2UZHA

Mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
153
Chain Sequence
LPRVGLGTDVHPIEAGRPCRLLCLEFDDADGCASDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVGAPVSVSATTTDGLGLTGRGEGLAAIATALVAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title The Structure of Mycobacteria 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase, an Essential Enzyme, Provides a Platform for Drug Discovery.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Lyase
total genus 45
structure length 153
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2uzhA00
1U3LA 1U3PA 3IKEA 1VH8A 3FBAA 1JY8A 1KNJA 1U40A 1W57A 1VHAA 3GHZA 3JVHA 1JN1A 1H48A 1H47A 4C8EA 2AMTA 3ELCA 1YQNA 1IV4A 3F0DA 3EORA 3FPIA 2GZLA 1KNKA 3F0FA 3Q8HA 4C81A 1IV1A 4C82A 3QHDA 3K14A 3ESJA 4C8IA 3T80A 1GX1A 1W55A 3B6NA 3MBMA 5B8FA 3KE1A 3F0EA 3K2XA 3ERNA 4C8GA 2UZHA 1U43A 1IV3A 3F0GA 3P0ZA 3IEWA 2PMPA 3IEQA 3F6MA 1T0AA 3RE3A 3P10A 3IKFA 1IV2A
chains in the Genus database with same CATH superfamily
5KMGB 2CHTA 3PAFA 3K12A 3CYQA 4BT6A 5HY1A 4IHJA 3MDOA 1SA0A 2OTMA 2BTUA 3LMEA 4X1IB 4X1YB 2CHSA 2V9YA 2AMTA 2CSLA 3C9TA 4EB6A 5FLXM 3FD6A 2ZF8A 5GIOC 3ON1A 4TV8A 3TD4A 5IJ0A 3K14A 2YYEA 4O4JA 3OBYA 5JCOA 3CCRF 3RYFA 1YITF 5FJ4C 1YJNF 5GONA 5EAZA 2UYPA 2R6R1 2PMPA 3FFMA 3RYCB 1XBIA 3CPQA 3S06A 5HY2A 2OTJF 5HY4A 1JJ2F 4DRXB 3HAXD 1IPAA 1Q8RA 1U3LA 4YJ2A 2GLZA 3CC2F 3HKDB 3NK7A 2H8EA 1GZ0A 4X20B 1W2BF 1KD1H 5JVDA 4BVRA 2HRYA 2HQSC 2QA4F 4O4HB 1W5FA 3DC2A 1XRGA 4X3LA 1ODEA 2ZOVA 4LNUA 2VGNA 3IEQA 3JAKB 4TV9B 4NUTA 3D00A 1VQ5F 3MCQA 3WGLA 5LP6B 4I4TB 1U3PA 3IKEA 4B62A 4WBNB 3JAMM 4B46A 3DDNA 4TUYB 4DXDA 1NMUB 3HKCA 4O4IA 5C8YB 2KGWA 2F9ZC 5FNVA 2ZODA 1IV4A 5LOVB 3RYIB 2I6DA 3VOBA 1IV1A 4C4WC 5G4VC 2Z1TA 3RA6A 3F0EA 4O2AB 3KJJA 5IYZA 3M1XA 5HP8A 3LWQC 4ZHWA 1YIJF 5G4UC 3D01A 1RA4A 3S0YA 5CA0B 4ZOLB 4IIJB 2GVIA 3VYSC 3GHZA 3IMPA 3ZP4A 4BT4A 5LXTB 1CN7A 4ZK7A 4C8EA 3CC4F 1H7MA 2DYYA 2VAMA 4NWOB 5LA6A 5B8FA 3ZO8A 3JALB 1U43A 3N4ZA 3NMUC 5HY0A 2G9IA 3OW2F 3VTIC 3HJWC 1VQ8F 3OONA 5CB4A 5IJ9A 3V3TA 4NQ3A 5J2UA 4R40B 1TUBB 1DT9A 3WJQA 2BTQB 3JAWB 2OZBA 1M90H 1YQNA 2YXZA 5EZYB 3C8LA 1YJ9F 