2UZHA

Mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
153
Chain Sequence
LPRVGLGTDVHPIEAGRPCRLLCLEFDDADGCASDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVGAPVSVSATTTDGLGLTGRGEGLAAIATALVAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Mycobacteria 2C-Methyl-D-Erythritol-2,4-Cyclodiphosphate Synthase, an Essential Enzyme, Provides a Platform for Drug Discovery.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Lyase
molecule keywords 2C-METHYL-D-ERYTHRITOL 2,4-CYCLODIPHOSPHATE SYNTHASE
total genus 45
structure length 153
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2uzhA00
3F0GA 4C82A 4C8GA 1U40A 1KNJA 1IV3A 3ERNA 3JVHA 1KNKA 1YQNA 1H47A 1W57A 3B6NA 3P0ZA 3T80A 4C8IA 3IEQA 3FBAA 2PMPA 3QHDA 2AMTA 5B8FA 3EORA 1T0AA 1U3LA 4C81A 2GZLA 3ESJA 3F6MA 3RE3A 1IV1A 1JN1A 3K2XA 1VHAA 3Q8HA 1GX1A 1JY8A 3IEWA 4C8EA 3F0DA 3F0EA 3GHZA 3IKFA 3F0FA 3K14A 3P10A 1IV2A 1IV4A 1W55A 1H48A 1U3PA 1VH8A 3MBMA 1U43A 3FPIA 3KE1A 2UZHA 3ELCA 3IKEA
chains in the Genus database with same CATH superfamily
3CCRF 3NMUC 1GO0A 2HVYD 1W41A 3N2GB 5J2TB 1PXWA 2KTUA 3LWRC 3VOAA 1YJ9F 4C4WC 5JCOC 4DRXA 1ODEA 2VAPA 3HKDB 4C8EA 3F0EA 3K14A 4O4JB 1IV2A 1FSZA 1OAPA 3HKEA 3FPIA 3MCAB 3E1YA 5GONA 1FFXB 3T80A 4XCQA 1X7OA 5G4UC 1N8RH 2FGYA 1VQ4F 4B62A 4TUYB 3P0ZA 4O4LA 4ZOLA 1RQ7A 2HRUA 5MN4A 1M1KH 2CHTA 2LBTA 2OTMA 3HKCB 3D54A 3VYUC 3C9SA 2VAWA 3HKEB 1KQSF 3VTIC 4O4JA 4ERHA 5C8YA 1ONIA 1W5FA 1U40A 3CYQA 1IPAA 3MCQA 5IYZA 4DRXB 1VQ9F 3B6NA 3CMAF 1VQ5F 2CHSA 3LWPC 2HS4A 4G4VA 3OONA 2Q1XA 3TD5A 1YJNF 3F6MA 2AIZP 3N2GA 4RQOA 1JN1A 3JAKA 5LA6A 5EYPA 5HY4A 3KHNA 4O4IB 2RHLA 2UYPA 1Q81H 4I4TB 5HXUA 3N2KA 3ON1A 1JFFB 3J7AR 3OBYA 5EB1B 3DDNA 1XHOA 3RE3A 4LNUB 1KNJA 1X7PA 2QTPA 2BTOA 1XRGA 3G4SF 2RHHA 1YJWF 3WJPA 4ZI7A 4TV8A 2G9IA 5JVDA 3HKBB 3CCQF 3CC4F 4X20A 1QAHA 3WGKA 3R0PA 1GX1A 3VCZA 4TV9B 5JQGB 3NVKE 5JCOA 4X3MA 2RHJA 3I55F 3CCVF 4ZOLB 3MDOA 4TUYA 5FNVB 3RYHB 3VIUA 1QVFF 5CA1A 5G4VC 4TV8B 1ZWZA 1FNKA 2QI2A 3CCSF 2BO1A 2GVIA 4YJ3A 4C8IA 3S0HA 3LDTA 2IG8A 2KGWA 