3LMEA

Structure of probable translation initiation inhibitor from (rpa2473) from rhodopseudomonas palustris
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
SLKIIAPTDKTITPSGTWSIGARAGDFVFIGGMHGTDRVTGKMVDGDEARIRRMFDNMLAAAEAAGATKADAVRLTVFVTDVAKYRPVVNKVQKDIWGDGPYPPRTVLQVPALDQGDIAEIDGTFYAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible translation initiation inhibitor
publication title Structure of probable translation initiation inhibitor from (RPA2473) from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Translation
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3lmeA00
3I7TA 4NWOB 3LYBA 3M4SA 2CHSA 1FNKA 1JD1A 1QU9A 1XRGA 3ZO8A 1X25A 2UYJA 1ODEA 2DYYA 2EWCA 1DBFA 1ONIA 2CHTA 1J7HA 1NQ3A 1UFYA 2B33A 3GTZA 3ZP7A 1UI9A 1COMA 2IG8A 2OTMA 4ZK7A 2CW4A 2UYNA 5HP7A 1XHOA 1QD9A 3V4DA 3ZOPA 3D01A 2UYKA 3K0TA 3R0PA 3M1XA 3K12A 3LMEA 2CSLA 3ZP4A 3KJJA 3KJKA 1QAHA 2UYPA 3QUWA 2CVLA 1PF5A 3L7QA 3I3FA 3VCZA 1FNJA 3MQWA 2UYNB 2CWJA 5HP8A
chains in the Genus database with same CATH superfamily
5LYJB 1K8AH 3JATA 1JJ2F 4C8IA 2LBXA 4F6RB 1YQNA 2I6RA 3SIUA 4TUYB 3IMPA 1FFXB 3G4SF 1VQ7F 2HRUA 1VQ6F 3J81M 2UYNA 2UZHA 4RHAA 4BT5A 2KGWA 2OTLF 4B5CA 3AGKA 1KQSF 3RA6A 1H47A 3CXCF 1VH8A 4LNUA 4YJ2B 1IV3A 1S72F 4HNAA 1KC8H 2OZBA 1TUBA 3E22B 4O2AB 4X1KB 5HP8A 2OTJF 3K14A 2VAMA 3G71F 1KNKA 4X20A 2BTQB 2HS0A 3KE1A 1Q7YH 1W5FA 3JARB 5EYPB 4G4WA 4BT7A 3VYTC 3MDOA 2B33A 1COMA 3RA5A 4G4YA 2CW4A 4U39A 3WXMB 4B46A 2QTPA 4IHJA 4BW0B 2I6DA 5LYJA 5DCVA 1W5EA 4BT3A 4F6RA 4XCQA 5KX5B 4TUYA 1FFXA 2Z1FA 3KJKA 1RQ7A 4E6EA 1W41A 3CCVF 1FNJA 2AIFA 3HWUA 3IEWA 1VQLF 4O4HB 3JAMM 3ERNA 2W8BC 2KTVA 4BVTA 3HAXD 3S0WA 5IYZB 2BTOA 2PMPA 5FLXM 3FD6A 1UFYA 4YJ2A 4TZZA 2Z1TA 3E22A 4O2AA 4X1KA 5G4VC 1W3EX 1NMUB 4I4TB 3LWOC 3CCLF 3WGLA 2WALA 5EYPA 1U43A 5HY4A 4C81A 3QUWA 5HXZA 5BMVB 3PLAC 2N48A 5ITZB 3NK7A 4C8GA 1X7PA 3RYCB 3S0HA 2L26A 3FD5A 4LCKA 4DXDA 5KX5A 2GLZA 5LP6B 3WJPA 3O85A 1UI9A 3LDTA 3RYFB 2HRYA 3N2KB 5MN5A 5HY1A 4BY9D 1VK3A 3WJQA 4O4HA 5JVDB 1NJIH 3EORA 3WGNA 3C8LA 3TD4A 2VXYA 5IYZA 3F0DA 3J7AR 1YGYA 1GZ0A 2H8CA 1Z5WA 3E20B 3KIZA 2Q1YA 4M8IA 1FNKA 2VGNA 4I4TA 1W55A 