4IHJB

Crystal structure of tubulin-stathmin-ttl-adp complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 167
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ihjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4ihjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4ihjB01
5FNVA 4TV8B 4LNUA 5FNVB 4X20A 3N2KB 3JALB 4X1YB 5KX5A 4I50B 1W59A 5LXTA 2GVIA 5LP6C 3JAKB 3UT5B 5J2TA 4X1IB 2RHOA 4O4JA 5MN6A 3M8KA 5IYZA 4IHJB 2R751 3RYFB 5CA1B 5LP6B 5LYJB 5EYPB 5IJ9B 4ZOLB 3N2KA 4X1YA 4LNUB 5LA6A 5ITZB 5KMGB 1SA0A 5J2TB 3WGMA 3JATA 5GONB 4I50A 4X20B 5EZYB 4EI9A 4DXDA 3R4VA 5EZYA 3HKEB 4ZOLA 3HKCB 3C8LA 3VO9A 3JASB 5CA1A 1W5BA 4TUYB 3E22A 3JAWA 4O4HA 5IJ0B 2VAPA 4M8IA 1TVKB 5BMVA 2XKAA 3RYFA 5KX5B 5LP6A 4O4LB 4YJ3A 1RQ7A 4I55B 4O4IA 4WBNA 2VAWA 4X1IA 3VO8A 3WGLA 4EB6B 3HKCA 1JFFA 5LXTB 3HKBB 4O2BA 3JARB 3JALA 3HKEA 1Z5VA 2BTQB 5JH7A 5JCOA 5C8YA 4ZI7B 4B45A 4KWEA 3HKDA 2Q1XA 4IIJB 4DRXB 5CA0A 4I55A 2BTOA 1W5FA 3RYCA 5LYJA 3JAWB 4X1KB 4O2AB 4I4TB 1Z5WA 5JQGB 3ZBQA 5IYZB 2XKBA 4B46A 3RYIA 5M7EA 4U3JA 1FFXA 1TUBB 4IIJA 1OFUA 4TV9A 5EIBD 4ZHQA 1RLUA 1RQ2A 3WGNA 5J2UB 5JH7B 4U39A 3VOAA 3VOBA 3WGJA 3JARA 3RB8A 4EI8A 3RYHA 5EYPA 3RYIB 5BMVB 5IJ9A 5LOVB 4XCQA 4EB6A 4O4HB 5IJ0A 5JCOC 4YJ2B 4WBNB 4IHJA 3VPAA 4O4LA 4YJ3B 5EIBC 4DRXA 4FFBB 5LOVA 4ZHQB 1TVKA 4ZI7A 5C8YB 1FFXB 1TUBA 4U3JB 2RHJA 5CA0B 4F6RB 3WGKA 3CB2A 5GONA 3HKDB 5JVDA 1SA0B 4EI7A 3ZBPA 1W581 5ITZA 5KMGA 5CB4B 2RHLA 3M89A 1JFFB 4E6EA 1W5EA 3RYCB 4HNAB 4FFBA 1FSZA 1W5AA 3E22B 5LA6B 4O4IB 5JQGA 4O4JB 4I4TA 4O2AA 4X1KA 4YJ2A 4HNAA 3V3TA 3JAKA 3UT5A 3RYHB 2RHHA 2VAMA 5MN4A 4TUYA 2BTQA 5CB4A 2VXYA 4TV8A 2Q1YA 5J2UA 2R6R1 3HKBA 4O2BB 3JASA 3JATB 3N2GB 5JVDB 4TV9B 5MN5A 3N2GA 3ZIDA 4F6RA
chains in the Genus database with same CATH superfamily
5K1XA 1Q86H 3DJFA 4Y1EA 3VNRA 2YV5A 5JCPA 3LA6A 3K0DA 1MEEA 3CCSF 4M9SA 3AJ8A 2QWRB 1AT1A 4DV1O 1ODTC 3BD6A 2BM0A 4HNVA 1PE0A 4K9DA 4X7PA 1N8KA 2Z1DA 3A70A 4FDVA 1Y48E 2QTHA 4YCLA 2QY6A 5DLEA 1V55B 4BLVA 3SIXA 3I2KA 2QDXA 3IURA 3GX1A 4X1YA 3NB0A 4M6WB 1RYMA 1TTPB 4OK6A 1QCEA 5F12A 10MHA 4DSNA 4NJMB 2PGAA 3WLJA 3OBBA 3QMVA 4JLDA 1VPVA 4ZYZA 2ATKC 1I2DA 3LX8A 2BOCC 3L0ZA 2AG6A 3VH1A 1CZHA 1Z7YA 4V0QA 4BV2A 3UKOA 1ABFA 4Z49A 4TKLA 1F2VA 2IBZH 3VKFA 1FTNA 2PZMA 2YXZA 1FNJA 2A4MA 4CMCA 1GKFA 1OI3A 3OF3A 2I2AA 3GVMA 1BCCH 3T7SA 3MAJA 4Z4CA 1AD2A 1QPBA 1RTTA 3I92A 3MRTA 4IWYA 3R65A 1NMQA 3K20A 2MCFA 4MQ6A 1K6IA 3FUUA 3GV0A 3LVBA 4HUTA 1U97A 1XAHA 5BWNA 3TLCA 2G7ZA 3BDAA 1DZIA 1EDEA 5FT9A 2BTQB 4UXIA 4XR4A 2QTRA 2JEUA 5EKXA 1WPQA 5KJEA 4GXRA 3UVEA 3M4XA 3DWGA 5TARA 2WLIA 3VXKA 2AVDA 3FWNA 3D3NA 2VHEA 1IATA 2IZOA 1GRQA 1SHZA 1ZWLA 3N6RA 1U4SA 1HPLA 3L73H 1YITF 2ZYWX 4OYLA 2XQGA 2G1PA 4WASA 1U8CB 5AVTA 2Z1FA 1I2CA 3DZJA 3QPAA 1TLTA 2C2KA 2IH1C 3H01A 4MQBA 3TXAA 3UK0A 1WDTA 1SD1A 4W6QA 3AF5A 1JTFA 4ECEA 4L9RA 2W7TA 3MGBA 1E8MA 1HE1C 1LC0A 2Q7XA 3IKLA 3K5IA 3OPVA 4IIJA 1PJTA 3HCAA 3PE3A 1AF7A 3I2GA 4MGKR 3F5MA 3TZEA 1U0FA 5HHTA 3HXMA 3CC2V 2JFWA 3IE0A 1WIWA 4YRKA 5IANA 2ZQZA 4X65B 1G98A 1JIIA 2VJOA 1VQPV 1KBOA 2XOKA 2Y4OA 2EZUA 2DETA 3CS5A 3S8YA 1ADCA 5DO9A 3F5FA 2A33A 4MYHA 4WBNB 5CT9A 3KP1A 3OZ7A 4GLJA 4A6DA 3AJRA 1Q17A 1N75A 3B1KA 3N7TA 4UMEA 5I9TA 2BHRA 3O21A 2E82A 3VI3B 1DCMA 4ZU3A 2GHYA 1TVKA 4NFHA 4RV4A 1CR2A 2H63A 4YHBA 4Q6GA 3WIEA 1PUXA 1Z26A 1Q11A 4B31A 1LSJA 4CKEA 3YASA 1J21A 3LT0A 4QULA 1DXOA 5HXZA 4BGUA 2HA4A 2WWWA 5KKCA 2J30A 1CR4A 4E5NA 4LV5B 3B7PA 5AVVA 4PO8A 3OQIB 2AXTZ 1OI2A 1SOAA 4B6PA 1EM8A 2GN9A 4BLWA 1YZYA 3N39C 4UNSA 3V4VB 4E15A 2FSFA 3I3SR 3IAHA 3OT1A 2DC1A 1YACA 4AVYA 4DZZA 4YRQA 4BDTA 5KAFZ 1WL8A 1XALA 2VNHA 2PDAA 3EAQA 1KE1A 4DUGA 1XGKA 2VLIA 1XU4A 3O93A 3AEUA 3TOCA 4MVJF 4XIJA 5IT9M 2FPSA 4V0LA 5DYWA 4D41A 3V46A 2BBOA 3EB9A 1GY8A 4YEDA 2YWHA 2IPAB 1KZYC 4G67A 3P32A 2ZTLA 3L8YA 4MP8A 4WFHA 3DFFA 4TVSA 3G6KA 4P34A 5AJVB 4J7JA 1XA0A 4AY5A 3WJ1A 5EPUA 1RYDA 1H2YA 2W90A 5J58A 3HP1A 3B6EA 5BRAA 3ADPA 2V7BA 5ALHA 3V4LA 2BH2A 2OAEA 1P4AA 2DWPA 3QUBA 1U0EA 4PYRA 3G8YA 2VBGA 1E3IA 2FKAA 3DM9B 2IEYA 4FHCA 5B1AB 4G5QA 1KHTA 3ZI4A 3WV4A 4QM6A 3R75A 1DRVA 1T0JB 3EXFB 1JYSA 5AG2A 3RBZA 1OWOA 1UBGA 4GSLA 4IVPA 5I8PA 5I7OA 3ZHRA 1ONBA 4Q4HB 5J2TB 1Q12A 2CMHA 4UXJA 4YRFA 1Y5RA 2WIFA 4G4JA 4UBNA 5HIMA 1MIOB 3EGCA 3ESRA 3FKSA 3VR4A 3W4JA 1ORVA 1QDEA 4NFYA 2IODA 2KLHA 4OPMA 3ZWKA 3QUSA 1XN4A 5KSPA 4NTWA 5DTIA 4CNQA 3KQKA 5CA1A 2ZAIA 1UFVA 4I6GA 1N1DA 1EFRG 1NTMH 1B93A 3PD1A 4GPEA 2IFTA 2JAWA 2XDAA 2QAIA 3L1KA 1QK4A 4DSAA 1F1JA 4R8CA 1LPPA 1U2SA 5H16A 4C7XA 5HSGA 1QOQB 1WAZA 2DUMA 4AQYB 2FSHA 3T06B 1G5HA 2Y99A 4BFLA 4HZIA 3BABA 1T1EA 2OIGA 2PA0A 2QSJA 4H3KB 3FHTA 3SIVA 1CY7A 1Z2DA 4GNKA 4L78A 1AV6A 2FQYA 2ZKOA 1A8QA 2ZRFA 4R1OA 1TW3A 2LDBA 3FNFA 3TCXB 4D3DA 1WB4A 2PSHA 3ND8A 3Q5EA 4U2EA 4U6QA 5TJ9A 1TM7E 5A6SA 2IKSA 3EZLA 1SVSA 3VNQA 1U2GC 2EIMB 1UBCA 1UZMA 1KYXA 3JD2A 2IL1A 1ZCAA 5DASA 3WLEA 4F8EA 2IYSA 2ZNJA 2MMCA 4IY1A 4PGMA 4EGSA 1I9GA 5CDYA 1AF4A 5KTPA 2C61A 3R0PA 4G26A 4C7KA 3ZWXA 2NSJA 4R9SA 1E69A 2PLRA 