3LMEA

Structure of probable translation initiation inhibitor from (rpa2473) from rhodopseudomonas palustris
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
SLKIIAPTDKTITPSGTWSIGARAGDFVFIGGMHGTDRVTGKMVDGDEARIRRMFDNMLAAAEAAGATKADAVRLTVFVTDVAKYRPVVNKVQKDIWGDGPYPPRTVLQVPALDQGDIAEIDGTFYAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible translation initiation inhibitor
publication title Structure of probable translation initiation inhibitor from (RPA2473) from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Translation
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3lmeA00
1QU9A 1DBFA 3ZP4A 2UYPA 3ZP7A 2DYYA 2OTMA 2UYNB 1XRGA 1ODEA 3KJJA 3M4SA 3R0PA 1UFYA 1XHOA 3K0TA 3VCZA 2UYNA 3KJKA 3GTZA 2CW4A 1FNKA 3I3FA 4ZK7A 5HP8A 1J7HA 2IG8A 3ZOPA 3QUWA 4NWOB 2CSLA 3K12A 1COMA 2CWJA 2UYKA 1JD1A 1PF5A 3M1XA 3ZO8A 2CHTA 1FNJA 1UI9A 2UYJA 3D01A 2CVLA 1QD9A 2B33A 2EWCA 5HP7A 2CHSA 1QAHA 3L7QA 1ONIA 3V4DA 1NQ3A 3MQWA 3LMEA 3LYBA 1X25A 3I7TA
chains in the Genus database with same CATH superfamily
4X1KB 3ZP4A 1IV3A 1XRGA 3CYPB 4O4JA 2FGYA 1VQNF 2OZBA 4LCKA 2BTOA 3QTYA 2OTLF 3CYQA 5GONB 4TUYB 2Z1EA 2L26A 5LYJA 2I6RA 1YJWF 1KC8H 1XV2A 2CHTA 3LWOC 1W581 5LXTB 2Z1UA 3TD5A 1VQ8F 5FJ4C 2RHHA 1TUBA 4C8IA 2H8CA 2AMTA 3MQWA 1RLGA 3S0YA 3S03A 3SIUA 3F0FA 4R40B 1IPAA 2DYYA 3T80A 2ZOVA 1M90H 1X7OA 1YI2F 5FNVB 2UYNA 1YJNF 2ZODA 5IYZB 2FC3A 3QUWA 1RA4A 2UYKA 1VQ7F 1UI9A 1SA0A 1SDSA 4EI9A 3LFOA 3MCQA 5CA0A 3F0DA 3D00A 3WPWA 3V4DA 2CZWA 5G4UC 3LYBA 4B45A 4I4TB 3K14A 2QA4F 2OHWA 3SIVA 2UYPA 4FFBB 4X1YB 3P4EA 2KTVA 3ON1A 3CCLF 1Z5WA 1YGYA 2H6LA 4IIJB 1ZWZA 2Q1XA 3VO8A 5JVDA 3G4SF 3JVHA 1FFXA 3MBMA 1JFFA 3HJWC 1PXWA 2LCAA 4U3JB 3JAMM 1W3EX 3J81M 2B33A 2HVYD 4EI7A 1Q7YH 3V3TA 1IV2A 1ONIA 1K73H 3FPIA 1RLUA 2UZHA 5C8YB 3RYCB 5GINC 4F6RA 2ZVYA 3RYHB 5HP7A 1DBFA 4ZHYB 1QU9A 4I50A 1W59A 3P0ZA 1TVKB 5J2UA 1FSZA 3RA5A 1VQ4F 5AVMA 1R1MA 3ELCA 4BVTA 3LDTA 3IKEA 3KHNA 1W40A 3Q8HA 5MN4A 3WGKA 1H48A 2Z1FA 4RHAA 4EI8A 3DC2A 5HY2A 3F6MA 1RQ2A 2H8EA 1PF5A 2UYJA 3NMUC 1H47A 2EWCA 3JASB 5LOVA 3L7QA 4BT2A 1U40A 5JCOA 4BW0B 4IHJB 3O85A 4B5CA 2ZVZA 3CCRF 1VH8A 5JCOC 3N4ZA 5IT9M 2F9ZC 