2UZHA

Mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
153
Chain Sequence
LPRVGLGTDVHPIEAGRPCRLLCLEFDDADGCASDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVGAPVSVSATTTDGLGLTGRGEGLAAIATALVAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
publication title The Structure of Mycobacteria 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase, an Essential Enzyme, Provides a Platform for Drug Discovery.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 45
structure length 153
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2uzhA00
3F0GA 5B8FA 1H48A 4C81A 4C8GA 1U3PA 3FBAA 3K14A 2AMTA 1KNJA 3IEQA 1JY8A 1VHAA 1H47A 1U40A 1W57A 1YQNA 3F6MA 3FPIA 4C8EA 1IV2A 4C8IA 4C82A 3EORA 1T0AA 1U43A 3ELCA 1GX1A 3F0EA 1W55A 2PMPA 3P10A 1IV3A 3IEWA 3K2XA 3B6NA 3ERNA 1U3LA 3GHZA 3MBMA 3F0DA 3KE1A 3F0FA 1IV1A 1JN1A 3ESJA 3IKFA 3IKEA 3JVHA 1IV4A 3RE3A 1KNKA 2GZLA 2UZHA 3P0ZA 3Q8HA 1VH8A 3T80A 3QHDA
chains in the Genus database with same CATH superfamily
3E20B 3FBAA 2VAPA 3G71F 4O4IB 4G4XA 3DC2A 4LCKA 1PXWA 3J7AR 3WGNA 3JASB 1NJIH 5HY1A 4O4HA 1T0AA 5HY0A 1PF5A 2IAFA 3CCMF 3FD6A 3J80M 2Z1FA 4O4JB 5LA6A 3B6NA 3WPWA 2RHLA 1J7HA 3JARA 3HKCB 1YJWF 3KIZA 2HVYD 3P0ZA 1VH8A 1VQPF 3F0GA 2DYYA 5EYPB 1U3PA 4X1YB 5G4VC 5GONB 1H47A 1X52A 3S0YA 2OHWA 2OTJF 1YJ9F 1VQLF 1YI2F 5FJ4C 4BT5A 4TZZA 3CC2F 2W8BC 3VCZA 2PHNA 3CCRF 4YJ3A 2KTUA 1W581 2ZODA 4B46A 5FLXM 3P10A 2LCAA 4E6EA 3ERNA 1Q81H 1NMUB 2QEXF 3JALB 1K73H 3GTZA 3VMFB 5JVDA 4G4WA 5GANK 4O2AB 4ERHA 5LXTB 5MN4A 3G4SF 4TUYB 3RA5A 3MQWA 3V7EA 3TD3A 4B5CA 1VHAA 2BTOA 5HXUA 3WGMA 2ZVZA 3QUWA 5KMGB 1VQ6F 5EWRA 4BT2A 5GINC 2HRYA 2PMPA 3CMAF 3ON1A 3K2XA 4I55B 1T0KB 3CG6A 4YJ2B 3LYBA 2DT4A 3R0PA 1VQ4F 2UZHA 2BTQB 3JAWB 2KGWA 4ZOLA 2QTPA 3V7QA 4NQ3A 3RYHB 3LWQC 2ZOVA 3CC7F 4X1IA 3C9SA 2HS0A 3VYUC 3C9RA 1W57A 5MN5A 2I6RA 3D00A 5IJ9A 3CPWF 1W5AA 3S02A 5JCOC 5EIBC 3C9UA 1UI9A 5IJ0B 3RYIA 2F9ZC 1X7OA 1QVGF 3HKDB 1Q7YH 4G4YA 1QAHA 2UYNA 5CA1A 3IKFA 4BVTA 2B33A 3V3TA 1NQ3A 3GYQA 2R751 1JFFB 4DRXB 2OTMA 4I50B 5JH7A 1JY8A 1SA0A 4O4LA 1Q82H 4ZK7A 2HS3A 2WALA 5HP7A 1ODEA 5JQGA 2BTUA 2HP0A 3RYCA 5JVDB 3K0TA 3MDOA 