4PG4A 3N86A 1OCCB 3W6ZA 4EUNA 3ABRB 1KHHA 3G71V 1L7OA 1NOKA 2YHIA 3FF1A 1DO0A 1I94O 3GQBB 3KNZA 2REQA 3PQ6A 4FKZA 3TB6A 4UM9B 1O3YA 5BQFA 2YZGA 4B6SA 2ZIAA 2H8KA 3RAPR 4AJNA 3GHYA 3R6LA 4E5YA 4RPLA 3S2FA 4MVZA 1CB7A 3EZ2A 3B1VA 4UEJA 3BD8A 3SZOA 3QU2A 3GVIA 4MHTA 1QFJA 1PXWA 4YJ3B 1C80A 3L7KA 1DJNA 2F8TA 3SSOA 1P6UA 4OL0A 3R7FA 2ZRBA 2WWTA 4QJ4A 1QTIA 3ISTA 3RIXA 3MTAA 2NU9B 1RYBA 3VSBA 1XC7A 3QWBA 1JHDA 5H7XA 1GPAA 4M36A 5AW9A 3TRKA 3UEOA 4IDBA 2D2IA 1TJNA 1VQ4V 3K5NA 2CL7X 1KDTA 2QTCA 4LF8B 3L84A 4YONB 3I42A 4LKOA 4P1ZA 1MDFA 3MINA 2XAAA 4AN4A 3U3DA 2VIIA 4BX3A 3PZRA 3WP0A 2NMUA 4A0HA 1YJNV 4U7HA 2QA4V 1RMQA 1L4HA 1RWXA 3LPLA 3A6PC 4KP4A 1H2LA 1E7WA 5LLDA 1GVHA 1UWKA 2IJHA 1UP6A 5EZQA 3CX5F 5KAIZ 2A57A 4TLLB 2C0QA 2X7RB 4AC9A 5KO2A 1TYCA 4H1TA 2P9FA 1J97A 4TQ9A 3ZD6A 4G81A 4JOQA 3F0GA 4MQ5A 4DPKA 2JD1A 2VOEA 2BP7B 5CT4A 1W4CA 5DK4A 3NG1A 5LP6F 1G0NA 1FB5A 1B0ZA 4HI0E 3NHFA 2RD2A 3OIVA 2O5EA 4CH6A 3PF9A 3R5FA 4YAOA 4YY3B 2G9ZA 3DD1A 2ZROA 4DEYA 5A9SB 5DEIA 2CBZA 2QXYA 1IDSA 1E7YA 4TN1A 4XTCS 4V0MA 4YAJA 5HMLA 5K3DA 5LQUA 3H9EO 2GRAA 1XILA 1MKYA 5CYOA 1MW9X 5DT9A 3ANYB 3BJEA 1SUIA 3WWPA 1H85A 1LJ8A 1JQEA 4QYIB 1X25A 3IAM6 5K6AA 4RF2A 2O8EA 1VZ2A 2I33A 2QVLA 1P29A 1JKJA 1N36O 3HA3A 5GPBA 4FNGA 4UFOA 2ZDIA 4L6IA 5E9QA 4DANA 5C35A 3DZBA 4W5TA 2WF5A 3PG5A 1I3LA 3BDVA 4YAFA 2OL4A 4C21A 2EZTA 2P2LA 4E70A 1OBFO 1I36A 2Z3ZA 2NYAA 3VHQA 3OEED 4IXTA 4O4LB 3H1IH 1GILA 4EY8A 3QYAA 5EWLA 1TXGA 1FVXA 2JFQA 2R96A 4OJQA 4RZ3A 3ZCPA 1VQMV 4QGSA 1TMKA 3GLKA 3P5SA 4RFSB 2UYHA 3A2NA 1OH5A 1LWNA 3PJGA 5HM8A 4WFBV 2FPOA 1EFUA 1JA8A 3K3WA 5AVMA 4TXHA 4JX8A 2UVPB 3LW7A 4L5JA 4TKUA 3UA3A 4PZUA 3B6IA 1NLMA 4B6FA 4JB3A 1ZESA 4X6YA 3TW4A 1T91A 3KJHA 3QWIA 1JKMA 4QA9A 1POWA 2AFVA 5AKKA 3WWOA 5K7SA 4JJ8A 1VKJA 5FLXA 6YASA 5KOJB 4FUTA 1R16A 1S8OA 3KCQA 4MPRA 4UVHA 3R9XA 1H0KA 3WJPA 2R4UA 5IAOA 2GF2A 4IDAA 5HFMA 2Z5GA 3SI7A 1KO4A 1TQHA 1JQ5A 4H1HA 3GZTB 4II2A 1XZAA 3NS7A 3QITA 4GP7A 3WB0A 1FFXA 2BUBA 1E1QG 4YIOA 2HCFA 2HU7A 2PJUA 4NP6A 4NOJA 1L3IA 1X6VA 2EF1A 3STVA 2H06A 4UM9D 1R3IC 3Q8XB 4PDVA 3ICPA 1DXHA 1X7YA 1IXKA 3KS9A 5YASA 4NBUA 2R7KA 4DHEA 1A1VA 2C3MA 1FUYB 4PR0A 3IPAA 4HAUA 1I0LA 2XDYA 3HSSA 3A25A 4FFNA 1Z0SA 2FOXA 2D0DA 1YMUA 3NYQA 3FHLA 4JA2A 3I9FA 1BRTA 1ZNYA 3FD8A 4PQFA 1XTIA 4JP8A 3IKEA 2J4DA 4Q15A 4U02A 3REQA 3UA4A 2KBEA 4B6JA 5FKJA 1KWGA 2OZVA 1O54A 4C1NA 4UVAA 5FBRB 5FUXA 5IZCC 2W2OA 3P9IA 3VJLA 4GBJA 4D97A 3B6MA 1YR7A 3FR8A 3G49A 1WXWA 3GJ6A 3OKCA 4OAOA 4X61A 4DT1A 1R15A 2QAJA 4W1RA 3ZCUA 1XVAA 5IMSA 5FI0B 2IM9A 3K1ZA 4JASA 2ZBGA 4YVFA 1KDYA 4HFJA 4ZEMA 4R3UC 5T7BA 2HYDA 5EWJB 1ZFNA 4Y2VA 2EARA 1N0WA 5KNDA 1W2BF 4IIJF 4S35A 4XR9A 3WGIA 4GLOA 4BS9A 3FD6A 1YK1A 1QTRA 1TEVA 3HBNA 1VQOV 5AIBA 3Q9SA 1AV7A 1X7PA 5B58T 3ZPXA 3F6CA 4L8FA 1B7GO 2IHVA 4CDMA 2ISQA 4ZRMA 2B1IA 2ZNIA 3AQIA 3DTVB 3FRHA 1BN6A 3IUSA 3NV7A 4JH0A 3KFLA 4F91B 4QDZA 2PF4E 3CW8X 3VYSB 1M7BA 1LSUA 2GFHA 5B7PA 5JVDB 5DHSA 3BA8A 4J41A 4IHKA 4Y2QA 1GL7A 5EIAA 5J1TB 4FI3C 2DBZA 3IP9A 4F6RA 3QP9A 3UUEA 2D54A 3ZUPA 1ND5A 5KHGA 1VJ5A 1F23A 2FPGA 4YROA 5F9FA 1R5JA 5HTKA 1JA1A 3CZRA 3RD5A 4KNYA 5FWXB 2AYYA 1PD1A 4KOEC 2CE7A 3WZ2A 3I9OA 4G65A 3MSCA 2QA5A 3PR2B 1GYPA 3UO2A 5H82A 2NQTA 1RU3A 4WDQA 1BOFA 4MLDA 1Y33E 1ZK2A 2ORYA 4Q66C 5ESRA 2ZUUA 4FGJA 4GC5A 1TC2A 4ZHYB 1XVIA 3D2CA 3N2KA 3C70A 4F84A 3MCWA 4C07A 3OZSA 2HU8A 4QYTA 3P2OA 1YEWA 3PEWA 2A8YA 2JJQA 4C4AA 5GIOC 3PL5A 1GRNA 3SNHA 1BXGA 1VYTA 4OQ4A 1XMVA 1CQJB 1RC8A 1H0SA 4TV8F 1W40A 4TT3A 5CBHA 2HRBA 5CA3A 4LWPA 4NBNA 1L3CA 1X1AA 1VPLA 3VO9A 5D1NA 3PHGA 4LDQA 2G3YA 4YT8A 2P91A 3UPDA 3CT4A 3K0BA 3NBAA 5I6DA 1SHUX 3E18A 1ECPA 4LDNA 1KI8A 4R0NA 5ICMA 3GLSA 3E1KA 3FYIB 1C4WA 2HRCA 2X13A 2L26A 3FI0A 3MPOA 5BPFA 1XF9A 1N34B 1FJGB 1J07A 1E6MA 2ZB3A 5FQOA 3WYCA 3VO8A 4EB6B 1SUEA 5ILQA 1CY0A 2R2GA 3UC9A 4EHBA 1QIDA 1O08A 5B5SA 1L5MA 3D6TB 3GL9A 5KNBD 5TR9A 1L7VC 4D81A 3OECA 4LFBO 3NEAA 4PIPA 3QEMB 4N48A 4PA7A 2JJ2D 1UQTA 4DRXB 3H0CA 4LN1A 4R1NA 4AMZA 5JHHB 5L3QB 3PX7A 4HBZA 4Z4EA 3AOEA 3V9PA 3CUWA 1NVGA 3R3VA 3FWPA 3DEZA 4I5EA 4OA5A 2QLLA 3KYJB 1TAGA 2YXBA 1KYZA 1W55A 1E1NA 4HRAA 4Q3EA 1VQ6F 4QREA 4TX1A 4X8HA 3PPIA 3CX6A 4M8SA 2W2VA 3I64A 1KORA 2AFHA 1Y80A 3K8ZA 4LWOA 5ECGC 4ZMRA 5JNLA 4PZYA 3I0MA 3OOHA 2X9GA 4G97A 5IEJA 5FUWA 2WJ6A 1RHUA 2W37A 2XNCA 1U1DA 1ZMRA 2BM1A 1M3SA 5ULLA 1MNQA 3RGGA 2D0OB 3HLTA 3EXG2 4IFIA 3AGKA 1I10A 3WK6A 1LFAA 3CPWF 2RHCA 3TZCA 3ANSA 3EF0A 3VR2D 3D5EA 2ZPAA 5C8VA 1IY9A 5BVHB 3ROQA 4GQBA 3RYIB 4XCQA 2Q9LA 2Z04A 2P6OA 3C3WA 3P10A 4RIGA 1G18A 4NMHA 1WBDA 3U4MA 3GJ7A 3JTMA 4RVFA 4YLEA 1JPUA 5FDFA 5JI3E 2EL9A 4ZVQA 2EDCA 4C08A 5C5DA 5IF3A 1XHEA 2OP1A 4CL8A 3WL8A 4CM9A 2M1XA 3D7KA 3V4OA 3WE7A 3LKZA 1MPTA 1P2TA 3HPQA 3R7NA 1NX6A 3LJKA 1JG6A 2XMSA 3EASA 3KZ1E 2OAP1 5CXXA 5KOHB 2OORC 4NSNA 4JYAO 1GQ2A 4DLNA 2QD1A 3BMNA 2VHTA 3ZQJA 1RWQA 3AR7A 3EY4A 1ILWA 3NAZA 2FL4A 4OQZA 5E4FA 5EJIA 2WWHA 2HPAA 5KSWB 3GLVA 3SQDA 4GIBA 1X2BA 2Y1DA 1VJ0A 1IIRA 1BVYF 3KJZA 4OK5A 1HE2A 3ABLB 4X41A 2H6EA 