1U3LA 3U0OA 5JH7B 3GHZA 5KMGB 2N48A 4X1KA 3M4SA 4DRXB 4C82A 4PWTA 3FD5A 3F0EA 2R6R1 3ESJA 3JCMM 2ZAUA 4BT5A 3F0GA 3HTNA 5LA6B 5JQGB 3VYSC 2YYEA 1KQSF 3KIZA 3WGJA 5GONA 4TUYA 1VQ6F 3E22A 2HS4A 3D01A 1GO1A 1VQ9F 3D54A 5LXTA 4BY9D 3G71F 1S72F 1NMUB 4O4HB 2Z01A 1YQNA 2OTMA 2ZF8A 5GANK 3FBAA 3VYTC 4ZHQB 4KWEA 5HXUA 3I3FA 4ZK7A 5HP8A 1J7HA 3RYFB 1Z5VA 3WPXA 4G4XA 3K12A 5IYZA 3E1YA 2GZLA 3CPWF 5MN6A 1VQOF 1Q82H 4YJ3B 4X3MA 3J7AR 5EIBD 1SZQA 1YJ9F 5LP6B 4C8GA 1VQMF 3IMPA 3ZP7A 3C9TA 4G4YA 4I4TA 3C9SA 5IJ0A 3VCZA 4G4ZA 4FFBA 2YXZA 1VHAA 2WALA 3OONA 4X1IB 4X1YA 4X20B 5EB1B 2Z1TA 4IIJA 4NQ3A 3HKCA 1W2BF 4YJ2B 2RHOA 2BTQB 1N8RH 4U3JA 4I55B 1VQPF 2HS3A 1VQKF 4LNUB 4B46A 4B62A 3LMEA 5CA1A 3RYCA 5C8YA 3HWUA 4BVQA 3RYHA 4ZHVA 5KX5B 5DCVA 1W5AA 3WXMB 5HY4A 1TVKA 4XCQA 1W5BA 4G4VA 2QI2A 3HKDB 4O4LB 3TD3A 3IEWA 5BMVB 2VXYA 4DXDA 5EWRA 1M1KH 1W42A 2QEXF 2VGNA 3OBYA 4BVSA 4TV8B 1NQ3A 3JASA 4WBNB 3I56F 3NVIB 3JATB 4IHJA 1CK2A 3C8LA 3J80M 2AIZP 2G9IA 5JH7A 1T0KB 5KMGA 4DRXA 3TD4A 2AIFA 4ERHA 1X52A 4O4IB 3S02A 5LA6A 5JQGA 2NMUA 5B8FA 2KGWA 4C8EA 1W57A 3MCAB 4C81A 1QVFF 4BT7A 4EB6B 3QHDA 3I7TA 3WJQA 3N2KB 4O4HA 5ITZB 5EO3A 4ZI7A 3M84A 4RQOA 3OW2F 3N4YA 3UT5B 5IJ9B 4G4WA 3VOBA 1FNKA 3FD6A 3RYIB 3CB2A 2I6DA 1Q8RA 4ZHWA 5EIBC 1KD1H 5G4VC 1VQ5F 1COMA 2CWJA 3RYFA 1T0AA 3V7QA 2IQQA 1XBIA 1Q86H 1JD1A 3S06A 5FLXM 3JARB 2OTJF 4I50B 3N2GB 4O2AB 1KNJA 4YJ3A 5HY0A 5HXZA 1X25A 2HP0B 2PMPA 5GAPK 5HY1A 5EB0A 2LBTA 2R751 3JALB 3JAWB 5EZYB 5MN5A 1CLIA 1U43A 4E6EA 1IV1A 3NK7A 2IG8A 2MQEA 1GO0A 5FNVA 4X1IA 3WGLA 3DDNA 3P10A 4X20A 3EORA 1W41A 2HS0A 2V9YA 3M1XA 4O2BB 3G6EF 2CVLA 3JAKB 1GZ0A 4X3LA 4YJ2A 1OFUA 3KE1A 5EYPB 2HQSC 2HRYA 3VTIC 4I55A 2W8BC 3WGNA 3CC4F 3HKBB 1QVGF 2HP3A 2ALEA 4TV9B 4LNUA 2KTUA 1ODEA 3KJJA 3CPQA 3R0PA 3HKEB 1XHOA 3K0TA 4ZOLB 1DT9A 4M8IA 5A2QM 2CW4A 5KX5A 4U39A 2DT4A 5CB4B 3VMFB 1RQ7A 3CMEF 3NK6A 3E22B 3HKDA 4O4LA 3VYUC 4HNAB 1Q81H 3S0WA 5BMVA 4C4WC 5J2TB 2CHSA 2VAWA 5HWEA 4BT3A 1W5EA 1W55A 4O4JB 4TV8A 3PAFA 4WBNA 3JATA 3MDOA 1CN7A 3WGMA 1W5FA 2VAPA 3CCSF 4TZZA 2Q1YA 3CCEF 3CCUF 3IR9A 5EAZA 3RA6A 3CCQF 5LYJB 3ZOPA 3IEQA 1K9MH 3CCJF 3E20B 3S0HA 3CCMF 4O4IA 3ERNA 