2F9ZC 1W59A 2HS4A 1Z5VA 3TD5A 1YJNF 4C8EA 5BMVA 2OTMA 4ZK7A 3MBMA 4KWEA 3VIUA 1W40A 1YJ9F 3IKEA 1K9MH 3LMEA 5HXUA 2BO1A 5IT9M 1CK2A 3IKFA 2HQSC 3VCZA 5LP6A 1VQNF 3M84A 3CPWF 3CMAF 4RQOA 3RYFA 3N2KA 3N4YA 3K2XA 2ALEA 5JVDA 2RB9A 4I55B 4BVSA 5FJ4C 5CA1B 4C82A 2VAWA 3I56F 2OHWA 1W42A 2JNBA 4O4IB 1VQ4F 5MN4A 3HKEB 2ZOVA 2ZVYA 5EWRA 2AIZP 3VOBA 3CYPB 3VYSC 3ZP4A 2IAFA 3L7QA 1RLUA 2KTUA 1VQKF 2LBTA 5A2QM 3CCEF 1N8RH 1QU9A 2CHSA 1YHQF 3WJRA 1XRGA 5EZYB 3V7QA 5GAPK 3CCMF 2DT4A 3ELCA 3CB2A 4ZHQB 4ZI7B 3V4DA 4G4VA 3C9TA 4R40B 3NVKE 3QHDA 1X7OA 1SDSA 4I55A 1RA4A 1QAHA 2QA4F 5CA1A 3HKCB 2CZWA 1GO1A 4ZHWA 1VQMF 4O4IA 3OBYA 1U3LA 3HKEA 1YIJF 3P10A 1W581 3FBAA 2G9IA 5GONB 3VYUC 2PHNA 3MCAB 2NMUA 5FNVB 5EB0A 5JCOA 4C4WC 4I50B 1VQOF 1TVKB 2LBWA 3S03A 3LWQC 1QD9A 4EB6A 3K0TA 3JALB 5IJ9B 3K12A 3S0YA 5EZYA 2CVLA 3P4EA 2FGYA 1KD1H 4FFBB 3TD3A 2BTUA 2HX0A 4ZHQA 4ZI7A 5EB1B 3U0OA 5J2UA 5C8YB 1JFFB 4NUTA 3ZO8A 4BT6A 5GANK 3C9RA 3VO8A 3CD6F 1J7HA 3HKCA 3VTIC 2RHJA 3JAWB 5LOVB 1Q86H 4IIJB 4NQ3A 1VQ8F 2HVYD 1YJWF 1XHOA 1CN7A 3IEQA 3S06A 3B6NA 4X1IB 5GONA 3PAFA 3F0GA 3LFOA 5FNVA 1H48A 4EI7A 4I50A 5EAZA 1TVKA 3I7TA 2QI2A 4ZHVA 3M4SA 1H7MA 1IV1A 3CCRF 1YI2F 3KHNA 3JALA 2UYJA 5IJ9A 5B8FA 2HP0B 3CCUF 1T0AA 1R1MA 2AMTA 3ON1A 4O4JB 4U3JB 3HJWC 4FFBA 3WGKA 4WBNA 1XBIA 5HWEA 1PXWA 5C8YA 1JFFA 3BYQA 5LA6A 4X3MA 2HS3A 5CB4B 4B62A 5JQGB 4BVRA 2ZODA 5EO3A 3MCQA 1CLIA 2RHOA 3FFMA 3JAWA 4NWOB 4IIJA 5LOVA 4X3LA 3QTYA 1KNJA 1X25A 2YYEA 2RHHA 4TV9B 1ONIA 3HKBB 4X1IA 5JH7B 1M90H 3F6MA 3V3TA 1RLGA 1OAPA 3NVIB 1K73H 3R0PA 3RYIA 1XV2A 1W57A 5IJ0B 1VQ9F 3HTNA 4YJ3B 2VGMA 4ZHYB 2HP0A 4DRXB 3T80A 5CA0B 1W2BF 4O4JA 4U3JA 1GX1A 4EB6B 1Q8RA 1QVGF 3N2GB 4X1YB 4O4LB 1SA0A 1GO0A 3LWRC 3CCJF 2EWCA 1DBFA 4PWTA 5HY2A 3GTZA 1M1KH 2RHLA 5CB4A 5JQGA 2R751 5GIPC 2HP3A 2VAPA 3D54A 3D01A 1W5AA 5LP6C 2QEXF 5J2UB 3NK6A 1JN1A 3E1YA 3P0ZA 5GINC 1DT9A 5LXTB 3RE3A 4TV9A 5JH7A 3HKBA 3CYQA 2CWJA 3S02A 2ZVZA 5HY0A 1IV2A 3WPWA 1QVFF 4O2BB 2H8EA 4G4XA 3FPIA 2ZAUA 5IJ0A 4YJ3A 3ZP7A 2Z1UA 4BT2A 4DRXA 5CA0A 2Z01A 3VI6A 4BT4A 4G4ZA 5GIOC 2K1SA 3VMFB 4EI8A 3N2GA 4X1YA 4O4LA 1Q82H 1SZQA 2H6LA 3C9SA 3WGJA 1RQ2A 1PF5A 4G88A 3I3FA 