5J2TA 1W2BF 4F6RA 3LMEA 1IV4A 3HWUA 4G4VA 5EZYA 1FFXB 1RQ7A 1ONIA 1SDSA 4U3JB 5GIPC 2HQSC 4RQOA 5HY2A 2Z1TA 5J2UA 2BO1A 3C8LA 3HJWC 1YJNF 5LYJA 1XHOA 3N2KA 1Z5WA 2Z1UA 4TV8A 3PAFA 5IYZA 1RQ2A 1RLGA 3ELCA 4LNUB 4BT6A 4NWOB 4X20B 2YXZA 3PLAC 4WBNA 3F0DA 4IHJB 3RYFA 5BMVA 3ZP7A 4O2BA 3IKEA 3ZO8A 3CCQF 2ZF8A 3HKBB 3WJRA 1KNKA 2Z01A 4X1IB 2CZWA 3L7QA 5DCVA 4C81A 3VYTC 3NVIB 4EI9A 3SIVA 2OTLF 4EB6B 1YHQF 1IPAA 1VQOF 1E7KA 3E22A 1Q8RA 1TVKA 4ZHVA 4IIJA 2AIFA 3JAKB 3I55F 3N2GA 1CLIA 3JAMM 3CCUF 1VQ5F 4G4ZA 1OAPA 2CHSA 4G88A 5ITZA 4PWTA 1JD1A 3LFOA 3M84A 1Z5VA 3TD5A 2CSLA 2K1SA 1W41A 2Q1YA 3UT5A 3FFMA 2GZLA 3J81M 2LBXA 4ZHYB 1H48A 3JATB 2P6YA 1SA0B 5FNVB 5LP6C 4I4TA 4TV9B 1VQ8F 5HY4A 3N4YA 3O85A 4ZI7B 1UFYA 2I6DA 1W5FA 1GO0A 3NK6A 3RYCB 1QVFF 1GZ0A 3MCQA 1VQKF 1W55A 4M8IA 1COMA 4R40B 1JN1A 3CMEF 5C8YA 3CCVF 3HAXD 1N8RH 4U39A 4HNAA 5G4UC 3VOBA 4EI7A 5KX5A 2VAMA 1VQVA 5J2UB 2V9YA 3I56F 3IMPA 3OONA 5EB1B 5LP6A 5CB4A 1K8AH 2L26A 3D01A 4BVSA 3HTNA 4O4IA 5GAPK 3P4EA 2FGYA 4O4HB 1XV2A 2VAWA 3EORA 3JASA 1W5EA 3VOAA 5MN6A 1VQ7F 3AGKA 1DBFA 1U43A 1W59A 1KC8H 3F0EA 4WBNB 3WXMB 5LA6B 1OFUA 4B45A 1U3LA 4X1KA 5AVMA 3JARB 4O4JA 4RHAA 3NMUC 1W40A 2HX0A 2LBTA 1K9MH 1VQMF 1M90H 1FSZA 3CCJF 3D54A 5LOVA 2Q1XA 2NMUA 1TUBA 5EYPA 3TD4A 4ZHQA 1U40A 3N4ZA 3N2GB 4X1YA 2HP3A 5GONA 3LWPC 3LWOC 4C82A 5JCOA 3FD5A 3U0OA 1R1MA 2GLZA 2QI2A 4YJ3B 1H7MA 3S06A 3KJKA 2H6LA 3NK7A 2HS4A 4EI8A 1S72F 3UT5B 3WPXA 1IV1A 3CCEF 3K12A 1KD1H 3VTIC 3ZP4A 3RE3A 3Q8HA 4ZHWA 3CYQA 3S0WA 3WJPA 4I4TB 3KHNA 3K14A 4TUYA 1RLUA 3CXCF 3NVKE 5KMGA 1X7PA 3S03A 1W3EX 2CHTA 2MQEA 2ALEA 1ZWZA 4I55A 4BVRA 4ZOLB 4YJ2A 1XRGA 3T80A 5CB4B 1QU9A 3JAWA 3ZOPA 3RYHA 3IEQA 5IJ9B 2CW4A 2EWCA 3OW2F 2ZAUA 3C9TA 4XCQA 3KJJA 3RYIB 4KWEA 2Z1EA 5HP8A 4X3LA 4X1KB 2UYNB 2RHOA 1IV3A 5IJ0A 3LWVC 2LBWA 5CA1B 3MBMA 3HKDA 3F0FA 1XBIA 3ESJA 4FFBA 2AIZP 2UYPA 3HKEA 5LOVB 5CA0A 1TUBB 3WJQA 5B8FA 4ZHQB 5JH7B 2UYKA 2AMTA 1JFFA 4O4LB 3F6MA 3FPIA 4DRXA 4I50A 3RA6A 5EIBD 4C8EA 1IV2A 2VXYA 3VI6A 2KTVA 5HXZA 5JQGB 3JCMM 2HP0B 2H8EA 5J2TB 3IEWA 3CC4F 4F6RB 3BYQA 2N48A 5EZYB 2RB9A 2VGMA 3JVHA 3OBWA 1QD9A 3V4DA 4BY9D 1FFXA 3QHDA 2CVLA 4U3JA 