4IHJB

Crystal structure of tubulin-stathmin-ttl-adp complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
428
structure length
422
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Structural basis of tubulin tyrosination by tubulin tyrosine ligase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 167
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ihjB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4ihjB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4ihjB01
2BTQA 4KWEA 3HKCB 3RYFB 4O2BA 1W5FA 5CB4A 3N2GB 4U3JA 5MN6A 3JASB 3N2KB 4EI8A 5LP6A 3JAKA 5LP6B 1TUBA 5BMVB 4B46A 4DRXB 4O4IA 4I50B 5JVDA 4TV9B 4DXDA 3VO8A 3V3TA 3HKDA 4WBNB 4LNUA 3JARA 3UT5B 5LOVA 5KX5A 3JAWB 3HKBA 5LYJB 3VOBA 4I55B 5GONA 4M8IA 5J2TB 4O4HB 2BTOA 5JQGB 3HKEB 5CA1B 4X20A 2GVIA 5IJ9A 5FNVB 4EB6A 4X1KB 1FFXB 5EZYA 3JALB 3JATB 4IHJA 4X1YA 5JH7A 3WGMA 3ZBQA 4O4LB 5EZYB 5JH7B 4ZHQB 5M7EA 4F6RB 2Q1XA 3N2GA 4TUYB 5JCOA 5LXTB 1TVKB 3JASA 3N2KA 3RYHB 1RQ7A 5KMGB 1SA0B 4FFBB 5BMVA 4DRXA 1JFFB 4I50A 4TV8B 3RB8A 2XKAA 4TV9A 4B45A 3RYIB 4WBNA 5LYJA 3UT5A 5MN4A 3JAWA 5EIBC 4I55A 4IIJA 4YJ3B 5J2TA 4IIJB 5EIBD 4O4HA 5JQGA 3HKEA 4O2AB 5CA1A 5MN5A 5FNVA 3VOAA 4X1KA 1FFXA 3JALA 3JATA 3VO9A 3WGJA 4U39A 4O4LA 3M8KA 5J2UB 4ZHQA 4F6RA 1RLUA 3M89A 5LA6B 2RHOA 4O4JB 2VXYA 4TUYA 5LXTA 1W5AA 1TVKA 1W5EA 3WGKA 3RYHA 3CB2A 4E6EA 5KMGA 1SA0A 4FFBA 4X1IB 1JFFA 4XCQA 4TV8A 2RHHA 5IYZB 2Q1YA 4EI7A 3RYIA 5CA0B 2VAMA 5EYPB 3E22B 4HNAB 4YJ3A 4ZOLB 4I4TB 3VPAA 5C8YB 1W581 2R751 5ITZB 4O2AA 4ZI7A 5IJ0B 2R6R1 4ZI7B 5J2UA 5LP6C 2BTQB 4EI9A 5LA6A 4O4JA 4O2BB 5CB4B 1W59A 4X1YB 3RYFA 2VAPA 4U3JB 2XKBA 3WGNA 4X1IA 3ZBPA 3JAKB 2VAWA 1TUBB 5IYZA 1FSZA 1RQ2A 3C8LA 4O4IB 5CA0A 5JVDB 1OFUA 2RHJA 5EYPA 1Z5WA 3E22A 3HKDB 4HNAA 4ZOLA 3JARB 1Z5VA 4I4TA 4LNUB 5KX5B 5LOVB 3HKBB 5C8YA 5GONB 5ITZA 3R4VA 3ZIDA 3RYCA 3WGLA 5JCOC 3RYCB 4X20B 5IJ0A 5IJ9B 4YJ2A 1W5BA 4EB6B 2RHLA 4YJ2B 4IHJB 3HKCA
chains in the Genus database with same CATH superfamily
1MO4A 4DV1O 4JODA 2YC2C 5TRTA 1B0ZA 5I9BA 4RKEA 2HCTA 3SIPA 4R54A 4CTOA 1G6OA 2VNJA 3E3NA 2IF2A 2D3TA 4Y2TA 3BIJA 2ONYA 4DIEA 2QVLA 2P0YA 1Q20A 3I6YA 3IOYA 5IT5A 1QK5A 2AK3A 1JG2A 1RTKA 3NHWA 2DPLA 1MRSA 5A05A 5HRAA 3NORA 1MFPA 1VJDA 3A0HZ 5FUVA 2DBZA 4PCVA 3MA0A 4RIFA 1UKBA 4RFSA 3PENA 4R50A 4XX0A 4A27A 4LOKA 1T9BA 2DPGA 1V7QA 4K86A 4DJJA 3HE3A 3DBHA 1ZMTA 3JQAA 3KVOA 4EYSA 1HFJA 3EDCA 5TQJA 4JP1A 2NYUA 2HLNA 4BNMA 1QR8A 3VDRA 2ZI6A 2A84A 4BFSA 1KMHB 3G88A 1ARZA 3GYGA 1HM5A 2C5SA 1DSSG 2BEKA 1FXHA 1H6BA 3CXCF 1RXYA 1NTMH 2QVYX 4RDIA 5C8VA 3I0ZA 1JJAA 3NV7A 1K8AH 2WM2A 5YASA 3T1TA 3MWJA 2RIRA 3OIGA 1G1XB 2N1BA 3C4QA 4BX8A 3LQKA 4WLOA 2A1TR 1VG9B 3OAAA 1WXEA 1D5WA 3K0DA 3GUYA 1X39A 1CUDA 5ESWA 1Y4MA 3ILYA 1E4VA 2ORIA 4YP0A 1PLKA 2ZDIA 4DYDA 3CLTC 5ALNA 2C7GA 4E07A 5JYEA 4JF3A 4G1BA 4N18A 2XTJA 2D2CB 5F2NA 5HXAA 1JIQA 3O7MA 3HZOA 4CMIA 1TQDA 1E2NA 2LUOA 4HTFA 2Z5LA 5IK2D 1WW3A 3L7IA 3RC2A 1EAMA 1GPKA 1NC1A 3LVRE 4M0DA 1OCRC 5C18A 3IEWA 4LBYA 3U4HA 2VA9A 5I7OA 3MRXA 2QTNA 3QMPA 2HGZA 2VZ9A 1HG1A 2AI3A 5EPEA 5EWJB 2WI8A 4URYR 4MDYA 2FPPA 4IZIA 2NXCA 1QF7A 4B32A 2PMWB 1CUWA 3OO0A 1OGJA 5K8UA 2FLWA 1RYEA 2FZEA 1JJVA 1HDXA 3K0EA 4PR0A 3O85A 4YACA 3DVRX 1GGFA 2OZBA 1XREA 2Q7EA 3SEQA 3O4JA 1E1RA 3PXBA 1S8AA 2VWGA 1BOOA 1XWFA 1GM5A 1JDTA 3D1LA 1U8ZA 3PX3A 2V7GA 3LKDA 2JIZG 2GM3A 3VHLB 1NI3A 3T3MB 5JAHA 3A11A 1QYWA 3K8ZA 2R8RA 4KQ9A 3IR7A 4B82A 2EJ7A 5EKDA 1A50B 4ZCQA 1GQYA 2CHQA 4MYSA 1PZGA 2J31A 3MAQA 4OA5A 3OOYA 1OYYA 4RD1A 4HCJA 1QYXA 2ZUCA 2O50A 4P0QB 1B8OA 2YI9A 2QLLA 1UBMS 4PSVA 4WK2B 4FONA 4WBNB 1NI5A 5LYJB 4OHOA 2P2LA 1PE0A 4R8CA 3CTPA 4LGMA 4L02A 1T0PA 1U28A 3CR8A 2HT1A 1TF2A 1RXUA 4FFBB 3RABA 1Z5GA 4C21A 3I9LA 1XMOB 3HMQA 1LSJA 3F6MA 4TMZA 4WLEA 2ZITA 1FLVA 1Y66A 2F1OA 2DWOA 3STXA 1SRRA 1U0RA 4QXMA 1ULTA 2CTQA 4NCJA 4E4EA 3RC7A 5AVUA 3HJCA 3SYCA 1TU3A 1KKUA 4ZJYA 4O3FA 2PY6A 3JPYA 1I7DA 2PRZA 3SZMA 1L5HA 5FBWB 5KOIA 4Q6BA 3GU3A 1RYFA 3Q11A 4RQEA 3ZN1A 3ZX5A 1EVQA 4ABTA 2X9QA 4Q1VA 3GAAA 4O4JF 4UEWA 3BWVA 4XGNA 3NAGA 3I6BA 1JJ2U 1SQVH 5KI6A 3P30A 1KKDA 2LV8A 1OX6A 2ADQB 3B9PA 2PX3A 4AIRA 3ZRWA 4BNUA 4JYZA 3VO8A 5K6AC 3BILA 1AK2A 1G4UR 4MQ4A 2CFIA 3O75A 2PKEA 3N0WA 2WMYA 3CHYA 3VKVA 2LGWA 2DB3A 3ZKAA 3O74A 4J0EA 2E75B 5E7JA 3M2PA 3JD2A 3DVAA 4WXRA 4E30A 2IXGA 3OE7A 4MKFA 2WLLA 4CI9A 3OZSA 5LHHA 3MD0A 3B09A 2XGMA 2E4ZA 4C6TA 4ALKA 1SBCA 1REQB 2C5FA 2EYQA 4L95C 4KBGA 3AEZA 3HADA 4J1SA 4UB8Z 4KJZA 3JVIA 2W0FC 4JSTA 5HY4A 3ASYA 1M57B 2O5RA 2JH9A 4ETWA 3E8BA 3AG4C 1K7XB 2HYDA 3GCZA 2BFCA 2X6BA 4K3VA 2XTZA 3T4UA 3NWOA 1Z2CA 1JQDA 2H1OA 1PI3A 4LZWA 4YMSA 3AONB 1WCWA 3HWRA 3C3SA 1D2RA 3DH0A 3EGCA 1IOVA 3COPA 1ZKMA 5AQEA 3O4VA 4Q4AA 2NZYA 1WXXA 1ESDA 4M0UA 4LRTB 1Q7TA 2J5XA 2OY0A 3D7NA 3ZU3A 2PNFA 1K7SN 2ADOA 1R4ZA 3V4PB 1JIUA 3AR8A 1UBSB 4IKEA 1SETA 4PE5B 2YWGA 3HCPA 1JR2A 1V1JA 4N5IX 3INTA 3F78A 4F3RA 1GPUA 1SY7A 4W9NA 3UJHA 4TS4A 1M2OA 1Z7YA 4AYTA 3DV2A 1E79D 1S9DA 3LA6A 4FGKA 4IXDA 5KQGA 3SSMA 1CLEA 4TKZA 4PWYA 2QAJA 2O6HA 2Z01A 2I1WA 