3JASB 1YITF 1VHAA 4WBNB 3V7EA 3GHZA 4EI9A 5LA6B 3UT5B 3SIVA 3F0EA 3LWVC 3ESJA 5LXTA 2Z1EA 2MQEA 5KMGB 5G4UC 2P6YA 2UYKA 5EIBD 3JARA 5J2TB 3JAKB 4O2BA 2CSLA 3CCQF 3CPQA 2UYPA 3RYHB 4TV8B 3JVHA 3J80M 2R6R1 5AVMA 3MQWA 3HKDB 3I55F 1IV4A 1OFUA 1U40A 1VQVA 3LYBA 4ZOLB 5JCOC 2V9YA 1JD1A 3RYIB 2IQQA 1ODEA 2DYYA 5EIBC 1NQ3A 4B45A 2FC3A 3CMEF 2IG8A 1ZWZA 3CG6A 3JASA 3OONA 3JATB 3GYQA 3LWPC 3WPXA 3Q8HA 3M1XA 3F0FA 3KJJA 3CC7F 1SA0B 1VQ5F 3UT5A 2GVIA 2KG4A 2UYNB 1X52A 3CC2F 3NMUC 2LCAA 3OW2F 3C9UA 5KMGA 1Q81H 1U3PA 3D00A 3G6EF 5J2TA 3VOAA 1JY8A 3JAKA 4LNUB 5MN6A 2YXZA 3N4ZA 2CHTA 3DDNA 4HNAB 1W5BA 1TUBB 4TV8A 3RYHA 3WGMA 3CC4F 1VQPF 5HP7A 2Q1XA 3DC2A 3HKDA 4X20B 5ITZA 3RYCA 4ZOLA 3ZOPA 4ERHA 1FSZA 3CCSF 1T0KB 1E7KA 1IPAA 3OBWA 2GZLA 3JCMM 2ZF8A 3IR9A 4BVQA 4IHJB
chains in the Genus database with same CATH topology
3I7TA 4NWOB 3LYBA 3M4SA 2CHSA 1FNKA 1JD1A 1QU9A 1XRGA 3ZO8A 1X25A 2UYJA 1ODEA 2DYYA 2EWCA 1DBFA 1ONIA 2CHTA 1J7HA 1NQ3A 1UFYA 2B33A 3GTZA 3ZP7A 1UI9A 1COMA 2IG8A 2OTMA 4ZK7A 2CW4A 2UYNA 5HP7A 1XHOA 1QD9A 3V4DA 3ZOPA 3D01A 2UYKA 3K0TA 3R0PA 3M1XA 3K12A 3LMEA 2CSLA 3ZP4A 3KJJA 3KJKA 1QAHA 2UYPA 3QUWA 2CVLA 1PF5A 3L7QA 3I3FA 3VCZA 1FNJA 3MQWA 2UYNB 2CWJA 5HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7T A;  4NWO B;  3LYB A;  3M4S A;  2CHS A;  1FNK A;  1JD1 A;  1QU9 A;  1XRG A;  3ZO8 A;  1X25 A;  2UYJ A;  1ODE A;  2DYY A;  2EWC A;  1DBF A;  1ONI A;  2CHT A;  1J7H A;  1NQ3 A;  1UFY A;  2B33 A;  3GTZ A;  3ZP7 A;  1UI9 A;  1COM A;  2IG8 A;  2OTM A;  4ZK7 A;  2CW4 A;  2UYN A;  5HP7 A;  1XHO A;  1QD9 A;  3V4D A;  3ZOP A;  3D01 A;  2UYK A;  3K0T A;  3R0P A;  3M1X A;  3K12 A;  3LME A;  2CSL A;  3ZP4 A;  3KJJ A;  3KJK A;  1QAH A;  2UYP A;  3QUW A;  2CVL A;  1PF5 A;  3L7Q A;  3I3F A;  3VCZ A;  1FNJ A;  3MQW A;  2UYN B;  2CWJ A;  5HP8 A; 
#chains in the Genus database with same CATH topology