4C8GA 3E1YA 3LDTA 4BT4A 3CD6F 1FNKA 1M1KH 5LYJB 3N2KB 4TV8B 5A2QM 3S0HA 2JNBA 2CWJA 2RHJA 5EAZA 4BVQA 5IYZB 1YGYA 1GX1A 3M4SA 4LNUA 3RYFB 1FNJA 5BMVB 5GIOC 4X20A 4O2BB 1JJ2F 5IT9M 1CN7A 5EO3A 1GO1A 2OZBA 4IHJA 5HWEA 2HRUA 1YIJF 1YITF 3WGKA 4BT3A 2R6R1 3HKBA 1VQ9F 3HKCA 3OBYA 3I3FA 1VQNF 2IG8A 2VGNA 2QA4F 3VO8A 4BT7A 3M1XA 1SZQA 3E22B 1TVKB 4IIJB 2H8CA 4EB6A 1W5BA 3CCLF 2RHHA 5ITZB 3JAKA 3SIUA 3CCSF 3G6EF 1RA4A 3DDNA 3VIUA 3I7TA 3LWRC 4FFBB 5EB0A 3HKEB 3MCAB 1Q86H 5CA0B 3JALA 2UYJA 3CB2A 2YYEA 2G9IA 3VYSC 2IQQA 4X3MA 4O2AA 1CK2A 2GVIA 2KG4A 5LXTA 3CYPB 3JATA 2ZVYA 1KNJA 5FNVA 1YQNA 4DXDA 4C8IA 4TV9A 1X25A 4BW0B 4ZI7A 3WGLA 3QTYA 2FC3A 4B62A 1VK3A 3GHZA 1W42A 5C8YB 1DT9A 3KE1A 4HNAB 3CPQA 1KQSF 5KX5B 3WGJA 4C4WC 4NUTA 3IR9A 5LP6B
chains in the Genus database with same CATH topology
3F0GA 5B8FA 1H48A 4C81A 4C8GA 1U3PA 3FBAA 3K14A 2AMTA 1KNJA 3IEQA 1JY8A 1VHAA 1H47A 1U40A 1W57A 1YQNA 3F6MA 3FPIA 4C8EA 1IV2A 4C8IA 4C82A 3EORA 1T0AA 1U43A 3ELCA 1GX1A 3F0EA 1W55A 2PMPA 3P10A 1IV3A 3IEWA 3K2XA 3B6NA 3ERNA 1U3LA 3GHZA 3MBMA 3F0DA 3KE1A 3F0FA 1IV1A 1JN1A 3ESJA 3IKFA 3IKEA 3JVHA 1IV4A 3RE3A 1KNKA 2GZLA 2UZHA 3P0ZA 3Q8HA 1VH8A 3T80A 3QHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0G A;  5B8F A;  1H48 A;  4C81 A;  4C8G A;  1U3P A;  3FBA A;  3K14 A;  2AMT A;  1KNJ A;  3IEQ A;  1JY8 A;  1VHA A;  1H47 A;  1U40 A;  1W57 A;  1YQN A;  3F6M A;  3FPI A;  4C8E A;  1IV2 A;  4C8I A;  4C82 A;  3EOR A;  1T0A A;  1U43 A;  3ELC A;  1GX1 A;  3F0E A;  1W55 A;  2PMP A;  3P10 A;  1IV3 A;  3IEW A;  3K2X A;  3B6N A;  3ERN A;  1U3L A;  3GHZ A;  3MBM A;  3F0D A;  3KE1 A;  3F0F A;  1IV1 A;  1JN1 A;  3ESJ A;  3IKF A;  3IKE A;  3JVH A;  1IV4 A;  3RE3 A;  1KNK A;  2GZL A;  2UZH A;  3P0Z A;  3Q8H A;  1VH8 A;  3T80 A;  3QHD A; 
#chains in the Genus database with same CATH topology
