9A 1U8CB 3CU5A 1M6EX 4A8TA 2BKLA 3K0AB 5A2QA 4XWWA 2UZ1A 3ICPA 1DT3A 3W05A 4WFIA 1B42A 3RR2A 3TEMA 3OTOO 1KGSA 4R84A 1T9GS 2W22A 4G0PA 1L7DA 1YWGO 2AHOA 5COAA 1IUPA 2OCXA 2V9PA 3HSYA 3KXLA 3QIAA 5TQ2B 1NVKA 2ZJ7A 4ZYTA 1GN2A 4PHFA 2O50A 2XOKD 1H1TA 4JLKA 1QWOA 1JZTA 4GF5A 5LL6Y 1XMJA 4A10A 5EJIA 5BNIA 3CEMA 4YREA 1H2NA 4X84A 3IPRA 5BW5A 1Z25A 4NP6A 1L7RA 3UFBA 1EDOA 5EIBD 1IHXA 3H1AA 3GUCA 4L0DA 3TLZA 3RYIB 4EL5A 4YFVA 4RQEA 3GIWA 1GJRA 4PAOA 5CB8A 1V37A 1E3QA 4ZMBA 2ZDHA 1SQQH 1U7XA 2IWRA 3WSWA 3TJRA 1M1YB 1ATIA 5KZMB 1R0SA 3KOYA 2MDTA 1R8JA 1XNJA 1ZUD1 1QHIA 2RGNA 2YN0A 4KLRA 4G0WA 2UUBO 3IEIA 4Z3DA 4C82A 1DMRA 1XZMA 5LA6B 4JLWA 3RU3A 4I50A 3MILA 4O08A 3BHIA 2BE7A 3DMTA 3OCZA 3QEOA 4BBJA 1U8FO 1BDHA 1JQEA 3DHYA 3VC1A 4QFCA 4A8HA 2CNNA 5IBPA 1PGPA 1H48A 2DBQA 2OV2A 4DMHA 2BR4A 1L9KA 3JQ6A 4DDTA 2LWIA 4TPKA 1SUAA 1GPYA 3FPBA 2QVCA 1O5TA 4MQFB 4NDNE 5GV8A 2ZS7A 3V1NA 5SICE 2V3CC 1EVYA 2I4RA 4N0MA 4OHBA 1TVKA 4BFVA 1AP6A 1AA6A 4H7JA 4B3TO 4MYTA 1E9DA 1EDBA 1NTOA 4OIFA 5BYAA 2VDQB 4FJCC 1VMKA 3QLTA 4O4LF 3L7YA 3VKGA 1MA0A 1KZGB 4L6CA 3KV1A 1SO8A 3LG2A 4GPAA 2C5HA 4LDQA 3NAMA 3AL0C 2UDPA 1G7RA 2PX5A 4NNPA 3GAZA 1XMOO 1OZGA 4R1OA 4V2IA 1U2ZA 3I04M 2WYVA 2Q6KA 2XECA 2G0NA 2ZSJA 3E0XA 3M1LA 4IUYA 5E7QA 3K57A 1LTKA 4RELA 3THWB 4Y1FA 5EJ4A 1RM4A 3R3VA 2G9ZA 2Y4UA 4HTFA 4NU5A 3L70H 3IR9A 1EGQA 1IHDA 3H5RA 5B1HA 4GI2A 4E5UA 2E7ZA 4U7PB 4KUHA 4DM4A 3RYCA 4M1QA 3SYKA 2P78A 4J0HA 3L6DA 3T1OA 2F4VO 2HUNA 5CK5A 4C2BA 4NBKA 4CKEA 5JT1A 4WCEV 1XZPA 1DQPA 3EQ2A 4N5LA 4EYOA 521PA 3P7MA 4NOKA 4PWZA 4DPMA 3HKBB 5J5VA 2ZSDA 5C53B 3UMJA 3IKFA 4WCFB 5KOHA 4YRTA 5HS6A 1MLDA 3L8ZA 3HJUA 5B6JA 2CN1A 1MENA 3K7EA 2O3TA 4FCCA 5F3RA 2ONYA 5B1IA 2IXBA 5SY9A 5FWAA 3ZE6A 1CJSA 2V5AA 2WAAA 4UPEA 1N0IA 2Z3WA 5BXYA 2DR0A 1NKSA 4RDHA 2X86A 2YXLA 2XMQA 1CJVC 2Y27A 2YXEA 4R51A 4X95A 4ZEOA 5GPBA 1JXAA 3DULA 3GFFA 5T3UA 4KDCA 5JASA 1AV6A 3MXOA 1NWHA 5DNCA 1U5AA 1NG9A 2JBAB 3X2QB 1C9YA 3EG5A 2E5LO 1CK4A 1TO1E 3ABIA 2J3KA 2VXOA 4H4EA 4DJJA 5JI2E 3BQMB 4PC7A 4DARA 3D7NA 5B1AB 1D2CA 2QLBA 1YUBA 3ONNA 2CNKA 4QM6A 2GBOA 1WM1A 3N8HA 1A96A 1JEQB 2QR3A 3CLRD 1I7DA 3AG1C 4ZO7A 2D54A 4Q16A 2HDWA 2O5RA 3GD5A 1SUPA 1HLGA 1PR0A 4FZVA 4GM0A 5HDBB 1YJCA 4MDEA 1JVNA 4OGLA 5AJYA 4Q7QA 3F5SA 5FOTA 1W5FA 2QTVA 4K86A 2EZ8A 1YITV 5DIZA 3FYTA 4OP1A 1P5RA 3I6QA 3OJLA 4X3CA 2JD2A 3KVOA 1IJBA 5JCJA 5LQDA 1KI2A 4HAUA 4DXAA 3R40A 4F4FA 1KR5A 1JEJA 2H0QA 2JATA 2A9FA 2ZIEA 1JE0A 2HM7A 3OO1A 2ZIZA 4DV0O 2YVKA 3Q8WA 5CTAA 3SKXA 1UDCA 1SK8A 3P19A 4IWXA 4BN0A 5CBGA 1LBIA 3CZRA 2PKEA 2PGLA 2W2MA 3ZZTA 5A4KA 4HB0A 4QDKA 3GZNB 2QXUA 4UCUA 4K0KB 1UBHS 3G67A 3H6GA 1R8QA 1P60A 3BL5A 2Q6VA 5C1OA 1FYEA 4TV9F 1ZK2A 2IW1A 3PF9A 3H7IA 1XTIA 1QP8A 3D3IA 1M3SA 4U9UA 3ZLTA 2VBCA 1ZVKA 1BS3A 3RDPA 1GA1A 2C58A 5IM4A 3A10A 1XD2A 5FPRA 1GNLA 1ZN8A 2NSLA 1XWWA 3IFXA 1TYDE 1PUIA 3N6XA 1OILA 1G7TA 2FHSA 3GXOA 3KR0A 4EAQA 5ITSA 1URFA 5JAMA 1YL7A 2CY0A 4MAAA 