 5LYJ B;  1K8A H;  3JAT A;  1JJ2 F;  4C8I A;  2LBX A;  4F6R B;  1YQN A;  2I6R A;  3SIU A;  4TUY B;  3IMP A;  1FFX B;  3G4S F;  1VQ7 F;  2HRU A;  1VQ6 F;  3J81 M;  2UYN A;  2UZH A;  4RHA A;  4BT5 A;  2KGW A;  2OTL F;  4B5C A;  3AGK A;  1KQS F;  3RA6 A;  1H47 A;  3CXC F;  1VH8 A;  4LNU A;  4YJ2 B;  1IV3 A;  1S72 F;  4HNA A;  1KC8 H;  2OZB A;  1TUB A;  3E22 B;  4O2A B;  4X1K B;  5HP8 A;  2OTJ F;  3K14 A;  2VAM A;  3G71 F;  1KNK A;  4X20 A;  2BTQ B;  2HS0 A;  3KE1 A;  1Q7Y H;  1W5F A;  3JAR B;  5EYP B;  4G4W A;  4BT7 A;  3VYT C;  3MDO A;  2B33 A;  1COM A;  3RA5 A;  4G4Y A;  2CW4 A;  4U39 A;  3WXM B;  4B46 A;  2QTP A;  4IHJ A;  4BW0 B;  2I6D A;  5LYJ A;  5DCV A;  1W5E A;  4BT3 A;  4F6R A;  4XCQ A;  5KX5 B;  4TUY A;  1FFX A;  2Z1F A;  3KJK A;  1RQ7 A;  4E6E A;  1W41 A;  3CCV F;  1FNJ A;  2AIF A;  3HWU A;  3IEW A;  1VQL F;  4O4H B;  3JAM M;  3ERN A;  2W8B C;  2KTV A;  4BVT A;  3HAX D;  3S0W A;  5IYZ B;  2BTO A;  2PMP A;  5FLX M;  3FD6 A;  1UFY A;  4YJ2 A;  4TZZ A;  2Z1T A;  3E22 A;  4O2A A;  4X1K A;  5G4V C;  1W3E X;  1NMU B;  4I4T B;  3LWO C;  3CCL F;  3WGL A;  2WAL A;  5EYP A;  1U43 A;  5HY4 A;  4C81 A;  3QUW A;  5HXZ A;  5BMV B;  3PLA C;  2N48 A;  5ITZ B;  3NK7 A;  4C8G A;  1X7P A;  3RYC B;  3S0H A;  2L26 A;  3FD5 A;  4LCK A;  4DXD A;  5KX5 A;  2GLZ A;  5LP6 B;  3WJP A;  3O85 A;  1UI9 A;  3LDT A;  3RYF B;  2HRY A;  3N2K B;  5MN5 A;  5HY1 A;  4BY9 D;  1VK3 A;  3WJQ A;  4O4H A;  5JVD B;  1NJI H;  3EOR A;  3WGN A;  3C8L A;  3TD4 A;  2VXY A;  5IYZ A;  3F0D A;  3J7A R;  1YGY A;  1GZ0 A;  2H8C A;  1Z5W A;  3E20 B;  3KIZ A;  2Q1Y A;  4M8I A;  1FNK A;  2VGN A;  4I4T A;  1W55 A;  2F9Z C;  1W59 A;  2HS4 A;  1Z5V A;  3TD5 A;  1YJN F;  4C8E A;  5BMV A;  2OTM A;  4ZK7 A;  3MBM A;  4KWE A;  3VIU A;  1W40 A;  1YJ9 F;  3IKE A;  1K9M H;  3LME A;  5HXU A;  2BO1 A;  5IT9 M;  1CK2 A;  3IKF A;  2HQS C;  3VCZ A;  5LP6 A;  1VQN F;  3M84 A;  3CPW F;  3CMA F;  4RQO A;  3RYF A;  3N2K A;  3N4Y A;  3K2X A;  2ALE A;  5JVD A;  2RB9 A;  4I55 B;  4BVS A;  5FJ4 C;  5CA1 B;  4C82 A;  2VAW A;  3I56 F;  2OHW A;  1W42 A;  2JNB A;  4O4I B;  1VQ4 F;  5MN4 A;  3HKE B;  2ZOV A;  2ZVY A;  5EWR A;  2AIZ P;  3VOB A;  3CYP B;  3VYS C;  3ZP4 A;  2IAF A;  3L7Q A;  1RLU A;  2KTU A;  1VQK F;  2LBT A;  5A2Q M;  3CCE F;  1N8R H;  1QU9 A;  2CHS A;  1YHQ F;  3WJR A;  1XRG A;  5EZY B;  3V7Q A;  5GAP K;  3CCM F;  2DT4 A;  3ELC A;  3CB2 A;  4ZHQ B;  4ZI7 B;  3V4D