 3E20 B;  3FBA A;  2VAP A;  3G71 F;  4O4I B;  4G4X A;  3DC2 A;  4LCK A;  1PXW A;  3J7A R;  3WGN A;  3JAS B;  1NJI H;  5HY1 A;  4O4H A;  1T0A A;  5HY0 A;  1PF5 A;  2IAF A;  3CCM F;  3FD6 A;  3J80 M;  2Z1F A;  4O4J B;  5LA6 A;  3B6N A;  3WPW A;  2RHL A;  1J7H A;  3JAR A;  3HKC B;  1YJW F;  3KIZ A;  2HVY D;  3P0Z A;  1VH8 A;  1VQP F;  3F0G A;  2DYY A;  5EYP B;  1U3P A;  4X1Y B;  5G4V C;  5GON B;  1H47 A;  1X52 A;  3S0Y A;  2OHW A;  2OTJ F;  1YJ9 F;  1VQL F;  1YI2 F;  5FJ4 C;  4BT5 A;  4TZZ A;  3CC2 F;  2W8B C;  3VCZ A;  2PHN A;  3CCR F;  4YJ3 A;  2KTU A;  1W58 1;  2ZOD A;  4B46 A;  5FLX M;  3P10 A;  2LCA A;  4E6E A;  3ERN A;  1Q81 H;  1NMU B;  2QEX F;  3JAL B;  1K73 H;  3GTZ A;  3VMF B;  5JVD A;  4G4W A;  5GAN K;  4O2A B;  4ERH A;  5LXT B;  5MN4 A;  3G4S F;  4TUY B;  3RA5 A;  3MQW A;  3V7E A;  3TD3 A;  4B5C A;  1VHA A;  2BTO A;  5HXU A;  3WGM A;  2ZVZ A;  3QUW A;  5KMG B;  1VQ6 F;  5EWR A;  4BT2 A;  5GIN C;  2HRY A;  2PMP A;  3CMA F;  3ON1 A;  3K2X A;  4I55 B;  1T0K B;  3CG6 A;  4YJ2 B;  3LYB A;  2DT4 A;  3R0P A;  1VQ4 F;  2UZH A;  2BTQ B;  3JAW B;  2KGW A;  4ZOL A;  2QTP A;  3V7Q A;  4NQ3 A;  3RYH B;  3LWQ C;  2ZOV A;  3CC7 F;  4X1I A;  3C9S A;  2HS0 A;  3VYU C;  3C9R A;  1W57 A;  5MN5 A;  2I6R A;  3D00 A;  5IJ9 A;  3CPW F;  1W5A A;  3S02 A;  5JCO C;  5EIB C;  3C9U A;  1UI9 A;  5IJ0 B;  3RYI A;  2F9Z C;  1X7O A;  1QVG F;  3HKD B;  1Q7Y H;  4G4Y A;  1QAH A;  2UYN A;  5CA1 A;  3IKF A;  4BVT A;  2B33 A;  3V3T A;  1NQ3 A;  3GYQ A;  2R75 1;  1JFF B;  4DRX B;  2OTM A;  4I50 B;  5JH7 A;  1JY8 A;  1SA0 A;  4O4L A;  1Q82 H;  4ZK7 A;  2HS3 A;  2WAL A;  5HP7 A;  1ODE A;  5JQG A;  2BTU A;  2HP0 A;  3RYC A;  5JVD B;  3K0T A;  3MDO A;  5J2T A;  1W2B F;  4F6R A;  3LME A;  1IV4 A;  3HWU A;  4G4V A;  5EZY A;  1FFX B;  1RQ7 A;  1ONI A;  1SDS A;  4U3J B;  5GIP C;  2HQS C;  4RQO A;  5HY2 A;  2Z1T A;  5J2U A;  2BO1 A;  3C8L A;  3HJW C;  1YJN F;  5LYJ A;  1XHO A;  3N2K A;  1Z5W A;  2Z1U A;  4TV8 A;  3PAF A;  5IYZ A;  1RQ2 A;  1RLG A;  3ELC A;  4LNU B;  4BT6 A;  4NWO B;  4X20 B;  2YXZ A;  3PLA C;  4WBN A;  3F0D A;  4IHJ B;  3RYF A;  5BMV A;  3ZP7 A;  4O2B A;  3IKE A;  3ZO8 A;  3CCQ F;  2ZF8 A;  3HKB B;  3WJR A;  1KNK A;  2Z01 A;  4X1I B;  2CZW A;  3L7Q A;  5DCV A;  4C81 A;  3VYT C;  3NVI B;  4EI9 A;  3SIV A;  2OTL F;  4EB6 B;  1YHQ F;  1IPA A;  1VQO F;  1E7K A;  3E22 A;  1Q8R A;  1TVK A;  4ZHV A;  4IIJ A;  2AIF A;  3JAK B;  3I55 F;  3N2G A;  