1FRZA 4IILA 3LRTA 4QVGA 1LFAA 3E22A 2XUPA 3TJMA 5TEWA 3PT9A 4MDEA 5E7IA 3OUZA 2Y1GA 3KPWA 3ZYCA 3RU9A 2CUZA 1HY3A 3Q7EA 4HN2A 3R9XA 4MS2A 5I45A 5JVDA 1G0NA 5LOVA 5BXQC 3VISA 3BSFA 3O3CA 4GMDA 5J5AA 4I2NA 4FFNA 4DXWA 3HU3A 1RRVA 1QGUB 5JRZA 2VVTA 1QH8B 2F4NA 1Y76B 3EFBA 4C7MA 3PAFA 1M6WA 4Y1FA 1RWKA 3HL4A 3ABUA 1D5AA 2BSAA 5AM5A 4RTQA 2HLDG 1GTL1 1QTRA 1LSOA 2BMJA 1BHJA 3VMFA 3X2SA 4PZUA 4YUWA 5EHGA 1WTCA 3BCCH 4R05A 4BNGA 2PKXA 2E0IA 2QGFA 4MW3A 3SFVA 1N6LA 3EBPA 4P3YA 4AJLA 2XI4A 1E61A 4GF5A 4HBNA 1VJGA 4JV5B 3SC3A 2EKPA 3S29A 1A3CA 4FUQA 3W78A 3LT1A 4PS0A 4A4DA 2VJCA 1VHLA 1QGZA 1CULC 1JNYA 5CH3A 1TFRA 4FM2A 4ASUD 3IV6A 5HKKA 5AVRA 4Q3BA 1QRUA 4N6NA 2MR5A 1QQ7A 5J47A 3RSZA 4EA7A 3WDSA 3IUEA 3MTJA 3U49A 2I7CA 5LYYA 3WY9A 4B2LA 1QSGA 4KQWA 3DF9A 3V4FA 1SBTA 1LX7A 1K8RA 5B66Z 4QG7A 3EEIA 4N6GA 3AG1B 4E09A 1NLUA 1IWOA 5JZ9A 1GFWA 4W7HA 1UMCA 4WL0A 1CY8A 2YJNA 1BMFD 2IBTA 1RXWA 3RQSA 1IJKA 2PZMA 3NHAA 2HVYD 4GXQA 2IZ7A 3PYLA 3TAUA 2Y99A 3J7AU 1TKRA 3L6BA 2WAYA 1N33B 4OQDA 2G1JA 2HWYA 3ZK8A 4YECA 5JAQA 3OE1A 3JWEA 1OCOB 2E37A 3MGGA 1G5FA 2FU5C 2FEPA 3F5FA 5B3LA 1PBNA 1PD0A 3V9AA 1FTQA 1QHHA 5IDJA 4EYKA 3O2QB 3ZIUA 3ZHBA 4K6CA 1U3DA 3OZUA 1WB9A 4BT2A 4XDGA 1ADYA 3KCNA 1VHWA 2FGYA 5B1DA 1XO1A 1O6CA 4KMSA 4LV8B 3VOUA 5ICGA 3MW8A 1HOTA 5IJ9A 3CC2F 1I4EB 3WGHA 2R8PA 3KIPA 5HZGA 2RGEA 4G4GA 2ZYDA 3EXG1 4LGVA 4OAPA 4Y0VA 1Y6JA 3NLLA 5C1IA 3S7ZA 4RTPA 4RVUA 2A9FA 2YUIA 3PNOA 1Q6YA 3L0IB 5IABA 1WA5A 1Z45A 5E2BA 3CF6R 1RQLA 4GR5A 4OKSA 2CFTA 3AX6A 1R16A 4HS9A 2P78A 3K30A 1IN4A 3ZJYA 1T8SA 2YQZA 4ZK2A 3CW2A 2H06A 2WFMA 4M54A 1VBMA 1SD2A 3I92A 3CSSA 1WETA 1K73W 1QWSA 4ZRDA 3H97A 2WDPA 4H4CA 4RK5A 3TGPA 3MJ4A 3CNOA 4E0BA 3ROEA 5F1YA 3BZBA 1O89A 2HK8A 4UTZA 3DKVA 1OJLA 1OWOA 3TZQA 4RQBA 3PPXA 4H1WA 3LPAA 5KNBA 3LCMA 3N2KA 5L3EA 1I6WA 4QFDA 1JEQB 3PF9A 1XZQA 1A2KC 5B12A 4UTPA 4Q7MB 1KH1A 4W5OA 5JJBA 1XVUA 2I7XA 3GJ5A 1RRCA 1IBRA 3FPBA 1HL7A 3O8QA 1X14A 1LK7A 1OF1A 4DMFA 4L4SA 4C81A 4G4SP 1A9ZA 1UCFA 3DP7A 4JVMA 2JAUA 3EA5A 4R7ZA 4JLMA 3ID6C 2PWBA 1KUQA 1C0IA 3OFSA 3E84A 4P92A 4AECA 3FVVA 3CU5A 4DSNA 4GRDA 1NJ2A 4MWZA 3QU9A 2OV8A 4KXRA 3AY7A 2P41A 4JLPA 2Q6VA 2IW5A 3O8CA 1F9AA 5FLXM 4K88A 3UT5B 4Z2AA 2J08A 2BGIA 1BE6A 1YSCA 4LJAA 3W8FA 3U31A 2FMHA 4YR9A 2ZSKA 3SXUA 4EFNA 1IEXA 2P5UA 2OHVA 3VR1A 3FSEA 5AW7A 4BVEA 3HWSA 3GTZA 2F1MA 3T0IA 1E0AA 4UV9A 4HADA 3OE4A 5JEEA 2HPVA 1N3BA 3AI2A 4O2AB 1NBME 2QA4F 1LF0A 1K8XB 4UUJC 1AKMA 3A9VA 2QT0A 3R5FA 1IJEA 2QRGA 4J3FA 4X60A 2VPIA 1UJWB 1KPIA 3SN6A 1EX1A 5JI2E 3UAWA 3L7CA 1GYQA 1OHHG 3UA3A 2G25A 4RSGA 3L6UA 3ZEDA 5JEDA 2RG1A 1I3OA 1R8QA 4PLZA 2OBFA 3BHJA 3H11B 1SFRA 3CUYA 1P91A 1AQUA 4LTMA 1YIDA 2UYQA 4BE7B 8OHMA 5ERGB 2DUNA 3SVLA 4WINA 1Z2EA 2VH5R 1JWLA 3WZ2A 5ALTA 2JLUA 5JS6A 3M9LA 2QRVA 3A06A 4A5SA 1WDTA 1QJ4A 3VU0A 1VMGA 3U60B 3KHTA 5FOUA 5HF9A 4B3FX 2P68A 4GMFA 3JAWA 1A7KA 5JSHA 4NMWA 4I1SA 5TE9A 2C2BA 1JPUA 5JNLA 4Z9FA 3VR4D 3ZS9A 3FJYA 1Z16A 1JE0A 3QMMA 2GEJA 4FM9A 2D1TA 4LYHA 4BRSA 3LT4A 4M98A 5KYNA 1VL2A 3AJEA 4YY3O 2FR8C 3CE6A 5DHPA 4YAIA 4DAEA 5CN0A 2PAAA 1DJNA 2JJ8A 3FZGA 3RLIA 1VF7A 1JMVA 4NBUA 3R0XA 4GYYA 4KNWA 1O6GA 1WX1A 2P2GA 1BVRA 1Q91A 1HR0B 4HL6A 1M5RA 3WAGA 3LC0A 2XAGA 4QUIA 4Z4CA 2EFEB 3RBVA 3VKWA 3PV0A 3KOUA 5BOSA 2C8VA 3L05A 1OQAA 1Z22A 2L26A 1K8ZB 5L3RA 4E1AA 4RFSB 3WHPA 4R2MA 4XX0B 1N1DA 3SXPA 1NTZH 1IRXA 4YRPA 3CSDA 2WC1A 3DPSA 5GIPE 1QTQA 3SQWA 1IY0A 2AXPA 3DBHB 4NF2A 1E2PA 3JQAB 4M1OA 1A9TA 4EUSA 2VIIA 3ZLVA 6YASA 3TOXA 3BS4A 2QDKA 2GO7A 4KIWA 4BLUA 1G17A 3CIFA 2GK6A 3OPYI 3V7UA 1HDOA 3EXHB 1EBBA 1JXMA 3GGDA 4XUCA 2E4VA 3AIIA 1YB6A 3EAFA 4UEQA 3Q5EA 5D87A 3ESAA 1RLJA 2R5FA 1U0JA 3VFDA 2Z2KA 4RM2A 1JLRA 1UINA 1PJZA 2UUOA 5CBGA 3KB8A 3T7DA 2EBUA 4UHCA 4TRJA 3ZBHA 1YWGO 3K4PA 4AY2A 1CVLA 5LMUO 1XCBA 4K46A 3SZRA 2CVFA 1Y3FE 1I94B 2HQRA 3C3YA 3E9YA 1T2FA 3S1LA 1I3LA 3HVIA 4LRUA 4MTGA 3LX6A 1ZNYA 4FS3A 3HCCA 1IJBA 2XZDA 3JWPA 4BBZA 5IUJC 2GNAA 1AHPA 4NOJA 2GAAA 3HK2A 2C98A 1X7WA 4CMIB 1EFRD 2XB6A 2GETA 4HTFB 3OZDA 2AZMA 4Z54A 2OTJF 1IQ0A 3HFRA 2PKYX 3OQHA 2A79B 3L8DA 1OAOA 2DFVA 2I67A 4V39A 4J0DA 4DIKA 4C03A 4GLBA 4ZI7F 2F8LA 3T1OA 1N9GA 1M34E 2W11A 2FPPB 2PRYA 3W7UA 2R6FA 3O03A 3WADA 1RWXA 2RHMA 1AB3A 2B8TA 3A3NA 1CNFA 2ZPUA 4C4OA 2CZCA 2QL7A 3ZKWA 1FNJA 5FI3A 2RCVA 4G67A 4RM3A 1I24A 1MFZA 5CB4F 3KQUA 4J9YB 3TTSA 1BXRA 3QQ5A 4OYYA 2AX3A 4KHPO 4B40A 5A3VA 2AT1A 2OCLA 2MYNA 1RBZA 3KR9A 2WIFA 2IPXA 5BQXA 2KQUA 2ZSDA 4UDYX 5DNWA 5C4MA 2LD4A 3PFIA 5BW8A 3BJEA 3BF8A 1UT5A 1SXJA 1N5LA 3W2IA 2YWFA 4RLQA 5A3QA 1GGVA 2WJYA 2EIKC 1STOA 4HNSA 3IXLA 1X8XA 5CLIA 3V48A 1W4LA 5G0TA 2R6R1 4AZSA 1PTJA 1EJ6A 4XDJA 3ZDZB 1TU0A 3VDNB 1E7MA 1CY2A 4I46A 4UOZA 3STZC 3VR6A 4R6WA 2ATEA 1VLHA 2P2DA 2YJTD 4FFWA 2HA6A 3LW8A 3FY4A 2BIFA 2D2EA 5T4FA 3VSAA 3CX4A 3DMGA 1XLVA 3NOQA 3S03A 1S76D 3A0UA 1H0KA 2X6CA 3WDMA 3CUWA 3S70A 1ZA2A 2A0YA 3P9XA 4BGUA 3J81A 3ZRSA 5JBQA 5LP6F 3ZWYA 1TYDE 3NOVA 5DN6A 2FZWA 3OQ1A 5IFLA 4FOTA 1KI6A 5F4BA 2YC0A 3NCTA 2G71A 2POCA 4M86A 3T7IA 3PVSA 2OC4A 3LTNC 1L5HB 4FJ2A 4YCBA 