3I3FA 4G4WA 5CA0B 5IJ0B 3OBWA 3WGJA 2OTJF 5CB4A 4B46A 3JARA 1W2BF 3CYPB 3JALA 3TD3A 1W581 3RYIB 3P10A 2CW4A 1K9MH 5ITZA 1W5EA 2RB9A 1W55A 3PAFA 3RYCA 1SA0B 4BT3A 5LP6B 2HP3A 1SZQA 3J80M 4HNAB 2ZF8A 5J2TA 3KJKA 2MQEA 4F6RB 3ELCA 3CCUF 5LA6B 4EI8A 2VXYA 4B45A 2AIFA 4BT5A 3LWOC 2HP0B 5LP6A 1W3EX 3RYCB 3NK6A 2CWJA 2NMUA 2HRYA 5J2UA 3JARB 4DXDA 2KG4A 3EORA 3VMFB 1YHQF 3PLAC 3FD5A 3L7QA 5FLXM 5MN6A 3E22A 4ZHQA 2QEXF 1GO1A 5EZYA 2P6YA 4LCKA 1NJIH 1DBFA 3O85A 4X1KA 2H8CA 1U43A 3IR9A 4IIJA 4O4HA 4YJ2B 3M4SA 3OW2F 1KC8H 3IKEA 5GINC 3NK7A 5FNVA 3JCMM 5DCVA 4O4LB 5GANK 2UYNB 4TV9A 5JQGA 1VQLF 3C9TA 4EI7A 2AMTA 2I6RA 4F6RA 3WXMB 3RA6A 3CCJF 3HKBA 3VI6A 3LMEA 4EB6B 1FFXA 2W8BC 3CCEF 3GHZA 3IMPA 5KX5A 3CB2A 5MN5A 2Z1FA 3HKDA 2FC3A 4BT7A 3JASA 3CXCF 3LWVC 1XBIA 4U3JA 3N2KB 1W59A 2JNBA 4ZHVA 4I4TA 3LWQC 1CLIA 1NQ3A 5LXTA 5JH7A 3CC7F 4O4IA 1CK2A 2HS3A 1W40A 3RYHA 5HP7A 5IJ9A 1VQMF 3JAKB 3VYTC 4IHJA 4KWEA 2BTUA 3Q8HA 2DYYA 1JY8A 3F0DA 1TUBA 1IV4A 4O2BB 3V7QA 3JAWA 4RHAA 5EIBD 5LYJA 1K73H 4X20B 4BVSA 4YJ2A 4ZI7B 4B5CA 2IAFA 3UT5B 1R1MA 1VQVA 2BTQB 4ZHWA 1VQ8F 2VAMA 1Q7YH 2OHWA 3DC2A 4BW0B 3JATA 3QHDA 3G71F 5LP6C 5A2QM 5EIBC 4G4YA 2I6DA 2RHOA 4C81A 1VK3A 1TUBB 1JJ2F 2ZOVA 5HY1A 3F0FA 3MQWA 1CN7A 3CG6A 2V9YA 1H48A 1SDSA 3MBMA 3ZP7A 5HXZA 1S72F 5EAZA 2OZBA 4X1IA 5FJ4C 2YXZA 3FFMA 5EO3A 3F0GA 3V4DA 5BMVB 3HTNA 1UI9A 3JVHA 2LBXA 3JAMM 1KD1H 1XV2A 1W5AA 4BVQA 2N48A 5KX5B 2GZLA 5BMVA 3K2XA 2PHNA 2CSLA 4YJ3B 3GYQA 3WPXA 4E6EA 1YI2F 3E20B 3P4EA 2Z01A 4BVRA 1TVKB 3S0WA 4BT4A 5AVMA 2UYNA 1OFUA 4I50B 4EI9A 2ALEA 1IV3A 2UYKA 3D01A 4ZK7A 3VOBA 3CCLF 4G88A 1W5BA 2CZWA 3WJQA 1QU9A 3JATB 5HP8A 4X1KB 4X3LA 3ESJA 3AGKA 3TD4A 3G6EF 1RA4A 3S03A 2HS0A 2ZAUA 4ZHYB 2DT4A 3CMEF 1VQOF 4TZZA 3BYQA 4LNUA 5LYJB 2UZHA 4FFBA 4G4XA 4IHJB 1RLGA 3M1XA 2Q1YA 1K8AH 3K0TA 1VQ6F 2R6R1 5EYPB 4O2AB 3WPWA 1Z5VA 1QD9A 5JH7B 4I55A 3RYFA 5IJ9B 5EB0A 4G4ZA 1J7HA 5LXTB 2CVLA 1Z5WA 1IV1A 3CD6F 4U3JB 4X1YA 3RYIA 3JALB 3SIVA 1Q8RA 1FNJA 1X25A 2LCAA 2F9ZC 3WGLA 5EWRA 5IJ0A 1VQNF 5C8YB 5GAPK 1COMA 4BT2A 