2VDWA 2OT5A 1L1FA 1DDGA 1E4EA 4PFSA 3VTKA 2QE7A 1S2GA 1GGHA 3DLPX 3F7MA 4ARZA 3ZN1A 3LUFA 4BWYA 2E5WA 2AJCA 5FJIA 1IZZA 3GLFA 1D8TA 2MINA 5KYUA 3DO6A 2C5SA 2J9FA 2YHBA 3CA8A 3EIQA 1YNSA 2BBTA 4P98A 1D2CA 2P06A 1HYGA 3ASZA 2FAXA 1N7GA 4JJKA 3R74A 3ZCQA 1TZBA 4KODA 1GEGA 1H93A 3T1NA 3USCS 1QGUA 2ZAOA 4AYWA 4F96A 5JTTA 5EJ8A 2FSVC 1SBQA 2ZR0A 5T8KC 5F98A 2ACKA 3GH1A 2FZ4A 1CYEA 4JI4B 3ZCSA 3WK9A 4ARZB 5KC8A 3FB6C 1QRTA 4YR7A 4DV4O 3KHSA 2JB9A 5FA8A 2I87A 1OE0A 1QCYA 1VKHA 3PJEA 3RSHA 2JATA 4NBTA 2FC3A 3TQIA 4AK9A 3HKCB 2NM0A 4UCQA 3V7QA 1H8HD 3B78A 1DJOA 4S1VA 3VVBA 4DCMA 4FDUA 4JI0B 3CCEF 1P3DA 2JF0A 2NAPA 2Y27A 4ENTA 1KMHB 1PJCA 2VTVA 3E22A 1JLLB 2PU7A 2DYYA 4FK8A 1NYRA 3ZZTA 5JPDA 3KETA 3OHMA 2GM5A 1JG3A 1YZHA 4IQ4A 4JT4A 5LP6A 2OFOA 3SSAA 1ZLZA 5LU8A 5IYZF 4FBMA 3JQDA 3AG2C 2P1ZA 5DOZA 3DXFA 4ERXA 2FQ1A 4M21A 3TB4A 5BWOA 3GYQA 5I7EA 5JSFA 5HE9A 1A5ZA 4URHA 4F92B 4RA9A 3KAJA 4JBNA 3CX8A 4MRNA 5CK4A 1IL0A 2JFOA 2NOAA 4F12A 4OQFA 4UUOA 1CQIA 2B82A 4M0MA 4UCFA 1EU1A 5AM0A 3BCHA 1XPRA 5HUJA 1D2RA 1K08A 2B20A 3QQPA 1XUOA 2PS1A 1W94A 1HDZA 3FPIA 5FJ4C 3DR3A 4R31A 2VWGA 2JHPA 4C06A 1L4FA 2WLLB 1AKQA 2BFDA 2EJWA 2WKPA 4LPKA 1KVQA 3NHUA 3OJ0A 5G0TA 1Y81A 2R6GA 2N0SA 2QRMA 3JVVA 4LYEA 4ZYYA 4A10A 5I8WA 4WZZA 4XWGA 1BKYA 4K88A 2WSBA 2X0JA 3HTXA 2NSYA 4IUYA 3V1NA 1XCOA 4WIAA 4YI5A 2W6ZA 5AKJA 2NO4A 4QGPA 3BGIA 1CPYA 4KHPO 3HXLA 3RTCA 4E7PA 3HY3A 1SFRA 2PRSA 1X59A 2XCRB 3K70B 1ZJ5A 2PPVA 2IU6A 2ZD9A 1Q1AA 2J67A 1N5RA 2R11A 1XD8A 2PR2A 3IVXA 4HPWA 3HY4A 4J1QA 4EARA 3DWEX 4L8WB 4FJ1A 3NWEA 1U81A 1V7PC 5AKYA 2G83A 3DHEA 1RLTA 4S1OA 3O65A 3USES 3VRHA 3RODA 2QWQB 1R74A 1YHNA 2FWAA 2YYAA 1Z06A 3N2IA 2LFRA 1TCUA 2IY7A 3GY0A 4YHHO 1T10A 3B82A 4PPNA 2I6QA 1ESEA 1U0JA 2CUGA 4PZCA 3VU9A 4B7ZA 4E51A 4TLEA 3WLHA 5CLJA 3OGCC 4E33A 4ZHWA 4YCNA 1MQ8B 3P2IA 4A8HA 4IZIA 4O08A 4UPEA 3A4LA 3PVCA 4P81A 4RSMA 2P2CA 4RHTA 5FFNA 3W3AH 3P3NA 1SGWA 1JFFB 2O8FA 1NMYA 1KPHA 2C2XA 3DUWA 3EORA 2Q1WA 3ZH9B 2WE7A 2J0UB 3U4DA 4PZDA 2V9YA 3O4FA 4WAUA 4RAIA 3NWPA 4ZOEA 4WL0A 2WMDA 1HEIA 2QLBA 2HEGA 2X6QA 3MS4A 3IKFA 4Y2XA 3RO7A 3MCUA 2NZVG 3IUYA 1OUMA 2KKWA 4HL6A 3TNLA 4WCVA 3RF7A 1W0KG 3KYCA 2IP4A 4CR6A 2VXBA 2AMYA 4EM6A 1ISRA 4NCNA 1VPWA 2D8AA 4JI5O 4B3IA 1D0IA 3NUQA 4QRHA 3I1YA 3I4LA 2RC6A 2R6AA 3GCDA 4DNFA 3L4BA 2HLNA 1MA3A 4YJHA 4DLXA 1DKLA 4ZI3A 4HDSA 4FOSA 4FM0A 4MWZA 4BWAA 3RVSA 4G4SO 4MSUA 4W9RA 3WKEA 1KNKA 1PV0A 2LGJA 3ZY2A 1PFVA 2ERCA 1OAOC 1C7IA 2ZJFA 3T1QA 2DULA 4F5WA 1VG1A 4DCNA 4R16A 3OZVA 5JCJA 4JBIA 1MG5A 2FTKE 1XROA 1P39A 3OHPA 3FCAA 4L3WA 5TPWB 1G6OA 1YS7A 3HUFA 4BFZA 2FMFA 3C41J 2E21A 1HE3A 4YYZA 1YJAA 5FB3A 3KQHA 2XUZA 5THQA 4LBYA 1DTWA 1LI5A 5FBWB 2O3UA 2YWXA 2PZEA 2XQJA 2GXUA 2VTDA 3VPBA 5BUZA 4JHXA 2ADOA 3ZNNA 4J2HA 2ECPA 5B3AA 2MW2B 2JGDB 1I3OA 1CLUA 3CEHA 1IZYA 2C83A 1GPDG 1AUPA 2ZAUA 1KFEB 4BP8A 1VMAA 3DOCA 3HY6A 2CCGA 2FH5B 3RFFA 3I1JA 2ZUTA 2QJ1A 2XAHA 3VJMA 5CHEA 3VI6A 1DUVG 3G0DA 3JAMM 3GGCA 5AM4A 3TQSA 4M1YA 4UFNA 3OU6A 3UT0A 3RA5A 1HT0A 3FOWA 3VX3A 4PFKA 3L0BA 3BX1A 1E1CA 1ZCFA 4FYHA 3JWJA 1JRLA 3GRPA 3VM6A 1Q0HA 4QYSA 3TXYA 2ANCA 4EFDA 4MUHA 1PR2A 5EWRA 3DP9A 5DGHA 5THKA 4N76A 2DFNA 4GMDA 5EZYF 4JUCA 4COKA 2IXBA 3AHFA 1EWYA 3O8QB 1LF5A 1IHYA 1E9VA 1JPJA 2JBAA 3E48A 1JL3A 4XB2A 2XE4A 3I28A 4C0AC 1W88A 4RKYA 1ZKMA 4U6SA 2QNIA 3RYIA 4B9EA 1SKVA 1S1CA 3PLAE 3Q5DA 1LK5A 4IMPA 1LZLA 1QTNA 2D3TA 2OZLA 3ADKA 2JA1A 3GHHA 2PYDA 2QUIA 3MIZA 1YJWF 1AXRA 5T4FA 5E3HA 3CJHB 4OHXA 5LNK6 1F1BA 4WY2A 5KDLA 1O4VA 4F71A 3VOBA 1KYIA 2WLNA 2F3QA 1TM1E 5DCUA 4LF6O 1IM8A 1PEAA 1VE9A 5DB4A 1VPTA 4EW3A 1XPUA 3B20A 1J2UA 2YDEA 3UAWA 2BZSA 1RXYA 2WKRA 1V8PA 2XV1A 3FSJX 3IRVA 3TX2A 1K2VN 1O96A 3UMBA 3E5HA 1V11A 3BMNB 4NMXB 3DTUB 4RU1A 5JXHA 3H05A 4BIZA 4TYWA 3F6MA 4JVSB 1L7EA 2FSUA 3SPIA 3HLYA 3JQEA 3CCBA 3MHPA 4DNXA 4F4HA 1QPZA 3QIAA 1QHHA 5LQKA 1Z6QA 1JY8A 2B1GA 3BXOA 2GX6A 3K1JA 2VBIA 4TMWA 2R0QC 1SHLA 1XTRA 1R4MA 3LT4A 5DN6G 1OLSB 2HMYB 3CZAA 5EXDA 3PTZA 1M1YE 1SVNA 1Y3HA 4LGMA 1KAOA 2P1RA 4EFKA 3E8GA 1J2EA 3ZCRA 3IMCA 4P5PA 1MC5A 4KMMA 1CB0A 3CMAV 1GV0A 3I72A 1XNRB 4OF4A 4TYMA 3WNQA 2AJBA 3ADBA 3CRNA 4MP6A 3ASYA 2IX3A 4WN9A 3JAKA 1UBLS 3A9CA 3O1JC 4MWBA 5JD4A 2ONZA 4JN6B 2Q0HA 1UBJS 2J3DA 3EGIA 1AHPA 2R65A 3LHKA 2YVUA 4N3AA 4GX0A 5CVUA 4BTEA 2IUFA 2X0LA 1QV9A 4GVXA 3SIWA 4OU4A 4V2UA 3TSAA 4OPAA 1HDXA 5CIWA 4N0PA 3AHDA 3SE0A 2R8BA 5JATA 2O8DA 3D1JA 5BN4A 4ZU6X 2Q69A 4D3ZA 5T4HA 4YAUA 2GJ8A 3UM9A 1C3OA 1K73H 2H2AA 4YXWG 3EZFA 1WSDA 5LPNA 2HGSA 1NDHA 2Q5JA 4TVKA 2QTAA 4OAQA 1KU9A 1F2UB 2CXPA 2JIPA 3HU3A 2EFEB 3WBBA 4X92A 4X60A 3WRWA 3IAYA 3UFXB 4W5OA 1PUIA 2AI3A 5FPRA 2BKVA 2C5HA 5E38A 5HA5A 5TGTA 5MGBA 1DAPA 4AXBA 3HO6A 5DDIP 2Y77A 3G9ZA 3NP7A 4M0UA 4QYMA 1VRVA 3QFRA 4I50A 1FSSA 5ALLA 4KRGA 4L28A 3SCZA 1U8AA 4B3XA 3TZ6A 2W5UA 1H38A 4LF5B 2BPOA 4NCJA 5CCDA 1KJNA 2PS0A 2ZQYA 1W9MA 3CF2A 2H6LA 1YH3A 1YCHA 3G0CA 2Q7DA 3TIGA 4B6RA 3R6WA 1FRFS 1H3EA 1XCJA 1A5SB 4PLVA 4O4HA 4AN1A 2JJ1A 1TVKB 3BE8A 5DHFA 4NX2A 1OFTA 1ZUNB 5AK5A 3W5HA 2QVZX 