2UZHA

Mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
153
Chain Sequence
b'LPRVGLGTDVHPIEAGRPCRLLCLEFDDADGCASDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVGAPVSVSATTTDGLGLTGRGEGLAAIATALVAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title The Structure of Mycobacteria 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase, an Essential Enzyme, Provides a Platform for Drug Discovery.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Lyase
total genus 45
structure length 153
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2uzhA00
3GHZA 1KNJA 1U3LA 3K2XA 3Q8HA 4C81A 3B6NA 3IKFA 4C8GA 1H48A 4C8EA 3F6MA 3P0ZA 3IEQA 3F0EA 3ELCA 3F0GA 3IEWA 1U43A 1JY8A 2PMPA 1W55A 3FBAA 3MBMA 1H47A 1KNKA 1W57A 1U40A 1IV1A 3F0DA 1IV4A 4C82A 3ERNA 3EORA 1T0AA 1IV2A 3RE3A 1GX1A 1VH8A 3IKEA 3T80A 1JN1A 1IV3A 1U3PA 2AMTA 3K14A 3QHDA 3KE1A 3JVHA 3P10A 1VHAA 4C8IA 5B8FA 2UZHA 3FPIA 3F0FA 1YQNA 3ESJA 2GZLA
chains in the Genus database with same CATH superfamily
4XCQA 3OBYA 1Z5WA 3IMPA 3WGLA 2ZF8A 5GANK 1KQSF 1W5FA 4ZI7A 5CA1B 1Q7YH 5EB1B 3WGKA 2H6LA 4X3MA 5KMGB 3RYFB 3NVIB 4BW0B 3VO8A 2HP0B 3WJQA 3J7AR 2YYEA 1T0AA 4I50A 1XV2A 1Q8RA 3WGNA 5BMVB 4DRXA 1M1KH 3N2GA 1NQ3A 3VMFB 1YJNF 4ERHA 1Q81H 2FC3A 4BT7A 1PXWA 3HJWC 1SDSA 1VQPF 1W5EA 3F0GA 3CCJF 1QU9A 3O85A 3SIUA 4KWEA 1FFXB 1JJ2F 1W40A 2Q1YA 3JARA 4X1IB 3HKDA 3UT5A 2CSLA 5JH7B 4B62A 3MCAB 4EI9A 5EIBD 1X25A 4ZHVA 1OAPA 2CHTA 2LBWA 4I55A 4BY9D 1FNKA 5HP8A 2V9YA 4DXDA 4C81A 3MQWA 1X7PA 3ELCA 5FNVB 1QD9A 3G6EF 3VTIC 3ZO8A 3U0OA 3RYFA 2HP0A 3JAMM 1W3EX 4B45A 3R0PA 1ONIA 2HVYD 5LP6A 3C9TA 4TV9A 1VQ8F 4BT3A 5EAZA 1UFYA 3CPQA 3CMAF 3C9SA 5GIPC 3HAXD 3S06A 4WBNB 5HY4A 5IYZB 2ZVYA 2UYJA 5KX5B 3GHZA 3I55F 4U3JB 1FNJA 2QI2A 3M1XA 5JQGB 3WJPA 3V4DA 1FFXA 3K0TA 5ITZB 3CCLF 5EO3A 1KD1H 2R6R1 4X1IA 4YJ2A 3MCQA 4C82A 5JH7A 1VQ7F 2LBXA 1YI2F 3WJRA 1QAHA 3KJJA 1VH8A 3V7EA 2LBTA 5C8YB 3K14A 5LOVB 4I4TB 4LNUB 4ZOLB 2RHHA 1SA0A 2UYNB 4EB6B 1VQLF 3TD5A 3K2XA 1R1MA 5IJ0A 3KHNA 3KJKA 4G88A 3RYCB 3VOAA 3JASB 2KTVA 3RA5A 3OONA 3MDOA 2BO1A 5GONA 3OW2F 3HWUA 1GO0A 5J2UA 3ERNA 2LCAA 2BTQB 3D01A 1GX1A 4ZHQB 3S03A 