2PHZA 3QV1A 5DHUA 2HXYA 1LX6A 3W1WA 3CX3A 3X1KA 4G5XA 3PDWA 4RY0A 2HBYA 3ZHOA 2ALEA 1VKHA 5FTJA 1PBTA 4L8WB 4N1AA 3FAZA 2GHRA 4MTCA 3E4DA 2JH3A 1WJZA 4DV4O 3N2YA 3QHQA 1Y7LA 1YR9A 3RS2A 1SXQA 1C9KA 1CY6A 4YTEA 1ZRHA 5DEOA 1FSPA 2ODMA 4C4SA 1XJCA 1V0JA 1C41A 4ZTBA 3FVQA 2YC2C 4ROSA 4B1FA 2DECA 2O8DA 2GYWA 2ZRIA 2ZXFA 3LHDA 2JAPA 1T9GR 1R2QA 3NOOA 1L8XA 2AJBA 5TSDA 1BN7A 2Y66A 3PNLA 8LDHA 4HVTA 4DWWA 1RI1A 4OXNA 1P1FA 3O26A 1G18A 1JG3A 1Z33A 4PA6A 5ALMA 2WU3A 4R3NA 1BVHA 4CKZA 4OUDA 1BXRA 2A9HA 2FF5A 1DARA 3DPUA 3M5WA 5KTMA 1V9LA 3ETLA 1CNEA 3D4NA 4HB4A 5CIYA 1YOVB 3QMVA 2AGAA 5KHKA 4NMHA 2AFHA 1YH3A 4DMMA 1NI4B 3WLIA 2HPZA 1GUBA 3EZXA 4F9FA 4PC2A 1A9QA 2J9GA 1BE6A 4JAAA 3NT4A 3OAAA 3MRTA 1JYFA 2JASA 3K9AA 2P0YA 4ITUA 1H8HD 4URUR 5ITZA 3FBGA 1QH8B 2EFJA 3WGNA 4LV6A 4KL1A 3RHFA 2FW7A 3AFOA 5CVCA 3DSRA 3FSJX 3VSAA 4HLDA 4TSKA 5KTRA 1S0UA 2EZOA 3K32A 3TVTA 2REQA 1CBUA 1T36B 1XQ1A 2ZJAA 1GX1A 3CPWF 3L7MA 2GHQA 3MCVA 1PCXA 5FBZA 1AUOA 2O3UA 1OWMA 1SHJA 2PZEA 4UQPA 4YXWG 5LXTB 4E2WA 2C59A 2JC3A 3VDMA 4KGDA 3SDBA 1VMEA 1R6BX 1D4OA 3K9SA 2HJGA 2YZ7A 5CVDA 3MGGA 1X0XA 1N8NA 2XUIA 1EX9A 2QZJA 3HB9A 4ZT7A 4O0LA 3ELWA 4WOPA 3LBHA 2Z8YA 1WMDA 3QYJA 4RKQA 1SQBH 1CRPA 3ECCA 1VQ7F 4IXNA 1VYTA 2AZXA 3DO8A 1GWNA 2XUHA 1X7WA 3SFVA 1T4BA 2QS9A 1XVLA 2VOEA 1NONA 5LBTA 3N74A 1R10A 2ATXA 1FFBA 1G8YA 1AMUA 5F7JA 4QT0A 4JJEA 2EIMC 4AP6A 4EY6A 4RK4A 1OX4B 4BDSA 3RV3A 2QPAA 3COSA 1F8XA 1IOWA 1NVWQ 2C8KA 2QXTA 3QY0A 4N6OA 4QUDA 5F1PA 5C52B 2VAPA 4GX5A 1MDFA 1LLUA 4MW9A 4OFZA 3FUXA 4GT1A 1QBKC 3FHCB 3L8DA 1V54B 4G4VA 3KOWA 3MQ4A 2HCTA 2W6JG 2Y6UA 1XZQA 1QTQA 1PJ3A 2ZUCA 1XZBA 3BD7A 1MIHA 4NE7A 1A9PA 2JHGA 2KQUA 2V6MA 3A6HA 3CCVV 2XDQB 5CURA 2JJYA 1MMMA 1NX6A 2ZQYA 1H2AS 1QMGA 3BQ9A 5EO3A 3WNCA 2MSKA 3Q15C 4M8IA 2CXSA 3B40A 5ECYA 4LQ4A 5BSFA 1JJ7A 3U7GA 3KKYA 3PLAC 4CC6A 3MJSA 3NVDA 3VR4H 1GRRA 1ODTC 2ODWA 2L42A 2MINA 2P6PA 5JQGF 3LDTA 2BOCC 1V7QA 2HF9A 3V7EA 1SETA 3W1EA 2D4HA 3R09A 4IRUB 2OR3A 5EB1B 4H77A 3T41A 4TLLB 3QFCA 2XNCA 1BG6A 1CD5A 4GZ6A 1HYHA 3VQWA 2BEJA 2FLVA 2BM8A 2I4LA 4OHKA 5LBIA 3VR5A 1LUVA 3ESJA 4ITVA 2R97A 2M6YA 1P0MA 2I1QA 5FI5A 2EV9A 4A9AA 4X62B 4O2LA 2BKEA 4B46A 5EPUA 3JARA 2AZMA 1D1PA 2Q3FA 1IM8A 3AF1A 4ERNA 3CUVA 1I4OA 1P0FA 2N75A 2JBWA 4IIHA 4FPXA 4X94A 3R9KA 4DLRA 1JR9A 5BR7A 1SVOA 3ZX4A 2R48A 4DDWA 5EKXA 4XASA 5LB2A 4JAVA 4AECA 1EP9A 2AE2A 3TSWA 2QTSA 1V55C 2HRQA 2O0LA 3IDQA 4HAXA 4TT3A 3TFOA 5HE9A 1SKAA 4IM7A 2JI9A 3K1TA 2E4VA 3DLPX 3EVNA 2WSLA 3UMYA 5DF1A 3H9BA 4CE6A 1LUWA 2I2CA 3IC7A 2J4DA 5GIOC 3HPRA 5H68A 1EZVH 4G1VA 2FRXA 3VYWA 4BASA 2Q4PA 1G98A 3RCBA 4PQRA 2X7RB 5A3VA 2ZRPA 3ZWYA 2C9BA 4LZPA 4JCCA 4L9AA 4I55A 4MTFA 3IALA 3R7WA 3SNKA 5M2QA 3QVMA 4QIWF 2P91A 4B7UA 3NHFA 1ARZA 4WBNF 5TMPA 4K3UA 3AVVA 5GJCA 1NBMA 5IH7A 4BPRA 1RHKA 1WJGA 2W8BA 2ZYHA 4B7AA 4PDVA 2YWDA 1MG0A 3T5DA 2IOQA 1EESA 2OK8A 4OM7A 5LGUA 2YWBA 5HW0A 3VC2A 2EL7A 5C37A 2HQBA 3NI2A 3QNUA 5A7HA 