1E9CA 5DYTA 3LTEA 4CQNA 4BMNA 2F8MA 4D56A 1JE1A 4EI9A 2GHQA 2J85A 3H9CA 4LI0A 5ALPA 4EHKA 3ECSA 3ZRWB 4RETA 4RHEA 2FAXA 1PFUA 1Z2OX 3AUUA 1E62A 4Q47A 1UT8A 1SXGA 3A6LA 1ENPA 1PM9A 1GZ3A 3CX7A 1PSWA 2OFWA 3QEJA 4ISCA 3ZMTA 3EPHA 2R11A 3DVAB 5IP5A 4GBED 5EO3A 3ZZ1A 2JDIG 4LF9B 4M0LA 2WLLB 3W8RA 2Q67A 4C6TB 4JBIA 4IGEA 4P4LA 2QJOA 1KR2A 1AR4A 5JAIA 3W4IA 3KT0A 1JMYA 1RAAA 1VQ6F 2EKQA 3PP8A 1QH0A 3EULA 1LLCA 4GZMA 1ZIOA 1H6CA 4IM7A 1VQPF 3PCXA 3FR8A 2X8WA 2ZSHA 2JLZA 2HQSC 3DO6A 4QBFA 2ZI9A 1NKSA 4I9HA 2JD2A 1VXRA 3D0OA 4X62O 2BFCB 3B7PA 1E9DA 3CW8X 3MJTA 1FSZA 3NJ8A 3B3GA 4Q4AB 4J6EA 3TB4A 1YH3A 1LSUA 4C82A 3GHZA 3FBAA 1QHTA 3KQQA 2FRDC 2Q1UA 1NZDA 1ZJ6A 1Y5MA 3Q3JB 5JJNB 4F8JA 3VBCA 1LSSA 4BW0B 3KZXA 1NXXA 1WY7A 4OQNA 2OGTA 2ARHA 3L04A 2VPYA 2AI2A 1LLUA 4R69A 1M2OB 4XJVA 3HI4A 3T4DA 3NG1A 2XB2A 1LNSA 2O1XA 3W9UA 5AKHA 1PPJH 4QICA 1A9PA 4RSMA 3I3FA 3G5UA 3A36A 1J9EA 1TJ3A 3E22B 5FD8A 5IC6A 4A5UB 1QHGA 2AH5A 5BNIA 3WKBA 1IUKA 2R68A 4LJRA 3G89A 3SPJA 1EUZA 3QPVA 4MV3A 2JG3A 4D9IA 3Q41A 1KAMA 3R9XB 4MDFA 1KORA 5JVDB 1MOZA 3LC1O 5LOVB 3KXPA 1UPCA 2BBTA 1TW3A 1LWNA 1KDOA 2Q0AA 1KU9A 4AIIA 4URXR 4XWOA 1OV6A 1XZKA 3OZ7A 4UULA 3NDIA 1M8PA 2Y4OA 5E38A 4IL5A 1KS9A 4UTOA 1BE3H 3H4TA 2WK1A 3ZE9A 1R0LA 2GRAA 2GFQA 3BWYA 1IY9A 2HEGA 1S96A 1ZD9A 4WFAV 1GTZA 2A5JA 3GLHE 3GJ4A 4CKCA 4DCOA 1Y81A 3VMFB 1K5SA 2OCCC 4JJZA 2DT4A 2HO4A 4Z1MD 1U7OA 1F8YA 2BKAA 4PV1B 4MUIA 3V33A 4GU5A 1U2PA 3B9BA 4U2BA 4RHAA 1FS5A 3D54A 2ATKC 2ADPA 5A0FA 3VH4A 3N87A 3USES 3NOXA 1QTNA 1IXZA 5IT4A 4NUTA 1M76A 2XMCA 3RYIA 1I5EA 1NMYA 3MLAA 3GQBA 4E2WA 2NUPA 3FD5A 4PYIA 3U7JA 3I5XA 3WYCA 1ZM4A 2GJ8A 4GXNA 2BKLA 2AZ2A 3IVXA 3VUFA 1VL0A 2JK5C 2V4DA 4X89A 4FWIB 4P3OA 3MPUA 3AF4A 1WS6A 3KCXA 1XA4A 4ZU1X 4U1RA 3THSA 5FWAA 1D2NA 5I01A 4ZYZA 4LSWA 2Q0OC 4XB1A 1FL9A 1CFZA 3KHSA 4KBYA 3G85A 3OIUA 3C1TA 2CKDA 1YHQV 3MLBA 4P93A 4L8JA 1C80A 3FDJA 3OKPA 4MVJA 1UMCB 1F4MA 4FHCA 4AY5A 3Q7TA 3C2QA 1JQEA 4MUNA 5KWIA 2H65A 1SOMA 1WLYA 3DTTA 1D5CA 4BECA 5HE8A 3AT1A 5JS8A 2OC9A 1I2DA 1XRRA 4EEQA 3L7NA 3VHRA 4YAWA 4KL8S 4WXEA 1XTBA 1W0KG 3U6KA 4Q1DA 1M8GA 2BY4A 1JG6A 3BCHA 1QHHB 1C0LA 3TFOA 4FTWA 4JR0A 5DIFA 5DEIA 1F8GA 4MUGA 3FTDA 5CXXA 4X91A 3EIOA 1HZZC 3ZLTA 4FYXA 3TZCA 3LU1A 2NXJA 2QTSA 5KCMA 5IJ9B 1WG8A 2AR9A 2IZOA 2FMXA 4CTKA 2G40A 3TEJA 2NADA 4B3TB 1K27A 4CGYA 1RPOA 1JS1X 1UBGA 1J09A 4Y2SA 1HDCA 1L9XA 1RZRD 5LLDA 4L87A 4N9WA 3HABA 5J40A 3S5UA 2A3NA 2PZFA 2NZJA 1UXHA 4KFRA 1ZOIA 2HSJA 2GASA 2J59A 2QSYA 5JYDA 1T8WA 2Q4EA 2ZT6A 5HIKA 2KSQA 2WPDA 3CCVF 2J9ZB 4OAQA 3GWGA 4GYJA 4OLBA 4HYOA 2AL7A 3RW0A 3QW2A 5FAKA 3LQ1A 2V7WA 2HBYA 4G09A 1E3MA 4P0PB 3I56F 3DAHA 1TO1E 3ON5A 5AKZA 4WNYA 1M73E 1WNFA 1YIJV 2ACKA 1RHJA 5KDLA 4RANA 4DA0A 3KZIZ 4J0FA 1U2TA 2QW0X 3BSYA 4E5NA 1P4JA 3N2KB 4FXOA 1S3GA 3FETA 3OUTA 4BTEA 4BTLA 2Y69B 1T4MA 3MT8A 4TPKA 2VS1A 4YY3B 3NGMA 4J49A 3GRZA 3IJRA 4F6LA 2FLVA 1ZIYA 4CF7A 2JAPA 3FFWA 5JJCA 2CNDA 1AZLA 2J0SA 4J3JA 5LZ7A 1XIVA 4LMRA 2VF5X 3O8QB 4HDQB 1RXSA 3H5VA 4MMYB 4B9EA 1OBFO 4RZ3A 4PIMA 2X7JA 2MSDB 3B1XA 4EGSA 1BFDA 4YXWD 3DZHA 2XSZA 5KTYA 3K14A 3IGAC 4TS3A 1XRMA 2OHXA 1EU1A 4ZGGA 4IUYA 4JJEA 3IVGA 4CDMA 3OEYA 2Q3DA 3CGWA 1J2YA 2F3RA 4RPIA 3S27A 4RQUA 4OGKA 1AV6A 3FVQA 1YJ8A 4NZNA 1GT91 2G4CA 2Q7HA 1VQKF 1F6WA 1OB2A 3WMRA 1IAVA 2NZ8A 4FN4A 1CRPA 3FW1A 1L7BA 2F1KA 4I5DA 1PEYA 3U9LA 1RIIA 4KO4S 5I51A 3OX4A 2F66C 3SXUB 5BR7A 4C0SA 2EKLA 4G5FA 2VF7A 4J9VA 1YL7A 4PSAA 4PHTA 1JHZA 1XDUA 3UAVA 3EVBA 1YUMA 1AHIA 1M74A 3IAYA 4LH7A 1NJFA 5KNDD 2CXTA 1SS3A 1R1BA 4L75A 4G8CA 5LZ2A 2F00A 3AG5A 1B16A 5CXQA 4XGRA 1Q0LA 4DGQA 4FYKA 4FS8A 4X8HA 3U09A 4DSTA 2XUIA 4KIUA 1RC8A 1ETUA 5C8XA 1NUPA 5LMUB 2ETVA 1QDEA 1KOGA 5JJJB 4FDMA 2IP2A 4M1TA 1TGVA 4EVQA 2VRZA 2EDAA 1AKWA 2FPSA 4ENTA 2I2WA 5BV0A 2QJTA 3E0QA 2E1PA 4UBOA 1RKVA 4JKOA 4CLOA 3W7VA 5D3QA 5F9MA 1T3SA 1MAUA 1T4DA 3OO1A 2Y0PA 1ZW1A 2QRVB 5B1AB 1SOVA 4Z1OA 1E2FA 1T9AA 1Z4JA 4CH4A 2X5NA 5FLYA 4Q7JB 4I9NA 1NFFA 3GD5A 4KDEA 5LU9A 4EECA 2H7XA 5CP8A 4PINA 1ZK4A 3FCOA 3JAWB 1RMQA 2A7QA 1GR1A 1MPTA 2QD2A 2WAMA 4CMCA 4D3SA 1MCZA 4C6RA 2KG4A 5T4BA 1KYTA 3EIEA 5BV2P 4NMHA 1S4QA 1T34A 4XCXA 2WF7A 4XVQA 1IN1A 1I2MA 4RIHA 2VP2A 2P3QA 5TPZA 1BHO1 1F5SA 4UM7A 2VLIA 1MQ8B 3MB5A 1PUIA 3L0OA 2YV5A 2O23A 5B1BB 4RV9A 2PMEA 4HZ3A 2O2YA 5I9SA 3B77A 2XQIA 4OHYA 1SHTX 4M9UA 3VI3B 2WVHA 3R5KA 3QJ5A 3VKGA 1T2DA 4BC1A 2YXBA 2HTFA 2YHBA 3BFPA 2H6EA 4J4HA 4HFJA 2GZRA 3IKTA 5BOSB 4IAOA 1WOYA 4R5MA 5BSGA 3KJQA 1IB6A 4G01B 1DCFA 2FZKA 3W6PA 3QVNA 1X1RA 3QU5A 5FX2A 4JV5O 1ZWLA 1WXHA 4KXYA 4N5DA 2PGDA 5LQDA 3FYEB 1Z36A 3THOA 3ZVKA 3TX6A 2IHUA 2IY9A 4RWEA 5KB3A 4KC0A 3ERNA 4YHBA 1EGQA 5ECWA 1PR3A 1VCNA 1U7TA 2F64A 4P84A 4XSVA 3L43A 3TJRA 2D4AA 3NAQA 4KL1A 1V8FA 3HBNA 4EUNA 1JXOA 3CYOA 5L6LB 3TB6A 1RYHA 3ZK9A 1GAEO 1GGJA 4UAUA 3IVCA 1GLNA 2Q73A 3W6OA 1NUAA 4HWPA 4JIGA 1E4YA 3Q0IA 2J5RA 2D2XA 5KDDA 2OR3A 3QNUA 3P0HA 4D8TA 1EZVH 1KYVA 4HAUA 2VUTA 1N33O 2DGDA 1W9HA 3DG9A 1G1MA 3TTXA 3CH7A 3P0JA 3SLKA 3E1GA 3ZNOA 3A58B 3FYUC 2JKYA 2R4UA 3WC4A 3VV2A 5HIIA 3EZNA 