1WMFA 3U09A 1WV0A 4L75A 4CLXA 5K0CA 4ZJUA 4WBNA 1NQ3A 1JIQA 1JLRA 4XYLA 3QBEA 1QNLA 4BEJA 1ORQC 1Y9AA 3HL0A 2W71A 4MMYB 2F17A 3PDJA 1AKVA 4HPJB 3WHKA 5HM6A 2OOKA 3LSTA 1BA2A 1S2DA 4IHAA 4YRDA 4YX9A 4KO3S 4OKNA 3B1ZA 3ZQKA 3CUUA 4IIJB 4KH0A 4KRYA 4MSWC 1ZU4A 2QROA 4WZAE 2B35A 5I8ZA 1W19A 1XL6A 2MQEA 1Z8DA 2PGDA 2ZM5A 1EUCA 4LJLA 1VE1A 4N7BA 5LL6P 3AF1A 2YVKA 4FWTA 5KNBH 1JQ3A 4MQUA 4IYJA 3N28A 1BGVA 4Q93A 1T9CA 1YRYE 2NXJA 1ORRA 3Q9LA 3TZLA 2BJHA 3VC1A 1Y8QB 3IBTA 1R7RA 1YBMA 5K0LA 4BCCA 5JVDF 2VYNA 3A14A 4JBXA 2BSQA 1SVUA 4CM8B 3CCFA 2A7XA 2G82A 2FEPA 2IJGX 5DP1A 1MO2A 3V1UA 5HX7A 1MOFA 3A04A 1EE9A 5KYWA 5JASA 3ZTTA 1H1LA 1VKRA 3HN7A 3OHSX 4G89A 4CKBA 4LJYA 1VQ5V 4I9UA 2XMZA 1NKTA 3PKJA 3FXAA 5HOQA 3T0GA 1JEDA 1JECA 4AKTA 3PC3A 4BMVA 4DQXA 2QRLA 4UTZA 1GPUA 1BCSB 1MHPA 1U9JA 4ND7A 4KR3A 3WXBA 1Y74B 4DDTA 1VP7A 3T3EA 4ZYVA 2GHRA 2FW0A 2SECE 3TPFA 2GZSA 4A6PA 4CHTA 5IM5A 3NDRA 1NRXA 4LYAA 4TVBA 4Y0VA 3LPNA 2ODBA 1IUKA 5DU2A 1M2VA 3IEUA 5KEIA 3ZK8A 3OCUA 1P84F 1BHQ1 2CUTA 5K4AA 4HNAB 1S2LA 4MDYA 2DM6A 1Z56C 1AGNA 3AHJA 2PWYA 1HLDA 3PRYA 4UU0A 1SXJB 2E5LO 4FQ7A 1IXRC 4JD5A 3R40A 3AUFA 4CMJA 1USWA 2ZTVA 4TMVA 3CYFA 2EFCB 4UU8A 4F9EA 4OX9Y 1P0IA 1IEQA 1RDFA 2WT9A 2ZYUX 4TV8A 3IT0A 4KUMA 4G56A 1NPYA 4IDNA 1C9YA 4MHOA 4XLTA 2W4IA 1ZJ4A 3EMKA 2V55B 4XUGB 1YFZA 2DTEA 3Q3EA 4YAIA 3S1SA 1MZVA 2KSQA 4F8JA 1C30A 5T57A 1N3BA 2C92A 3VSDA 3R76A 2W0XA 1QIGA 3Q3VA 3Q0TA 4FMBB 5IYCO 2LCQA 3TSZA 1IURA 4LHEA 3QXXA 2GWHA 3C48A 4HLCA 1G2QA 4NR1A 3RAEC 2W11A 1CTQA 3TETA 1C7RA 1E9FA 4AD8A 2UVDA 3C97A 2YVQA 1HLGA 3M83A 1QIJA 2JDID 4RM3A 3F2VA 2YZNA 4FYMA 3W9BA 1SELA 1ZXLA 3DDNA 2XWBF 3OEEA 5E0KB 2HH9A 2P2NA 3QTCA 2UKDA 5FR2A 3ZEAA 1QGDA 2ZJAA 3NTUA 2X6CA 4TRJA 3TNDA 2WALA 2IYPA 2NSDA 1HORA 4H77A 2DHCA 3JZFA 4FHEA 1ZC3A 3VUFA 4ALNA 4JNKA 4LYDA 2BFDB 3CMMA 2YFHA 3N53A 4MO9A 4YBZA 3ZQ6A 2FWJA 1U7TA 1NWHA 3P9SA 5CNIA 3AI3A 3K05A 4YH1A 5D5PA 3ZQUA 3GLFE 1B76A 2AE2A 5TT0A 1BXRB 1UC9A 3MWGA 4IILA 3AM5A 4ZQEA 2RGXA 5JALA 3VVLA 1JKXA 4ZVPA 1HTTA 2UZ1A 2P4QA 4JVOA 3UB3A 2C4MA 3HM9A 2GLZA 1TMGE 4R6XA 4RA9B 1ONIA 2NIPA 1OTHA 1GTL1 2IXTA 3IBFA 1VLVA 2DUWA 2JGMA 3QFHA 4JS0A 3U81A 5KWSA 3KAPA 1ZW6A 3P4UA 4DQVA 4URXR 1SBIA 2FUNB 1XA3A 4PLCA 5LOVF 2PKRA 5A9SA 5ARBA 4Y2TA 3LUBA 5KPDA 4ENVA 1H22A 3FGNA 4C03A 2IV2X 2J3IA 2BDTA 3UYKA 4ESHA 3MJFA 3LXUX 2IYUA 5EBWC 3QX7A 1JQLB 2CNOA 3D59A 2NUTB 3RKUA 2PL3A 1RZVA 3KKQA 5C7OO 3RKSA 4P31A 1FDSA 1UBKS 1Y5LA 3Q7TA 4IJ5A 2OQ2A 4W7SA 1VJCA 3CMCO 1G7SA 4KITB 3N76A 4YJDA 5B3SC 1YS6A 2H11A 2VF8A 2Z3YA 1OWLA 2R68A 3A1FA 4F5YA 3A6ZA 2J3EA 2C3YA 4OUDA 4ZU1X 4BTLA 5CFPA 1HC7A 2D7JA 4YUZA 4MS4B 3T9DA 3W5AA 4QXMA 1SKUA 2G70A 4FBGA 3R41A 4KBFA 3TQRA 1D03A 2QX8A 5DZSA 4BNDB 5IFLA 4HRYA 2HXYA 2Z09A 2A3QA 4KU4A 1KEEA 1OV6A 1HOXA 2ETVA 3F7NA 3QF4A 1EFHA 4X9QA 3M6WA 3WG9A 4B73A 2AF4C 4D9GA 3SHFA 4EVIA 5KHOC 5HBRA 3BG5A 3W2IA 1PFKA 5MHTA 1J0BA 3SF8A 3ZE8A 3CCMF 4HYYA 1CS0B 2O2GA 2SHKA 2WHYA 1KP9A 1EUCB 2R87A 5B7GA 1VQNV 1HI9A 1CUJA 1VF5B 4PDLA 1UIMA 1FSZA 3KDSE 1LI4A 5ES3A 3TW8B 3ZG6A 1A71A 2GK4A 1V6SA 4MTFA 4OHYA 2XCOA 2A1IA 3LZDA 4MRAA 1GNQA 3FNRA 2OVFA 3WYBA 1M56B 3PKZA 4I1SA 4TUYA 1S2NA 2IELA 4XW2A 3B8EA 1JWAB 4QODA 3P8ZA 2AL7A 5IK2A 4J0JA 3ZXUB 2GBPA 3O74A 4DR1O 5K0GA 3KZMA 1L5SA 2YHIB 3D31A 1PQYA 2FU5C 1TMYA 2CDRA 1US6A 3D9QX 5A02A 2ZJ3A 5BR1A 2E5FA 4N8SA 5AQ1A 3QEAZ 4U7GA 4A0SA 2EFHB 5J2TA 2I7VA 3KQYA 1G5RA 5H59A 4K6OA 2RQ6A 2ZXWC 2DLDA 2I6TA 3MTDA 1FNKA 3QWFA 4F2GA 4KR6A 4DV2B 2W6IG 3T1HO 2NT4A 1VL1A 3R0JA 4NZ9A 4Y6LA 3UBMA 4EYOA 4PO9A 5I4CA 3A2LA 5JH7F 3L5KA 3AESA 3WGMA 1OA1A 3FTPA 3ISVA 4U2CA 1LLCA 5EHNA 1SESA 2VP3A 3OOJA 4OV6B 4EUKA 4X8AA 3QHAA 2WLHA 2XCIA 4HO1X 4QDXA 4ZP1A 3N0TA 3H11A 4HS4A 4BO2A 4YAGA 1Z18A 4QICA 2H7CA 2JGAA 3LL7A 5DRTA 3R9IA 5FL7G 5ALSA 1DX9A 2P2SA 1K86A 1V5FA 1VSVA 1X74A 1XQYA 2PMBA 3KE9A 3R0IA 3UJHA 5CG1A 5KX5F 1S76D 1W52X 2J0VA 2WHPA 3RAFC 5SZIA 1BCRB 5HDBB 3D8BA 1XMXA 5L3QA 3K03A 1URFA 1RXVA 1PX2A 3B4SA 1X7XB 1M57C 5JT1A 3IRUA 4S04A 3K1YA 4N7MA 4RE5A 2WAYA 1GPLA 2R1TA 2KE5A 2PSJA 4AJIA 3IULA 3MF4A 5IAEA 4FFRA 2XXBA 2YRWA 1CBUA 1V5EA 1SOUA 4TL8A 1FMLA 4DCGA 4MWGA 5DLDA 4EZEA 3UHFA 5F3DA 2JVJA 1FYXA 2BM8A 2XXAB 3ORFA 4D1YA 1IDN1 5LP1A 2CHVA 4O1MA 1X14A 5JOQA 5FOSA 5G0SA 2CBXA 2OBNA 1JYFA 5CNJA 2FEXA 5LWHA 2G36A 2O6HA 3V7NA 3EVTA 1WUTA 3AG7A 5LZ9A 2PSFA 2PAAA 2Q8PA 3EQ7A 1N2XA 3L8MA 2P5OA 4C2AA 3CUKA 4WBNF 1SETA 4QU8A 1U4NA 3P9RA 3N8HA 4PBRA 3OJCA 4WD3A 5U4QA 3T0IA 5K0FA 1CF2O 3UM7A 1FIUA 1JG7A 4LYHA 4ZPJA 4ERNA 2ONCA 3JRWA 4UQOA 3KIZA 1SVOA 4BPRA 2JCSA 2IHNA 1QORA 2ZZMA 4UPDA 1L7BA 2B0CA 5LDGA 4BVEA 4WKGA 3STTA 5T41A 4Y2HA 1NW7A 3EC2A 2FUG6 2JGJA 4W8GA 3TZKA 3GFVA 1MX3A 3RWBA 1D2AA 3R44A 3H19A 5CJJA 5AD1A 1N6KA 1GDTA 4FN4A 1KB9F 3V1TC 3ZV7A 3JQ7A 5HYVA 1DQZA 1M5RA 3G0HA 4KN5A 3NRCA 4PHCA 4FFMA 5JVDA 3B1YA 4EI7A 3SU8A 1RQGA 3K5MA 4B2PA 3O75A 2PT9A 2F23A 2ZWAA 3M89A 4UCOA 4NARA 3TR6A 4UV8A 3RFCA 1XEXA 4JJEA 2RHBA 4XQGA 4G23A 3WK5A 1YFLA 3QHPA 4ICGA 4GOLD 2R9IA 4BR6A 3I76A 2GN2A 