3RIMA 2IVZA 3ZJVA 4U6QA 3TMYA 4EIWA 4L02A 3OU6A 4B7KA 1TZCA 4JSYA 1Y48E 5IY5C 4KX5A 5E3IA 5EZYF 3ZI7A 1WEHA 2EWVA 2VTEA 4JKYA 1XEQA 1U3LA 1BDJA 1XIVA 2HA6A 3FTCA 4OQFA 5LDGA 1PWHA 2IP4A 1SDSA 5JE8A 5I5EA 1SB8A 1GM7A 2VG8A 2YI8A 1YHNA 4IVNA 4JGIA 5EP1A 2X6CA 2FYTA 3BH7A 1YDXA 3OIDA 5ALGA 1UBCA 1TKRA 5A6VA 4M9ZA 1WVIA 3OX3A 5ICSA 5JFTA 2RK3A 1S8AA 2JB9A 4B7CA 1OXXK 4QWWA 4YCBA 5ITZB 5ICCA 4Y0AA 3QEBZ 2NNWB 4RSRA 4TQAA 3U4QB 2YSUB 4YIPA 5FV4A 1LU9A 1YVRA 2VJQA 2ZYIA 3G59A 3QYFA 2ORWA 1GQ2A 3IBCA 4I4IA 5B1SA 2ATKC 1RYBA 3JARB 2CYAA 5KHLB 3NGMA 1NW8A 3HR4A 4MR9B 2Z1UA 2FETA 1YQWA 4MLZA 3H2BA 5EESA 4DG9A 2CLCX 2JFGA 2Z8XA 1QGDA 3BL8A 4MYDA 5AESA 1P4SA 3SBDA 3WDLA 2O8BA 1IOZA 2RI0A 3H8WA 2NU7B 1JFVA 2VJLA 3ZXIA 3IKLA 5IXJA 3PBKA 4RAQA 1NVTA 1VF6C 4KFRA 4OMCA 3HM9A 4R81A 2NOAA 3KTFA 1S0VA 1N2EA 2BUCA 3P2OA 2JVKA 3F9IA 5JFGA 2FR8C 4HZ3A 3O8OB 3SMQA 1A7JA 3E9QA 3ADPA 3CZAA 3S2ZA 4G0VA 4BVRA 4M0FA 4A0FA 1BD3A 1A9SA 1RCUA 4HLUC 2R0QC 2X5KO 3E8BA 1VGVA 2E89A 3GLQA 1W59A 3L0DA 3WLAA 3PJRA 1H0SA 3O7WA 3NV9A 5AWFC 1E3TA 4GBJA 4JLAA 2YV5A 3ZOPA 1NVVR 4BP1A 4BQNA 5F1OA 2GZLA 1Q0ZA 2HEPA 1QFSA 5P8WA 9MHTA 1PZXA 1O5IA 1UDWA 2SICE 1B6RA 3D31A 3LV8A 1Y8RB 1UDBA 4D4KA 4LDZA 3IVXA 1QRUA 1FU8A 2J07A 3DDOA 2PS3A 4TKUB 1R37A 1G21B 1NQ5A 1BE1A 1RBQA 1ISMA 2WB4A 2Y71A 1CKEA 2ZDGA 4LXIA 4DV5B 4MROA 2GUZA 2G38A 1M2VA 3NYIA 4FR0A 1PN3A 2Y4OA 4R8CA 2CBZA 1UBOS 2XPCA 2ZTMA 3PFGA 1KP3A 1UZUA 3QTCA 2WTEA 4URYR 4J0CA 1B74A 2NR5A 2NLOA 1N2SA 3IR5A 3TTXA 3N8DA 4D0GA 4ZMSA 3BFVA 5AOAA 1Q3HA 5JNTA 1VEWA 4AP5A 2RNBA 1IPAA 5AUQA 4B3XA 4YJ3F 3JAMA 2Z30A 3DVAA 1ZK0A 1KIMA 4IF4A 3BREA 2B99A 3H9VA 3CCSV 1B6GA 1N4DA 4WXPA 3EXHB 4A8JC 3RS8A 1U7WA 1RRCA 5E0OA 5DBEX 4JVMA 2FK7A 2PA0A 4OEHA 4WNIA 5CT4A 5H5JA 3ZDEA 4KBYA 2C2HA 1M72A 1GZ5A 2GPWA 4UM9B 1R9GA 4R7TA 1L4EA 4JV5B 3BF7A 1VL8A 4V02A 2DYKA 2FZLA 1JA1A 3LCVB 1UFKA 4LZOA 4O1HA 4AMBA 4E11A 5AHRA 4RTRA 3THWA 1MHTA 3RRYA 3Q5GA 4L4YA 5A1JA 3K04A 5DJ5A 3BXFA 2VRZA 2ZZKA 3ZPXA 1EG2A 4XRRA 3HGMA 5T67A 4KPFC 3W34A 2VWGA 5LIRA 2PI4A 4KP4A 5AKXA 5I9MA 3H1LH 3RQIA 3N0WA 4V0SA 5JJBA 1R73A 2RKOA 3SC4A 4L8YA 4HXYA 1QVFU 3TQTA 5KA6A 1MR3F 4PGAA 4B40A 5K7SA 4TRRA 2HXSA 1S9HA 2DFTA 1ZXXA 1JG7A 1SUSA 3DLTA 2YC0A 1Z82A 2YFYA 3FZYA 3IKVA 4INJA 2ZJ5A 4UCXA 2VF7A 3PUYA 3SBOA 2O0MA 3EF3A 2QTRA 4TWRA 4F6EA 3D00A 1PWYE 1ZK3A 3QE0A 4RIFA 1Y66A 4QJ4A 3IP6A 4DQLA 2H8EA 5SYNA 3ENQA 1XTJA 5ER9A 3EXFA 1F5NA 3KB1A 1TGVA 1DU4A 1MQSA 1K8AW 4V0OA 3C43A 4JBWA 3UEOA 5HGJA 3AVOA 5HP4A 4DV1B 1QRRA 3VC3A 4D9KA 4DPLA 2HLDD 4EY7A 4UUJC 1C1YA 4Y2RA 1L9XA 2QJFA 3TXQA 4LVNA 1WOYA 2RHDA 2AZDA 3QVXA 1I80A 4TTJA 4XFDA 4QBKA 3U3ZA 4FK8A 4HDNB 2JI7A 5B6IA 5K8LA 4U5QA 4BVBA 3WLMA 4IIJA 1IBKB 1H5UA 1OYYA 3I2GA 4ENRA 3K5WA 1THZA 3C3AA 3RLIA 3FUUA 2GLXA 5KAPA 1SAYA 3U26A 1PJRA 5F5XA 2E5LB 4PRZA 1O97D 4E5SA 4B17A 1I5XA 2ZTLA 4J1NA 1IOVA 4NUTA 2Q0XA 4OM8A 3SYLA 3WBFA 1AGRA 1FW8A 2J5XA 2DYYA 1I1QB 4IIJF 4PFQA 