3IKFA 1YITF 1H7MA 1TUBB 3VI6A 3LWPC 2VAMA 3LWRC 3C9RA 2PHNA 5IJ0B 2BO1A 4EB6A 3CD6F 2UYNB 2HRUA 1X7PA 1VQLF 2K1SA 3B6NA 2HX0A 3LWVC 3N2KA 1KNKA 1K8AH 3GTZA 3RE3A 3WJPA 5ITZA 3HKCB 3UT5A 5IJ9A 3RYIA 3V7EA 1IV4A 5GIOC 2LBXA 3CC7F 3PLAC 3I55F 1SA0B 5CA0B 3LWQC 1NJIH 4BT6A 3VIUA 3OBWA 5CA1B 1QAHA 3CC2F 3JARA 2GVIA 3N2GA 4O2AA 3BYQA 1OAPA 2HP0A 3CCVF 1JN1A 5JVDB 1FFXB 3JALA 3JAWA 5EZYA 1JFFB 2KG4A 3C9UA 3CG6A 1JJ2F 2RHJA 2JNBA 4ZHQA 4NWOB 1YHQF 2CSLA 3K2XA 4BVRA 3HAXD 4BT4A 1E7KA 1FNJA 1QD9A 4O2BA 3NVKE 4F6RB 2IAFA 3JAKA 5EYPA 5J2UB 3HKBA 1VQVA 4NUTA 5LP6A 4TV9A 5GIPC 1U3PA 3AGKA 1UFYA 3WJRA 3KJKA 5LP6C 2RHLA 3CMAF 4ZOLA 3HKEA 2GLZA 3VOAA 3FFMA 5CB4A 3GYQA 4G88A 3ZO8A 5LOVB 1YIJF 4HNAA 1VK3A 2LBWA 2P6YA 2VGMA 1JY8A 3CXCF 5J2TA 2RB9A 1GX1A 2QTPA 4ZI7B 2BTUA
chains in the Genus database with same CATH topology
1QU9A 1DBFA 3ZP4A 2UYPA 3ZP7A 2DYYA 2OTMA 2UYNB 1XRGA 1ODEA 3KJJA 3M4SA 3R0PA 1UFYA 1XHOA 3K0TA 3VCZA 2UYNA 3KJKA 3GTZA 2CW4A 1FNKA 3I3FA 4ZK7A 5HP8A 1J7HA 2IG8A 3ZOPA 3QUWA 4NWOB 2CSLA 3K12A 1COMA 2CWJA 2UYKA 1JD1A 1PF5A 3M1XA 3ZO8A 2CHTA 1FNJA 1UI9A 2UYJA 3D01A 2CVLA 1QD9A 2B33A 2EWCA 5HP7A 2CHSA 1QAHA 3L7QA 1ONIA 3V4DA 1NQ3A 3MQWA 3LMEA 3LYBA 1X25A 3I7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QU9 A;  1DBF A;  3ZP4 A;  2UYP A;  3ZP7 A;  2DYY A;  2OTM A;  2UYN B;  1XRG A;  1ODE A;  3KJJ A;  3M4S A;  3R0P A;  1UFY A;  1XHO A;  3K0T A;  3VCZ A;  2UYN A;  3KJK A;  3GTZ A;  2CW4 A;  1FNK A;  3I3F A;  4ZK7 A;  5HP8 A;  1J7H A;  2IG8 A;  3ZOP A;  3QUW A;  4NWO B;  2CSL A;  3K12 A;  1COM A;  2CWJ A;  2UYK A;  1JD1 A;  1PF5 A;  3M1X A;  3ZO8 A;  2CHT A;  1FNJ A;  1UI9 A;  2UYJ A;  3D01 A;  2CVL A;  1QD9 A;  2B33 A;  2EWC A;  5HP7 A;  2CHS A;  1QAH A;  3L7Q A;  1ONI A;  3V4D A;  1NQ3 A;  3MQW A;  3LME A;  3LYB A;  1X25 A;  3I7T A; 
#chains in the Genus database with same CATH topology