5HY2A 3V7EA 4NWOB 2HQSC 4BVTA 1QVGF 1DT9A 2VGMA 4I55B 3RYFB 4EB6A 3V3TA 3HKCA 3QTYA 3NVIB 4O2AA 3ZOPA 1YIJF 1VQ7F 3ZP4A 2UYJA 2HX0A 5B8FA 2L26A 1VHAA 2Z1TA 1PF5A 3I56F 3WJRA 1RQ2A 2OTLF 2Z1EA 5JVDB 2H6LA 4IIJB 4O4HB 5GONB 3HJWC 3U0OA 4PWTA 5KMGA 5EZYB 3QUWA 3RA5A 4C82A 3UT5A 4C8GA 5KMGB 1W42A 3E22B 3HWUA 4ZHQB 3ZO8A 2B33A 3D00A 1H47A 1W57A 3M84A 1M90H 2VGNA 5LOVA 2GLZA 3WGNA 3JAWB 5GIPC 1Q86H 4M8IA 5J2UB 3J81M 4I50A 3FD6A 3KJJA 3S0YA 2Z1UA 2HP0A 4R40B 2YYEA 3S02A 3I7TA 1TVKA 4BT6A 3C9RA 3SIUA 1E7KA 3LYBA 1VH8A 4NQ3A 1UFYA 1RLUA 4HNAA 5ITZB 1SA0A 4U39A 3N4YA 3CPQA 3JASB 3ERNA 5LOVB 1YITF 5CB4B 1YQNA 2EWCA 5IYZB 5CA0A 3VYSC 1YGYA 3IEQA 2ZVZA 4WBNB 5HY0A 3FBAA 1Q82H 3C8LA 3WGMA 2KTVA 3KIZA 1GZ0A 4X1IB 1NMUB 5CA1B 2WALA 3HAXD 2ZVYA 3GTZA 4FFBB 2LBWA 2IQQA 1T0KB 3N4ZA 2ZODA 1H7MA 1VQKF 5GIOC 2K1SA 5IT9M 3CC2F 1X52A 3CCMF 1KNKA 3CPWF 4BY9D 3LFOA 1VQPF 3VO8A 2PMPA 3C9UA 5HWEA 2H8EA 4WBNA 1T0AA 1U3LA 2QA4F 2R751 3IEWA 4NUTA 3S06A 3IKFA 4X1YB 1JD1A 4O2BA 1U3PA 3K12A 1JFFA 3KE1A
chains in the Genus database with same CATH topology
3F0GA 4C82A 4C8GA 1U40A 1KNJA 1IV3A 3ERNA 3JVHA 1KNKA 1YQNA 1H47A 1W57A 3B6NA 3P0ZA 3T80A 4C8IA 3IEQA 3FBAA 2PMPA 3QHDA 2AMTA 5B8FA 3EORA 1T0AA 1U3LA 4C81A 2GZLA 3ESJA 3F6MA 3RE3A 1IV1A 1JN1A 3K2XA 1VHAA 3Q8HA 1GX1A 1JY8A 3IEWA 4C8EA 3F0DA 3F0EA 3GHZA 3IKFA 3F0FA 3K14A 3P10A 1IV2A 1IV4A 1W55A 1H48A 1U3PA 1VH8A 3MBMA 1U43A 3FPIA 3KE1A 2UZHA 3ELCA 3IKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0G A;  4C82 A;  4C8G A;  1U40 A;  1KNJ A;  1IV3 A;  3ERN A;  3JVH A;  1KNK A;  1YQN A;  1H47 A;  1W57 A;  3B6N A;  3P0Z A;  3T80 A;  4C8I A;  3IEQ A;  3FBA A;  2PMP A;  3QHD A;  2AMT A;  5B8F A;  3EOR A;  1T0A A;  1U3L A;  4C81 A;  2GZL A;  3ESJ A;  3F6M A;  3RE3 A;  1IV1 A;  1JN1 A;  3K2X A;  1VHA A;  3Q8H A;  1GX1 A;  1JY8 A;  3IEW A;  4C8E A;  3F0D A;  3F0E A;  3GHZ A;  3IKF A;  3F0F A;  3K14 A;  3P10 A;  1IV2 A;  1IV4 A;  1W55 A;  1H48 A;  1U3P A;  1VH8 A;  3MBM A;  1U43 A;  3FPI A;  3KE1 A;  2UZH A;  3ELC A;  3IKE A; 