1CLI A;  3JAM M;  3CCU F;  1VQ5 F;  4G4Z A;  1OAP A;  2CHS A;  4G88 A;  5ITZ A;  4PWT A;  1JD1 A;  3LFO A;  3M84 A;  1Z5V A;  3TD5 A;  2CSL A;  2K1S A;  1W41 A;  2Q1Y A;  3UT5 A;  3FFM A;  2GZL A;  3J81 M;  2LBX A;  4ZHY B;  1H48 A;  3JAT B;  2P6Y A;  1SA0 B;  5FNV B;  5LP6 C;  4I4T A;  4TV9 B;  1VQ8 F;  5HY4 A;  3N4Y A;  3O85 A;  4ZI7 B;  1UFY A;  2I6D A;  1W5F A;  1GO0 A;  3NK6 A;  3RYC B;  1QVF F;  1GZ0 A;  3MCQ A;  1VQK F;  1W55 A;  4M8I A;  1COM A;  4R40 B;  1JN1 A;  3CME F;  5C8Y A;  3CCV F;  3HAX D;  1N8R H;  4U39 A;  4HNA A;  5G4U C;  3VOB A;  4EI7 A;  5KX5 A;  2VAM A;  1VQV A;  5J2U B;  2V9Y A;  3I56 F;  3IMP A;  3OON A;  5EB1 B;  5LP6 A;  5CB4 A;  1K8A H;  2L26 A;  3D01 A;  4BVS A;  3HTN A;  4O4I A;  5GAP K;  3P4E A;  2FGY A;  4O4H B;  1XV2 A;  2VAW A;  3EOR A;  3JAS A;  1W5E A;  3VOA A;  5MN6 A;  1VQ7 F;  3AGK A;  1DBF A;  1U43 A;  1W59 A;  1KC8 H;  3F0E A;  4WBN B;  3WXM B;  5LA6 B;  1OFU A;  4B45 A;  1U3L A;  4X1K A;  5AVM A;  3JAR B;  4O4J A;  4RHA A;  3NMU C;  1W40 A;  2HX0 A;  2LBT A;  1K9M H;  1VQM F;  1M90 H;  1FSZ A;  3CCJ F;  3D54 A;  5LOV A;  2Q1X A;  2NMU A;  1TUB A;  5EYP A;  3TD4 A;  4ZHQ A;  1U40 A;  3N4Z A;  3N2G B;  4X1Y A;  2HP3 A;  5GON A;  3LWP C;  3LWO C;  4C82 A;  5JCO A;  3FD5 A;  3U0O A;  1R1M A;  2GLZ A;  2QI2 A;  4YJ3 B;  1H7M A;  3S06 A;  3KJK A;  2H6L A;  3NK7 A;  2HS4 A;  4EI8 A;  1S72 F;  3UT5 B;  3WPX A;  1IV1 A;  3CCE F;  3K12 A;  1KD1 H;  3VTI C;  3ZP4 A;  3RE3 A;  3Q8H A;  4ZHW A;  3CYQ A;  3S0W A;  3WJP A;  4I4T B;  3KHN A;  3K14 A;  4TUY A;  1RLU A;  3CXC F;  3NVK E;  5KMG A;  1X7P A;  3S03 A;  1W3E X;  2CHT A;  2MQE A;  2ALE A;  1ZWZ A;  4I55 A;  4BVR A;  4ZOL B;  4YJ2 A;  1XRG A;  3T80 A;  5CB4 B;  1QU9 A;  3JAW A;  3ZOP A;  3RYH A;  3IEQ A;  5IJ9 B;  2CW4 A;  2EWC A;  3OW2 F;  2ZAU A;  3C9T A;  4XCQ A;  3KJJ A;  3RYI B;  4KWE A;  2Z1E A;  5HP8 A;  4X3L A;  4X1K B;  2UYN B;  2RHO A;  1IV3 A;  5IJ0 A;  3LWV C;  2LBW A;  5CA1 B;  3MBM A;  3HKD A;  3F0F A;  1XBI A;  3ESJ A;  4FFB A;  2AIZ P;  2UYP A;  3HKE A;  5LOV B;  5CA0 A;  1TUB B;  3WJQ A;  5B8F A;  4ZHQ B;  5JH7 B;  2UYK A;  2AMT A;  