3OURA 1X7WB 4PLTA 3ACCA 2BMWA 4M49A 2A30A 1Q0TA 1JHXA 4K81B 2AG5A 3TR5A 5G3YA 2OHHA 3NHSA 4G0XA 1UBUS 1HMYA 3AJRA 2XXAA 4CI0B 1RRGA 4IIJB 1Z56C 2FR1A 3URKA 3IT1A 1U0TA 4FE3A 3Q7IA 3TECE 2B0JA 3KJIA 3SOPA 4D9JA 1LW6E 2TMKA 1T8UA 3ZDYB 1SKAA 3ZCSA 5COQA 3RW9A 3S2UA 1XZCA 1KQPA 4G85A 1N9GB 2ES4A 3GLFA 2YV3A 1MENA 5AM4A 1JX6A 1YU6A 1J95A 3V3KA 5CFZA 3ESRA 2Z09A 1AI4A 4WAUA 2CNKA 1A1SA 4KV7A 4HNGA 1UPAA 1RNLA 4IIGA 1OFUA 3ZKWB 1RI1A 4ZAXA 2JFGA 4H6PA 2XUAA 1EHYA 1Z9BA 3RRXA 4TZ6A 3ENWA 1Z5ZA 1BXRB 3QHAA 5LQCA 4EWLA 4RVNA 4RUKA 1XK7A 1CRZA 2IQ5A 4C4XA 3B8MA 2XE6A 3GXBA 5HUQA 1UKYA 4OHPA 1CNEA 2CWJA 4TYWA 4I8IA 2ZBDA 5A3JA 5E1AC 1EVYA 2XKKA 1SXJB 1JX9A 2H0RA 1A98A 4QTZA 5KC8A 4AL4A 4C3VA 5I8ZA 1HE8B 4Z4HA 2D2IA 5CDTA 4B6JA 2AN4A 3TLBA 2V1DA 2WP0A 2RCNA 2C9DA 2FH5B 5C2JB 3TSZA 4Y7DA 2PI5A 4BJ3A 1K66A 5IM4A 5CB6A 3MCWA 2VDPB 2PJZA 4L6IA 4C0HA 3P3PA 4A8JA 3KEMA 1U5AA 1H2LA 4MA5A 1GUFA 4B3CA 5JHHB 1HZJA 2QLBA 4DLZA 5GIPC 1FLDA 1G4HA 4YDQA 1ZOSA 5DX1A 1K8QA 1KI6B 2OLEA 1SQBH 3STVA 3VYWA 4RKRA 3JYQA 2F7SA 1S2GA 1Z6AA 4XYEA 3AG7A 4N9QA 2J07A 3K06A 1KI3A 3OJXA 3ZDEA 3JAMN 4PF1A 4MQUA 3W9YA 2RAVA 3IOCA 1F4NA 3FZEA 1BKSB 1ZR2A 2KI5A 2UXXA 3WBKA 1K7FB 3BORA 1WV1A 1UM9A 3JALA 2FKAA 2OCIA 3FB1A 4PCLA 7AT1A 1EXDA 1GV1A 3GLUA 3VOSA 2WTBA 4MKXA 3EXHA 3CCBA 4O0LA 1CQJA 5EE5B 1XRJA 4QE3A 1R9GA 3HI6A 3MS7A 4XLLA 3U7EB 3F1KA 3N6VA 3FVRA 3PJRA 1F17A 1YQWA 2XHZA 3IT2A 4DDHA 2CXRA 4MJLA 5AW6A 2D7CA 1JH9A 2JFOA 1QG4A 2LW1A 3K15A 3Q3HA 1Y1LA 3LZDA 5FFNA 5DI3A 1E3SA 1R15A 4F2HA 1PV4A 4LF4B 1KKCA 3EIFA 1L0BA 1F4LA 2GCOA 2A9KA 4EY4A 1E3DA 4JMLA 4BU0A 2BR3A 1T0UA 3S4YA 1YI2V 5IY5B 5DEOA 3O1HB 3DM5A 1VQMF 5ECDA 2I6DA 3I2FA 1P5RA 3ZR4B 2ECOA 5M04A 1NR5A 1KD1W 2GJ9A 4LYGA 1RLGA 3GDHA 1YI8A 3JR3A 3E8SA 3QNMA 3ZU4A 1FQOA 3D8TA 4UXIA 3M1AA 3IUMA 2IHJA 4I5FA 1KE1A 4E5KA 1YV9A 4G6ZA 2P4VA 5T7BA 3ZBPA 3BMXA 1YC2A 1H0SA 2RHGB 3QGMA 1SZCA 2PGOA 1CZRA 5EJ7A 2DPHA 3CD6V 4AUKA 1MJGA 4KRGA 3P9PA 2C0CA 4M36A 1NWCA 2Q69A 2I29A 4LXXA 4BVAA 1U40A 1FD9A 4MGZR 1JQ3A 2WALA 4RTNA 3BTUA 1MB9A 1GUDA 1UMKA 1VQOV 2WD8A 2XAHA 2VT3A 3ZHCA 4P34A 4CG2A 1HR0O 2ZRBA 5HIJA 2FPGA 3TQSA 1U0BB 3R2JA 5GMOA 2BGGA 4IHJF 1H23A 4LHEA 3UF0A 4NOMA 3K5NA 1OLUA 3EBLA 4COKA 2FW8A 1XHEA 2Q5QA 3F7TA 1L8XA 3UV7A 1D2CA 2RQ6A 3O3MB 4MICA 3ANMA 4D45A 3C5EA 2V97A 3EQ7A 1I01A 1JF8A 1ZM7A 1M8JA 2J4FA 3R3WA 1K92A 4E1VA 3OUUA 2I65A 3SM9A 5H9VA 3HNPA 2ZXEA 1R7RA 3DXRA 3T5PA 2HJRA 4QTUB 4ZK6A 4R7TA 1BMDA 2CVHA 4S2EA 3Q7SA 1DP4A 5FADA 4OUKX 4JYMA 3QX8A 5LD2B 2AQKA 4CKCB 3SWWA 4G37A 5KEIA 3ZDAA 2CE7A 4PFKA 4FOSA 3LV8A 3LYHA 2X3FA 3A4MA 3T52A 4NYMQ 3FUTA 1LF5A 1YFKA 3KKOA 3K1JA 3RYIB 1AXGA 2C31A 4LDPA 3GQBB 3H8VA 1BHAA 2XECA 1I94O 2NUPB 1WP8A 3A1UA 5L6MB 3O9OA 4U39A 4Q5IA 2A7XA 4OV6B 4TM7A 1JDVA 2G0TA 3NBMA 4NWOB 4EW3A 4HSEA 5G2OA 4DKXA 1YUNA 4HWKA 1UFRA 1LPSA 1W0CA 1FU7A 1RHKA 4CODB 1QR6A 3CCUV 4HV4A 1SUAA 5IAEA 5JMPA 5FWYA 2C9YA 3RO7A 2C1ZA 4OQMA 3IEMA 3OG9A 5FBHA 1SVKA 2AIFA 5EY5B 3BY6A 1D4OA 1SQ5A 3LP5A 1GLVA 4MB2A 5FBRB 2F95B 5F35A 3VX3A 1RE1A 3Q9UA 3OA2A 1A32A 5JY1A 3LSTA 3L7MA 1YACA 2CHGA 4N0QA 1U90A 1XELA 1GARA 1A95A 1C1DA 5CDUA 1N6KA 2QS9A 3BAZA 1Y3HA 5HFMA 2EU8A 3QKTA 2HMSA 1F8FA 3ST7A 2JK0A 5CDYA 3EH1A 3U7FB 3BEDA 4BZPA 5DM6V 5A4FS 1XKLA 2Q5EA 2ZIXA 2AMJA 4B3MB 2PE5A 5G1NA 5EIAA 2DX7A 3AVXA 5A04A 3RBZA 4MT8A 2QY6A 1MQSA 3T3NA 3CNLA 4LDZA 1IL0A 2XMRA 2ZSIA 2M6YA 1IQRA 3FB4A 2X42A 1LQ2A 5ICMA 4DB4A 1BX1A 4UBJA 1E0SA 1F2TA 2R62A 4DARA 1T1IA 2HYIC 3P32A 4ARBA 1RR6A 1T3LA 3UC9A 5G41A 1NYTA 2P7IA 4AKSA 4H7KA 5A0VA 2ZRFA 3B48A 4G4XA 2ODTX 1Q7YH 4FIDA 2ZREA 4E6PA 2D54A 2OE2A 5ES3A 3NM6B 2RI0A 3BVPA 2RHDA 2YR0A 2HA3A 1W93A 2PT6A 4I50F 3DXZA 5IVKA 4HZGA 4TMFA 3SGLA 1YXBA 4IGAA 1N92A 3OTIA 2QYHA 3VR5H 2YRFA 4Y2RA 3C7KA 3UH1A 4L5AA 1GQ2A 3ZP4A 1ORHA 2YINC 5J5CA 3FWNA 4QDTA 1GT6A 3BH6A 5JCPA 4ZZ3A 4PX5A 2C9BA 3QO7A 3WNBA 1WUYA 5BSUA 3AG2C 2Z5VA 2CXUA 2XGOA 3CH5A 1AUPA 3QVOA 4LJLA 5IN5A 4G27B 2IQQA 1HP8A 4G2TA 3ENNA 4RNDB 4DLWA 5ALSA 3OD5A 3WGMA 3T9BA 2FZ4A 3IAAA 5T4EA 1GPYA 2Y1EA 4GI2A 3W5SA 3NK6A 5J2TF 1P8JA 2WM8A 4FN5A 4O4HA 3FI0A 5G4VC 1CUUA 2E48A 3THXA 4LF9O 3IQZA 5CFMA 4EB0A 3B70A 1JECA 1GKUB 1H4VB 4C89A 3I76A 4B6PA 3BGDA 3L3BA 5FI5A 2JZCA 4PVCA 3AB3A 4EO4A 2H59A 4L8GA 1KI7A 1JQLB 3GGPA 2IU6A 4K26A 5KYWA 4QGBA 4B3XA 2PDAA 4ND3A 3UEOA 3ZBTA 2C2ZA 1G9SA 3C41J 1X4TA 1QPZA 4BT5A 4IKOA 5DWVA 1DAIA 1X7OA 2NNUA 4TMXA 2P35A 3PE3A 4M7RA 3D7RA 5T64A 1T5BA 3JARA 3LWRC 2Q50A 3PHGA 4BQNA 3CYPB 3F6YA 2RHWA 2PZKA 5KTNA 3K9NA 3H99A 2HSEA 7ABPA 4UBLA 3QLTA 4Q03A 1V3TA 5CG1A 3IFSA 3R6GA 4AWBA 3R7NA 1DQNA 2JIMA 2Q7GA 1W30A 1E6WA 3UKMA 2EWWA 4CLOB 4A0GA 2ISCA 1FQKA 4WKCA 2F1HA 2CNWD 2X7HA 4HUTA 1KRXA 2YXHA 4B2YA 4XX1A 1YBMA 3ETCA 3L4BA 5DO9A 3P9YA 2IW1A 5KTTA 3OZCA 4DQUA 4GSKA 5HCNA 4P5DA 2QJRA 4ZAWA 1XCMA 2L2QA 3GELA 2I4NA 1GHTA 4JKIA 1RAEA 4E5UA 5F12A 3CSUA 4HNUA 3WYDA 2ET6A 3FNBA 1T1RA 3ZVRA 1EZ1A 1Z82A 2FYUH 1PNQA 4IF4A 4WXYB 4FCWA 5TS3A 3K05A 5LL6P 1LX6A 2C29D 4RTLA 2SKEA 6PFKA 5IE9A 3HCOA 1N8SA 3ADOA 2CLOB 1QHXA 3I64A 