1U0LA 2FZWA 4UU1A 4C87A 1QK3A 5TB5A 3MHHC 2CXPA 3LL7A 1ORQC 3JAWA 1M0TA 3QFRA 4D3DA 2OKCA 3DOEA 4HDMB 4Q12A 3HO8A 4QA9A 2ZB3A 4BO8A 4KFCA 2HWXA 4EKGA 4ASUA 1JSZA 2UZ1B 1E8NA 4OX9O 2PS1A 1FS5A 4YP7A 2I6SA 2LD4A 2PXHA 4J4HA 1NQ3A 1HLDA 2FWIA 2PR2A 2WIBA 3CJHB 1E1YA 4G8BA 3IBSA 1Z47A 3W3AD 5I4BA 4Q1DA 3DZHA 4RGVA 2AE1A 2GTPA 2A1UB 3KQMA 5BPHA 2IPXA 2O0JA 1G3QA 2WU1A 4G4ZA 3NG1A 4FN4A 3SX4A 3UXMA 5HCIA 5T8KA 5JCJD 3M4YA 2C4HA 4DV0B 2ZSAA 4H7FA 1RHRA 3AY0A 1YI8A 5EKUA 3V7YA 4ABYA 4C03A 1PIWA 4QL3A 4RQAA 3JWPA 4WK4B 1TTTA 3D2LA 3LCJA 1KHTA 4AJKA 3PFHA 5KVQA 5JARA 3BBLA 4GOJA 4WGFA 3VFDA 1DB3A 3FLEA 4LYFA 4F56A 1W93A 1Z2PX 5BN4A 1WU7A 1SC9A 1HT3A 1MOPA 4MJ3A 3FGZA 3BRCA 3JD1A 1I0LA 2H16A 1QGYA 3SJCA 3FOZA 2XAJA 2KB1A 5F52A 1NQUA 2ODAA 1Z2OX 3KE1A 2C5AA 4LH7A 3ZX6A 4OMDA 2XE8A 4FNGA 3VNRA 5BUCA 2QWNB 3TOZA 4XWKA 5KVCA 2AMFA 2HK6A 4MB6A 5CGQB 1W88B 5EVJA 2JFUA 3M6AA 4GMGA 4EG8A 4RVGA 1X92A 1FXWF 3Q2KA 2ZYAA 1N1EA 3SCZA 2Q7EA 1QIHA 1UMDA 1YKGA 3G79A 4N7JA 1N32O 4P84A 1WKBA 4AURA 5DU2A 4C6SA 3MTGA 1MTZA 3QUQA 1QQBA 4MVQA 1M1YE 4EJSB 4J9YB 3CP1A 3DV2A 1YJNF 4MQUA 1RHQA 2CNWA 1PR3A 5EINA 3H04A 1OGYA 4OQXA 1RTTA 4WKGA 1XAHA 1GL7A 2P75A 3A11A 3UAWA 3AK1A 1J09A 2HSZA 4FMCF 4XARA 3AXTA 3D5TA 2OP0A 1TVMA 2QN2A 3B8NA 3VJKA 3A3PA 4ZD6A 3WIDA 3WLJA 1T0PA 1ONOA 2JRIA 1VP3A 1RLTA 3NIBA 4P3NA 4CM1A 3INNA 5JH7F 4CZZA 4GICA 3VNVA 2KQXA 4IXMA 2R5WA 4NH4A 3UHAA 3P2EA 2YWEA 1WB8A 4X8OA 4MDFA 4L4SA 2ZE7A 1AQYA 3HNOA 3G6EV 3I3FA 4QFBA 5EK0A 4ZEXA 2XMCA 1A2QA 4XX1A 4PV7A 2X6TA 2LGWA 3K5IA 1TGYA 4BWAA 2P35A 1ONBA 1JDNA 3JQQA 3VBEA 3BIJA 1ZRMA 3LUCA 1JHOA 4KWCA 3W4IA 5DDIP 1HSZA 1MEOA 2VL7A 1TM1E 2XQGA 4X90A 5H8WA 4ZXPA 4TTSA 5KUTA 5IJ9B 4LSGA 3BWVA 5A0VA 3MM4A 4J4BA 4P4TA 5D7NA 2CLFB 3UG6A 3VDRA 4U2FA 1QIKA 3NAQA 3E8MA 4DJEC 1ZSPA 4ODIA 4RO2A 4IWYA 1CUYA 4LRXA 3OBIA 1MRNA 1ABBA 3CXCU 3ZYZA 4NENB 3FYUB 4D8UA 1VYVA 1NXQA 2YJTD 1GO0A 2QR2A 4OJTA 2OCCC 3JQAA 3B1VA 3CPSA 3TQHA 4Q3OA 3TGLA 5H7XA 4DUPA 2ACEA 5JBIA 4AP9A 1G8MA 3U31A 4BQOA 1PL6A 4DCMA 2AVDA 1OXMA 2XJ4A 5E38A 3U7RA 2JLUA 3MWLA 5L3BA 1HTWA 3DQQA 5CXXA 4A5OA 6GPBA 1LH0A 1RI3A 2VDKB 3C16C 5COBA 2BF7A 1J25A 2EW1A 3NBYC 5EKSA 5LOVA 5CHYA 1VE5A 1JIJA 1BQ3A 3ETDA 1NKVA 3KVNA 3UJHA 3JQEA 4KYTA 3KEMA 1C3XA 4QO7A 4W1QA 3C7TA 4EVSA 4EA6A 1BS9A 2IYFA 2VF4X 3EASA 2VJPA 2AHYA 4TL9A 5ICGA 4V1CA 3NAGA 4AG6A 3T3IA 2QRJA 3F6MA 3MTIA 1EFAA 4MVMA 2RCNA 3OLXA 4D45A 1UPXA 4PLHA 4ND7A 3W5UA 1C0IA 3V2UA 3F71A 1OPRA 2ERXA 3QLVC 4GKKO 3SYMA 4PCUA 1Y76B 4B4DA 3SF0A 2ZVZA 5KNLA 3ZTWA 4TKZA 1UAGA 5C5DA 4D0SA 2D5IA 2FP3A 3NTVA 3PA8A 2IU3A 3M99B 2LKDA 5MGNA 4E08A 3IQDB 4LBVA 1PW7A 2HIMA 3T5MA 2GF2A 3DV0A 2Q1WA 1AI4A 1R3JC 2RCYA 1K3UB 3JQ7B 4JYPA 3AY6A 4RSHA 2NZ8A 4U9IS 3K96A 4ZOEA 3DJYA 1SC1A 4CC5A 3GARA 2PUSA 2IHJA 1T5IA 3IAS1 2JS3A 1YU6A 3KPYA 4JT8A 5JR3A 1KQFA 3O2JA 4AJPA 5LLTA 1XEXA 2NWQA 4MCAA 5CBFA 1WPBA 1I3KA 4PI2A 2YWHA 4OGQB 4MTOA 2H2WA 3CEIA 1AQUA 1CV2A 