3WGNA 1KNKA 3N2GA 3E20B 4FFBA 4G88A 5EIBD 3KE1A 5KX5B 2AIZP 3AGKA 1X7PA 2HP0B 1K73H 4TZZA 2HS4A 1VQVA 3JCMM 4BT2A 5ITZB 1Q81H 2Z1EA 1XV2A 1M1KH 1CLIA 1VQ7F 4I55B 2OHWA 2BTOA 3TD5A 3SIVA 1W5EA 1W5BA 4ZHQB 1CK2A 2KTVA 3CCQF 5HP7A 3TD3A 1GO1A 4X1YA 3CG6A 2H6LA 2HVYD 3WPXA 5JQGB 1W581 3CC7F 3M84A 2RB9A 1T0AA 3HKBB 4G4YA 1QAHA 3RYCA 3J80M 4O4LA 3ZOPA 1R1MA 1VQOF 1U40A 4DRXA 4LCKA 3CCLF 2IQQA 2RHHA 4X1KB 2VXYA 2CW4A 1ZWZA 3HKDA 3LWPC 3E22B 2IG8A 2KG4A 1X25A 4X20A 5GONB 3Q8HA 3J81M 3WGMA 4U3JB 4C81A 3T80A 3JATA 3R0PA 1YJWF 3N2KB 1FSZA 2B33A 3L7QA 5EYPB 5HXZA 4B5CA 4O4HA 2UYKA 4G4VA 3CMEF 3CD6F 4I50B 3C9RA 3UT5B 3S02A 2Q1XA 2L26A 3JAKA 2LBXA 4TV9A 2IAFA 3HWUA 5LP6A 1K9MH 4I4TA 2OTLF 1UI9A 3CMAF 3VCZA 4G4XA 5A2QM 1W5AA 4BVQA 1J7HA 3G71F 4BT5A 1OAPA 2HRUA 5LOVA 2AIFA 3CCJF 3I7TA 1SZQA 1NQ3A 3RYIA 1W40A 3CCMF 5LYJB 5CA1B 4HNAB 3LFOA 4O2AA 5J2TB 3WJRA 3RYHB 3I56F 2UYNB 3G4SF 1VH8A 1TVKB 1KNJA 5BMVA 3LWRC 5JCOC 1RLUA 3JVHA 3K0TA 3LWVC 5CA0A 4F6RA 1KC8H 2VAWA 3NVIB 2ZAUA 5EO3A 1JFFA 4ZOLA 1Z5WA 4IIJA 3KHNA 3M4SA 1W41A 5LXTA 2KTUA 1X52A 2CVLA 3JASB 2WALA 1Q7YH 3QUWA 3JARB 1PXWA 4C8IA 1VQLF 1COMA 1YI2F 1S72F 3N4YA 1OFUA 3LYBA 1QVFF 3SIUA 3F6MA 1T0KB 3JALA 3WGKA 2W8BC 3P10A 1W3EX 3VIUA 5MN5A 1TUBA 4E6EA 4M8IA 2H8CA 5JH7B 2R751 3ELCA 4EI7A 3CCVF 3JAWA 4O2BB 2RHOA 4ZI7B 3HKEB 4BT7A 5AVMA 5EZYA 1FFXB 3WPWA 3K2XA 3IR9A 1Q82H 1SDSA 1FNKA 2CZWA 4KWEA 1RLGA 5EWRA 5KX5A 3PLAC 4EI8A 1YHQF 3CXCF 2Z1UA 2HP0A 1VK3A 5EIBC 4YJ3B 3GYQA 3HTNA 5ITZA 1VQMF 1H47A 5MN6A 5KMGA 3VOAA 1YGYA 3FPIA 4C82A 2HP3A 4X1IA 4ZHQA 5GIPC 1W59A 3KIZA 3WJPA 4BW0B 3ERNA 2UZHA 5HWEA 5GANK 4IHJB 5JQGA 1SA0B 2QEXF 1JY8A 2FC3A 4BY9D 3LWOC 3HKBA 4EB6B 3C9UA 3CYPB 4TV8B 5IJ0B 3MQWA 4BVSA 4BVTA 4G4WA 4O4JB 3RYFB 3LDTA 4X1KA 3ESJA 3QTYA 2EWCA 3MBMA 3VMFB 5HXUA 1XHOA 2PHNA 3E22A 4U3JA 1IV3A 2CWJA 2RHLA 4O4LB 4YJ2B 3N2KA 1E7KA 5EYPA 4ZHYB 3FBAA 1N8RH 3ZP7A 2Z1FA 1JN1A 4BT3A 4I50A 4G4ZA 1QU9A 3UT5A 5JVDB 3I55F 3JATB 4WBNA 4TUYA 5IT9M 4XCQA 5C8YA 3CCEF 2N48A 1W42A 2FGYA 3D54A 4LNUB 4ZHVA 3VI6A 5GAPK 3G6EF 3U0OA 3OBWA 5EB1B 4PWTA 3IEWA 1K8AH 2HS3A 1VQKF 3WXMB 4X3MA 3HKCB 5LYJA 4O4IB 5CA1A 1QVGF 2HX0A 