1IV3A 3JALB 3D54A 3GYQA 3FD6A 5IYZA 3C9UA 3F0FA 1X7OA 4U3JA 2ZOVA 3TD4A 3S0HA 3WPXA 2QEXF 4ZK7A 3JATB 2HRUA 5JQGA 3P0ZA 2KGWA 1GO1A 3DDNA 2RHOA 3J81M 5ITZA 1VQ4F 1J7HA 1JY8A 4IIJB 4RHAA 3LWPC 4R40B 1VQ6F 3RA6A 4O2BB 2HP3A 2OTLF 2I6RA 2F9ZC 3CYPB 3RE3A 2QTPA 5J2TB 4U39A 4TZZA 5C8YA 3E1YA 1DBFA 1Q82H 3NVKE 4LNUA 4G4VA 1Q86H 2VAMA 5FJ4C 2OTJF 4BVQA 2CZWA 4EB6A 4NQ3A 3CPWF 1U3LA 3CYQA 3B6NA 1H7MA 5LXTA 3F6MA 3S0YA 3RYHB 5EYPB 2N48A 2PMPA 2MQEA 2EWCA 3LYBA 1IV1A 5HY1A 5JCOC 3N2KB 4G4XA 3EORA 5HXUA 1W59A 4ZHQA 3JAWB 1K73H 3CC4F 3N4ZA 1RLGA 2DT4A 4B5CA 5IJ9B 1YGYA 2I6DA 5HY0A 5G4UC 4TV8B 4O4IB 3ESJA 4YJ3B 3CXCF 5LA6B 3PAFA 3LWQC 5EB0A 5CB4B 3BYQA 3JATA 4O4LB 3E20B 1VQ9F 4HNAB 2RHJA 3N4YA 2H8CA 2AIZP 1VQMF 3DC2A 1U43A 5CA1A 2Z1UA 4IHJB 4O2BA 1YHQF 5KMGA 4TUYB 5DCVA 3S0WA 1VQVA 3I7TA 3JAKB 3I3FA 3KIZA 5BMVA 1RQ2A 2KTUA 5B8FA 4LCKA 1GZ0A 3FPIA 1TVKB 3HKCB 1JFFB 2HX0A 3WGJA 2BTOA 4O2AB 4O4JB 5GINC 2CW4A 2VXYA 3HKEB 2R751 1VQ5F 1VQNF 1E7KA 5JVDB 5EYPA 2CWJA 3IEWA 4F6RB 2Z1EA 1XRGA 3PLAC 3CB2A 2BTUA 2L26A 2VAWA 1Z5VA 3V3TA 3N2KA 3CCEF 5HP7A 3E22B 5HXZA 1SZQA 3VOBA 4O4IA 4YJ3A 2Z1TA 5LA6A 2GZLA 3D00A 1IPAA 1KNJA 5CB4A 4B46A 1RQ7A 3WPWA 5MN4A 5FNVA 3TD3A 4IHJA 3MBMA 1H47A 2KG4A 4BVRA 4X1YB 4BT6A 3JAKA 4G4ZA 3LWRC 2UYKA 4X1KB 2ZODA 4I50B 4BT4A 3G4SF 2AMTA 3C9RA 4DRXB 3FFMA 1TVKA 3HKCA 4C8IA 4WBNA 1JFFA 3C8LA 3LMEA 3V7QA 1N8RH 2CVLA 4O2AA 4O4JA 2AIFA 2G9IA 3CMEF 5IT9M 5KX5A 3HKEA 2Q1XA 3L7QA 4NUTA 5JVDA 3HTNA 5EWRA 3NK6A 3S02A 2Z01A 3P4EA 4BVTA 3FBAA 3JARB 3M84A 1ZWZA 3F0DA 5AVMA 2ALEA 3FD5A 3AGKA 3HKBB 1IV2A 1X52A 1U3PA 3JVHA 3P10A 4I55B 5LOVA 4I4TA 3LWVC 3LFOA 2OTMA 4ZOLA 1YQNA 4X3LA 2UYNA 3Q8HA 2H8EA 3IKFA 4C8GA 4G4WA 3F0EA 3RYCA 3JASA 1W581 4X20B 3SIVA 1KNKA 2DYYA 4X1YA 2HRYA 2NMUA 3VI6A 3WGMA 3WXMB 5HWEA 4X1KA 4ZHYB 2JNBA 5LP6B 5HY2A 5EZYB 4C4WC 4TV9B 5GIOC 2IAFA 1W42A 3JALA 1YJ9F 2ZAUA 3QHDA 2WALA 3CCQF 1CK2A 5LP6C 2P6YA 1CN7A 2Z1FA 3JCMM 1S72F 2UYPA 2HS3A 2PHNA 4IIJA 3QTYA 1ODEA 1W55A 1OFUA 3CCRF 3RYIB 2OHWA 1U40A 4YJ2B 3ON1A 3HKBA 1JD1A 3CC7F 2QA4F 4BVSA 5J2TA 3IKEA 2YXZA 3KE1A 1NJIH 1XHOA 2RB9A 2UZHA 2GLZA 3QUWA 1SA0B 1QVGF 3I56F 5IJ0B 3NMUC 