 4X1K B;  3ZP4 A;  1IV3 A;  1XRG A;  3CYP B;  4O4J A;  2FGY A;  1VQN F;  2OZB A;  4LCK A;  2BTO A;  3QTY A;  2OTL F;  3CYQ A;  5GON B;  4TUY B;  2Z1E A;  2L26 A;  5LYJ A;  2I6R A;  1YJW F;  1KC8 H;  1XV2 A;  2CHT A;  3LWO C;  1W58 1;  5LXT B;  2Z1U A;  3TD5 A;  1VQ8 F;  5FJ4 C;  2RHH A;  1TUB A;  4C8I A;  2H8C A;  2AMT A;  3MQW A;  1RLG A;  3S0Y A;  3S03 A;  3SIU A;  3F0F A;  4R40 B;  1IPA A;  2DYY A;  3T80 A;  2ZOV A;  1M90 H;  1X7O A;  1YI2 F;  5FNV B;  2UYN A;  1YJN F;  2ZOD A;  5IYZ B;  2FC3 A;  3QUW A;  1RA4 A;  2UYK A;  1VQ7 F;  1UI9 A;  1SA0 A;  1SDS A;  4EI9 A;  3LFO A;  3MCQ A;  5CA0 A;  3F0D A;  3D00 A;  3WPW A;  3V4D A;  2CZW A;  5G4U C;  3LYB A;  4B45 A;  4I4T B;  3K14 A;  2QA4 F;  2OHW A;  3SIV A;  2UYP A;  4FFB B;  4X1Y B;  3P4E A;  2KTV A;  3ON1 A;  3CCL F;  1Z5W A;  1YGY A;  2H6L A;  4IIJ B;  1ZWZ A;  2Q1X A;  3VO8 A;  5JVD A;  3G4S F;  3JVH A;  1FFX A;  3MBM A;  1JFF A;  3HJW C;  1PXW A;  2LCA A;  4U3J B;  3JAM M;  1W3E X;  3J81 M;  2B33 A;  2HVY D;  4EI7 A;  1Q7Y H;  3V3T A;  1IV2 A;  1ONI A;  1K73 H;  3FPI A;  1RLU A;  2UZH A;  5C8Y B;  3RYC B;  5GIN C;  4F6R A;  2ZVY A;  3RYH B;  5HP7 A;  1DBF A;  4ZHY B;  1QU9 A;  4I50 A;  1W59 A;  3P0Z A;  1TVK B;  5J2U A;  1FSZ A;  3RA5 A;  1VQ4 F;  5AVM A;  1R1M A;  3ELC A;  4BVT A;  3LDT A;  3IKE A;  3KHN A;  1W40 A;  3Q8H A;  5MN4 A;  3WGK A;  1H48 A;  2Z1F A;  4RHA A;  4EI8 A;  3DC2 A;  5HY2 A;  3F6M A;  1RQ2 A;  2H8E A;  1PF5 A;  2UYJ A;  3NMU C;  1H47 A;  2EWC A;  3JAS B;  5LOV A;  3L7Q A;  4BT2 A;  1U40 A;  5JCO A;  4BW0 B;  4IHJ B;  3O85 A;  4B5C A;  2ZVZ A;  3CCR F;  1VH8 A;  5JCO C;  3N4Z A;  5IT9 M;  2F9Z C;  1U3L A;  3U0O A;  5JH7 B;  3GHZ A;  5KMG B;  2N48 A;  4X1K A;  3M4S A;  4DRX B;  4C82 A;  4PWT A;  3FD5 A;  3F0E A;  2R6R 1;  3ESJ A;  3JCM M;  2ZAU A;  4BT5 A;  3F0G A;  3HTN A;  5LA6 B;  5JQG B;  3VYS C;  2YYE A;  1KQS F;  3KIZ A;  3WGJ A;  5GON A;  4TUY A;  1VQ6 F;  3E22 A;  2HS4 A;  3D01 A;  1GO1 A;  1VQ9 F;  3D54 A;  5LXT A;  4BY9 D;  3G71 F;  1S72 F;  1NMU B;  4O4H B;  2Z01 A;  1YQN A;  2OTM A;  2ZF8 A;  5GAN K;  3FBA A;  3VYT C;  4ZHQ B;  4KWE A;  5HXU A;  3I3F A;  4ZK7 A;  5HP8 A;  1J7H A;  3RYF B;  1Z5V A;  3WPX A;  4G4X A;  3K12 A;  5IYZ A;  3E1Y A;  2GZL A;  3CPW F;  5MN6 A;  1VQO F;  1Q82 H;  4YJ3 B;  4X3M A;  3J7A R;  5EIB D;  1SZQ A;  1YJ9 F;  5LP6 B;  4C8G A;  1VQM F;  3IMP A;  3ZP7 A;  3C9T A;  4G4Y A;  4I4T A;  3C9S