1BVRA 2EP7A 2OD9A 2EKQA 3IP8A 4L74A 5AUOB 4N9QA 5J2UA 1BHO1 3GPIA 2ALJA 1GTMA 3QEJA 4LSZA 2W2LA 4W5WA 1SN7A 1KXJA 5KHIA 2PEZA 2PL1A 1AUOA 4XDGA 4KQFA 1Q7YH 2GNAA 1DJLA 5E7QA 5CDHA 4G1EB 1UBMS 5ALEA 5BYKA 4K0KB 3CWQA 3UAXA 3HHEA 5JV5A 3RQSA 2Z6QA 3ILXA 3EPHA 2V3CC 4DV0O 2Q8NA 3AP3A 3SDLA 3BJIC 1DKRA 1RM1B 5ALJA 1PNVA 1T4CA 4XFJA 1DX4A 4ZI5A 2XY4A 3PWZA 4KPUB 3SXUA 3UIEA 4K03A 3Q88A 1I6KA 4E22A 2W2QA 3I5DA 1CXZB 4XGQA 4YRRA 1MQSA 5EPOA 1AILA 2FR8A 1Z08A 1CW2B 2JGIA 1QKIA 4B4VA 3I1FA 3STWA 4C82A 2Q8QA 2FQQA 4DVGA 4FIPC 4XFDA 4D5GA 2O7NA 5TPZA 1DQSA 2G07A 3WNCA 3BMOB 3ZWNA 1Q1QA 5EG5A 4BJHB 4ZK6A 3ICVA 4G07A 2OKGA 1JE0A 3GA7A 3FAVB 3LXMA 3T35A 4L8VA 3VV2A 3D36C 3KAKA 1GN9A 4DE5A 4XGNA 1H2MA 3TD4A 1KZ4A 4OJYA 4XPZA 3O7MA 5KYYB 3S70A 4D82A 2DSNA 1VLJA 2JCXA 3LDUA 2DX7A 4LTDA 5TQ0B 3AZOA 2D5CA 4P3PA 2VSYA 3B6KA 3SIUA 3BILA 4PD4F 4ZCLA 2AMTA 3R9XB 1KO7A 2ZRGA 4MZDA 4QUHA 3QFFA 4ZTUB 3DTNA 4DB2A 2LW1A 1WJGA 4BKUA 2EX0A 4G1MB 5EP1A 3BAZA 1WCYA 1FF9A 4UNIA 2BMDA 3OCYA 2B2NA 4Z1OA 5HPYB 3RE1A 1ORIA 3KZOA 3T3MB 3AG3B 4ZI7B 3HR0A 1T1GA 1BJTA 4TWAA 1AI7A 1EFDN 3HNOA 4C0KA 3HDJA 3MA0A 1GZ4A 2WVJA 3LHSA 3N4ZA 2AX4A 1JQ0A 2PUJA 2X5NA 2FN7A 1SHTX 4MKFA 5IF9A 2V3WA 3O1HB 3QKSB 5I4BA 2UUBB 4Q9DA 2YTZA 1AMOA 1Z0DA 4LZLA 2QMEA 3TS1A 1BW9A 3DL7A 2A14A 1PJ2A 3W06A 2Y0IA 2ZSJA 4TZ0A 5DEDA 1TM4E 1ADYA 5IUKC 3SS9X 5B36A 1FDOA 2X22A 1AQ6A 4IF4A 4CTOA 1TQ8A 4IRUB 2YNMD 3P19A 2IEZA 3LLCA 4QJFB 4ZHQA 5EB0A 1Z4IA 2WYWA 3HEAA 3PYMA 3H2KA 4P36A 2FCAA 3ZLVA 1NE2A 2QTVA 1W0JA 1IXYA 4J1NA 4NBSA 1PKEA 1ECJA 1L4KA 1ND6A 2FPMA 2XHZA 3DYBA 4GPIB 2C03A 3VMMA 1YRBA 1Y3AA 3B51X 3JVHA 5FOUA 5IJ0A 5CJPA 2G1UA 3UWSA 5A4AA 1SVMA 5B6PA 3STLC 4DR5O 3R5SA 4J0EA 4LXXA 4TT8A 4ML3A 5EIBC 1T6YA 1EAMA 1TYDE 2R6CA 5DXJA 5FAXA 4EF4A 5JEDA 2FE1A 2I3ZA 3ZCVA 2LBXA 4DIFA 1X0VA 2RCYA 5E9WA 1EJ0A 3S0WA 1NJ8A 3CPHA 1W47A 4NTZA 4AIIA 3KTFA 3HKDB 4XOIA 1WUJS 5AVOA 3NTXA 2QTTA 5HCIA 1YQDA 4JELA 1M8FA 1EQ2A 1Z5ZA 2W6JG 4KBGA 3CUSA 1EGQA 4EHHA 4M0KA 1EVZA 3GROA 4Z6KA 2J48A 2P9CA 2X40A 3CLVA 2ZS9A 5HY4A 3COZA 3UN1A 3ZZNA 3H2SA 3O2SB 4DQKA 2IH5A 2D7DA 1NU6A 1J2RA 5M29A 1GUZA 3AR4A 4UM5A 1Y1SA 2ON6A 2YV3A 3JZAA 2NQ8A 4BWGA 1ZVVA 3CO5A 3OC0A 4I50F 2ZE5A 1L5LA 1JCHA 1VLQA 3NR2A 4R9VA 1IHPA 1LI7A 2VF4X 2W6IA 3KKLA 3SDBA 2DOKA 1P5RA 3L1HA 3Q7SA 3SZGA 5DSTA 1M1KW 3TOVA 1ZPDA 3CNOA 4JT8A 4RHCA 3UGJA 2VPQA 4NMWA 1QGAA 1XRGA 1SHKA 2YXPX 3C6BA 1QE5A 2HHHB 3AY0A 2FKXA 3UT5B 3RJ9A 3OZTA 3AEYA 2GCNA 2P5TB 2Z43A 3KR2A 4GNRA 4YRGA 4RAOA 4RMNA 1T0IA 3H75A 1DI0A 3LQKA 5TQ2B 1EZVH 4KO2S 4B87A 4NUTA 4BO1A 3PQ7A 5ENDA 3LS2A 5EY5B 3JS5A 5JSHA 3O1IC 3L8DA 1R0SA 2XBUA 5JTUA 1H6DA 3U61B 5LDHA 2E6KA 1NKSA 3IR5A 3NEPX 4IIEA 3OSZA 2QE6A 3DMRA 1QYXA 5KYYA 1NIJA 1Y4MA 1KSHA 2PO5A 4XEUA 1ULBA 4YCDA 5JD3A 2ZTSA 3E9ZA 1ZH4A 1Y7IA 4B40A 2I1WA 2YQ5A 4IIGA 2C5FA 5CH3A 1GGEA 1Z0UA 2I4TA 2BLNA 2C5EA 4B7EA 3AF4A 3EXEB 3VTZA 4EJ6A 2D2EA 3BCRA 1JZSA 3C1AA 5DGIA 3WYNA 4ZYWA 1BKSB 4HDQB 4RHXA 1BHBA 2FMIA 5D3MB 3WJQA 2XKAA 3LFUA 4J4BA 1P7BA 4RKRA 4CCSA 1N2GA 4DMMA 1SK8A 1KRHA 2HMTA 2Q4TA 4O4IA 5CNKA 2QQGA 1IG0A 2CUNA 4F2PA 3SC4A 2CV0A 3M4SA 2BE7A 4B43A 4KR2A 1PFWA 2BR3A 4FOPA 4N7RA 4XGKA 4M9RA 2VS0A 4PIVA 1GLGA 3I01A 1EHIA 2H4XA 1A4RA 1TZKA 2E1RA 2VN8A 2UV8A 5FFFA 4DYHA 1M5TA 4NG4A 3TPZA 3I9V6 1JIJA 4KGZA 2OLEA 4B3FX 3B40A 5CPFA 3ZP7A 1DIAA 4CEHB 2V5AA 3BE4A 1KO1A 1P18A 1OKKA 1VQ8F 1X1SA 2WRZA 3FH0A 3L7LA 3G7SA 1HTBA 1WTAA 1IEVA 3R7SA 1AKMA 2WVGA 1A4XA 3QFCA 2A84A 3DJYA 3GXOA 3AL2A 3P0EA 2VC2B 1CUYA 4ZCQA 2OY0A 5EE0A 1X8XA 5HMMA 5IZCA 4OYHA 1U31A 4I14A 4KB5A 4M88A 2QYTA 3EVBA 4QUDA 2BGGA 3PBKA 3NBFA 3O8RA 1AKNA 2GN4A 4KNWA 4IT5A 3ZUGA 3CYOA 4G4SP 2PH5A 4RYLA 3UY4A 3ZMZA 2WJZB 2IOQA 3PNBA 5AI6A 5F33A 5KKAA 5HKKD 5SZKB 3JCMM 1FFWA 1R6AA 2E4XA 3E03A 4MEAA 4BO6A 4DUZO 4C6HA 2H2WA 3FPJA 1DP4A 1YD7A 4ITRC 1I32A 3OZEA 3MYYA 4KN9S 4LJAA 2HTFA 3L7MA 2TYSB 3T3DA 1M8KA 2B1JA 3TTWA 5CB4F 721PA 4P54A 4E5UA 1QAOA 1X7HA 2PGNA 2NZXA 3FOCA 3WAKA 3AY7A 4K0RA 3CMEF 4G5GA 1DQPA 3ZJVA 4MP3A 2X19A 3RK0A 4E31A 2J3MA 5C53B 4MKIA 4QGHA 5EZ5A 4W5NA 5LHGA 1I51A 4LVCA 4C76A 5CXSA 3ZWYA 4R9NA 5P21A 3VDQA 5C4MA 4AZ0B 3OOWA 3GLIA 2YS8A 5HY2A 4GGPA 1T3ZA 1KJ9A 2XH8A 3KPUA 4F72A 2PYIA 1W5EA 2IJJA 1USKA 1P0FA 2O2YA 2Z1MA 1Z25A 4MUEA 3HTNA 4BMCA 3A3OA 4DMCA 1P49A 2LKCA 1DDIA 1VSQA 4GKKO 2B4RO 2CY0A 2YIVX 3L04A 2IV3A 3R8XA 1EYZA 2M1ZA 2EP5A 1AH2A 2DQSA 4GI2A 1SB9A 1DOZA 4RGYA 3C3MA 1TZJA 1RRVA 1L5GB 1SH7A 3KHUA 4J80A 4LP8A 1B8VA 1J06A 2A58A 3U9LA 2PS9A 3AUKA 2IGTA 3DONA 5AJXA 1OCZB 3PC8C 2FPLA 2OBYA 1U98A 4DV2O 1QV7A 2YIMA 2W2TA 1R6UA 3OZBA 1MB2A 1WXIA 4NQRA 1QYWA 2QL6A 1IN8A 2ZR9A 3NYIA 1E0DA 4IX9A 4PYKA 2XCQA 4R7TA 3VH3A 3DB1A 3QSGA 4MR7B 1LX7A 1Q0ZA 1E3TA 1GR0A 2HU5A 3C15C 4QLAA 4CRWB 2Q3DA 1DBRA 1U28A 2OCYC 1WXFA 1ZLXA 5JNVA 1LLQA 1D5WA 4JLJA 2OB2A 2VPPA 5EKTA 4BX9A 1V45E 4OUKX 3FPGA 4C0JA 2ZYAA 1DNPA 1E2EA 1O6GA 1V7ZA 3H16A 4Q1BA 2G4VA 4XX0A 4IKOA 4Y9TA 3LWNA 5ENZA 2A86A 5F2KA 4BNHA 1Q1ZA 4EVSA 4RNCA 4DWJA 1TJ5A 4A15A 4V03A 2QJOA 3WWYA 