1W5AA 1DT9A 1TUBB 1UI9A 1FSZA 1H48A 5JCOA 4RQOA 4C8EA 3IEQA 5MN6A 4X20A 3RYHA 4O4HB 5LYJB 3VYSC 1YITF 1RA4A 4BT2A 5GONB 2IQQA 5J2UB 5EZYA 1NMUB 5CA0B 3JAWA 4FFBB 1JN1A 2RHLA 5IJ9A 3VCZA 3VYUC 3CC2F 5GAPK 1K9MH 4TV8A 4EI8A 3GTZA 3LDTA 4E6EA 1YJWF 4O4LA 4HNAA 2GVIA 3CCSF 1T0KB 1XBIA 1VQKF 3ZOPA 4ZI7B 3RYIA 2B33A 4BT5A 3LWOC 3OBWA 1W57A 4ZHWA 1COMA 1IV4A 2VAPA 4NWOB 4TUYA 3ZP7A 2IG8A 3ZP4A 5FLXM 3CG6A 2FGYA 3CCMF 2HQSC 2HS4A 2HS0A 3T80A 2OZBA 3M4SA 1W41A 3K12A 1KC8H 1VHAA 1W5BA 1PF5A 3N2GB 2VGMA 2ZVZA 3IR9A 3J80M 3CD6F 2CHSA 3VYTC 1TUBA 2K1SA 5LXTB 5A2QM 4O4HA 2W8BC 5EIBC 3CCUF 5LYJA 1M90H 4EI7A 1CLIA 4F6RA 1K8AH 1QVFF 1W2BF 3G71F 5MN5A 3NK7A 3CCVF 4M8IA 4PWTA 5G4VC 5CA0A 3HKDB 1VQOF 3UT5B 1VK3A 3E22A 4FFBA 2VGNA 4G4YA 1YIJF 3VIUA 1RLUA
chains in the Genus database with same CATH topology
3GHZA 1KNJA 1U3LA 3K2XA 3Q8HA 4C81A 3B6NA 3IKFA 4C8GA 1H48A 4C8EA 3F6MA 3P0ZA 3IEQA 3F0EA 3ELCA 3F0GA 3IEWA 1U43A 1JY8A 2PMPA 1W55A 3FBAA 3MBMA 1H47A 1KNKA 1W57A 1U40A 1IV1A 3F0DA 1IV4A 4C82A 3ERNA 3EORA 1T0AA 1IV2A 3RE3A 1GX1A 1VH8A 3IKEA 3T80A 1JN1A 1IV3A 1U3PA 2AMTA 3K14A 3QHDA 3KE1A 3JVHA 3P10A 1VHAA 4C8IA 5B8FA 2UZHA 3FPIA 3F0FA 1YQNA 3ESJA 2GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHZ A;  1KNJ A;  1U3L A;  3K2X A;  3Q8H A;  4C81 A;  3B6N A;  3IKF A;  4C8G A;  1H48 A;  4C8E A;  3F6M A;  3P0Z A;  3IEQ A;  3F0E A;  3ELC A;  3F0G A;  3IEW A;  1U43 A;  1JY8 A;  2PMP A;  1W55 A;  3FBA A;  3MBM A;  1H47 A;  1KNK A;  1W57 A;  1U40 A;  1IV1 A;  3F0D A;  1IV4 A;  4C82 A;  3ERN A;  3EOR A;  1T0A A;  1IV2 A;  3RE3 A;  1GX1 A;  1VH8 A;  3IKE A;  3T80 A;  1JN1 A;  1IV3 A;  1U3P A;  2AMT A;  3K14 A;  3QHD A;  3KE1 A;  3JVH A;  3P10 A;  1VHA A;  4C8I A;  5B8F A;  2UZH A;  3FPI A;  3F0F A;  1YQN A;  3ESJ A;  2GZL A; 
#chains in the Genus database with same CATH topology