2G5GX 3CPJB 3K30A 4DXWA 1E66A 2FPPA 2H1RA 4MWDA 4OJMX 3LGAA 1P2VA 5KIAA 2IYAA 3RHSA 1SQVH 1RFYA 3GJXC 2QKYA 1T8RA 1G2IA 1VJCA 2P4KA 2MCFA 3QO8A 5BNZA 4CM5A 4QXQA 3ZXYA 4Z2YA 3AY7A 3D7LA 4NU0A 1I7NA 5CB4B 4ZVNA 2VUIB 3HYSA 2BC9A 4GGPA 4JOCA 1EFVA 2AW9A 4ERHA 1BGYH 3QVGB 4MWZA 1ZOIA 3V9AA 1JQ5A 5LIPA 1ZW1A 2JA2A 2IOFK 4XQ9A 3PR2B 4GCZA 1SG6A 4OHFA 3ZG6A 5HNKA 4M1TA 1F0NA 1XQ6A 1IB0A 4EMUA 4JI4O 2RAUA 2W43A 4J1TC 4RVOA 3MUEA 1SXIA 2IW3A 4YRLA 5ALJA 3OZ7A 4ZI3A 1X0VA 1UXJA 3QVOA 1LGYA 1WABA 4FINA 2ZJZA 1Q0SA 4E2ZA 4LFBB 4CQJA 2CH7A 1P0QA 3CNBA 2AYZA 1GRNA 2YMPA 3AKEA 3E3MA 1SD2A 4PIVA 3WQSB 5JRJA 1HEUA 4K6KA 1IU9A 5EVCA 3LDAA 1TTPB 3VYSC 1OY1A 3AESA 4FFVA 4U9HS 2ZUSA 3EN0A 3G5AA 3K0FB 2N05A 3LT5A 2P9FA 5A71A 2W0FC 4J3FA 5LPNA 2EOAA 4LF6O 3D3JA 5F1KA 1U3GA 2HIGA 4S05A 3K70D 4MPDA 4ZT4A 5CVVA 3MCQA 4H7DA 3ELCA 2OHIA 2OVBA 3ZHRA 4DSOA 2C78A 1XMXA 2EJUA 2WOJA 4U00A 4LGYA 1KWKA 5A3SA 3MTEA 2I9KA 4MW0A 721PA 1P2UA 4CEHA 1YS2X 2J5RA 4V0NA 4CM8B 3FUCA 3WGJA 1CETA 3BT7A 3FJOA 1ZC3A 4GVLA 5H9VA 4R1LA 4R9VA 1ULHA 2C2OA 3FNGA 2C92A 3EEBA 2NQTA 4PPGA 4FZ0A 1IBMO 3PGLA 5DHSA 3KHNA 2MYTA 3SJZA 5IT9M 2XT6A 1E69A 4EOGA 3M70A 4FE4A 2HO4A 4PBSA 3AUJB 3G1WA 3DTUB 3JAWB 2RHGB 4EKYA 1YIJV 3CXRA 3JATA 2C77A 3NIGB 3PRYA 1WDKA 4ZRMA 1JFTA 4G0XA 3OX2A 5DT2A 3VVLA 1QIEA 1IDSA 1Z29A 3K09A 5M04A 1LNZA 5ARDA 1L7PA 3I56V 1NW6A 3DOFA 5JAZA 5GAJA 1Q7YH 2NT4A 4C4ZA 4YMHA 3D3EA 2XUAA 3LX5A 1JTFA 1SIOA 1E0DA 1ORIA 3DONA 3NH9A 3WV5A 5KEIA 1MABG 1Z12A 4X41A 4J9UE 2KSDA 3AGPA 1M33A 4HD8A 3RF7A 2R7LA 4POAA 1K4MA 5AO9A 4UTXA 4A0GA 5IZ4A 2WJ4A 1APBA 4PZZA 1ES9A 4CMIB 2ETVA 1D09A 4MRPA 4LX0A 4TTAA 4E5NA 3H5OA 5IC6A 3ZEIA 4ARCA 3C3CA 2PWZA 1UJMA 4FHCA 5H2FZ 3G2MA 1DRJA 2Y4TA 1JJ2F 1K6JA 1VG0B 2XYQA 3LMEA 2NG1A 4JQCA 5DYIA 4B2PA 3DLBA 3TOCA 4LTMA 4GPBA 4LYYA 4OY3A 3QOWA 4P53A 5BN5B 4AWXA 4J2HA 4HAOA 4BGIA 3OIYA 4OFXA 1TE2A 2H3OA 1I10A 1G8PA 1X7WB 2XUQA 2IWHA 4Q7KA 3DCIA 4GMXA 5TV2A 3SPIA 4J7UA 1ZVJA 3DOIA 3OHSX 3ABTA 2HS4A 3W6NA 4K9RA 5AW1A 3ZY5A 5TS3A 4YMVA 1JDPA 1ID1A 2JFOA 4MUMA 5L95A 3TTUA 3ZVLA 2V5VA 2R9VA 3ZYCA 4I1UA 3ER8A 1HI9A 3WFZA 2ZI7A 4QARA 1BXZA 2BZ0A 3DPSA 1U2QA 4NTXA 1VF6A 1C1XB 1GZ4A 1NBAA 4HAVA 5CFPA 4EPVA 1S5JA 4ZHQA 3ZI0A 1AVTA 1XXHB 3MJFA 4LSZA 4Q3EA 4S1VA 3VR2D 4EMBA 3EEOA 1Y74B 2I55A 2VDMB 1IC6A 2B69A 4F5EA 5AW8A 1NOKA 2PGIA 2VJBA 2MHCA 4FB5A 4GR4A 1G4HA 2F17A 5L7TA 3QG5A 2P5SA 3G17A 4QQNA 3KZCA 3SHOA 3K70C 2GUZB 3WXMB 3BHPA 3PIRA 2DUJA 4BHTA 4BUCA 3ASZA 1Y4UA 4CH6A 2NV6A 5DM1A 2DJ5A 3RJ5A 1UDAA 3HJAA 3WL8A 3IAM1 5IAAA 5HY1A 3GEGA 3TJZA 3WU2Z 3I6IA 3GTZA 3FJ1A 1C0PA 2XTMA 3X1ZA 1D4FA 1Z5VA 2AFHB 3RVQA 2DOSA 2FP4A 3ESYA 2OXCA 4NZNA 4HFRA 1IY2A 3BQNB 2CLKB 5IT5A 3C9SA 3VPDA 3WYNA 2OMKA 1Q2XA 3ASUA 1MO6A 5IYZF 1E9FA 1QB8A 3HE3A 4H3KB 5CXQA 3A1FA 1P7BA 4DMUB 1P2BA 1YFKA 1E3IA 1W9HA 1YBFA 4Q66C 5C51B 1R6AA 1E3LA 4LF5B 5ALZA 5WRFA 4JFRA 5F7ZA 2BAGA 3W8EA 1FL9A 4CH3A 2AJCA 3SQXA 3EQZA 3IQEA 