A;  5IJ0 A;  3VCZ A;  4G4Z A;  4FFB A;  2YXZ A;  1VHA A;  2WAL A;  3OON A;  4X1I B;  4X1Y A;  4X20 B;  5EB1 B;  2Z1T A;  4IIJ A;  4NQ3 A;  3HKC A;  1W2B F;  4YJ2 B;  2RHO A;  2BTQ B;  1N8R H;  4U3J A;  4I55 B;  1VQP F;  2HS3 A;  1VQK F;  4LNU B;  4B46 A;  4B62 A;  3LME A;  5CA1 A;  3RYC A;  5C8Y A;  3HWU A;  4BVQ A;  3RYH A;  4ZHV A;  5KX5 B;  5DCV A;  1W5A A;  3WXM B;  5HY4 A;  1TVK A;  4XCQ A;  1W5B A;  4G4V A;  2QI2 A;  3HKD B;  4O4L B;  3TD3 A;  3IEW A;  5BMV B;  2VXY A;  4DXD A;  5EWR A;  1M1K H;  1W42 A;  2QEX F;  2VGN A;  3OBY A;  4BVS A;  4TV8 B;  1NQ3 A;  3JAS A;  4WBN B;  3I56 F;  3NVI B;  3JAT B;  4IHJ A;  1CK2 A;  3C8L A;  3J80 M;  2AIZ P;  2G9I A;  5JH7 A;  1T0K B;  5KMG A;  4DRX A;  3TD4 A;  2AIF A;  4ERH A;  1X52 A;  4O4I B;  3S02 A;  5LA6 A;  5JQG A;  2NMU A;  5B8F A;  2KGW A;  4C8E A;  1W57 A;  3MCA B;  4C81 A;  1QVF F;  4BT7 A;  4EB6 B;  3QHD A;  3I7T A;  3WJQ A;  3N2K B;  4O4H A;  5ITZ B;  5EO3 A;  4ZI7 A;  3M84 A;  4RQO A;  3OW2 F;  3N4Y A;  3UT5 B;  5IJ9 B;  4G4W A;  3VOB A;  1FNK A;  3FD6 A;  3RYI B;  3CB2 A;  2I6D A;  1Q8R A;  4ZHW A;  5EIB C;  1KD1 H;  5G4V C;  1VQ5 F;  1COM A;  2CWJ A;  3RYF A;  1T0A A;  3V7Q A;  2IQQ A;  1XBI A;  1Q86 H;  1JD1 A;  3S06 A;  5FLX M;  3JAR B;  2OTJ F;  4I50 B;  3N2G B;  4O2A B;  1KNJ A;  4YJ3 A;  5HY0 A;  5HXZ A;  1X25 A;  2HP0 B;  2PMP A;  5GAP K;  5HY1 A;  5EB0 A;  2LBT A;  2R75 1;  3JAL B;  3JAW B;  5EZY B;  5MN5 A;  1CLI A;  1U43 A;  4E6E A;  1IV1 A;  3NK7 A;  2IG8 A;  2MQE A;  1GO0 A;  5FNV A;  4X1I A;  3WGL A;  3DDN A;  3P10 A;  4X20 A;  3EOR A;  1W41 A;  2HS0 A;  2V9Y A;  3M1X A;  4O2B B;  3G6E F;  2CVL A;  3JAK B;  1GZ0 A;  4X3L A;  4YJ2 A;  1OFU A;  3KE1 A;  5EYP B;  2HQS C;  2HRY A;  3VTI C;  4I55 A;  2W8B C;  3WGN A;  3CC4 F;  3HKB B;  1QVG F;  2HP3 A;  2ALE A;  4TV9 B;  4LNU A;  2KTU A;  1ODE A;  3KJJ A;  3CPQ A;  3R0P A;  3HKE B;  1XHO A;  3K0T A;  4ZOL B;  1DT9 A;  4M8I A;  5A2Q M;  2CW4 A;  5KX5 A;  4U39 A;  2DT4 A;  5CB4 B;  3VMF B;  1RQ7 A;  3CME F;  3NK6 A;  3E22 B;  3HKD A;  4O4L A;  3VYU C;  4HNA B;  1Q81 H;  3S0W A;  5BMV A;  4C4W C;  5J2T B;  2CHS A;  2VAW A;  5HWE