 4XCQ A;  3OBY A;  1Z5W A;  3IMP A;  3WGL A;  2ZF8 A;  5GAN K;  1KQS F;  1W5F A;  4ZI7 A;  5CA1 B;  1Q7Y H;  5EB1 B;  3WGK A;  2H6L A;  4X3M A;  5KMG B;  3RYF B;  3NVI B;  4BW0 B;  3VO8 A;  2HP0 B;  3WJQ A;  3J7A R;  2YYE A;  1T0A A;  4I50 A;  1XV2 A;  1Q8R A;  3WGN A;  5BMV B;  4DRX A;  1M1K H;  3N2G A;  1NQ3 A;  3VMF B;  1YJN F;  4ERH A;  1Q81 H;  2FC3 A;  4BT7 A;  1PXW A;  3HJW C;  1SDS A;  1VQP F;  1W5E A;  3F0G A;  3CCJ F;  1QU9 A;  3O85 A;  3SIU A;  4KWE A;  1FFX B;  1JJ2 F;  1W40 A;  2Q1Y A;  3JAR A;  4X1I B;  3HKD A;  3UT5 A;  2CSL A;  5JH7 B;  4B62 A;  3MCA B;  4EI9 A;  5EIB D;  1X25 A;  4ZHV A;  1OAP A;  2CHT A;  2LBW A;  4I55 A;  4BY9 D;  1FNK A;  5HP8 A;  2V9Y A;  4DXD A;  4C81 A;  3MQW A;  1X7P A;  3ELC A;  5FNV B;  1QD9 A;  3G6E F;  3VTI C;  3ZO8 A;  3U0O A;  3RYF A;  2HP0 A;  3JAM M;  1W3E X;  4B45 A;  3R0P A;  1ONI A;  2HVY D;  5LP6 A;  3C9T A;  4TV9 A;  1VQ8 F;  4BT3 A;  5EAZ A;  1UFY A;  3CPQ A;  3CMA F;  3C9S A;  5GIP C;  3HAX D;  3S06 A;  4WBN B;  5HY4 A;  5IYZ B;  2ZVY A;  2UYJ A;  5KX5 B;  3GHZ A;  3I55 F;  4U3J B;  1FNJ A;  2QI2 A;  3M1X A;  5JQG B;  3WJP A;  3V4D A;  1FFX A;  3K0T A;  5ITZ B;  3CCL F;  5EO3 A;  1KD1 H;  2R6R 1;  4X1I A;  4YJ2 A;  3MCQ A;  4C82 A;  5JH7 A;  1VQ7 F;  2LBX A;  1YI2 F;  3WJR A;  1QAH A;  3KJJ A;  1VH8 A;  3V7E A;  2LBT A;  5C8Y B;  3K14 A;  5LOV B;  4I4T B;  4LNU B;  4ZOL B;  2RHH A;  1SA0 A;  2UYN B;  4EB6 B;  1VQL F;  3TD5 A;  3K2X A;  1R1M A;  5IJ0 A;  3KHN A;  3KJK A;  4G88 A;  3RYC B;  3VOA A;  3JAS B;  2KTV A;  3RA5 A;  3OON A;  3MDO A;  2BO1 A;  5GON A;  3OW2 F;  3HWU A;  1GO0 A;  5J2U A;  3ERN A;  2LCA A;  2BTQ B;  3D01 A;  1GX1 A;  4ZHQ B;  3S03 A;  1IV3 A;  3JAL B;  3D54 A;  3GYQ A;  3FD6 A;  5IYZ A;  3C9U A;  3F0F A;  1X7O A;  4U3J A;  2ZOV A;  3TD4 A;  3S0H A;  3WPX A;  2QEX F;  4ZK7 A;  3JAT B;  2HRU A;  5JQG A;  3P0Z A;  2KGW A;  1GO1 A;  3DDN A;  2RHO A;  3J81 M;  5ITZ A;  1VQ4 F;  1J7H A;  1JY8 A;  4IIJ B;  4RHA A;  3LWP C;  4R40 B;  1VQ6 F;  3RA6 A;  4O2B B;  2HP3 A;  2OTL F;  2I6R A;  2F9Z C;  3CYP B;  3RE3 A;  2QTP A;  5J2T B;  4U39 A;  4TZZ A;  5C8Y A;  3E1Y A;  1DBF A;  1Q82 H;  3NVK E;  4LNU A;  4G4V A;  1Q86 H;  2VAM A;  5FJ4 C;  2OTJ F;  4BVQ A;  2CZW A;  4EB6 A;  4NQ3 A;  3CPW F;  1U3L A;  3CYQ A;  3B6N A;  1H7M A;  5LXT A;  3F6M A;  3S0Y A;  3RYH B;  5EYP B;  2N48 A;  2PMP A;  2MQE A;  2EWC A;  3LYB A;  1IV1 A;  5HY1 A;  5JCO C;  3N2K