4MJXA 3AVTA 2J59A 5LSAA 5BY1A 5JS7A 3STLC 1H2MA 2ITCC 3VCZA 1LS6A 1WPXA 2BI7A 4I4LA 5ESXA 4PLCA 1JAXA 1PG2A 1R0BA 1SCBA 2H1IA 2FMUA 1FRVA 2HV8A 5JD5A 3HVJA 1WQ3A 4ZI5A 1ULBA 2C29D 3L3BA 2D1TA 3TYXA 4KITB 2ZRMA 5D51S 4CQMB 1TEXA 3E7WA 1MO5A 4NBNA 3JD4A 2VYND 2F1JA 1UZNA 2GNPA 1EWQA 4YJ3A 3N6RA 3EIQA 5DXFA 4AMZA 1OH5A 1RE0A 2QQEA 3OETA 3ND8A 4MI6A 4RKYA 4YQYA 4XUGB 3SR3A 5TPWB 3T9AA 4P22A 3CCVF 1T1IA 4KQEA 1JLKA 4WKNA 2H4ZA 1V3QE 2VWQA 1YRHA 5A0FA 1U3CA 1NLZA 3IUJA 3QVLA 4H3HB 4OXYA 2OXEA 4QC2A 3KIZA 1CUUA 1DIRA 2ZXUA 1UKAA 3IJRA 4EGJA 5AIBA 1I5OA 1SJ9A 1GYRA 3ASYA 4OSPA 5B53A 3ZIAD 4UEQA 4F5DA 4URFA 1ISHA 2VXBA 2FEAA 5JOQA 2ZIXB 5K3EA 2DGDA 1CEYA 2MINB 1OH6A 4LE0A 2CSXA 3BGWA 1MAWA 3AU9A 2AG0A 4V0ME 1Z5UA 3B7PA 4K05A 1ZUIA 4LSMA 5FEUA 4PF1A 2X77A 1NM5C 1AVMA 3ZWQA 1PXWA 3TMAA 1TEZA 1EEHA 2ZIXA 1H23A 1Z0SA 3CUWA 3AUSA 2Y1XA 4C8GA 16PKA 1JLLA 1N2ZA 3L7IA 4OQQA 5EJFA 5GOZA 4DGQA 3P0JA 2ZJ3A 2XASA 3NDPA 2UZ3A 1U2TA 4NQRA 3P27A 4PR0A 1CY4A 3BTUA 2W6QA 3I58A 1S4MA 5A2QM 1KYZA 3ET5A 2UYGA 2YRFA 4HGZA 1M1KW 3B78A 1E64A 3LO8A 2RFLA 4K1XA 2PD3A 4KSYA 4U7GA 2J6IA 2WSYB 4XQCA 3VOTA 2CVOA 4Q21A 2Y1WA 1VQLF 3CLSD 3L6OO 3W8RA 5IVHA 4IR7A 1W44A 2GJSA 4TKLA 2VI5A 2Y67A 1W2GA 2XH8A 1ST2A 1ABEA 4Y7CA 1WXFA 3W7BA 3VXKA 1ACJA 2JZNA 3CYPB 4WECA 1G59A 4RCZA 3IX7A 4RMGA 3A6FA 4F9TA 2Q3MA 2G08A 4FJ0A 4NFLA 3FB7C 2ZOVA 1SC5B 1OIWA 1Z5OA 2GARA 2GSWA 3NJ4A 2OZLB 3ETEA 1G8HA 2W71A 3PC6A 3QHPA 2FPSA 4HFJA 1RPNA 2I99A 3MCAA 3I37X 1KD1H 4R0VA 5G0SA 1E2KA 1G4AE 2FG7C 2X6QA 4W9NC 3C6KA 4L5IA 4RZ2A 4PLGA 3HB3B 2A7QA 4MTLA 2ZWIA 1C1DB 2Z4SA 3A9CA 3G4SF 1YDGA 5AJXA 1O94C 1F6DA 3OJWA 4LJ4A 2OM2A 3CUKA 3LX6A 5CYPA 1UOPA 2Z5GA 4FD2A 3EGDB 4XOUA 5ES3A 4EYGA 2R3SA 3E89A 1N92A 1EK5A 2OXTA 5BVGB 5DRYA 1G42A 2PIDA 2YWRA 5EZYA 5AHKA 3C5HA 2GAIA 4ADSG 2YJ6A 4QOIA 4DANA 2ZJYA 3GRRA 1MNAA 2FWBA 2L0XA 1GN8A 2HWWA 3PVZA 4M55A 1KMIZ 3ZDFA 4B2YA 1IHUA 1SESA 2YV2A 3WBJA 3AHCA 2B3TA 3BWCA 1DBWA 1Z7BA 2B5OA 4ANFA 3SDLA 4XTRA 1NFQA 2QJTA 3A14A 5ICEA 4MTXA 4L6AA 2XT9A 4DR4O 5EUQB 3STZC 5TT0A 3ZHXA 4BB6A 4DR4B 1X8XA 1DBFA 4A0SA 5DTIA 3PIDA 5HOEA 1SBIA 1SKUA 2AT1A 4MKFA 4MSWC 3TD4A 5C0OE 4MWSA 2VQEO 2PYDA 5ALIA 1WMBA 5MF6A 4F3KA 4IGFA 4PYQA 2R70A 1XXHA 1E61A 4JCOA 1HZJA 4LHZA 4QDZA 4RIEA 5EE3A 3S5UA 1JHRA 3AXSA 4IUDS 1QM5A 2UV8A 3GLGE 4ZOBA 4UKDA 4EJFA 3ZZUA 3V7QA 1VLZA 3EQ6A 3AWIA 3T9CA 1P0CA 3A1NA 2O0HA 5J59A 3WIUA 3VHXB 1EUDB 2C3PA 4MQBA 4P7FA 3W5JA 2RGCA 4FGLA 4ZDIA 5I45A 2GZ2A 2E76B 2UXNA 2DM6A 3T2MA 3DGEC 5AKYA 4QTYA 3IVAA 4EQ6A 5BV7A 2ZD9A 2Z9BA 4NCBA 1SM4A 3IAM6 1DELA 1NT4A 3ZWAA 5KVSA 1QG0A 3QELB 3HB1A 2ZT5A 5EMHA 4CTMA 1X3LA 4CYMA 3WLSA 2X2PA 4OX9B 3O8OA 2FMLA 3UA3A 2HREA 2WA1A 3VNAA 3EJ6A 1Z4JA 5TIIA 2H3HA 3H86A 3E8XA 3UHOA 1QAHA 2OZBA 1M1YA 2R8BA 4YPVA 2VLIA 2QRNA 4Q02A 3FDJA 4Z6KA 3M7IA 4KYVA 4BO2A 1HEIA 3W5BA 1KNKA 3L6BA 4HC4A 1LVHA 2B1RA 1YZQA 2DQZA 2FW6A 1C9JA 2XVZA 3NGXA 3LE8A 1FRNA 4FW9A 2FL4A 3KPJA 