4HNAA 3I3FA 2Z01A 1RQ7A 5FNVB 3VYUC 5J2TA 1Z5VA 3C9SA 1VHAA 3RYHA 2I6RA 2NMUA 2RHJA 1VQPF 2UYNA 1TVKA 1RQ2A 1UFYA 3S03A 3FD5A 5IYZB 2LBWA 4EI9A 3CCSF 2JNBA 4U39A 3CCUF 1PF5A 4C8GA 3S0WA 3JASA 3F0GA 3WGJA 3P0ZA 3JARA 4RQOA 5MN4A 5BMVB 1VQ9F 3KJKA 5DCVA 3E1YA 3NVKE 4F6RB 5EB0A 1IV2A 1JFFB 2HS0A 1GO0A 1W57A 1H48A 5LA6B 2Q1YA 3F0DA 3EORA 2UYJA 3V7EA 3V4DA 2LCAA 2ZVYA 3QHDA 5JH7A 3B6NA 4O2BA 1KQSF 5LP6C 2LBTA 5CB4B 5IJ9B 4ZI7A 3O85A 3HKEA 1ONIA 5J2UB 1FFXA 3V7QA 2VGMA 4B45A 2ALEA 3RE3A 2DT4A 3IKFA 2ZVZA 3J7AR 3NK6A 5GINC 3MCAB 3VYTC 1DBFA 3CPWF 3N2GB 2BO1A 4FFBB 2P6YA 4I55A 3GTZA 4YJ3A 1Q86H 2GZLA 2VAPA 2QI2A 3CB2A 1NJIH 1GX1A 1W55A 1FNJA 1X7OA 1VQ4F 3BYQA 1VQNF 2MQEA 1JD1A 3S0HA 3VO8A 3P4EA 3RA5A 4ERHA 1VQ6F 2K1SA 2QTPA 4RHAA 1QD9A 3F0FA
chains in the Genus database with same CATH topology
1U3LA 1U3PA 3IKEA 1VH8A 3FBAA 1JY8A 1KNJA 1U40A 1W57A 1VHAA 3GHZA 3JVHA 1JN1A 1H48A 1H47A 4C8EA 2AMTA 3ELCA 1YQNA 1IV4A 3F0DA 3EORA 3FPIA 2GZLA 1KNKA 3F0FA 3Q8HA 4C81A 1IV1A 4C82A 3QHDA 3K14A 3ESJA 4C8IA 3T80A 1GX1A 1W55A 3B6NA 3MBMA 5B8FA 3KE1A 3F0EA 3K2XA 3ERNA 4C8GA 2UZHA 1U43A 1IV3A 3F0GA 3P0ZA 3IEWA 2PMPA 3IEQA 3F6MA 1T0AA 3RE3A 3P10A 3IKFA 1IV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3L A;  1U3P A;  3IKE A;  1VH8 A;  3FBA A;  1JY8 A;  1KNJ A;  1U40 A;  1W57 A;  1VHA A;  3GHZ A;  3JVH A;  1JN1 A;  1H48 A;  1H47 A;  4C8E A;  2AMT A;  3ELC A;  1YQN A;  1IV4 A;  3F0D A;  3EOR A;  3FPI A;  2GZL A;  1KNK A;  3F0F A;  3Q8H A;  4C81 A;  1IV1 A;  4C82 A;  3QHD A;  3K14 A;  3ESJ A;  4C8I A;  3T80 A;  1GX1 A;  1W55 A;  3B6N A;  3MBM A;  5B8F A;  3KE1 A;  3F0E A;  3K2X A;  3ERN A;  4C8G A;  2UZH A;  1U43 A;  1IV3 A;  3F0G A;  3P0Z A;  3IEW A;  2PMP A;  3IEQ A;  3F6M A;  1T0A A;  3RE3 A;  3P10 A;  3IKF A;  1IV2 A; 
#chains in the Genus database with same CATH topology