B;  4G4X A;  3EOR A;  5HXU A;  1W59 A;  4ZHQ A;  3JAW B;  1K73 H;  3CC4 F;  3N4Z A;  1RLG A;  2DT4 A;  4B5C A;  5IJ9 B;  1YGY A;  2I6D A;  5HY0 A;  5G4U C;  4TV8 B;  4O4I B;  3ESJ A;  4YJ3 B;  3CXC F;  5LA6 B;  3PAF A;  3LWQ C;  5EB0 A;  5CB4 B;  3BYQ A;  3JAT A;  4O4L B;  3E20 B;  1VQ9 F;  4HNA B;  2RHJ A;  3N4Y A;  2H8C A;  2AIZ P;  1VQM F;  3DC2 A;  1U43 A;  5CA1 A;  2Z1U A;  4IHJ B;  4O2B A;  1YHQ F;  5KMG A;  4TUY B;  5DCV A;  3S0W A;  1VQV A;  3I7T A;  3JAK B;  3I3F A;  3KIZ A;  5BMV A;  1RQ2 A;  2KTU A;  5B8F A;  4LCK A;  1GZ0 A;  3FPI A;  1TVK B;  3HKC B;  1JFF B;  2HX0 A;  3WGJ A;  2BTO A;  4O2A B;  4O4J B;  5GIN C;  2CW4 A;  2VXY A;  3HKE B;  2R75 1;  1VQ5 F;  1VQN F;  1E7K A;  5JVD B;  5EYP A;  2CWJ A;  3IEW A;  4F6R B;  2Z1E A;  1XRG A;  3PLA C;  3CB2 A;  2BTU A;  2L26 A;  2VAW A;  1Z5V A;  3V3T A;  3N2K A;  3CCE F;  5HP7 A;  3E22 B;  5HXZ A;  1SZQ A;  3VOB A;  4O4I A;  4YJ3 A;  2Z1T A;  5LA6 A;  2GZL A;  3D00 A;  1IPA A;  1KNJ A;  5CB4 A;  4B46 A;  1RQ7 A;  3WPW A;  5MN4 A;  5FNV A;  3TD3 A;  4IHJ A;  3MBM A;  1H47 A;  2KG4 A;  4BVR A;  4X1Y B;  4BT6 A;  3JAK A;  4G4Z A;  3LWR C;  2UYK A;  4X1K B;  2ZOD A;  4I50 B;  4BT4 A;  3G4S F;  2AMT A;  3C9R A;  4DRX B;  3FFM A;  1TVK A;  3HKC A;  4C8I A;  4WBN A;  1JFF A;  3C8L A;  3LME A;  3V7Q A;  1N8R H;  2CVL A;  4O2A A;  4O4J A;  2AIF A;  2G9I A;  3CME F;  5IT9 M;  5KX5 A;  3HKE A;  2Q1X A;  3L7Q A;  4NUT A;  5JVD A;  3HTN A;  5EWR A;  3NK6 A;  3S02 A;  2Z01 A;  3P4E A;  4BVT A;  3FBA A;  3JAR B;  3M84 A;  1ZWZ A;  3F0D A;  5AVM A;  2ALE A;  3FD5 A;  3AGK A;  3HKB B;  1IV2 A;  1X52 A;  1U3P A;  3JVH A;  3P10 A;  4I55 B;  5LOV A;  4I4T A;  3LWV C;  3LFO A;  2OTM A;  4ZOL A;  1YQN A;  4X3L A;  2UYN A;  3Q8H A;  2H8E A;  3IKF A;  4C8G A;  4G4W A;  3F0E A;  3RYC A;  3JAS A;  1W58 1;  4X20 B;  3SIV A;  1KNK A;  2DYY A;  4X1Y A;  2HRY A;  2NMU A;  3VI6 A;  3WGM A;  3WXM B;  5HWE A;  4X1K A;  4ZHY B;  2JNB A;  5LP6 B;  5HY2 A;  5EZY B;  4C4W C;  4TV9 B;  5GIO C;  2IAF A;  1W42 A;  3JAL A;  1YJ9 F;  2ZAU A;  3QHD A;  2WAL A;  3CCQ F;  1CK2 A;  5LP6 C;  2P6Y A;  1CN7 A;  2Z1F A;  3JCM