4KLNA 5JAQA 1YITF 5L3QA 4YCSA 3QX8A 4FLMA 4H0FA 2X6BA 4EP1A 2TMYA 2ZM5A 3Q8KA 1UPBA 2CCGA 2LGJA 2W2VA 4Z1MA 3BRWD 4DRYA 3CC7V 1TMGE 2PKCA 2VGNA 2VYVD 1TZBA 2Z01A 2DQ0A 4GZMA 5BSTA 3W5SA 1YFJA 4FGWA 5CT9A 2AB0A 3PYXA 4ILEA 2XXAB 1ODFA 4OBBA 1XPOA 1UJ4A 3DYVA 1P2TA 3WG9A 1K9VF 3A9SA 2GRUA 4FUTA 1EINA 2P0AA 3UK7A 2Q3HA 5AI0A 4PI0A 3KEOA 1R4ZA 2HVYD 1WEKA 3CCJV 4WF9V 5DWDA 4CRWB 2RHJA 2R85A 2YDYA 1EK2A 3D1VA 1JQJC 2L6LA 3JV7A 4XDZA 2YXDA 5JS2A 2W6PA 5F5NA 3ZGYA 1C9MA 1HYQA 2C7QA 1N6OA 2G09A 4LZAA 1A8IA 4CM8A 5LP6C 3PD0A 2NPIA 2HJFC 1M2JA 1U3PA 1XEWX 3IP1A 4LFBO 3WAGA 4KIFA 4M0UA 4I6GA 5A62A 5LWQA 5AJTA 2AMLA 5H82A 2FCRA 3FAVA 4HV4A 5HR5A 3K70B 4C4TA 1UP4A 1WQ1R 4OHRA 2JDIG 5CDFA 1Z45A 4EG5A 3DLCA 1C8LA 2QPLA 4KOEC 1VJRA 3PUHA 1G0OA 1KPIA 4MV3A 3MPOA 4RVFA 3KTAB 3KEFA 5I7AA 2OGZA 2X0RA 1G1MA 4I55B 3R7WB 3WL3A 4HZGA 1VL1A 4RD1A 4F7DA 4NYJQ 4LXGA 1ZR2A 1UT8A 3OVMA 3J81M 4L6IA 2GKOA 4CF5A 4W5RA 4U8HA 1FDUA 4BO0A 3DEIA 1Q50A 1TTHA 1QVWA 1WPRA 4NBVA 5IUNC 1KQSF 2VP6A 2C0CA 5AM4A 5F2VO 3MAGA 1S3IA 1A32A 1LSSA 3WTBA 4BW5A 1S3GA 1SVIA 4AKHA 3IIMA 4M0EA 1PJAA 3VU0A 1OZHA 2F6RA 3HTNA 5BR8O 4WH0A 3FDZB 2Q46A 2A78A 1OZAA 2X0JA 4H33A 4R2HA 5EXTA 1PF5A 4FX2A 3DWIA 2GDSA 1A50B 4FC7A 1G55A 3WJ1A 5LOVF 4M6WB 5L3VA 3GB7C 2WWTA 4BB0A 5JQGB 3GT3A 4ZT2A 2BJWA 3A9VA 5ALPA 3ZV7A 3ZCQA 5FUWA 3EPJA 3C1AA 3HRHA 1HWYA 1WMEA 4YDHB 1Q6IA 4D82A 2J9FA 2ZIUB 4KOAA 2OCGA 4YY3B 4LOAA 4PRKA 3OZCA 2N74A 1XZAA 3GJSA 1J9EA 1USIA 4DUYB 2MT9A 2O2CA 3A3OA 3CWQA 1RIFA 3ED1A 3NTLA 3O1HB 2XMSA 3FHLA 3DOHA 2J3MA 2C96A 3QFSA 2Q3DA 5KSZA 2QTLA 1P49A 1W0KA 3UAOA 3U09A 5BNFA 5L3EA 1B0AA 3C3EA 5KNBA 4UXIA 2F66C 2FSGA 1SC4A 1DG3A 2X5NA 2XUJA 2G83A 1ECLA 2WYUA 3HQ4O 3PJFA 4LWPA 5DHAA 3ZP7A 5EHNA 1IDOA 3N8KA 3NFRA 2Y0IA 2O2IA 3KYDA 2F1KA 2JI6A 3BULA 1NF2A 4EFBA 4Q3NA 1P81A 4XEUA 2O7NA 3QE4A 3QUBA 2IOYA 3OE7D 1GTZA 4FYHA 3A9TA 2K6GA 5FUXA 4UU0A 1JHXA 1SXJE 2AI2A 2JPDA 4LF7B 2BHRA 3FWHA 3IRVA 3K0FA 1YR1A 3I9NA 4R6XA 4RIHA 3WK9A 1XBIA 1VCOA 2OO7A 2OZEA 4EZEA 2YIBA 3ZHVA 5JH7A 1E79A 4I6EA 1VK3A 3SBXA 1E6CA 5DNWA 3S1AB 1YIJF 4TSFG 3HV0A 5LMUO 1RBMA 2YJGA 2PZMA 4HFMA 2QDXA 3DOUA 4B0PA 4D79A 2JFHA 5K9ZA 3F5DA 2FSFA 1BX3A 3TXYA 2FG6C 3OZAA 4MUGA 4W1PA 3OT7A 4AJ2A 4RD4A 3IDSA 3W3ZB 1KAHA 2Q4DA 1F2TB 4W9RA 1PL7A 1N7JA 4WXYB 3BMXA 2IZ7A 1PR9A 1G5TA 3AETA 3CZ4A 3K6RA 3K0SA 1QD9A 5DNDA 3SXPA 4KYIB 4ZAFA 1CYEA 3J81A 2OHOA 4ZAXA 4EZIA 2V4ZA 1QUFA 3TAUA 3TCNA 2EJRA 1P4HA 1XAIA 3LUTB 1KYTA 3OQPA 5GONB 4G4YA 1JU3A 3JQAB 1NAHA 2HHJA 3P3PA 4FILA 4CIVA 1H8ED 1PJCA 3FMIA 1ZM9A 3M5DA 2AD5A 1EX7A 2WAYA 2C07A 1W19A 3MZ0A 4EW1A 2F9LA 1MV8A 4MRAA 3WGZA 1VHJA 1KO1A 4HDKB 4B79A 3K0EA 1Y8AA 3CF0A 4ECEA 5F77A 3SZOA 5JZ9A 1XP8A 1KBHA 3H97A 1PFWA 1C1XA 1U3WA 2AN4A 4RNCA 4XWTA 5DP2A 1F4NA 5IYCO 5J1TB 5CITA 5AVXA 2PUBA 3WJ7A 1PEDA 4ZAWA 3TLJA 3P0HA 3R20A 5DSZA 5DLDA 2IYWA 3EGWA 3RSFA 6AT1A 3H3XA 5T41A 5KI6A 4HQLA 3IUSA 3HDQA 3ZW8A 2IUSA 2WG2A 5CJPA 