1JFF A;  4O4L B;  3F6M A;  3FPI A;  4DRX A;  4I50 A;  3RA6 A;  5EIB D;  4C8E A;  1IV2 A;  2VXY A;  3VI6 A;  2KTV A;  5HXZ A;  5JQG B;  3JCM M;  2HP0 B;  2H8E A;  5J2T B;  3IEW A;  3CC4 F;  4F6R B;  3BYQ A;  2N48 A;  5EZY B;  2RB9 A;  2VGM A;  3JVH A;  3OBW A;  1QD9 A;  3V4D A;  4BY9 D;  1FFX A;  3QHD A;  2CVL A;  4U3J A;  4C8G A;  3E1Y A;  3LDT A;  4BT4 A;  3CD6 F;  1FNK A;  1M1K H;  5LYJ B;  3N2K B;  4TV8 B;  5A2Q M;  3S0H A;  2JNB A;  2CWJ A;  2RHJ A;  5EAZ A;  4BVQ A;  5IYZ B;  1YGY A;  1GX1 A;  3M4S A;  4LNU A;  3RYF B;  1FNJ A;  5BMV B;  5GIO C;  4X20 A;  4O2B B;  1JJ2 F;  5IT9 M;  1CN7 A;  5EO3 A;  1GO1 A;  2OZB A;  4IHJ A;  5HWE A;  2HRU A;  1YIJ F;  1YIT F;  3WGK A;  4BT3 A;  2R6R 1;  3HKB A;  1VQ9 F;  3HKC A;  3OBY A;  3I3F A;  1VQN F;  2IG8 A;  2VGN A;  2QA4 F;  3VO8 A;  4BT7 A;  3M1X A;  1SZQ A;  3E22 B;  1TVK B;  4IIJ B;  2H8C A;  4EB6 A;  1W5B A;  3CCL F;  2RHH A;  5ITZ B;  3JAK A;  3SIU A;  3CCS F;  3G6E F;  1RA4 A;  3DDN A;  3VIU A;  3I7T A;  3LWR C;  4FFB B;  5EB0 A;  3HKE B;  3MCA B;  1Q86 H;  5CA0 B;  3JAL A;  2UYJ A;  3CB2 A;  2YYE A;  2G9I A;  3VYS C;  2IQQ A;  4X3M A;  4O2A A;  1CK2 A;  2GVI A;  2KG4 A;  5LXT A;  3CYP B;  3JAT A;  2ZVY A;  1KNJ A;  5FNV A;  1YQN A;  4DXD A;  4C8I A;  4TV9 A;  1X25 A;  4BW0 B;  4ZI7 A;  3WGL A;  3QTY A;  2FC3 A;  4B62 A;  1VK3 A;  3GHZ A;  1W42 A;  5C8Y B;  1DT9 A;  3KE1 A;  4HNA B;  3CPQ A;  1KQS F;  5KX5 B;  3WGJ A;  4C4W C;  4NUT A;  3IR9 A;  5LP6 B; 
#chains in the Genus database with same CATH homology
 3F0G A;  5B8F A;  1H48 A;  4C81 A;  4C8G A;  1U3P A;  3FBA A;  3K14 A;  2AMT A;  1KNJ A;  3IEQ A;  1JY8 A;  1VHA A;  1H47 A;  1U40 A;  1W57 A;  1YQN A;  3F6M A;  3FPI A;  4C8E A;  1IV2 A;  4C8I A;  4C82 A;  3EOR A;  1T0A A;  1U43 A;  3ELC A;  1GX1 A;  3F0E A;  1W55 A;  2PMP A;  3P10 A;  1IV3 A;  3IEW A;  3K2X A;  3B6N A;  3ERN A;  1U3L A;  3GHZ A;  3MBM A;  3F0D A;  3KE1 A;  3F0F A;  1IV1 A;  1JN1 A;  3ESJ A;  3IKF A;  3IKE A;  3JVH A;  1IV4 A;  3RE3 A;  1KNK A;  2GZL A;  2UZH A;  3P0Z A;  3Q8H A;  1VH8 A;  3T80 A;  3QHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...