A;  4G4V A;  3C9T A;  4R40 B;  3NVK E;  3QHD A;  1X7O A;  1SDS A;  4I55 A;  1RA4 A;  1QAH A;  2QA4 F;  5CA1 A;  3HKC B;  2CZW A;  1GO1 A;  4ZHW A;  1VQM F;  4O4I A;  3OBY A;  1U3L A;  3HKE A;  1YIJ F;  3P10 A;  1W58 1;  3FBA A;  2G9I A;  5GON B;  3VYU C;  2PHN A;  3MCA B;  2NMU A;  5FNV B;  5EB0 A;  5JCO A;  4C4W C;  4I50 B;  1VQO F;  1TVK B;  2LBW A;  3S03 A;  3LWQ C;  1QD9 A;  4EB6 A;  3K0T A;  3JAL B;  5IJ9 B;  3K12 A;  3S0Y A;  5EZY A;  2CVL A;  3P4E A;  2FGY A;  1KD1 H;  4FFB B;  3TD3 A;  2BTU A;  2HX0 A;  4ZHQ A;  4ZI7 A;  5EB1 B;  3U0O A;  5J2U A;  5C8Y B;  1JFF B;  4NUT A;  3ZO8 A;  4BT6 A;  5GAN K;  3C9R A;  3VO8 A;  3CD6 F;  1J7H A;  3HKC A;  3VTI C;  2RHJ A;  3JAW B;  5LOV B;  1Q86 H;  4IIJ B;  4NQ3 A;  1VQ8 F;  2HVY D;  1YJW F;  1XHO A;  1CN7 A;  3IEQ A;  3S06 A;  3B6N A;  4X1I B;  5GON A;  3PAF A;  3F0G A;  3LFO A;  5FNV A;  1H48 A;  4EI7 A;  4I50 A;  5EAZ A;  1TVK A;  3I7T A;  2QI2 A;  4ZHV A;  3M4S A;  1H7M A;  1IV1 A;  3CCR F;  1YI2 F;  3KHN A;  3JAL A;  2UYJ A;  5IJ9 A;  5B8F A;  2HP0 B;  3CCU F;  1T0A A;  1R1M A;  2AMT A;  3ON1 A;  4O4J B;  4U3J B;  3HJW C;  4FFB A;  3WGK A;  4WBN A;  1XBI A;  5HWE A;  1PXW A;  5C8Y A;  1JFF A;  3BYQ A;  5LA6 A;  4X3M A;  2HS3 A;  5CB4 B;  4B62 A;  5JQG B;  4BVR A;  2ZOD A;  5EO3 A;  3MCQ A;  1CLI A;  2RHO A;  3FFM A;  3JAW A;  4NWO B;  4IIJ A;  5LOV A;  4X3L A;  3QTY A;  1KNJ A;  1X25 A;  2YYE A;  2RHH A;  4TV9 B;  1ONI A;  3HKB B;  4X1I A;  5JH7 B;  1M90 H;  3F6M A;  3V3T A;  1RLG A;  1OAP A;  3NVI B;  1K73 H;  3R0P A;  3RYI A;  1XV2 A;  1W57 A;  5IJ0 B;  1VQ9 F;  3HTN A;  4YJ3 B;  2VGM A;  4ZHY B;  2HP0 A;  4DRX B;  3T80 A;  5CA0 B;  1W2B F;  4O4J A;  4U3J A;  1GX1 A;  4EB6 B;  1Q8R A;  1QVG F;  3N2G B;  4X1Y B;  4O4L B;  1SA0 A;  1GO0 A;  3LWR C;  3CCJ F;  2EWC A;  1DBF A;  4PWT A;  5HY2 A;  3GTZ A;  1M1K H;  2RHL A;  5CB4 A;  5JQG A;  2R75 1;  5GIP C;  2HP3 A;  2VAP A;  3D54 A;  3D01 A;  1W5A A;  5LP6 C;  2QEX F;  5J2U B;  3NK6 A;  1JN1 A;  3E1Y A;  3P0Z A;  5GIN C;  1DT9 A;  5LXT B;  3RE3 A;  4TV9 A;  5JH7 A;  3HKB A;  3CYQ A;  2CWJ A;  3S02 A;  2ZVZ A;  5HY0 A;  1IV2 A;  3WPW A;  1QVF