3R6LA 2GXUA 4H37A 1Z38A 3ADCA 3J7AC 3BWMA 3OJ0A 4ILKA 4QD3A 1H8EA 1Y1PA 5GZ3A 4W4LA 2DFDA 2OPBA 2PLRA 3B38A 4D44A 3FSGA 3CVXA 5KJEA 2PGJA 3FFAA 1B6QA 3BJRA 1GD1O 1FNMA 3F2IA 4GX1A 1KVQA 1WZIA 2PUEA 1FFXB 1VXRA 2AOVA 2D8AA 1KPHA 1GPDG 1H2BA 4CMHA 5LC1A 5K8TA 1ZJ5A 3GOQA 1BAPA 5AHXA 2ZR2A 4RHYA 2QN6A 2ZU6A 2GTAA 2FWNA 3H2IA 4OYHA 4KR6A 2QYHA 1RRKA 4RZSA 2X8JB 1DTEA 5E9QA 5T8KC 4RD2A 3DBVO 3R6WA 1VQ6F 2ZYSA 1W42A 2JRCA 2VYCA 4XQ0A 5AT1A 4CLHA 2VXCA 1KHHA 1A95A 1XQ8A 3LCUA 1A2BA 1L7OA 3NKVA 4HAZA 1BU8A 2OK7A 5C1PA 1M6WA 5IDJA 1II0A 1LW7A 1M90H 1XK7A 5FL3A 3P9NA 4Z1OA 4GZLA 1DEXA 3M4NA 2R8XA 1TK3A 3PQ3A 3QFHA 4EVQA 2BO1A 1ISRA 2VXYA 3AR9A 3QTLA 1M4UA 4IVPA 5A6SB 3SDZA 4O4LA 2FEOA 1I14A 4MVJA 2VK8A 1P2FA 2C20A 3RLFA 2WD8A 1M9NA 4AYTA 1R1BA 1PK7A 1UR5A 2OFPA 1JEEA 3TD5A 4IIYA 4UW9A 3DFZA 3IQZA 3TGUH 2PUWA 5HTKA 4FWBA 1Z26A 3T3MB 1GU0A 4CCYA 4BC1A 4D9GA 1DJMA 2XOKG 5L4SA 1JPUA 3PNVA 4CS2A 3OIWA 2G1PA 3KV3O 1FTGA 2LW7A 1NN3A 2C7BA 3LPAA 4GDFA 4OKIA 1J42A 3J80M 3F8SA 1RC0A 3W6ZA 4CDGA 3BH6A 1A9ZA 2VQDA 4QUHA 4PYLA 3FGPA 4ER6A 5IMBA 3C6QA 3F47A 2P5TB 1AJNA 1G9SA 2ZULA 4TS1A 1F6BA 4R0MA 4ZK2A 5JPCA 1W57A 1DIOB 4M46A 3U7QB 3K71B 1BO6A 1QBGA 1TI7A 3BSFA 3MWDA 1MG5A 4ZVPA 3N2GA 4OQEA 5KYVA 4FMTA 2DLCX 3GWZA 4GS5A 4JGSA 1LDEA 3F1LA 2CJPA 1B04A 2EARA 1THGA 2BFBA 8OHMA 4LGMA 4NK4A 1NXPA 1B3BA 1Q14A 3AJ9A 3CB4A 3LUHA 3NFYA 3O8QB 5DYWA 1U40A 3VR5H 3FHOA 4XUCA 3VPHA 1L1QA 3H19A 1XJQA 2PJUA 5EG5A 3K6SA 3C70A 4EJ2A 2D1YA 2BE3A 1AB3A 3SQWA 2XAHA 1JG6A 1HURA 5ARCA 5GJBA 2Q68A 2H63A 1XTUA 4H4CA 2IGTA 4LBZA 3VYTB 1EBBA 4EO9A 1JYEA 3EEIA 3LRTA 4Q18A 1XCBA 4M9SA 3UUFA 3WK5A 4X65B 1G0NA 1FQKA 2H92A 2YQ4A 3L6EA 3U56A 3K5HA 3DDUA 3PNKA 2CLLB 4KVGA 4LGCA 3UAXA 2R9AA 4XJXA 4DCPA 5HQ3B 2A5JA 1Q81W 2B98A 3BGDA 2F3RA 3TLBA 3TLYA 4JA0A 5EWLB 3LUBA 5IVKA 3SPCA 4YRNA 4FFLA 1CUBA 1NMSA 4FHDA 2AH5A 3PRJA 4MRNA 5F3DA 4K26A 2O8EA 5L7YA 1R0XA 4YUXA 1AK1A 5FQNA 2J7PA 2F3PA 2GFQA 3LY9A 3WLQA 2HHAA 3BBPA 2ZCJA 1FSFA 1DSSG 2QT0A 3VUFA 3DA8A 2JI8A 3SJQC 2F7SA 3HCDA 3DV9A 4YMWA 5KYUB 2IAFA 3MF4A 4PA9A 3TLKA 1WIWA 2NTJA 3NYWA 2OV4A 5F35A 5IWAB 4MEBA 1TUBA 3U7QA 1W36D 5CB6A 2WKRA 3KT0A 4NMXB 1XPUA 3CCMV 4LNUB 1KERA 4FXPA 4Y9RA 3FM9A 1XDDA 5KB3A 5AK6A 1H8HG 3NDIA 4JHLA 4DPKA 4EARA 1MMFB 4FP9A 1SVWA 2Q27A 4A3SA 2HV9A 3BXGA 3KJQA 4UMFA 4IV0A 4LQDA 2VJMB 1TUEA 2PH3A 3CG6A 4IEEA 2XKAA 4DV6O 4MWTA 4CQLA 4ISCA 4P9NA 3U1VA 3WMGA 2R6R1 1G21A 1ZHHA 3LUFA 4EHFA 3HYCA 1UK9A 2PZBA 3SYCA 1O6CA 3GRZA 4X6XA 3ELBA 4FTWA 3R3JA 5C2JB 4J43A 1R5OA 1TYEB 5IFKA 4EA8A 1MT0A 3L1IA 3G8AA 3UICA 3ZRWA 3K03A 4ONEA 2IZ1A 3ICWA 1AK9A 4I9QA 1F4PA 5TE9A 1JALA 2YBEA 4NMWA 4DBZA 1Z7EA 5KTSA 1JDTA 5ALSA 2V9YA 4MIOA 1GUYA 1IEXA 2A9VA 3NUGA 4II7A 1E1QA 2HPAA 4EQZA 4UOEA 2GN2A 3EZ9A 5BUSA 5EPEA 1T9DA 1RYYA 4KI0A 3WSTA 4MHTA 2WHPB 1LK0A 1GXSB 1U6IA 4LVCA 5EIOA 3GGPA 5CM2Z 1FMJA 1VLMA 3PQ6A 5I4CA 2O8BB 1VQ6V 4RHAA 3L0SA 3BFRA 1XWIA 5IJ9A 1K3EA 3Q98A