2VTBB 3IL2A 3ZYCA 5L7TA 5HCNA 1EGVB 3DMPA 2NMVA 4GXQA 3HR8A 4HJXA 1AR5A 3K3PA 4REOA 3VYRB 3K4HA 4LSWA 3V1YA 4DDWA 3MLAA 1I3NA 3WFZA 4G37A 1EFVB 1R9GA 2PCJA 1H1TA 1MC8A 3DMNA 3T61A 2IH4A 5JCJD 4AUNA 1XI1A 3KRTA 4ALJA 4HSEA 3KG2A 4AJ2A 2PNJA 3UWOA 2D1FA 5DI9A 2QX4A 1A5BB 1WF6A 4EOGA 2Y67A 1HETA 2IIPA 4QXAA 1MO4A 4NK5A 1RC0A 2XWPA 4WGGA 5LU9A 4AP6A 3RQIA 4FHGA 2BM9A 3SLKA 5EWJA 1UFKA 2IBSA 4H16A 4W1PA 4NU8X 4B46A 2GB4A 1KI2A 4FIDA 4C3OB 5B1DA 3ELCA 1GR1A 3H5NA 1OXXK 3DHVA 3U7JA 2AEJA 3OFNA 1Y98A 1NQOA 1Z73A 2ZYSA 3GUHA 4PYNA 2QL9A 3RLIA 1FNBA 2QSUA 3SF8B 5KWIA 2DQKA 3UAYA 1SQ5A 4HZUA 1SUDA 2ETXA 3QF4B 4RQFA 1PYOA 1T8PA 4IFEA 4JB8A 1VQ7V 3C7KA 5F3RA 1RAIA 3MXOA 3M9XA 2OG2A 4QHYA 2I8CA 1E64A 2JFNA 3O9MA 3WLSA 4B7KA 2QPLA 3WKCA 1IHUA 2ZI6A 4TLCA 1XV5A 2VVTA 3I34X 4JZGA 3ASOC 1MJGA 2GM9A 4BEWA 5JAQA 2VCHA 2RI0A 2WWFA 3J80A 1YNOA 3EXEA 3G23A 2X8BA 3ZDDA 3SYMA 2Z2KA 5HF5A 1Q7BA 3C16C 3LGSA 2Q7EA 1L5OA 2BKEA 3JZIA 3KPYA 4IKPA 3TDKA 3C3BA 2XB8A 5CDGA 4LE2A 4TSFG 1FQKA 1P1BA 4E5KA 2BCGY 1TUIA 4H7EA 4Z0PA 3SEAA 4DA0A 1NVMB 2C4KA 1JI3A 1ZN9A 3UH1A 3N5KA 4EPTA 3E84A 5HIJA 5TQ2A 1QOZA 1ODCA 3UJ7A 1E5XA 4Q02A 4JPRA 3MSXA 4HC4A 3T7JA 3BA1A 2DWDC 3RV3A 5KU1A 4MUNA 2C8LA 4DA9A 4A36A 4NZOA 4DJFC 2FSVA 3UT5A 2RHDA 2Z95A 4TKUB 1N7HA 4YMTA 1ZD3A 4B4UA 2Q4EA 5ESXA 3W7SA 4G63A 5IAKA 2R9VA 3H9CA 5GZ3A 2AKEA 3Q7IA 2V59A 2QYOA 4G85A 4NHOA 5DHRA 3R0VA 1Z2PX 4LHSA 4Q19A 4E5MA 3K92A 4ETIA 5HFAA 3O5AA 1YVDA 1ZEMA 2EZPA 1SC3A 4ES6A 3HYCA 7MHTA 3QELB 3NDBB 2GYUA 1B2RA 3PAFA 3OZFA 1T9DA 4H6VA 1GARA 3T1YB 2HBZA 1U8UA 3HA5A 4GEKA 4GOND 4LVOA 2G0TA 3F1KA 1CUXA 1O87A 4KH1A 3ASNC 4TLMB 4DUZB 4BQQA 5C1OA 4GR5A 5KAMA 1NVPD 1G7RA 1W48A 2HWYA 1F2TB 3G6BA 1NMEA 1KZGB 1RYEA 1NVVR 2GHQA 2ZXFA 3ILHA 4M7RA 1QUFA 1UKBA 1I7NA 1OV4A 3RTGA 3H4IA 4JBHA 3VR5A 2G9NA 5D2CA 3QVNA 5LMZA 2CVFA 2VL7A 3MOSA 3BZBA 1T4MA 3I8XA 4ND4A 1YUBA 4L22A 5EXSA 5KWJA 3ETHA 4P86A 1HP8A 5JWPA 1YSCA 2EIHA 4B79A 3F5TA 4K0KO 4ILKA 1V39A 4TROA 5IBQA 3KTAA 2IHJA 4NH0A 3VR3A 4BW0B 4BFUA 4DDHA 5C52B 2MK3A 4PDRA 4TXJA 4MI9A 1TECE 1AA9A 2CLDX 3MJCA 2GKOA 1HFWA 3NVDA 2CLIB 4ITVA 4RE6A 1KSGA 5KYWB 3ZU6A 4DXHA 3ENNA 3D36A 1PK7A 3PC7A 1VQNF 2GDZA 1TRKA 4FNOA 4PCAA 4PYLA 1G5IA 1JDTA 3PJDA 4I19A 2O3JA 2IW1A 2IZ5A 1CQZA 1KYVA 2VATA 2VEOA 3GJQA 2H00A 2Z1UA 2J08A 3UG7A 5EVJA 3KWMA 2BOVA 1VE6A 4FGUA 1CXZA 1SQPH 4Q3NA 3ONFA 3B9RA 5EUQB 4F9FA 3GYGA 1LY1A 4JIMA 4X5OA 3WLRA 5TNXA 1A9QA 4HWKA 3OE7D 3EMDA 3U62A 3UB2A 1M6NA 1GA1A 4L9SA 4DG8A 3QNEA 4ZMSA 4WLOA 3FUVA 1SXQA 4BO0A 3L6EA 2WEKA 2PGOA 4FS8A 4F4CA 2CFCA 1NTKH 3DEAA 2GZLA 4JL6A 1YRLA 1JG2A 2CHFA 2O05A 1TZCA 3AC0A 4R6WA 1CUAA 1B8PA 3GRCA 2BCJQ 2RAVA 3DNMA 4HQNA 1UK9A 4GI7A 4ZBMA 5J2UB 4QOHA 1A96A 1V16A 3STXA 4MVJH 1FS6A 1BSVA 1FRZA 1KYQA 1G63A 1WVMA 1ONSA 1M73E 2C96A 2ZU6A 1NT2B 1IBMO 3I73A 4GMXA 1Z3IX 2WSMA 2VNKA 1MXHA 3JQ9A 5B12A 5FBKA 4EQ6A 3TF5A 2BEUB 1HMPA 1NXPA 3OCJA 1HFJA 1CY6A 3A32A 3LOUA 1DX6A 1DCTA 4J42A 1ZHHA 4FYKA 3H86A 4LJ8A 5GV7A 3N87A 2ZRMA 3DEKA 4KL8S 4YREA 3JQGA 2FSSA 2GF0A 4L8GA 5DTJA 2O2ZA 2OFFA 3M4NA 4QGBA 3FI9A 5T67A 3GPCA 1Q74A 3BMOA 4ENSA 5KI6A 2FGYA 1K7SN 1Q22A 4RA6A 4RETA 3KUKA 4FLMA 5FL3A 5FOTA 1PJAA 1QQAA 2QAGA 1C0LA 2FHPA 4LY6A 4CIWA 4D6XA 3DE1X 3G71F 3OWHA 1ZGBA 2ZDIC 1XZGA 2V5VA 3TLGA 3B85A 3WL7A 4ABYA 1HMYA 1GKIA 4D74A 1RA4A 4QGAA 1QP7A 2GJKA 3KHNA 2NTJA 4DRZA 2B0JA 2P40A 1W4ZA 3E3MA 2G71A 3G67A 1ETUA 1M1KH 2P0YA 3TEJA 5JECA 5CB4A 3ER9A 1UWCA 1V7QA 1M90W 1RKUA 1PW7A 1HLPA 4MWSA 1MRNA 1FFBA 1FOEB 2GCIA 2LDXA 3MBKA 4PWZA 2QJRA 5CX4A 2VQFO 1AU9A 1M90H 2JCBA 3O47A 3WIOA 1U11A 2R86A 3EIEA 1L8DA 4IS2A 3MMXA 4TSRA 3BXEA 1W5SA 3F7OA 4BGDA 1P7PA 1WDKA 1ISFA 4CMBA 2ATXA 2HBQA 1GDHA 4RF5A 3EPPA 2UUCB 4I1IA 1S5JA 1XEXB 2NXEA 4P7JA 4RS4A 3FLBA 4UULA 1GL3A 5EC8A 5A7GA 1UAAA 2WMNB 4BT6A 4FQ8A 3P9YA 1COWA 5F21A 5LL6Y 4GOXA 1TUEB 4JDPA 4FD2A 4KXMA 3PL1A 4CEJA 4S1PA 4CCWA 1ENZA 1KZ1A 2IYQA 3FUWA 4M9XA 3T9BA 4DSUA 3BE5A 3QPBA 3C5HA 4M46A 2X5XA 2BMAA 2C54A 2OBLA 2LWIA 2QGFA 2YY5A 4JC5A 2DBYA 2FV8A 1F0PA 2GCOA 3HACA 3PFHA 1IBKB 1N5KA 1E5QA 1UKVY 2V97A 1NUAA 3CUVA 3JRNA 1T8WA 4I5SA 3E1SA 4HXEB 1WPXA 5DM6V 2OQIA 4ZZ2A 2JLVA 3BMCB 3L7QA 3OQOA 2N1MA 1P5HA 4FW9A 1Y8ZA 1OC2A 2FOLA 3F6RA 4ZICA 5A4JA 3GB7C 1AQNA 3CBGA 2WTAA 1Q1NA 1UM9B 4PPGA 1WX1A 1XRLA 1QRUA 1M2JA 3EZNA 3I55V 5AXAA 2XOKD 2JLSA 4FXOA 2XB6A 2XMRA 1DIRA 4YBRA 4DJAA 1ZMXA 1J5PA 1YJQA 3NRBA 5HILA 1OH7A 2RGNC 3HQ4O 3OEHA 4FKBA 4WK0B 2P4HX 1S0VA 5CYGA 5M2QA 3IT2A 1JXQA 1H2WA 2AQIA 4JAVC 3WBJA 2PUEA 4D25A 5JPIA 5C7IO 2DVMA 4B47A 3JAWB 1ZDMA 2VA8A 4GYJA 4JI8O 1C9DB 5AOVA 1Z5WA 3KUDA 1XZPA 2QVXX 2JBAB 3TECE 4LZZA 3ZJ5A 5LVAA 3TLZA 1QAHA 2ZRPA 4REQB 3VZRA 1QVZA 5CBPA 3EH1A 4DL9A 7ABPA 5AVXA 4HSGA 4QHSA 1QFYA 3WL6A 5HOEA 1U0OC 2ADQB 4WFJA 1A82A 1WP9A 2G17A 2O4UX 3O9VA 4UBKA 1DWPA 3IVGA 3AYZB 3NM6B 4O2BF 2O7SA 3IPYA 1NATA 2PPLA 2A7WA 2CL0X 4G4GA 3PNQA 4YIPA 1X7OA 3RUDA 4ACBA 1NNEA 4W9MC 1YA8A 3SZLA 4DUGD 3IHKA 2QUKA 1NI8A 1ZH2A 2B8NA 2GEKA 3FETA 2YXLA 4LYYA 3RRNA 3KELA 9LDBA 