5JR3A 3AVUA 2Z5UA 3QX3A 4KN8A 5K3OA 4OQEA 4HXYA 4KLNA 2ZUEA 4XOIA 1Z06A 3HP7A 4BQIA 1ZD8A 2ACEA 1NDUA 2BRUA 2JCGA 4NBWA 5G0VA 3E61A 4E2YA 1PZHA 4MWEA 4JUFA 1UK6A 3L0YA 3LUGA 1V7PC 1M2JA 3C7TA 1YR3A 2HXSA 3ZD6A 1GVNB 4GOND 2ZUFA 1KH2A 5T3YA 5A0TA 4ZZ2A 3UKJA 1WXFA 4F3NA 4TXHA 1TCBA 4EBFA 1M90H 4DPLA 5DCLA 1O95C 4MVXA 5HKAA 3G80A 2WG1A 4TGLA 1M5UA 1IIRA 4D3ZA 1XHFA 1VIYA 1SB8A 3WYBA 4N49A 1QX3A 1LI7A 3L8FA 4XDZA 3FBWA 1OSNA 4ENSA 1WQ3A 3EC1A 5G4UC 3NXKA 3RS3A 4D9GA 2UUPA 3QW4B 2XT6A 4CT4B 2OZPA 1GTOA 3ABMB 1GO3F 4FUTA 2E4WA 4NARA 3ILXA 4MW0A 1XI2A 1L8AA 5ILOA 1E9VA 4ACAA 1I7QB 1P44A 1I1QB 3DW3X 1W581 4IJKA 5NULA 3L7LA 4OHWA 2VHVA 1IV4A 1V1MA 3QVKA 2IH4A 2P8SA 5K3CA 4MQBA 1O08A 4KYIB 3K16A 1PLLA 1CPYA 4LRXA 1L4UA 5D86A 3RHTA 1ZYUA 2HP8A 2C4UA 2W4QA 3DQZA 4WN9A 5JYCA 2CKMA 3Q9LA 2RHTA 1U80A 4JB3A 1T25A 2ACWA 1QQ5A 2R65A 2VRNA 2FWJA 2GZ1A 1R3UA 2XXAB 4MW7A 1DJLA 3IERA 3D8SA 4TTQA 5KVAA 3GT4A 5L3DA 5AKJA 4KPEC 3PD1A 1WPRA 2OQRA 1FP6A 4FGJA 1PCXA 5CCBA 3RJ5A 5CUQA 1YJ9V 4FSHA 1DG3A 4ZTZB 4MSUA 5BUCA 4C7OA 3GLFB 3N76A 2XB9A 3GQVA 4B3TO 1FUEA 1TNDA 5HVNA 3PC7A 1MHPA 2VXYA 4HRXA 3AR4A 3LDDA 1CUYA 1K7DA 1QUEA 4LXYA 1K5PA 1S8NA 1H5UA 2ZGVA 2Q29A 3BXPA 3L0ZA 3GWZA 3OI7A 4UTRA 5B4TA 5B3SC 3SDSA 1JEDA 2CVPA 4II2A 2G63A 2BCCH 2HD4A 4AICA 1U8FO 4DV2O 1JAIA 3ECCA 1W36C 4RE5A 1U3LA 3TRIA 4EK9A 1OIXA 4YDRA 4LV6A 3B53X 1DT5A 3Q88A 2ZK7A 4YP1A 2JGRA 1X1TA 2FX2A 3TLCA 3HL0A 2L35A 5I8PA 3N74A 3NHKA 2QM8A 1JIIA 4V02A 1NTKH 2ZBGA 1UC9A 5FRDA 2PXHA 4K2HA 5J58A 1N0NA 3EVAA 2O20A 2PSDA 3HY6A 2JCVA 5E7QA 2IZ1A 5IC5A 4A8JB 2O7RA 2HS4A 1G20E 2BAGA 3K94A 2PO7A 1C14A 1BE8A 2CWDA 3DLAA 1SG6A 1EK0A 2QRNA 3CRZA 1GAWA 2VOJA 3IQFA 1MMMA 3UGKA 1Q1ZA 1UBKS 4BKPA 1X74A 5FL7G 4UNSA 1NMXA 2CUKA 4KI0A 2BJVA 1MOSA 1RKUA 4EJFA 3H3JA 4JLDA 4YR7A 4PA7A 1XQ6A 2B5VA 3CCMF 3K57A 3VSCA 3FKSG 3M81A 1J22A 4FZRA 1VE5A 3UV3A 1OTHA 3HKDA 2IELA 3PUHA 3CMAV 3W2GA 1UM9B 3DBOB 3ZDRA 2NYAA 3ESBA 5CGQB 1G4AE 3JALB 4RELA 3DZKA 1ZDMA 3CRAA 4PU0A 2G36A 2IYQA 3WQHA 4CKYA 1V8DA 2J9XB 4BLOA 5TQVA 4D3YA 1CQJB 4BNLA 1ILEA 1TJYA 3LY8A 3CRMA 1ZSNA 3BBLA 2UVDA 2QKYA 3LPLA 5IYBO 3E9RA 3NHLA 1BGXT 5H1YA 2YVQA 2EJVA 2YOGA 4IOJA 3ZJ5A 3PGLA 1HE1C 5DI3B 3VKUA 2OO3A 1KYYA 2EBWA 5ITVA 1S77D 3EVGA 5LWQA 2RHJA 1SRQA 1SQSA 4DY6A 5HIMA 4RMIA 1VXOA 3LSQA 2AMLA 5C7YA 3KXIA 2GCOB 1YRAA 1HQYE 2EWCA 2WU0A 1HT3A 3QXHA 4OKNA 1ZCAA 4EMUA 2EZ4A 2VG8A 3A26A 4EA6A 4FDLA 3OLCX 2ZXWB 4XD2A 5JWPA 2G82A 1BCRA 3VTKA 1XPJA 2DQ3A 1HC7A 1P19A 2P1RA 1QZTA 2BBWA 1F8UA 1U3UA 2QE6A 3SEZA 1BWRA 3H2SA 1DTWA 2GBIA 4DRXA 1JFSA 3OQVA 1HE2A 2CC2A 4B3DA 5B6PA 4IIJA 2FW0A 5BR4A 4TL6A 1QIEA 4Q7LA 1XTTA 3ROMA 3TQRA 3AUAA 1U7WA 1I33A 3TI9A 8MHTA 1BXKA 5ALRA 4LMAA 4IUBS 3KE1A 3ZQUA 1L4NA 2PRKA 3D6NB 3V42A 3GRAA 1H2NA 2BKEA 3B82A 1XOUA 5LA6A 1EUCA 3JYPA 3HY3A 5T6BA 4KXLA 4BWGA 1M66A 3T15A 2D8MA 2P1ZA 3NFYA 2Y1WA 3H2JA 2PX4A 1Z8HA 1Z63A 5JLAA 5DTQA 3MWFA 4LMPA 4YRRA 1L4MA 2FPGB 1Y1KE 2IDMA 1JILA 3FUWA 5P21A 2Z1FA 2JANA 2I55A 5AK3A 4ZOQI 2BSXA 5MN6A 3ROGA 1Q81W 1OLUB 3ZWCA 3UMYA 3QIAA 4ODIA 1IMOA 1SQXH 2DHCA 4EMTA 3PSAA 4CIYA 4P80A 4MDHA 4P35A 3F7OA 3GEMA 5JDCC 2RC6A 3CE2A 1LPMA 2H7YA 1KJJA 2NQ2C 4AUMA 4EP1A 3MB8A 4EI2A 2IYXA 3P71T 1P0PA 3LI2A 1AJPA 3IL2A 3CCRF 2ZU0C 3DXRB 1SJ9A 2QL9A 4OSEA 3REQA 5CM2Z 3GRKA 1YAHA 3JQBC 4MJ7A 2HEIA 4TYQA 1CK4A 2H4WA 1LV8A 3GVHA 4BB9A 4OREX 5HJ2A 2Q4RA 3L46A 4MS3A 4KO1S 2BMDA 4XYMA 4DR3O 3KRTA 2LKDA 4OVKA 4FKZA 3O83A 1USGA 3TZKA 3SZGA 1ZG3A 3BKWA 4P0TA 2V5UA 1BT8A 2YIAA 5ELMA 3BIOA 1IXYA 3QI2A 1YTFB 2OENG 3E5MA 1LJLA 3N5KA 4AJKA 4J7UA 1QU3A 4IWXA 4OAOA 2CGOA 4P3NA 4TTSA 1W6RA 1SC6A 1VI5A 3C3DA 2H4FA 1M2HA 4R98A 2QR3A 2EL7A 3MHHC 3HB1A 2IX9A 1VM6A 2QWNB 2GT1A 5T4HA 3DL4A 1R8XA 1T4CA 3FE2A 1KI2A 3EGEA 5JPIA 5AUPB 4F8YA 1FXKC 3BL8A 2VATA 2PK3A 5FWYB 4FHGA 3MLEA 1LI4A 3D7MA 3I05A 2VK2A 4LV5B 3EGIA 5KSWB 3M4NA 3MUEA 3BF7A 4M83A 1HT2E 4LDJA 4F06A 4E4TA 1J0DA 3FBTA 3RYFB 3UBMA 1SZXA 3FMGA 4DSZA 3UOWA 3L1VA 3RS4A 1OXBB 4EY6A 1C1DB 4EG5A 1II9A 5AI5A 3ENZA 2HA7A 4NONA 2JFVA 1IK4A 1RAFA 1T9GR 4D92A 4BATA 3JAMA 3WS7A 3ZWNA 5B1SA 3HA5A 3TW8A 4LDRA 4S1PA 4ROTA 3CRRA 4BNFA 1A7AA 1F9EA 2ZIXB 3FGZA 1HL3A 7REQA 1V6SA 3G2QA 2B4QA 3L7AA 1KOLA 3E9MA 2PMPA 1DAKA 3UMMA 2YYZA 1T10A 2QUKA 3QLUA 4Y67A 1P2GA 3SQMA 5JW6A 3W8DA 4PYNA 1W2BU 1ZGZA 3OCUA 1QLEC 1Z0DA 1K6XA 1MDFA 3OEED 1F2TB 4CF4A 1XG5A 2J3MA 1VGVA 3QY0A 4LSZA 3ORRA 3O38A 1SQGA 1JYEA 3VQXA 1TZBA 3DGEC 4G0MA 2BL4A 5C81A 2NUTA 5F73A 5CVVA 3FPCA 4ZCSA 5TJ9A 5B58T 2PN1A 4PPQA 3RUCA 1CDOA 4XGKA 1CKEA 3TVYA 4NV1A 1DC4A 4OHMA 4ZAVA 2V9YA 3GEEA 4TQUS 4PAMA 5F1PA 1GNLA 1AXRA 3AUXA 1U1FA 4YQFA 1PJTA 3CT4A 1TUEA 3AR9A 4YHHO 1D7OA 3D5QA 1NI8A 2I2XB 1D1PA 3RT1A 1XDSA 3KCYA 1BRTA 4WNCA 4GI5A 4EHFA 2C3OA 4JVOA 3L71H 2IHYA 5H9WA 3D2CA 2PUEA 2PQ6A 1G9TA 3VPDA 5HFJA 4W4LA 5FWNA 4EPTA 4X90A 3L0SA 1JHYA 3FTFA 2FUG6 1W42A 4Q82A 3WGLA 1XVAA 1KJNA 2WYUA 4B08A 5BNTA 2NAPA 4JQYA 4BT6A 5LDHA 2QJWA 1CJUC 2CJPA 2XNDD 4O4HB 3PE6A 4I4NA 3SKYA 3THXB 2YVUA 4NU8X 2ONKA 1Y9EA 1GTMA 2RN9A 4JP3A 4G4JA 4PTZA 