#chains in the Genus database with same CATH topology
 3CCR F;  3NMU C;  1GO0 A;  2HVY D;  1W41 A;  3N2G B;  5J2T B;  1PXW A;  2KTU A;  3LWR C;  3VOA A;  1YJ9 F;  4C4W C;  5JCO C;  4DRX A;  1ODE A;  2VAP A;  3HKD B;  4C8E A;  3F0E A;  3K14 A;  4O4J B;  1IV2 A;  1FSZ A;  1OAP A;  3HKE A;  3FPI A;  3MCA B;  3E1Y A;  5GON A;  1FFX B;  3T80 A;  4XCQ A;  1X7O A;  5G4U C;  1N8R H;  2FGY A;  1VQ4 F;  4B62 A;  4TUY B;  3P0Z A;  4O4L A;  4ZOL A;  1RQ7 A;  2HRU A;  5MN4 A;  1M1K H;  2CHT A;  2LBT A;  2OTM A;  3HKC B;  3D54 A;  3VYU C;  3C9S A;  2VAW A;  3HKE B;  1KQS F;  3VTI C;  4O4J A;  4ERH A;  5C8Y A;  1ONI A;  1W5F A;  1U40 A;  3CYQ A;  1IPA A;  3MCQ A;  5IYZ A;  4DRX B;  1VQ9 F;  3B6N A;  3CMA F;  1VQ5 F;  2CHS A;  3LWP C;  2HS4 A;  4G4V A;  3OON A;  2Q1X A;  3TD5 A;  1YJN F;  3F6M A;  2AIZ P;  3N2G A;  4RQO A;  1JN1 A;  3JAK A;  5LA6 A;  5EYP A;  5HY4 A;  3KHN A;  4O4I B;  2RHL A;  2UYP A;  1Q81 H;  4I4T B;  5HXU A;  3N2K A;  3ON1 A;  1JFF B;  3J7A R;  3OBY A;  5EB1 B;  3DDN A;  1XHO A;  3RE3 A;  4LNU B;  1KNJ A;  1X7P A;  2QTP A;  2BTO A;  1XRG A;  3G4S F;  2RHH A;  1YJW F;  3WJP A;  4ZI7 A;  4TV8 A;  2G9I A;  5JVD A;  3HKB B;  3CCQ F;  3CC4 F;  4X20 A;  1QAH A;  3WGK A;  3R0P A;  1GX1 A;  3VCZ A;  4TV9 B;  5JQG B;  3NVK E;  5JCO A;  4X3M A;  2RHJ A;  3I55 F;  3CCV F;  4ZOL B;  3MDO A;  4TUY A;  5FNV B;  3RYH B;  3VIU A;  1QVF F;  5CA1 A;  5G4V C;  4TV8 B;  1ZWZ A;  1FNK A;  2QI2 A;  3CCS F;  2BO1 A;  2GVI A;  4YJ3 A;  4C8I A;  3S0H A;  3LDT A;  2IG8 A;  2KGW A;  3I3F A;  4G4W A;  5CA0 B;  5IJ0 B;  3OBW A;  3WGJ A;  2OTJ F;  5CB4 A;  4B46 A;  3JAR A;  1W2B F;  3CYP B;  3JAL A;  3TD3 A;  1W58 1;  3RYI B;  3P10 A;  2CW4 A;  1K9M H;  5ITZ A;  1W5E A;  2RB9 A;  1W55 A;  3PAF A;  3RYC A;  1SA0 B;  4BT3 A;  5LP6 B;  2HP3 A;  1SZQ A;  3J80 M;  4HNA B;  2ZF8 A;  5J2T A;  3KJK A;  2MQE A;  4F6R B;  3ELC A;  3CCU F;  5LA6 B;  4EI8 A;  2VXY A;  4B45 A;  2AIF A;  4BT5 A;  3LWO C;  2HP0 B;  5LP6 A;  1W3E X;  3RYC B;  3NK6 A;  2CWJ A;  2NMU A;  2HRY A;  