5JISA 1EUDB 1G21E 2BD0A 2XMDA 4E4EA 2N1BA 3HYLA 1W1IA 3GA0A 3IHTA 1NUTA 1ZSVA 4DKXA 2XCLA 2WWXA 2YXYA 2RAPA 3DZIA 3DEYX 3Q3IA 2C5AA 4XARA 5ERYA 4QU5A 4WCFC 4KFSA 4LI0A 2HPHA 2JGLA 1OWNA 4FMCB 4II7A 4QXRA 3TZHA 1Q84A 3BTSA 1VF6C 3ET5A 5A03A 5LZ4A 1Q95A 3KIPA 3EDMA 1NZ6A 2NO1A 4TRMA 3I0NA 4LVUA 3H2YA 3UWPA 4A6XA 1KEEB 3KVNA 4M2LA 1PJRA 5G02A 1P74A 5JNUA 2PVSA 2ZT5A 4JY7A 4NYMR 3CG6A 3V2GA 4BAUA 4YPOA 4BQIA 2Z30A 1IN5A 4UUAA 5DW0A 2ILMA 2OTJF 1NVXQ 1T43A 2PUTA 3KUUA 5DF1A 3UGTA 4Z4GA 3FX7A 1M34E 2IE0A 3IAXA 2A9QA 2Q67A 1YOVA 4LRQA 2R9AA 1A9YA 4M60A 1I7QB 2BTQA 5EA2A 5L3SB 3LKDA 2IYWA 5CEEA 3ZY5A 1DAMA 3BL5A 1Y5MA 1X7WA 2CNLA 2FEWB 2YIBD 3K9HA 3O3NB 3QBDA 2I22A 5JJBA 4CCYB 3W7WA 3ZMVA 1DRKA 1NASA 4Z9YA 1VA4A 3EXG1 3GOHA 3KYCB 3WIVA 3LD9A 1MTZA 4FGZA 4B8WA 4Y9SA 3NR7A 3IUPA 3FHOA 4CQLA 1W73A 1EX7A 2HHCA 1E9CA 5JMPA 4PU0A 1IB0A 3UW1A 5FTLA 2BFFB 4DPLA 3EFOA 4G0MA 4MK4A 5A9GA 4JOBA 5IJ9B 3DS8A 1W6UA 1I7LA 4JQZA 4Z9FA 5FLYA 4HN4B 1ACJA 3LLUA 5DGDA 1P2UA 3S44A 2OHWA 4EY3A 4F4DA 4M8KA 3S55A 3JQRA 2CBGA 3IJRA 3BA9A 3JYLA 5IJZA 3M6IA 1O4WA 1RRMA 4PYMA 3GUUA 1SQFA 3DC5A 1F3LA 3SZMA 4K9PA 3RC2A 2NO9A 4K28A 1KO8A 4Q7QA 3C7TA 3VH2A 4P7KA 4O3MA 3AVUA 2CJXA 5FADA 2NTEA 5COQA 3DE7X 5AK3A 1BXRA 3NIDB 4M8LA 1PNTA 2VUSA 1FNMA 1O0SA 3GRYA 3PC6A 4FZ5A 4B2YA 5JDCC 4C7VA 1QHGA 3PP8A 3R5HA 4GL2A 1FMFA 1Z2CA 2GTHA 2ZT6A 1RSOB 3FHJA 3PGVA 3KKPA 2QLMA 4NBWA 2GETA 2OWEA 4IM7A 1RHJA 4A8TA 5EIOA 4CQMA 3R6TA 5ALTA 4UM8B 4PNEA 3K9LA 1R1MA 1FJHA 3ZD8A 2FCRA 4OY3A 1MIHA 3A7DA 5DECA 4X71A 1PVDA 4PYJA 4N9WA 1K3FA 4JB2A 2RE8A 3O7WA 4MR8A 2OV1A 2O52A 1TCBA 2EYUA 2HAEA 2E5LB 4A73A 3CN9A 5G3ZA 2XYGA 5CA0A 1G8JA 4GI1A 1PDVA 1DFHA 1ZI9A 1JVMA 2XTJA 3AIOA 1QG6A 4MVJI 5E6RA 2ORVA 3TW0A 4E5DA 4Q4CA 5JNWA 2GBIA 4ZKDA 3OFNG 1GZHB 1JHZA 3NLLA 4KQMA 2VHZA 5EUMA 2XHBA 2WLLA 2RSLA 5EB1B 4BO8A 3CH6A 4KHPB 1SBYA 2AEFA 1IONA 2VCEA 2HJ9A 3H7IA 3HA2A 4HH3C 1XXLA 1VMDA 521PA 4MICA 3NDPA 2QMQA 1UBNA 3KX2A 4MYDA 2DERA 1XL4A 3X2EA 4B8ZA 3NTQA 2ZU0C 4NE2A 2P5SA 1GNVA 2FZEA 1CQIB 5ITVA 2ODAA 2CUZA 5LQCA 1J90A 2WUVA 2UYKA 2XF2A 3WGJA 3D5QA 2PBFA 1OX4B 4P83A 1BNCA 4YV7A 3T9FA 1AO0A 3M6FA 4DQDA 3I9NA 5TS2A 5BSWA 4OI0A 4EHNA 5L4LA 3NIWA 3PRKE 4OM8A 4ZO9A 5HE8A 5TF0A 2P6NA 4N39A 4CVNA 1VJRA 3RHSA 5FPKA 1XN1A 2C2HA 3B7WA 3RIEA 3NHJA 4YGXB 2WU4A 2QM0A 3PTLA 3ELBA 1OCOC 4BOYA 5DM70 4ID9A 1G7CA 4G4WA 3F71A 3S40A 4BVBA 4BVJA 2ITCC 1Q1BA 4K9QA 1PL6A 3DBOB 3ZWCA 5AVWA 2VAXA 1M1YB 1E3EA 4HEA1 1KEVA 3A05A 1ZK1A 2J5KA 2JFUA 1AX9A 2PVPA 3DCYA 1V2HE 3F67A 1A9PA 5JSZB 2HR3A 2Q50A 3BTUA 1LPBB 3PEEA 4GOJA 4HAYA 4IX1A 4XPIB 4CG1A 2Q6TA 4EGCB 1HDEA 5FX2A 2X86A 1Z0FA 3VFDA 2AR7A 3H97A 4KLZA 4KWHA 5JAPA 1FXKB 4MWTA 3D00A 1Q21A 4BIUA 3CKKA 4KG7A 3GZNB 1Y76A 1BD4A 1VP3A 2FKNA 1CJCA 1R88A 3CONA 4YQZA 4CHGA 3RVRA 2VAMA 1XVTA 4LJ6A 2F4VB 3JYCA 2C7GA 3AEKA 1C8VB 3DPIA 4AN0A 2W42A 1QU9A 1U2TA 3LC1O 3ZW9A 4G4XA 1YI8A 2PQ6A 1PO7A 4KZKA 4U7DA 1Z07A 2CGOA 4Y6RA 3LV8A 4DLTA 1C7EA 2D4AA 4RY2A 4FNMA 4ENWA 3NDIA 1J22A 3A36A 1S7GA 4J6EA 4AMGA 4CH5A 4G2TA 2XUDA 2FI1A 1K8QA 4RF4A 2GEDA 3G6EF 4V1CB 3EVAA 4D79A 4HR7A 2F3SA 4MR9A 3T38A 3FYUB 4BLRA 4Y6OA 5EIWA 1HG1A 5CW2A 4Z0HO 4A4DA 2XCTB 1JLLA 2BMFA 3DKKA 5CW1A 2QWXA 1XTJA 5ALZA 4R84A 1E6WA 5A4DA 3E61A 2IS6A 4MVOA 1K3UB 2JEXA 1ZIOA 2BMEA 1XZQA 1DWOA 2EULA 1I5EA 1R6NA 3LNCA 3NC1C 4QPDA 3HCOA 4DMHA 1B8UA 1Y42X 3B8HA 3JYNA 3RVJA 2X3FA 3UMMA 4WEQA 4YCJA 2HUPA 4Q6BA 5EBLC 3L7DA 5C32A 5A3VA 3VNAA 4C4TA 5I9LA 1ZR4A 2PZLA 4EHIA 5IFKA 2H52A 1C9EA 3IIJA 5TMBA 5HXAA 4RF3A 2TMGA 2ZPUA 3WK8A 1QBKC 4C7JA 5H4GA 3PQ2A 5G4LA 4ENPA 4PIMA 2Z6UA 3W8EA 2ZM6B 2D2FA 3CT6A 2CVPA 2VDRB 3CIOA 4LJRA 3CP1A 2GCEA 2XYQA 1G8YA 3SYLA 3OQ1A 4MROA 1Y8QA 3AFMA 1HRDA 1K4MA 3U16A 4LAFA 2D5LA 2Q1XA 2J45A 5FBHA 2E76B 4FTWA 1GG9A 1R0RE 1ZOIA 5J23A 3DEHA 4EMTA 2MTBA 1J5EB 1WE2A 2RC5A 4H4EA 1K3TA 1CP9A 1Z82A 2YW2A 3EXIB 4TSFA 1MVOA 4EA7A 4I4TB 1NJ5A 1FFHA 4GMGA 3N70A 1EAYA 2G04A 1OF1A 3VSEA 3CCEV 5CX1B 1JH9A 4DXWA 2HHAA 3PGA1 4R71A 2GHTA 4NABA 1DUIA 5AM1A 1EA5A 2HNBA 2UZ0A 4UHHA 2C1ZA 4PZZA 4WSOA 3T94A 5CDSA 4XB6B 1ZGGA 4CKCB 5C0OE 1X4TA 1KAMA 3W78A 1UFIA 3ZWDA 1MSDA 1WXEA 2Q6AA 2X2PA 1BS1A 5AW1A 4OXRA 3BXPA 4PI0A 1OVGA 3LLMA 5K1ZA 4DVJA 4PSCA 3A6EA 1F14A 1GPKA 4KUEA 4FLWA 4TMFA 3B7GA 1MOPA 4AI6A 3R66A 1NXSA 2FZKA 3BWYA 4XQCA 1U90A 1F9AA 1XDWA 5LOVB 3G9XA 5B53A 1DTEA 4O4HB 3UHPA 1YZLA 4JHLA 2C0CA 1L4NA 2JGFA 2FYUH 1JJ2F 2QVGA 3G5LA 1TMOA 4JTDB 4HBGA 4S2EA 3CC7V 1RWBA 4AJJA 3IDOA 5C3MA 3NAGA 3HSKA 3O4HA 2V03A 5CLHA 1YDWA 2XYRA 4JXZA 4JNCA 3ZO8A 1CR1A 1J2YA 1WCV1 2Z98A 3MUFA 5KHHA 1VJTA 2WUDA 4LNAA 4LUCA 4EFBA 1KAHA 4GBMA 3BVOA 3E3NA 5EVCA 5IH7A 1N34O 1FJGO 1SA0B 1TO6A 2GBFA 2IP1A 3R7LA 1FTYA 3T7CA 3HB0A 3DMTA 2GAFA 4Z54A 1NQTA 4ZCRA 3L0DA 3FCSB 2DPLA 2VKQA 1GQFA 3KT3A 4MVJE 3NWJA 4R2MA 3EPJA 2OGUA 1YI1A 2DH5A 2X9QA 3I9MA 1N1GA 2DUNA 3JQ9C 1R6BX 1Y5NA 3VZPA 4XVHA 1YFJA 1E79A 1I4EB 2XIQA 3BK7A 3R3YA 4MB0A 1GM7A 3D54D 4LK2A 3FW1A 1PK9A 2CVZA 4XD2A 5EXEA 3U48A 3AGPA 1IWOA 3TM4A 4LH6A 2RHGB 