2ZR2A 1UEIA 1R6KA 5JANA 3CPJB 3KZCA 3M5WA 2AFIE 4HLCA 4LF4O 1LNQA 2QKAA 3EVZA 2YJZA 2JAXA 3M89A 2IEIA 4H6WA 5KYWB 1TTQB 1E9SA 4UM9B 2D0OB 1P1FA 2GYWA 4H7IA 3ICPA 5IJWA 2C97A 3O2NA 5C35A 2R7MA 1NW7A 2GHTA 4FIZA 1YVEI 1FDOA 4EL5A 3CLRC 2AYZA 2H5IA 2I4RA 3JARB 1D0SA 2XJ4A 4Q3KA 4P1ZA 2RHLA 4M46A 4WCEV 1U0GA 1SNYA 3T7KA 1XV5A 5I9MA 1Q2UA 4W4TA 4NZOA 4I6EA 3TXYA 2BJHA 4KQFA 2YW2A 4OA8A 4PPGA 1QQAA 2QD1A 4FGLA 2OORC 1IVNA 1KHHA 1L7EA 2C4HA 4RPLA 2BGWA 4FYPA 1Y4ZA 2IWRA 5KWVA 1K8AW 1IDSA 3NRCA 1VIAA 4L72A 2ZBRA 4GMHA 5DHTA 2X13A 1V55B 1T6NA 4QLOA 4BHTA 1HT1E 1VRVA 2HBZA 3IBTA 5BUSA 1UKEA 3MTEA 1C7JA 4Z7NB 3VX4A 3SPHA 4A6XA 3MVEA 3I9V1 4NZZA 2W6NA 4ESVA 3W1WA 4LQ4A 5FOQA 1DHTA 2XWJI 1PR5A 1IHPA 2ZWIA 2JRLA 2R4QA 1BC5A 5F77A 2Y0IA 5BQPA 2JLCA 3BAFA 3JYCA 3AFOA 3PD0A 5FLKA 4QHYA 3IIJA 5JCOC 9ATCA 3GRFA 2Q9AA 3C3BA 4EEXA 1NAIA 3G2JA 4U3JA 4KPFC 4EO9A 4R2KA 4ZD6A 2ST1A 1EA7A 2CL0X 4WEQA 1A9SA 4P4TA 3KNZA 1F0PA 4WZBA 4RTRA 4BR6A 3ZHOA 3LNMB 2WYHA 3GRYA 5I48A 5JTTA 1AGXA 4FQ8A 4YPVA 5FTMA 3GVXA 4DV2B 1D4ZA 4XLTA 3UMBA 2FZCA 2ZRQA 4NYMR 2WSYB 1IZ7A 1JQJC 2IG8A 2FA9A 5HX7A 4F12A 2ZNJA 1LZKA 1UODA 5B5SA 4OQLA 2QVZX 2WUEA 1Z2GA 5E9JA 3L8ZA 4EITA 1BROA 2G6TA 4EHBA 1NDHA 3F71A 2ZS8A 3PUJA 4ZI7B 3CLUC 3H0CA 5DBEX 1XQYA 1XBIA 2YMQA 3L6DA 4KIGA 3CXUA 2G9UA 3DKIA 1S3IA 1G7RA 5LNK6 5CDFA 2XRZA 2PUVA 1N1EA 3BJRA 3BCUA 1GNTA 2WNHA 5IJ0A 2RGUA 3BFXA 2RGCA 4HEJA 2RGNA 3FPKA 3A6EA 3MGKA 4WA7A 4BIMA 2FN8A 5BN3A 2WNSA 3K0GA 3HCRA 3TPFA 4BN5A 1TE2A 5BSTA 4UUBA 1XMPA 5M7EA 1DIOB 1N2XA 4NV0A 1CR1A 4TQDA 3SDLA 2ZCJA 5L4SA 1E5DA 1ZMXA 3WA7A 5ARDA 2J09A 1WAZA 1JJ7A 3A9SA 2VH1A 4ZYVA 3WWDA 2ANBA 5EIBC 3M1XA 1XUQA 1UBJS 1KVQA 3CF2A 1GN3A 2B4RO 1M0WA 3JZAA 5FIUA 1ISJA 3FIUA 3U7RA 2D06A 1V1MB 5C3MA 4PDVA 1H85A 3B5JA 4P9NA 1Y1QA 2PWPA 4M3NA 1ZD1A 4GLFA 3KVRA 4FZJA 1SMKA 2WKQA 2V0NA 4WN9B 2KX7A 5B3JA 1JV2B 2GM5A 1QB7A 1AH2A 3WLNA 3KHKA 1EXNA 2HMVA 4JITA 2HA0A 1YL6A 4NCBA 4U8HA 3L2OB 3X1JA 1XL6A 1YFZA 1E69A 2ECKA 3OD1A 3MIZA 4ZYWA 3O21A 4QL3A 3KELA 3NBUA 3JWIA 4NKRA 4GDFA 2IPMA 5L45A 5LP6B 4B3MO 1HDEA 2ZZKA 1DT3A 2AR7A 3CEHA 2W6JA 4BVRA 4MWDA 1RWWA 1OWMA 3TW4A 2GGSA 3K6RA 2B2XA 4C7OB 2J6CA 5KUKA 3U4DA 4CT5A 2YIBA 1Z62A 5H82A 2B9EA 3K09A 5D2CA 3K4QA 4D4LA 5TJHA 4WA8A 4X84A 2YN0A 3EIUA 2YXYA 2WMNB 1G8JA 2CMFA 1L4EA 4MRRA 3UK6A 3ZY2A 3ND5A 1HTBA 5K0SA 1EFCA 4XVHA 2QTOA 3W7BA 1VSBA 1W5TA 1RQPA 3PDJA 3BPZA 3H1JH 2W7TA 5AIBA 3QG5A 1I3CA 3K70B 5JS1A 1YRQA 5GANK 1AKVA 1NV8A 4LZPA 2C77A 5DNCA 4OP1A 3ZWVA 2O3QA 3ANTA 4BNXA 2P22C 2FPWA 1P7GA 4L85A 4BNHA 1AK1A 3IAFA 5AKGA 1SC4A 1YEWA 4DF3A 4DJTA 3FF4A 3K59A 5G1PA 3NZEA 2WWTA 1GDHA 2ZDGA 1B26A 2ZTMA 1ORWA 2DTXA 4JT4A 1B0AA 4RK1A 2PUBA 2IFTA 2UXCO 4XR4A 4MLZA 1T5EA 1ECCA 1RLTA 4LNUA 4KRXA 1RE0A 2PIDA 4UJ5A 3FTQA 1MO5A 3CPHA 2C3MA 1U7HA 2WTUA 3CXRA 4W6ZA 3F47A 4W7IA 1M33A 2R1VA 5DP1A 4XWWA 2W5UA 3I42A 1AA9A 3CYQA 4Q3AA 1YBFA 4CIVA 2Q6KA 3RS7A 5D00A 1NX9A 4H0LB 4RORA 3COJA 3J80N 2E4XA 4HPWA 4LJ8A 3A9WA 5J1SB 3IELA 2PGIA 1JMKC 2PR2A 3T94A 1RW4A 2CFSA 4L07A 8ADHA 2HKIA 1KERA 1M57C 4FFMA 5KAPA 2X7RB 4Z5XA 4YS6A 1I5YA 4U6NA 2IUYA 1X0VA 3W3AH 3EZYA 3HKDB 4CS3A 4FM1A 1USVA 1M1KH 3PPVA 3M6IA 3KJKA 3GDWA 5SY4A 1R27A 3GL9A 1R8JA 4JP5A 4P4SA 3VZRA 3ZWBA 3VC2A 3BA1A 4F9GA 2Z43A 3CKYA 2QTMA 5LHIA 3B36A 3LDFA 1SUBA 4GPAA 3HHEA 1ZVJA 3HJAA 4ENVA 1H2GA 2V3CC 1NFRA 4DR3B 4LTNA 4D9KA 4E1BA 5J23A 4MTOA 1Q0PA 4HGYA 2EILB 4YRDA 1WCXA 3HP1A 3AUFA 2QENA 2AWNA 1NZ6A 1BAPA 4L2IA 4LRSB 5LQUA 1QVWA 4MGEA 3U61B 3IBYA 1V96A 4JHXA 5B64A 3GT7A 5DNAA 3QTBA 1ZITA 3FOEC 4MZXA 3WTCA 5E8RA 2B4TO 4D8UA 3JSNA 3FB7C 1PQ4A 1VDMA 2XZLA 4TZKA 1BCRB 1WKVA 1UDAA 1OW3B 2OYSA 3WK8A 4MARA 2BFPA 2X86A 3ZTYA 3T9CA 2YWRA 1DTWB 4WVLA 4DRXB 1EWYA 3COVA 2QE7A 3V1YA 2FPOA 4W5QA 2OBYA 4J7XA 3J7AC 1ZM3A 1B6RA 1UXIA 3HEAA 3DM9B 2CUNA 5JSKA 3KQSA 1JRLA 4JTCB 1Q8RA 5JH7F 5HRUA 3FNIA 1Q7CA 2WSSA 2NPFA 2XD9A 3OIWA 3RYTC 2X9LA 1RABA 5BN4A 4US1R 4ARUA 3E03A 5LA6B 1EUCB 5CXSA 4TM8A 3HR0A 4RHFA 2ZJ2A 3UUGA 3LUHA 4JEUA 5FEMA 2QRKA 4J16C 1KETA 4ZYUA 1ZHHA 3D3NA 1SRYA 3ORQA 2B7LA 3K8QA 4O4JA 1RYMA 3LQ4A 2HMYB 3IKJA 1Y89A 4IJVA 1H8HA 4TKLA 3G6WA 4IIUA 4OOEA 4RHTA 1T4BA 4HNTA 5F23A 2YN4A 3UYLA 2O5EA 2C59A 2C2KA 4FMBB 5EJ4A 1PGOA 1VRCA 2OVBA 3YASA 1YZNA 3AZOA 3AG1C 4Z0NA 4X64B 2X19A 3K6JA 3GK3A 1E20A 4PN7A 3VNUA 3D36A 1VL1A 4D8VA 2G70A 1X8KA 4C29A 1NQXA 3REQB 3KEQA 1VL5A 1J8MF 1WMDA 4ZVNA 5CIQA 9ABPA 5H9CA 3SZUA 1KZYC 3K20A 4D41A 1R4NB 4QOHA 4Q1BA 4IIEA 4IINA 4D7TA 3KLMX 1G16A 1IN6A 4MS3B 5EFZA 1E96A 2JIZD 1E2GA 1LBHA 1F4PA 3QK7A 4KO2S 4RU1A 4YIHA 4OLAA 1OLOA 1SKUA 2COUA 3GFGA 2JFYA 5DGXA 1MV8A 3TLEA 1X1AA 2Y68A 4J11A 4JBGA 2C00A 4YHHB 1W57A 2ZSAA 3SC6A 4D4JA 4NG4A 2YRXA 2YVKA 2CBXA 4MTFA 5IAOA 1C3OA 5E1BA 4EPRA 2MINA 1P39A 1ZH2A 2XDQA 2B7CA 3JZFA 2MIIA 2UYJA 2FEXA 3IE2A 5JJLA 4ZKIA 1DK1A 2E82A 4OX9O 3D02A 5JXWA 2ALEA 3HLYA 4UUMA 1F0KA 1P9OA 4G8DA 3NCHA 2RMKA 1T4CB 5E1OA 5KTMA 1XZ8A 3ZWDA 1TIPA 2QMQA 4LGCA 5B2FA 1M90W 4A0QA 3EASA 4B2PA 1B93A 3UB2A 2GEKA 2HVJC 1HYQA 2DUMA 2PD4A 3NBFA 4N8SA 1O97C 