 5KMG B;  2CHT A;  3PAF A;  3K12 A;  3CYQ A;  4BT6 A;  5HY1 A;  4IHJ A;  3MDO A;  1SA0 A;  2OTM A;  2BTU A;  3LME A;  4X1I B;  4X1Y B;  2CHS A;  2V9Y A;  2AMT A;  2CSL A;  3C9T A;  4EB6 A;  5FLX M;  3FD6 A;  2ZF8 A;  5GIO C;  3ON1 A;  4TV8 A;  3TD4 A;  5IJ0 A;  3K14 A;  2YYE A;  4O4J A;  3OBY A;  5JCO A;  3CCR F;  3RYF A;  1YIT F;  5FJ4 C;  1YJN F;  5GON A;  5EAZ A;  2UYP A;  2R6R 1;  2PMP A;  3FFM A;  3RYC B;  1XBI A;  3CPQ A;  3S06 A;  5HY2 A;  2OTJ F;  5HY4 A;  1JJ2 F;  4DRX B;  3HAX D;  1IPA A;  1Q8R A;  1U3L A;  4YJ2 A;  2GLZ A;  3CC2 F;  3HKD B;  3NK7 A;  2H8E A;  1GZ0 A;  4X20 B;  1W2B F;  1KD1 H;  5JVD A;  4BVR A;  2HRY A;  2HQS C;  2QA4 F;  4O4H B;  1W5F A;  3DC2 A;  1XRG A;  4X3L A;  1ODE A;  2ZOV A;  4LNU A;  2VGN A;  3IEQ A;  3JAK B;  4TV9 B;  4NUT A;  3D00 A;  1VQ5 F;  3MCQ A;  3WGL A;  5LP6 B;  4I4T B;  1U3P A;  3IKE A;  4B62 A;  4WBN B;  3JAM M;  4B46 A;  3DDN A;  4TUY B;  4DXD A;  1NMU B;  3HKC A;  4O4I A;  5C8Y B;  2KGW A;  2F9Z C;  5FNV A;  2ZOD A;  1IV4 A;  5LOV B;  3RYI B;  2I6D A;  3VOB A;  1IV1 A;  4C4W C;  5G4V C;  2Z1T A;  3RA6 A;  3F0E A;  4O2A B;  3KJJ A;  5IYZ A;  3M1X A;  5HP8 A;  3LWQ C;  4ZHW A;  1YIJ F;  5G4U C;  3D01 A;  1RA4 A;  3S0Y A;  5CA0 B;  4ZOL B;  4IIJ B;  2GVI A;  3VYS C;  3GHZ A;  3IMP A;  3ZP4 A;  4BT4 A;  5LXT B;  1CN7 A;  4ZK7 A;  4C8E A;  3CC4 F;  1H7M A;  2DYY A;  2VAM A;  4NWO B;  5LA6 A;  5B8F A;  3ZO8 A;  3JAL B;  1U43 A;  3N4Z A;  3NMU C;  5HY0 A;  2G9I A;  3OW2 F;  3VTI C;  3HJW C;  1VQ8 F;  3OON A;  5CB4 A;  5IJ9 A;  3V3T A;  4NQ3 A;  5J2U A;  4R40 B;  1TUB B;  1DT9 A;  3WJQ A;  2BTQ B;  3JAW B;  2OZB A;  1M90 H;  1YQN A;  2YXZ A;  5EZY B;  3C8L A;  1YJ9 F;  3WGN A;  1KNK A;  3N2G A;  3E20 B;  4FFB A;  4G88 A;  5EIB D;  3KE1 A;  5KX5 B;  2AIZ P;  3AGK A;  1X7P A;  2HP0 B;  1K73 H;  4TZZ A;  2HS4 A;  1VQV A;  3JCM M;  4BT2 A;  5ITZ B;  1Q81 H;  2Z1E A;  1XV2 A;  1M1K H;  1CLI A;  1VQ7 F;  4I55 B;  2OHW A;  2BTO A;  3TD5 A;  3SIV A;  1W5E A;  1W5B A;  4ZHQ B;  1CK2 A;  2KTV A;  3CCQ F;  5HP7 A;  3TD3 A;  1GO1 A;  4X1Y A;  3CG6 A;  2H6L A;  2HVY D;  3WPX A;  5JQG B;  1W58 1;  3CC7 F;  3M84 A;  2RB9 A;  1T0A A;  3HKB B;  4G4Y A;  1QAH A;  3RYC A;  3J80 M;  4O4L A;  3ZOP A;  1R1M A;  1VQO F;  1U40 A;  4DRX A;  4LCK A;  3CCL F;  2IQQ A;  2RHH A;  4X1K B;  2VXY A;  2CW4 A;  1ZWZ A;  3HKD A;  3LWP C;  3E22 B;  2IG8 A;  2KG4 A;  1X25 A;  4X20 A;  5GON B;  3Q8H A;  3J81 