5J2U A;  3JAR B;  4DXD A;  2KG4 A;  3EOR A;  3VMF B;  1YHQ F;  3PLA C;  3FD5 A;  3L7Q A;  5FLX M;  5MN6 A;  3E22 A;  4ZHQ A;  2QEX F;  1GO1 A;  5EZY A;  2P6Y A;  4LCK A;  1NJI H;  1DBF A;  3O85 A;  4X1K A;  2H8C A;  1U43 A;  3IR9 A;  4IIJ A;  4O4H A;  4YJ2 B;  3M4S A;  3OW2 F;  1KC8 H;  3IKE A;  5GIN C;  3NK7 A;  5FNV A;  3JCM M;  5DCV A;  4O4L B;  5GAN K;  2UYN B;  4TV9 A;  5JQG A;  1VQL F;  3C9T A;  4EI7 A;  2AMT A;  2I6R A;  4F6R A;  3WXM B;  3RA6 A;  3CCJ F;  3HKB A;  3VI6 A;  3LME A;  4EB6 B;  1FFX A;  2W8B C;  3CCE F;  3GHZ A;  3IMP A;  5KX5 A;  3CB2 A;  5MN5 A;  2Z1F A;  3HKD A;  2FC3 A;  4BT7 A;  3JAS A;  3CXC F;  3LWV C;  1XBI A;  4U3J A;  3N2K B;  1W59 A;  2JNB A;  4ZHV A;  4I4T A;  3LWQ C;  1CLI A;  1NQ3 A;  5LXT A;  5JH7 A;  3CC7 F;  4O4I A;  1CK2 A;  2HS3 A;  1W40 A;  3RYH A;  5HP7 A;  5IJ9 A;  1VQM F;  3JAK B;  3VYT C;  4IHJ A;  4KWE A;  2BTU A;  3Q8H A;  2DYY A;  1JY8 A;  3F0D A;  1TUB A;  1IV4 A;  4O2B B;  3V7Q A;  3JAW A;  4RHA A;  5EIB D;  5LYJ A;  1K73 H;  4X20 B;  4BVS A;  4YJ2 A;  4ZI7 B;  4B5C A;  2IAF A;  3UT5 B;  1R1M A;  1VQV A;  2BTQ B;  4ZHW A;  1VQ8 F;  2VAM A;  1Q7Y H;  2OHW A;  3DC2 A;  4BW0 B;  3JAT A;  3QHD A;  3G71 F;  5LP6 C;  5A2Q M;  5EIB C;  4G4Y A;  2I6D A;  2RHO A;  4C81 A;  1VK3 A;  1TUB B;  1JJ2 F;  2ZOV A;  5HY1 A;  3F0F A;  3MQW A;  1CN7 A;  3CG6 A;  2V9Y A;  1H48 A;  1SDS A;  3MBM A;  3ZP7 A;  5HXZ A;  1S72 F;  5EAZ A;  2OZB A;  4X1I A;  5FJ4 C;  2YXZ A;  3FFM A;  5EO3 A;  3F0G A;  3V4D A;  5BMV B;  3HTN A;  1UI9 A;  3JVH A;  2LBX A;  3JAM M;  1KD1 H;  1XV2 A;  1W5A A;  4BVQ A;  2N48 A;  5KX5 B;  2GZL A;  5BMV A;  3K2X A;  2PHN A;  2CSL A;  4YJ3 B;  3GYQ A;  3WPX A;  4E6E A;  1YI2 F;  3E20 B;  3P4E A;  2Z01 A;  4BVR A;  1TVK B;  3S0W A;  4BT4 A;  5AVM A;  2UYN A;  1OFU A;  4I50 B;  4EI9 A;  2ALE A;  1IV3 A;  2UYK A;  3D01 A;  4ZK7 A;  3VOB A;  3CCL F;  4G88 A;  1W5B A;  2CZW A;  3WJQ A;  1QU9 A;  3JAT B;  5HP8 A;  4X1K B;  4X3L A;  3ESJ A;  3AGK A;  3TD4 A;  3G6E F;  1RA4 A;  3S03 A;  2HS0 