4Z99A 2ZYWX 2JHAA 2VF8A 3ZTWA 4WJZA 1E1QG 4XUEA 1MOFA 2WQ7A 3C9SA 4DNFA 4HWSA 4X1OA 1QP4A 2QPAA 2YZGA 4RVSA 3OTWA 2GDZA 2HC9A 3PHHA 4Q1CA 3P2KA 5J59A 4IGIA 1OBVA 1R3IC 1FFWA 2E89A 1WW8A 3QX7A 3GB7C 3TW8B 1Y37A 3VGJA 5CW2A 1VZ3A 3MTQA 7REQB 1KFCB 3JASA 3SNHA 5D5PA 2C3YA 3ETHA 1YMUA 3GY0A 3ABIA 5J2TA 3LDCA 1PZNA 1KTIA 5HFNA 3NVKE 3BD8A 3FFBA 3H0EA 4UXNA 1GTVA 3AK1A 3B9RA 1SVLA 1FOEB 1YRHA 2VUSA 3RVPA 4G23A 2VDJA 1IATA 5AHWA 1COWA 1NMZA 4IDHA 2A5LA 3F7VC 1MDBA 2NUTB 1PJ4A 1LI5A 3T7CA 3HS3A 5EFOA 3QFCA 3H1BA 5EJFA 2IM9A 2D8AA 5HBRA 4JI7B 4EY7A 4GP6A 3HA2A 2IRWA 3PFGA 2GNPA 3SR3A 4MS1A 4Q7EA 1RYNA 1YR7A 2ATCA 4MW8A 3F0FA 3CLSD 2JVJA 2BTOA 4G4YA 3TD4A 1TUEB 4OXQA 4PQYA 4LW8A 1JDUA 3S2YA 3SPIA 3WK7A 1NRXA 4QGSA 1YASA 2NV2B 4RKFA 3UPUA 2ILMA 1LDBA 1A76A 2PGJA 1ONNA 5ALZA 4ER7A 4FYJA 4RJJA 1Q1GA 3OOHA 3I1JA 3JQDA 2WQZA 1LVUA 1VJ5A 4FFKA 3QHPA 1NT4A 5EJMA 1KMIZ 4IRMA 4EJ2A 2B94A 1MA0A 4YV7A 4OXNA 4R6XA 4DGSA 1GL3A 4WPGA 4U00A 2I4TA 4XZ3A 3IB3A 1ZMRA 2A78A 4RPJA 2LCAA 3UN1A 1UDXA 1JJFA 3T3OA 4FIPC 1VLLA 2QUZA 3CSXA 1MNGA 4Q4HA 2GWHA 5L8VA 4UUAA 1QZUA 2X9VA 2N42A 4ZCMA 3G9TA 2EBHX 4RZQA 4JX8A 3AC0A 1QC5A 4Q7KA 4TSFA 4N5HX 3O2SB 3IVMA 3MWEA 3MCAB 1SERA 2JFBA 4FB5A 2H57A 4YAOA 1RCFA 3VPFA 1X1CA 2VF2A 1SHJA 2CW5A 3JQFC 2CHTA 4ILEA 4UFZA 4NZ9A 3BIXA 2INGX 2AG8A 2WSIA 3GGJA 3WDKA 4MWGA 1VLQA 4V0NA 1M1NA 3O73A 2BM1A 3HDHA 4ZT6A 3WB1A 1BYUA 4C1NA 2OT3B 1M4UA 4EO7A 2ISSD 2D1QA 1ZRHA 3ZG6A 1N7IA 2HLDD 4LYYA 3N0VA 2AMYA 1Z73A 3KYDA 5HDQA 3FMPB 3AL2A 4OI2A 2WMOB 4JOBA 2SHKA 4TMYA 2R44A 3QEKA 3RFTA 1M6YA 4D79A 2CSLA 1PSDA 3OJCA 2PPVA 2VHYA 2GUWA 3BWXA 5CITA 2OAP1 2Z6UA 4QU0A 2XRYA 2Z5GA 4TSRA 3BRWD 2WB2A 4BNDA 3R4VA 4MV4A 3FNGA 1EZJA 2KTVA 2GAFA 3RJ9A 4DAOA 3FUXA 1T5LA 4DV0B 3KLNA 5J43A 3RYFA 3PQ4A 3HM9A 4II3A 1YDXA 1S1CA 3N7AA 3GVIA 1CY6A 2F9FA 2RB9A 2JFWA 2CTWA 4WFEA 4R8RA 1UXKA 4UCWA 1SVWA 3NAMA 1PO7A 5IBPA 1W0JA 2HW8A 1XYVA 2DLNA 4ND5A 1IEVA 3HZRA 1DCTA 4U7PB 4X65O 2C9OA 1Q7RA 3JATA 1U0HC 3NUGA 3RRFA 1K86A 1OAPA 1N6IA 2X15A 4HPJB 1LWOA 2ZI4A 3OP4A 3DZDA 1XP5A 2ZR3A 1SB9A 4E51A 4I5EA 3E2MA 3E23A 4KE8A 3ESZA 5BR8O 3LHIA 4GFDA 2PUTA 3B3JA 4AN4A 3P9KA 5IYZF 3WYNA 1NE7A 4U3JB 2HGSA 2QEXV 4R1QA 1GZDA 4BJ1A 1T36A 4KPGA 4ZV9A 3GEDA 4TWRA 2WWYA 3ABKB 4X61A 3GRRA 5IEBA 4WZBB 3QFFA 1MC8A 4EI8A 4UPEA 3LWPC 4YT2A 3P0IA 3U3OA 5EIHA 1QFZA 5BV7A 3JZIA 3KAPA 5FOWA 4LXGA 2ZYHA 4AWAA 2VDKB 4GCZA 4G5OA 1E7SA 3IMGA 1RRMA 1ZH4A 1VLVA 2LCFA 1ZUHA 1QB8A 3DEFA 3W9BA 2NVOA 1ZRNA 3GN2A 4ML3A 3EBOA 2JS7A 1YL5A 3WI7A 4XWGA 2UXCB 3WJ2A 1IPFA 4EGQA 4BV9A 4Q66C 4MVZA 2ZJYA 4O29A 1HX7A 1U2GA 4NULA 4EUFA 3PTZA 2Q0XA 2OD9A 4QBKA 1QVFU 1YR2A 4MGYR 5IJ0B 8AT1A 4UU8A 4DDVA 2PU5A 1L6RA 4WKNA 1JDNA 2R8EA 3BB4A 5BN3B 5T8KA 4AM8A 1KGSA 5E0KB 4GPIB 4B6OA 1NU8A 1KH3A 4BIZA 4E14A 4RD6A 3ICCA 3EVNA 2Z4TA 3BX1A 1DLIA 2QTWB 1N2OA 3I23A 4FCVA 1Q16A 1WHTA 1QP7A 3IOMA 1ZISA 1QBKC 5CHEA 3HSYA 4H77A 2RK4A 3ICVA 1ACLA 4ZXPA 1JFVA 3L1HA 4K87A 1N2SA 3PGA1 5AVYA 3PU6A 4LC0A 1Q3TA 4CKXA 4RA6A 4J0IA 1QCYA 5KPJA 4ZAGA 4ND8A 1V8BA 1DVRA 4A5OA 1FNBA 3EDOA 5G4KA 1S8OA 2Y0CA 3LLSA 1J56A 1S72F 3C1AA 4JGBA 5ALOA 3K0SA 1MF7A 4YFVA 2NTYC 3PGKA 1MP0A 3RTAA 3N1UA 5BY2A 3VH3A 4IBOA 3L01A 4RMGA 1DMSA 1CYDA 2AYYA 2BF7A 3VSDA 1YB4A 2DC1A 3B13B 1H22A 4URHA 1G8SA 4V0LA 3DQPA 1YR8A 4IJ6A 1QIGA 1J00A 2EF1A 1AR5A 5T57A 1P9RA 1NM5A 1OZFA 2OGUA 3SS9X 4B46A 2D5IA 2ZJ0A 1FXUA 2Z3WA 1BXGA 5KNCD 1SBQA 5AW2A 3FLBA 1SBIA 3AR6A 4E94A 1B8VA 1VKNA 4ZCTA 1TCAA 2FK7A 1IC6A 2XITA 2FY8A 3ROXA 2V9CA 1USWA 1HBJA 3ZVNA 1SHZA 1UI9A 3AJ8A 1VQ8V 3D4IA 4FFRA 3Q9SA 2EIXA 4E13A 4EG3A 4C4AA 2H2HA 4YP5A 1B6QA 5TT1A 2FEAA 4KP7A 3R9KA 1J5XA 1SOAA 4WXPA 3ZQKA 1NOKA 1BJTA 2ZVYA 4KFCA 2XMBA 4L0MA 3TTYA 1KXJA 3QQPA 3RVLA 3LIIA 1RPTA 4OB6A 1OHHD 2JI6A 1NU1H 2IS6A 4F97A 3HRIA 3MERA 3WYFA 4LNUB 1DG9A 3UHJA 1I32A 1QV7A 5AH0A 4HDRA 2LNDA 2PMKA 3BMQA 1QD9A 1W2WB 1IV2A 1ESCA 4FGWA 2FR0A 5JZBA 4LVOA 4BBJA 5JS2A 2DW4A 1U8UA 2R1VB 4RW0A 4AY4A 4XEUA 1AGNA 1KVSA 1I36A 2VXBA 4CMGA 2DPMA 1L5FA 4RV4A 5DIZA 4QE7A 4CRWB 3QVXA 2I99A 3B3FA 1NQOA 1GFSA 2ZWOA 4LDQA 5I6DA 2A5FA 5DRYA 3P0EA 3KKPA 1GM7A 2JIDA 1KJIA 2FPMA 3B6ZA 3GPBA 3OM3B 3F46A 3AY3A 3QE2A 4HMPA 3T4ZA 3V6LA 1TQ2A 2NO6A 4EHAA 2OO5A 4FSXA 1QHIA 3Q0TA 4FMDF 2A7WA 4ZI7A 2DR3A 4AMYA 1EFLA 2QA5A 2AZTA 4Y2VA 4URUR 4MWBA 4AJEA 4ESHA 1EFVA 3CCFA 4P4SB 4LZAA 4V24A 1P1CA 3APOA 3EXFA 2R2AA 4KX3A 1FJHA 3EZLA 1L5QA 3E53A 1XALA 5JOQA 2C9MA 3UWOA 5CB4A 4I4TF 3S06A 4ZQCB 1QKKA 2N74A 1KU0A 2X22A 2PQMA 4PZ9A 1BX0A 3FLMA 4D97A 3I09A 1ZAYA 1THGA 1CUSA 1ZP6A 2ZEJA 4W9NC 3TOVA 2Z8ZA 1D4FA 1G7TA 1L8LA 2VJDA 3ES9A 4U9HS 4ZC1A 3G9ZA 3IAHA 5JT1A 4Y1RA 3TN7A 3GUZA 1YK0A 4L2IB 1DBSA 2EOAA 2YNMC 3IE1A 2VJBA 1JQ5A 1X59A 1DXQA 3GZTB 3WMWA 1YTUA 4BC0A 2PTMA 1Z39A 1I6KA 1L6IA 5AOAA 3TNLA 3BWDD 3ZHXA 1NVBA 2W22A 2YIJA 4OX9B 2KSDA 1J0BA 3KCQA 2V7UA 1BCCH 3KKQA 4NU5A 2LIPA 1POXA 2IXEA 2PCLA 1NR1A 3BHPA 4G28B 2QDOA 3O8LA 3U2QA 5AW5A 4DCUA 1P4GA 2NO4A 2ODNA 4X1IA 1KU6A 1OT3A 5TMPA 1XPOA 4IDPA 1QBZA 2R25B 2I3DA 5JS7A 3IOBA 2HF2A 4B6GA 