A;  4BT3 A;  1W5E A;  1W55 A;  4O4J B;  4TV8 A;  3PAF A;  4WBN A;  3JAT A;  3MDO A;  1CN7 A;  3WGM A;  1W5F A;  2VAP A;  3CCS F;  4TZZ A;  2Q1Y A;  3CCE F;  3CCU F;  3IR9 A;  5EAZ A;  3RA6 A;  3CCQ F;  5LYJ B;  3ZOP A;  3IEQ A;  1K9M H;  3CCJ F;  3E20 B;  3S0H A;  3CCM F;  4O4I A;  3ERN A;  3IKF A;  1YIT F;  1H7M A;  1TUB B;  3VI6 A;  3LWP C;  2VAM A;  3LWR C;  3C9R A;  2PHN A;  5IJ0 B;  2BO1 A;  4EB6 A;  3CD6 F;  2UYN B;  2HRU A;  1X7P A;  1VQL F;  2K1S A;  3B6N A;  2HX0 A;  3LWV C;  3N2K A;  1KNK A;  1K8A H;  3GTZ A;  3RE3 A;  3WJP A;  5ITZ A;  3HKC B;  3UT5 A;  5IJ9 A;  3RYI A;  3V7E A;  1IV4 A;  5GIO C;  2LBX A;  3CC7 F;  3PLA C;  3I55 F;  1SA0 B;  5CA0 B;  3LWQ C;  1NJI H;  4BT6 A;  3VIU A;  3OBW A;  5CA1 B;  1QAH A;  3CC2 F;  3JAR A;  2GVI A;  3N2G A;  4O2A A;  3BYQ A;  1OAP A;  2HP0 A;  3CCV F;  1JN1 A;  5JVD B;  1FFX B;  3JAL A;  3JAW A;  5EZY A;  1JFF B;  2KG4 A;  3C9U A;  3CG6 A;  1JJ2 F;  2RHJ A;  2JNB A;  4ZHQ A;  4NWO B;  1YHQ F;  2CSL A;  3K2X A;  4BVR A;  3HAX D;  4BT4 A;  1E7K A;  1FNJ A;  1QD9 A;  4O2B A;  3NVK E;  4F6R B;  2IAF A;  3JAK A;  5EYP A;  5J2U B;  3HKB A;  1VQV A;  4NUT A;  5LP6 A;  4TV9 A;  5GIP C;  1U3P A;  3AGK A;  1UFY A;  3WJR A;  3KJK A;  5LP6 C;  2RHL A;  3CMA F;  4ZOL A;  3HKE A;  2GLZ A;  3VOA A;  3FFM A;  5CB4 A;  3GYQ A;  4G88 A;  3ZO8 A;  5LOV B;  1YIJ F;  4HNA A;  1VK3 A;  2LBW A;  2P6Y A;  2VGM A;  1JY8 A;  3CXC F;  5J2T A;  2RB9 A;  1GX1 A;  2QTP A;  4ZI7 B;  2BTU A; 
#chains in the Genus database with same CATH homology
 1QU9 A;  1DBF A;  3ZP4 A;  2UYP A;  3ZP7 A;  2DYY A;  2OTM A;  2UYN B;  1XRG A;  1ODE A;  3KJJ A;  3M4S A;  3R0P A;  1UFY A;  1XHO A;  3K0T A;  3VCZ A;  2UYN A;  3KJK A;  3GTZ A;  2CW4 A;  1FNK A;  3I3F A;  4ZK7 A;  5HP8 A;  1J7H A;  2IG8 A;  3ZOP A;  3QUW A;  4NWO B;  2CSL A;  3K12 A;  1COM A;  2CWJ A;  2UYK A;  1JD1 A;  1PF5 A;  3M1X A;  3ZO8 A;  2CHT A;  1FNJ A;  1UI9 A;  2UYJ A;  3D01 A;  2CVL A;  1QD9 A;  2B33 A;  2EWC A;  5HP7 A;  2CHS A;  1QAH A;  3L7Q A;  1ONI A;  3V4D A;  1NQ3 A;  3MQW A;  3LME A;  3LYB A;  1X25 A;  3I7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...