M;  3WGM A;  4U3J B;  4C81 A;  3T80 A;  3JAT A;  3R0P A;  1YJW F;  3N2K B;  1FSZ A;  2B33 A;  3L7Q A;  5EYP B;  5HXZ A;  4B5C A;  4O4H A;  2UYK A;  4G4V A;  3CME F;  3CD6 F;  4I50 B;  3C9R A;  3UT5 B;  3S02 A;  2Q1X A;  2L26 A;  3JAK A;  2LBX A;  4TV9 A;  2IAF A;  3HWU A;  5LP6 A;  1K9M H;  4I4T A;  2OTL F;  1UI9 A;  3CMA F;  3VCZ A;  4G4X A;  5A2Q M;  1W5A A;  4BVQ A;  1J7H A;  3G71 F;  4BT5 A;  1OAP A;  2HRU A;  5LOV A;  2AIF A;  3CCJ F;  3I7T A;  1SZQ A;  1NQ3 A;  3RYI A;  1W40 A;  3CCM F;  5LYJ B;  5CA1 B;  4HNA B;  3LFO A;  4O2A A;  5J2T B;  3WJR A;  3RYH B;  3I56 F;  2UYN B;  3G4S F;  1VH8 A;  1TVK B;  1KNJ A;  5BMV A;  3LWR C;  5JCO C;  1RLU A;  3JVH A;  3K0T A;  3LWV C;  5CA0 A;  4F6R A;  1KC8 H;  2VAW A;  3NVI B;  2ZAU A;  5EO3 A;  1JFF A;  4ZOL A;  1Z5W A;  4IIJ A;  3KHN A;  3M4S A;  1W41 A;  5LXT A;  2KTU A;  1X52 A;  2CVL A;  3JAS B;  2WAL A;  1Q7Y H;  3QUW A;  3JAR B;  1PXW A;  4C8I A;  1VQL F;  1COM A;  1YI2 F;  1S72 F;  3N4Y A;  1OFU A;  3LYB A;  1QVF F;  3SIU A;  3F6M A;  1T0K B;  3JAL A;  3WGK A;  2W8B C;  3P10 A;  1W3E X;  3VIU A;  5MN5 A;  1TUB A;  4E6E A;  4M8I A;  2H8C A;  5JH7 B;  2R75 1;  3ELC A;  4EI7 A;  3CCV F;  3JAW A;  4O2B B;  2RHO A;  4ZI7 B;  3HKE B;  4BT7 A;  5AVM A;  5EZY A;  1FFX B;  3WPW A;  3K2X A;  3IR9 A;  1Q82 H;  1SDS A;  1FNK A;  2CZW A;  4KWE A;  1RLG A;  5EWR A;  5KX5 A;  3PLA C;  4EI8 A;  1YHQ F;  3CXC F;  2Z1U A;  2HP0 A;  1VK3 A;  5EIB C;  4YJ3 B;  3GYQ A;  3HTN A;  5ITZ A;  1VQM F;  1H47 A;  5MN6 A;  5KMG A;  3VOA A;  1YGY A;  3FPI A;  4C82 A;  2HP3 A;  4X1I A;  4ZHQ A;  5GIP C;  1W59 A;  3KIZ A;  3WJP A;  4BW0 B;  3ERN A;  2UZH A;  5HWE A;  5GAN K;  4IHJ B;  5JQG A;  1SA0 B;  2QEX F;  1JY8 A;  2FC3 A;  4BY9 D;  3LWO C;  3HKB A;  4EB6 B;  3C9U A;  3CYP B;  4TV8 B;  5IJ0 B;  3MQW A;  4BVS A;  4BVT A;  4G4W A;  4O4J B;  3RYF B;  3LDT A;  4X1K A;  3ESJ A;  3QTY A;  2EWC A;  3MBM A;  3VMF B;  5HXU A;  1XHO A;  2PHN A;  3E22 A;  4U3J A;  1IV3 A;  2CWJ A;  2RHL A;  4O4L B;  4YJ2 B;  3N2K A;  1E7K A;  5EYP A;  4ZHY B;  3FBA A;  1N8R H;  3ZP7 A;  2Z1F A;  1JN1 A;  4BT3 A;  4I50 A;  4G4Z A;  1QU9 