M;  1S72 F;  2UYP A;  2HS3 A;  2PHN A;  4IIJ A;  3QTY A;  1ODE A;  1W55 A;  1OFU A;  3CCR F;  3RYI B;  2OHW A;  1U40 A;  4YJ2 B;  3ON1 A;  3HKB A;  1JD1 A;  3CC7 F;  2QA4 F;  4BVS A;  5J2T A;  3IKE A;  2YXZ A;  3KE1 A;  1NJI H;  1XHO A;  2RB9 A;  2UZH A;  2GLZ A;  3QUW A;  1SA0 B;  1QVG F;  3I56 F;  5IJ0 B;  3NMU C;  1W5A A;  1DT9 A;  1TUB B;  1UI9 A;  1FSZ A;  1H48 A;  5JCO A;  4RQO A;  4C8E A;  3IEQ A;  5MN6 A;  4X20 A;  3RYH A;  4O4H B;  5LYJ B;  3VYS C;  1YIT F;  1RA4 A;  4BT2 A;  5GON B;  2IQQ A;  5J2U B;  5EZY A;  1NMU B;  5CA0 B;  3JAW A;  4FFB B;  1JN1 A;  2RHL A;  5IJ9 A;  3VCZ A;  3VYU C;  3CC2 F;  5GAP K;  1K9M H;  4TV8 A;  4EI8 A;  3GTZ A;  3LDT A;  4E6E A;  1YJW F;  4O4L A;  4HNA A;  2GVI A;  3CCS F;  1T0K B;  1XBI A;  1VQK F;  3ZOP A;  4ZI7 B;  3RYI A;  2B33 A;  4BT5 A;  3LWO C;  3OBW A;  1W57 A;  4ZHW A;  1COM A;  1IV4 A;  2VAP A;  4NWO B;  4TUY A;  3ZP7 A;  2IG8 A;  3ZP4 A;  5FLX M;  3CG6 A;  2FGY A;  3CCM F;  2HQS C;  2HS4 A;  2HS0 A;  3T80 A;  2OZB A;  3M4S A;  1W41 A;  3K12 A;  1KC8 H;  1VHA A;  1W5B A;  1PF5 A;  3N2G B;  2VGM A;  2ZVZ A;  3IR9 A;  3J80 M;  3CD6 F;  2CHS A;  3VYT C;  1TUB A;  2K1S A;  5LXT B;  5A2Q M;  4O4H A;  2W8B C;  5EIB C;  3CCU F;  5LYJ A;  1M90 H;  4EI7 A;  1CLI A;  4F6R A;  1K8A H;  1QVF F;  1W2B F;  3G71 F;  5MN5 A;  3NK7 A;  3CCV F;  4M8I A;  4PWT A;  5G4V C;  5CA0 A;  3HKD B;  1VQO F;  3UT5 B;  1VK3 A;  3E22 A;  4FFB A;  2VGN A;  4G4Y A;  1YIJ F;  3VIU A;  1RLU A; 
#chains in the Genus database with same CATH homology
 3GHZ A;  1KNJ A;  1U3L A;  3K2X A;  3Q8H A;  4C81 A;  3B6N A;  3IKF A;  4C8G A;  1H48 A;  4C8E A;  3F6M A;  3P0Z A;  3IEQ A;  3F0E A;  3ELC A;  3F0G A;  3IEW A;  1U43 A;  1JY8 A;  2PMP A;  1W55 A;  3FBA A;  3MBM A;  1H47 A;  1KNK A;  1W57 A;  1U40 A;  1IV1 A;  3F0D A;  1IV4 A;  4C82 A;  3ERN A;  3EOR A;  1T0A A;  1IV2 A;  3RE3 A;  1GX1 A;  1VH8 A;  3IKE A;  3T80 A;  1JN1 A;  1IV3 A;  1U3P A;  2AMT A;  3K14 A;  3QHD A;  3KE1 A;  3JVH A;  3P10 A;  1VHA A;  4C8I A;  5B8F A;  2UZH A;  3FPI A;  3F0F A;  1YQN A;  3ESJ A;  2GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...