4B84A 5T8KA 4AQ7A 4ZAWA 1CJMA 5A4MS 4JI1B 3D7LA 5FTMA 3VKWA 2PNFA 2VDPB 2O1WA 5DCLA 1UJ5A 4AJHA 5BN5A 6NULA 4QGFA 1L9KA 4PEVA 4TMXA 1GGMA 3CCUF 1W1UA 2PX6A 5DFAA 2XVAA 3KTOA 4F6EA 1BA3A 2EJTA 5HFJA 3DVSX 2YOFA 4II3A 2QEQA 4K8ZA 1TOAA 3CUYA 3TQFA 4H7KA 4XWAA 3CS3A 2MIIA 4MJ3A 3H18A 3KCNA 4LOHA 5A4KA 3WDLA 7REQA 4GECA 1YL5A 2BFBB 2WR8A 2ORED 1BJKA 3L8GA 1SEVA 4NVRA 4WK2B 3EGOA 2VQDA 3I09A 3RHTA 1TK9A 3ROMA 2WLSA 2XWSA 2YCBA 4M0CA 5CT8A 4KO1S 4JR2A 2Y1CA 1T5OA 1N6OA 3BPSA 3NFYA 4ICIA 1Z4LA 3F46A 4N41A 2DRIA 1IZ8A 2Z3WA 2SKCA 1VQ6V 1AY0A 3NRJA 1A4UA 1T9GS 2ZRLA 5JS6A 3H5LA 4NICA 2YWCA 4MCHA 5JAZA 5B66Z 2OTLV 3J81k 2ZSAA 2LE0A 4X8OA 1C1XA 4GWLA 5K3FA 3U0VA 2WV9A 4PBTA 3T5CA 1BE8A 1U9YA 2DG2A 4QQKA 3CCVV 2FF7A 1WB9A 1OFVA 2QAGB 4OK3A 3CCRV 1QLWA 4YMLA 4JJIA 4LZAA 3VTAA 4B71A 4NPAA 3MNFA 3ZHSA 1CERA 3OM8A 4LIPD 3A0UA 4Q5IA 2CSUA 2DKOA 4UDOA 5IVIA 5SYNA 3GDFA 4WI1A 1OHHA 3WJRA 2Y93A 2Z4SA 4FMCF 3BWCA 4Y0NA 3KV3O 4C04A 3JQGB 2C99A 2VQEO 2B78A 3M2TA 1HYBA 3C6ZA 2UUOA 3FZYA 3IDAA 2AZ0A 3KVOA 5EESA 3TCNA 2X1HA 2B5UA 2W6PA 4QBFA 3KJIA 3ND9A 4OUDB 4C6SA 4W99A 1P33A 2R1ZA 4RL4A 5EE3A 4GKVA 3MDOA 1G1AA 2D00A 2NUBA 4HB3A 2LVBA 1CZUA 2ZT9B 5HP4A 2C4NA 5FEUA 4PICA 4CNBA 1RLIA 4FP9A 1U1FA 3KEFA 4TV9A 2SBTA 3IALA 4CF5A 5CUQA 4FXPA 3K5LA 3C3DA 1U3TA 1GG5A 5B37A 4C8EA 2X4IA 3IV9A 4I3GA 4NJEB 2QD5A 2Q5LA 1NW8A 1YGYA 5AI9A 3CXHF 1DF4A 1FQOA 4BZZA 3C87A 3EIUA 5DSZA 3L02A 2IIQA 4O4LA 4P53A 5G0WA 4KNVA 4WJKB 4DJDC 3A28A 2WWGA 2GYYA 2VHCA 3IT3A 3MLEA 1C7FA 1HFKA 4GZLA 4MWDA 1HF3A 1ZOPA 3TEFA 1I4DD 5F5LA 4D9HA 4HDOB 3KQTA 3I52A 4EECA 221PA 4JLVA 2Y1XA 3PEYA 3L6RA 2CCJA 3OE7G 3EQ2A 5DIFA 4CH4A 2AN5A 3H5TA 3HCEA 4D92A 3J7AU 4J1TC 4CEIA 1X80A 4ZYLA 2HLPA 1JH8A 4MOWA 4QYIA 3ZGZA 1NVUQ 1PFUA 3FR7A 4HADA 5AM5A 2P90A 4DCUA 4E2ZA 4JI4O 1XJ0A 2YI9A 3F7VC 1NMSA 2JIDA 3G5UA 3LECA 3RVBA 5C4IA 3RVZA 3ETDA 3K9QO 4XUEA 5F5XA 2QZ9A 3VR6A 1W42A 1XTPA 3EIWA 4ALLA 4KCGA 5H3LA 3FB5C 1Q91A 3FBTA 4WOJA 3RUIA 3RW9A 4YT4A 2BYTA 1PR9A 1F7UA 4RGQA 2RGRA 2PM8A 4YXFA 4V0NA 4DSOA 2C1XA 4KGXA 1A9ZA 3U10A 1WZIA 1A0OA 3OIWA 5A2QM 2BGJA 2VAVA 1OOEA 1RM3A 2WFLA 3Q15C 4LF7B 2N74A 3C8MA 5F1OA 1JUDA 4JLPA 5LUAA 3AWIA 3LWRC 3CXCU 2GN6A 1BZYA 1J7HA 1K75A 3WLNA 1N2IA 4KVZA 1IPHA 1RKVA 3CLSD 4POAA 2R1UA 1LVGA 4DV7B 3OUSA 1P60A 3OX4A 3QKTA 5KKNB 3CKYA 3X1KA 3D3WA 3R3JA 1E3SA 1NT4A 4FGWA 2DW4A 4PYIA 1SPBS 1LVHA 2D5BA 1JXOA 1QZTA 1B42A 1KGSA 1I6MA 2PMDA 3K6KA 4OFXA 4FLUA 4RTJA 3RT1A 2XUGA 1K5HA 1Q57A 2CTQA 4IIHA 2ZRHA 3VQTA 3BMQA 1PLLA 4FC6A 5DNWA 3WLFA 3UFBA 4BASA 3JPYA 1LBIA 2DY1A 1OGYA 4FLVA 3E70C 4NQZA 3RFUA 3AVOA 4LF8O 4C7MA 1ZUQA 4YJ3A 1E7QA 1GTZA 3TRDA 5INTA 5IYDO 4XVCA 1JXMA 3CZ9A 1ZKDA 3HB3B 1ADGA 1CG6A 2GO1A 2FFHA 3FPLA 3GFOA 2I4IA 2FDCA 4OOFA 4MUJA 1BE6A 3QE3A 4X3CA 4S0XA 1LBTA 5AH0A 1GA6A 4E1BA 4IG4A 1GGKA 4H35A 2AS0A 1ZJWA 5IY5C 3LOPA 4NE9A 2JS7A 3M1AA 4XSHA 3TVTA 2HQSA 3H83A 4R41A 5B1BB 3CCLV 5JDCA 1J0CA 4KKXB 2TECE 3K79A 3H84A 4DNQA 3JAMA 3N2NA 2QP9X 3K14A 3M8AA 2O0KA 3T5BA 2N9UA 3E5NA 2FX2A 3WGOA 3NBMA 1DKUA 3VPCA 3UUGA 1U7DA 5CLQA 1GP2A 1DG3A 2VPZA 3PJRA 1MRSA 1EFKA 2X14A 2XWQA 5K3OA 1E2UA 2H92A 3KJNA 4IZOA 3U1BA 1PLKA 1BWSA 3T1CA 1I1HA 2F48A 1TFRA 2Q5OA 4ZAFA 3ZNQA 1HDYA 1UUFA 4IOJA 1QKKA 1RIIA 3H13A 5C1BA 3K9GA 1QVWA 3HGTA 4NS1A 3S6JA 1G8SA 2XVXA 1HA3A 1Q7EA 1SZPA 1IBRA 4NAHA 4Z7OB 1GDDA 2I3BA 1D6JA 3TOZA 2LKDA 1CQPA 4GSKA 4CGYA 4OLAA 4J0HA 4V1CI 1KZ7B 5BYAA 3C7DB 3OICA 3C8HA 2VQEB 3PYLA 5JR3A 3EDCA 2Q3CA 3VDRA 4ZZIA 5ALQA 5T6BA 5BSHA 4JLUA 3ZBPA 4DA7A 4XIGS 1RACA 3BEDA 2IJIA 2IF2A 3BGVA 1D9XA 1YQTA 1GU0A 1PR5A 2LP7A 1IOWA 1FPMA 2CE2X 3DZFA 4N82A 5D6NA 4ZOCA 5J5CA 1W75A 2IJKA 4J10A 3VR4H 3BIFA 1PT9A 4QPCA 2DXIA 3JPWA 5JPCA 3EXFA 3GA5A 2O2IA 4L7VA 3I55F 1ZIYA 3NH6A 4BFTA 2X0NA 1EE1A 1QR9A 3KYDA 3U3MA 3A0RB 3ES9A 2HVJC 5CFLA 5KUKA 1QVGF 2Y05A 4QJIA 2I2DA 4AKEA 1I5XA 1UBTS 3MAQA 2H85A 2VTBA 2X0DA 4JYZA 1EJBA 1JDBC 1N8RH 1SC9A 5LXTA 3F4KA 4LY3A 3C3TA 3HJWC 1NN0A 2DQZA 4CPDA 2Q8VA 4G4YA 2AMFA 4Q4JB 4UAUA 4C4YA 5IYZA 1DG9A 1TKBA 1YR9A 3F6YA 3FB1A 3G2JA 2V45A 4RJTA 5C5EA 2PX0A 3PWTA 3AWDA 4J7CA 3E9NA 3DFUA 1WUYA 2Y1LA 3IJ5A 3VR6D 5A05A 4AMUA 3FNEA 3CCJF 1YA4A 2DWQA 2UAGA 1J8FA 1SA0A 1WY7A 3CXRA 4NDZA 4DG5A 4HV4A 1Z6GA 2CEAA 3RCBA 5ICGA 2PXXA 3BH6A 4HQLA 4CUKA 1K5QA 3AJ9A 1WKBA 5AW7A 4UCUA 1FX0B 1TM2A 2GESA 1QQTA 2J32A 3LYHA 2YXEA 5KTOA 2A9PA 2QTNA 3TUIC 4DADA 3HU1A 1Q5OA 1VB3A 4P0QB 2ECOA 2VPYA 4MYRA 1ULTA 5IAJA 4LEIA 4XKJA 3DM5A 1PSZA 4KTVE 4ARVA 5L51A 3JAWA 1AS2A 1O6FA 3W7TA 3O4RA 3KSDO 4JV5O 1F8YA 1T5HX 2R85A 3ZLUA 1H2BA 2NO0A 3C8UA 4KIJA 3S2GA 1IN7A 5F23A 1JFLA 2ZCUA 4XRGA 1IN4A 5EFZA 3VPXA 3JQ8B 5LIPA 1KGDA 1VG9B 3L18A 4IKEA 4H7JA 1XZJA 4X63A 1II8A 1KS2A 1KARA 2JEYA 3G1WA 4ER3A 1E60A 3PS9A 2ENWA 1XMOO 1KY2A 1X9HA 1N0UA 2MR6A 3H5IA 3ROTA 4C0WA 4BUJA 1M0EA 3BIJA 4I2VA 4LI3X 3CCQF 1LDNA 3RREA 1A9RA 3AETA 1NDQA 1F8GA 3EXHB 4OYRA 4BLUA 1NW6A 1K98A 3DDSA 2VYVA 1G16A 2PXCA 4R3NA 2IWRA 3B6ZA 3OE7A 5F73A 4IQFA 1W36C 3EE6A 2B2XA 3E15A 3RVYA 3U3ZA 4I6JA 4YP7A