1QS0A 4I2VA 2XVMA 4QGHA 3G9UA 3SVZA 3ZHQA 4A82A 2VUUA 2CLDX 5LP6A 1Z34A 3RE3A 3GYQA 5I3CA 3IEXA 5LGUA 3LUAA 4C05A 4MTCA 4LR3A 4FWTA 1L7XA 4OFBA 4NH0A 5L3SA 3L6RA 5BN4B 4AG3A 1QLWA 3NYWA 4MUAA 4DYVA 1EDEA 2BDTA 2GM4A 2IV2X 2HIHA 4PSUA 1ZM9A 3EHBB 5JFGA 5J4LA 1U31A 2B37A 3QV1A 2W42A 5HS6A 1X80A 2YIMA 4I08A 4O4JB 1M54A 4F93B 1J2TA 2DR2A 3QBJA 3ETEA 3K3PA 4ED9A 3JRWA 4V1CI 1NVDA 3GNQA 1YNSA 2CEKA 1XU7A 2A35A 3FH0A 3GH1A 3GPLA 1SQFA 3FPSA 4HYQA 1FJXA 1GDDA 3ELDA 2WFLA 1J0AA 4K9KA 2Q5HA 3DKKA 1BMQA 2AFHA 1NLMA 4N3GA 5AJHA 1VK3A 1JN1A 5K3AA 4BDTA 4ZMRA 3OZBA 3ZJVA 3JVVA 3LMKA 3R0IA 4B5KA 2ZI5A 2E3CA 5EJ2A 1M10A 4EPWA 3ICOA 3IPLA 1T24A 3PNYA 1RP3B 1UZLA 1R5JA 1J5PA 5HUHA 1YMQA 4M1ZA 2G28A 3ISTA 5CURA 4F2GA 4LEIA 1EDOA 2OP0A 4KYTA 4F4DA 2VJYA 3ML1A 5EXPA 4QYMA 1U0SY 2YMMA 2VQ3A 3O95A 5GM1A 1MB3A 2HT6A 1PJ8A 1U2SA 4GL2A 3TK1A 5EVJA 4B6RA 5DPMA 3KVNA 5CH8A 3F5SA 3ZGVA 4Q48A 3IFXA 3LZ6A 1GJRA 3WOHA 3JVDA 1G2IA 4CMEA 2DHQA 1C3OB 1U3PA 2MINB 4JAAA 1XQ8A 2XDQB 4B33A 4TL7A 1K1EA 1JH8A 1ZSVA 4A92A 5D01A 1P7VA 4CM7A 3SPXA 4EHIA 4OG2A 1RTTA 1U0FA 3F6SA 3I6ZA 2RMKB 3SHWA 2ZAUA 3RANA 2FG7C 2V1UA 4PHHA 3EYWA 3BL5A 4HGRA 1L5NA 5BRNA 3K5IA 5K2MA 4WOKA 3WMEA 5DHSA 3UUWA 2OCGA 2X2PA 3B1JA 1Q0QA 3PKJA 5FF9A 3V00A 3PHJA 4LUCA 4XSHA 4YRGA 4M55A 4FILA 5HJ7A 5IK2A 2HP3A 3SSNA 3OIYA 4MLPA 2BWJA 2VT7A 1QKIA 2VP0A 3J80A 3FYHA 4REOA 2XAFA 4IIFA 1BMTA 3RUDA 3NPAA 2DG2A 2BFFA 1AGYA 3PNVA 1WUIS 2Z4RA 4AXXA 2OPBA 3KQNA 2ZBEA 3R6LA 2WFZA 2IZ0A 3GJ6A 1FCJA 4U6QA 2HFKA 3T7RA 4W9RA 4JXKA 2VTBA 4E88A 2H2IA 1UXJA 1TYZA 1JBEA 4JA0A 5E95A 4Z53A 3LBYA 1FJGB 2IYSA 3A0RA 2WF8A 3MQ2A 1NPYA 4Y2QA 2VNSA 3JASB 1B0UA 2F43G 3EQ6A 1PVDA 2NU8A 1MBZA 2HJSA 1TA9A 2F55A 5G53C 4NNOA 4BVFA 5J2TB 4NCHA 4YAEA 4W5HA 4EFDA 2VR1A 4OIFA 4TWIA 3MF4A 1KKMA 2JDID 2Z2IA 2RGRA 1X87A 4DUGD 2MWMA 3ZHVA 4BLWA 4GKJB 1OREA 4EFEA 1AKNA 3RU7A 4MVMA 1BZYA 5IT0A 2G9ZA 1RHUA 2I1LA 1OT5A 2NVWA 4Q9JA 3GFFA 3QM1A 3IP5A 3QTYA 5I7VA 1WW2A 3H42B 2REBA 2WPNA 1LK5A 4F1WA 4ZVKA 4XKJA 2XUZA 1KK2A 3D3EA 1M3SA 1C3EA 3IPCA 2YVAA 3DLHA 4MS1B 5KSYA 1ZAUA 3HJWC 5B1NA 1KJ9A 3O9VA 4Y2YA 4X65B 2GK7A 4IIYA 5AI0A 3OU6A 1EBUA 3NI2A 3G0BA 1F7UA 3RADC 1GPWB 4ZN6A 2HRBA 2WJIA 3HJNA 1XZDA 1VQ4F 5B37A 2DSNA 1SK9A 2DPYA 4M0FA 2QI9F 5BR8B 2WZQA 3G2PA 3L8YA 3NJRA 3ESJA 3PPIA 1TM2A 4F72A 2QN9A 5KHIA 4H59A 4EZBA 1T2NA 2VSXA 2W2VA 2GQ0A 2GB4A 4IJWA 3BQ9A 5F2KA 2GJAA 2B8WA 1OA0A 4LFAO 2O7VA 3SX2A 1BDMA 1B6GA 3FDZA 4EENA 4ER6A 1A7UA 2QSAA 1HEYA 3PNKA 4TQAA 1SR8A 3L1IA 3ER9A 3OMLA 1R4NA 1JJOA 3BKXA 3WKCA 4HWRA 4PZZA 4ZARA 3OHMA 1B06A 4Q4HB 2HJFC 4GOKA 3VNRA 1QC5B 4OJQA 1QGED 2NVUA 1TTTA 3Q15C 4ZI3A 3E89A 2P2CA 3MWEB 3GGOA 3CNBA 3TJZA 3KC2A 3E8MA 1KZ1A 3DL7A 4PW0A 1V37A 3R0ZA 3EUWA 4GBJA 4CCAA 3IJPA 5ES4B 5LJLA 1SG0A 4JFRA 3H9UA 5A2QM 3E3MA 1M1NB 1KMIY 1BJRE 2XB8A 3LT5A 1L4KA 1BA3A 1KXZA 2EBFX 3WNQA 3GD7A 4UQLA 1KFBB 2F9MA 3KYDB 4A0FA 3KT6A 1C4XA 4WX2B 4WFGA 3D4PA 3ZRVA 4H13B 3U13A 5B1BC 2IE0A 3B52X 1G21A 4A73A 2VN8A 2Q3JA 1Q7GA 5CT8A 3I61A 4BNDB 3DEYX 5KKNB 4FEGA 5TMBA 4B5CA 2P4HX 1C3LA 2R6HA 2PKRA 2BH2A 2DXIA 3ZCPA 3EJ6A 1O94D 5IBRA 1EH5A 4RXTA 4G3XA 3KKMA 4DCSA 3QKWA 3CX8A 2G07A 1D3AA 1NVVQ 1PD3A 3KSUA 1FYFA 3ZZUA 2IKSA 3HCBA 3EY9A 3AY6A 1WEKA 2OWDA 3PEWA 1E79A 1II0A 2O8NA 3JATB 1TA4A 1YUBA 4C7XA 2GCPA 2KMLA 3L7JA 4GM4A 4ZBMA 4MO9A 3X1YA 4ZYYA 4X64O 1NIJA 1EFDN 4M0EA 4L15A 1PS8A 2WP8J 1T36B 1E3IA 2L0XA 4MKHA 1KEWA 3RM3A 1W0KD 1Z2AA 1NU6A 1ZJZA 4MVQA 3CY6A 1SCJA 1I5RA 2BMEA 2VAPA 5F5XA 1T9KA 4B31A 1NXPA 3O92A 3T6KA 2QWOB 5A4JA 3IALA 3ADBA 4D57A 4OQFA 4MI3A 1EVKA 2DJIA 1CUEA 2C57A 3PIRA 5DYWA 3FCCA 3AHJA 1ZD3A 5CFNA 4D96A 2R85A 2RFLA 3FUUA 1CZOA 3OJOA 1CC1S 2X2FA 4FZ1A 3ZCQA 4D6YA 5FUWA 5FLEX 1SXPA 3BPSA 4DXAA 2H4YA 4KFSA 3VPCA 1ONOA 2KLHA 5BSFA 2XX3A 4DV7O 3H5IA 1YHNA 4LX0A 2RBKA 3GJZA 4JLJA 3EZ2A 3CPEA 1RAHA 2JPDA 1NATA 2QVBA 3HAXD 1OAOC 1RWQA 3RJMA 3RA6A 1YOBA 4AQDA 3M34A 4FT2A 4UU0A 1P2UA 3U16A 2Q1YA 3G3EA 1E0DA 3U48A 4GKBA 4YROA 4FLTA 5LQKA 1CJSA 2Y2VA 3BTVA 3UQYS 4H08A 5AHRA 4BQQA 4FKBA 4DQLA 5FQOA 3ENQA 4FDUA 2CB9A 1DRKA 3KUCA 4Y6GB 4ZYXA 2Q7DA 1P0CA 2SBTA 4KUGA 1MX9A 2G9QA 4HQNA 3S3TA 2X0KA 3SZOA 2PLWA 1WHTB 3HGQA 1BMFA 1ATIA 1CZNA 5HMLA 3RIEA 1NSTA 2AK2A 3MCAA 2CE4A 1TGOA 3NKFA 1A5BB 3KFLA 2KB0A 4H7PA 5B7NA 1FNSA 2VQ6A 3RVYA 2XMGA 1SXJC 2CXQA 4Q3EA 4RA6B 4EX6A 3RARA 1G2OA 4ND8B 2XVZA 2XADA 3DZCA 3HCFA 2OA0A 5G4KB 4KE6A 3RUHA 4DO2A 5CVEA 1PTJC 2GPNA 1DC5A 1XD9A 3GA7A 5K45A 3HSSA 5LIRA 3TWOA 1A77A 1S0VA 1QRRA 3SQOA 2C1XA 2CD7A 3G8DA 3DULA 3OWHA 2W00A 2ZUBA 2ZCVA 2B35A 5JWOA 2G7MC 2IOHA 5IEJA 3CZ9A 4UE3S 3PN1A 3GOQA 3H84A 3C16C 3SFTA 2X3YA 4HX5A 4MYCA 4GP7A 4NIMA 3TXSA 3TLXA 3DBRA 4PRKA 1P7CA 2AGVA 2VJPA 1NZFA 4FE7A 2Z2XA 1UIMA 3DFMA 1BXGB 4LY0A 3AEUA 4ZDKA 1U7ZA 1M2VA 1UFQA 3KX2A 2QLFA 1X9IA 4G89A 4B0OA 2DERA 4DBZA 3H5OA 4UREA 1QHEA 4MQ6A 3I01A 4XVRA 4N54A 1XCJA 3ZPXA 4LFCB 3R0VA 2O4CA 3VKHA 2X0DA 2YIDA 2RGWA 4DR2O 4JI7O 3U1VA 1AUQA 3L06A 4M7WA 4UCVA 3LVFO 2VQEO 1TVCA 2B9ZA 5F98A 3OQOA 1XMSA 1I4DD 3L9XA 2EFCB 3LXUX 5CFRA 1G8FA