F;  4O2B B;  2H8E A;  4G4X A;  3FPI A;  2ZAU A;  5IJ0 A;  4YJ3 A;  3ZP7 A;  2Z1U A;  4BT2 A;  4DRX A;  5CA0 A;  2Z01 A;  3VI6 A;  4BT4 A;  4G4Z A;  5GIO C;  2K1S A;  3VMF B;  4EI8 A;  3N2G A;  4X1Y A;  4O4L A;  1Q82 H;  1SZQ A;  2H6L A;  3C9S A;  3WGJ A;  1RQ2 A;  1PF5 A;  4G88 A;  3I3F A;  3JAS B;  1YIT F;  1VHA A;  4WBN B;  3V7E A;  3GHZ A;  4EI9 A;  5LA6 B;  3UT5 B;  3SIV A;  3F0E A;  3LWV C;  3ESJ A;  5LXT A;  2Z1E A;  2MQE A;  5KMG B;  5G4U C;  2P6Y A;  2UYK A;  5EIB D;  3JAR A;  5J2T B;  3JAK B;  4O2B A;  2CSL A;  3CCQ F;  3CPQ A;  2UYP A;  3RYH B;  4TV8 B;  3JVH A;  3J80 M;  2R6R 1;  5AVM A;  3MQW A;  3HKD B;  3I55 F;  1IV4 A;  1OFU A;  1U40 A;  1VQV A;  3LYB A;  4ZOL B;  5JCO C;  2V9Y A;  1JD1 A;  3RYI B;  2IQQ A;  1ODE A;  2DYY A;  5EIB C;  1NQ3 A;  4B45 A;  2FC3 A;  3CME F;  2IG8 A;  1ZWZ A;  3CG6 A;  3JAS A;  3OON A;  3JAT B;  3GYQ A;  3LWP C;  3WPX A;  3Q8H A;  3M1X A;  3F0F A;  3KJJ A;  3CC7 F;  1SA0 B;  1VQ5 F;  3UT5 A;  2GVI A;  2KG4 A;  2UYN B;  1X52 A;  3CC2 F;  3NMU C;  2LCA A;  3OW2 F;  3C9U A;  5KMG A;  1Q81 H;  1U3P A;  3D00 A;  3G6E F;  5J2T A;  3VOA A;  1JY8 A;  3JAK A;  4LNU B;  5MN6 A;  2YXZ A;  3N4Z A;  2CHT A;  3DDN A;  4HNA B;  1W5B A;  1TUB B;  4TV8 A;  3RYH A;  3WGM A;  3CC4 F;  1VQP F;  5HP7 A;  2Q1X A;  3DC2 A;  3HKD A;  4X20 B;  5ITZ A;  3RYC A;  4ZOL A;  3ZOP A;  4ERH A;  1FSZ A;  3CCS F;  1T0K B;  1E7K A;  1IPA A;  3OBW A;  2GZL A;  3JCM M;  2ZF8 A;  3IR9 A;  4BVQ A;  4IHJ B; 
#chains in the Genus database with same CATH homology
 3I7T A;  4NWO B;  3LYB A;  3M4S A;  2CHS A;  1FNK A;  1JD1 A;  1QU9 A;  1XRG A;  3ZO8 A;  1X25 A;  2UYJ A;  1ODE A;  2DYY A;  2EWC A;  1DBF A;  1ONI A;  2CHT A;  1J7H A;  1NQ3 A;  1UFY A;  2B33 A;  3GTZ A;  3ZP7 A;  1UI9 A;  1COM A;  2IG8 A;  2OTM A;  4ZK7 A;  2CW4 A;  2UYN A;  5HP7 A;  1XHO A;  1QD9 A;  3V4D A;  3ZOP A;  3D01 A;  2UYK A;  3K0T A;  3R0P A;  3M1X A;  3K12 A;  3LME A;  2CSL A;  3ZP4 A;  3KJJ A;  3KJK A;  1QAH A;  2UYP A;  3QUW A;  2CVL A;  1PF5 A;  3L7Q A;  3I3F A;  3VCZ A;  1FNJ A;  3MQW A;  2UYN B;  2CWJ A;  5HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...