A;  3UT5 A;  5JVD B;  3I55 F;  3JAT B;  4WBN A;  4TUY A;  5IT9 M;  4XCQ A;  5C8Y A;  3CCE F;  2N48 A;  1W42 A;  2FGY A;  3D54 A;  4LNU B;  4ZHV A;  3VI6 A;  5GAP K;  3G6E F;  3U0O A;  3OBW A;  5EB1 B;  4PWT A;  3IEW A;  1K8A H;  2HS3 A;  1VQK F;  3WXM B;  4X3M A;  3HKC B;  5LYJ A;  4O4I B;  5CA1 A;  1QVG F;  2HX0 A;  4HNA A;  3I3F A;  2Z01 A;  1RQ7 A;  5FNV B;  3VYU C;  5J2T A;  1Z5V A;  3C9S A;  1VHA A;  3RYH A;  2I6R A;  2NMU A;  2RHJ A;  1VQP F;  2UYN A;  1TVK A;  1RQ2 A;  1UFY A;  3S03 A;  3FD5 A;  5IYZ B;  2LBW A;  4EI9 A;  3CCS F;  2JNB A;  4U39 A;  3CCU F;  1PF5 A;  4C8G A;  3S0W A;  3JAS A;  3F0G A;  3WGJ A;  3P0Z A;  3JAR A;  4RQO A;  5MN4 A;  5BMV B;  1VQ9 F;  3KJK A;  5DCV A;  3E1Y A;  3NVK E;  4F6R B;  5EB0 A;  1IV2 A;  1JFF B;  2HS0 A;  1GO0 A;  1W57 A;  1H48 A;  5LA6 B;  2Q1Y A;  3F0D A;  3EOR A;  2UYJ A;  3V7E A;  3V4D A;  2LCA A;  2ZVY A;  3QHD A;  5JH7 A;  3B6N A;  4O2B A;  1KQS F;  5LP6 C;  2LBT A;  5CB4 B;  5IJ9 B;  4ZI7 A;  3O85 A;  3HKE A;  1ONI A;  5J2U B;  1FFX A;  3V7Q A;  2VGM A;  4B45 A;  2ALE A;  3RE3 A;  2DT4 A;  3IKF A;  2ZVZ A;  3J7A R;  3NK6 A;  5GIN C;  3MCA B;  3VYT C;  1DBF A;  3CPW F;  3N2G B;  2BO1 A;  4FFB B;  2P6Y A;  4I55 A;  3GTZ A;  4YJ3 A;  1Q86 H;  2GZL A;  2VAP A;  2QI2 A;  3CB2 A;  1NJI H;  1GX1 A;  1W55 A;  1FNJ A;  1X7O A;  1VQ4 F;  3BYQ A;  1VQN F;  2MQE A;  1JD1 A;  3S0H A;  3VO8 A;  3P4E A;  3RA5 A;  4ERH A;  1VQ6 F;  2K1S A;  2QTP A;  4RHA A;  1QD9 A;  3F0F A; 
#chains in the Genus database with same CATH homology
 1U3L A;  1U3P A;  3IKE A;  1VH8 A;  3FBA A;  1JY8 A;  1KNJ A;  1U40 A;  1W57 A;  1VHA A;  3GHZ A;  3JVH A;  1JN1 A;  1H48 A;  1H47 A;  4C8E A;  2AMT A;  3ELC A;  1YQN A;  1IV4 A;  3F0D A;  3EOR A;  3FPI A;  2GZL A;  1KNK A;  3F0F A;  3Q8H A;  4C81 A;  1IV1 A;  4C82 A;  3QHD A;  3K14 A;  3ESJ A;  4C8I A;  3T80 A;  1GX1 A;  1W55 A;  3B6N A;  3MBM A;  5B8F A;  3KE1 A;  3F0E A;  3K2X A;  3ERN A;  4C8G A;  2UZH A;  1U43 A;  1IV3 A;  3F0G A;  3P0Z A;  3IEW A;  2PMP A;  3IEQ A;  3F6M A;  1T0A A;  3RE3 A;  3P10 A;  3IKF A;  1IV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...