A;  2ZAU A;  4ZHY B;  2DT4 A;  3CME F;  1VQO F;  4TZZ A;  3BYQ A;  4LNU A;  5LYJ B;  2UZH A;  4FFB A;  4G4X A;  4IHJ B;  1RLG A;  3M1X A;  2Q1Y A;  1K8A H;  3K0T A;  1VQ6 F;  2R6R 1;  5EYP B;  4O2A B;  3WPW A;  1Z5V A;  1QD9 A;  5JH7 B;  4I55 A;  3RYF A;  5IJ9 B;  5EB0 A;  4G4Z A;  1J7H A;  5LXT B;  2CVL A;  1Z5W A;  1IV1 A;  3CD6 F;  4U3J B;  4X1Y A;  3RYI A;  3JAL B;  3SIV A;  1Q8R A;  1FNJ A;  1X25 A;  2LCA A;  2F9Z C;  3WGL A;  5EWR A;  5IJ0 A;  1VQN F;  5C8Y B;  5GAP K;  1COM A;  4BT2 A;  5HY2 A;  3V7E A;  4NWO B;  2HQS C;  4BVT A;  1QVG F;  1DT9 A;  2VGM A;  4I55 B;  3RYF B;  4EB6 A;  3V3T A;  3HKC A;  3QTY A;  3NVI B;  4O2A A;  3ZOP A;  1YIJ F;  1VQ7 F;  3ZP4 A;  2UYJ A;  2HX0 A;  5B8F A;  2L26 A;  1VHA A;  2Z1T A;  1PF5 A;  3I56 F;  3WJR A;  1RQ2 A;  2OTL F;  2Z1E A;  5JVD B;  2H6L A;  4IIJ B;  4O4H B;  5GON B;  3HJW C;  3U0O A;  4PWT A;  5KMG A;  5EZY B;  3QUW A;  3RA5 A;  4C82 A;  3UT5 A;  4C8G A;  5KMG B;  1W42 A;  3E22 B;  3HWU A;  4ZHQ B;  3ZO8 A;  2B33 A;  3D00 A;  1H47 A;  1W57 A;  3M84 A;  1M90 H;  2VGN A;  5LOV A;  2GLZ A;  3WGN A;  3JAW B;  5GIP C;  1Q86 H;  4M8I A;  5J2U B;  3J81 M;  4I50 A;  3FD6 A;  3KJJ A;  3S0Y A;  2Z1U A;  2HP0 A;  4R40 B;  2YYE A;  3S02 A;  3I7T A;  1TVK A;  4BT6 A;  3C9R A;  3SIU A;  1E7K A;  3LYB A;  1VH8 A;  4NQ3 A;  1UFY A;  1RLU A;  4HNA A;  5ITZ B;  1SA0 A;  4U39 A;  3N4Y A;  3CPQ A;  3JAS B;  3ERN A;  5LOV B;  1YIT F;  5CB4 B;  1YQN A;  2EWC A;  5IYZ B;  5CA0 A;  3VYS C;  1YGY A;  3IEQ A;  2ZVZ A;  4WBN B;  5HY0 A;  3FBA A;  1Q82 H;  3C8L A;  3WGM A;  2KTV A;  3KIZ A;  1GZ0 A;  4X1I B;  1NMU B;  5CA1 B;  2WAL A;  3HAX D;  2ZVY A;  3GTZ A;  4FFB B;  2LBW A;  2IQQ A;  1T0K B;  3N4Z A;  2ZOD A;  1H7M A;  1VQK F;  5GIO C;  2K1S A;  5IT9 M;  3CC2 F;  1X52 A;  3CCM F;  1KNK A;  3CPW F;  4BY9 D;  3LFO A;  1VQP F;  3VO8 A;  2PMP A;  3C9U A;  5HWE A;  2H8E A;  4WBN A;  1T0A A;  1U3L A;  2QA4 F;  2R75 1;  3IEW A;  4NUT A;  3S06 A;  3IKF A;  4X1Y B;  1JD1 A;  4O2B A;  1U3P A;  3K12 A;  1JFF A;  3KE1 A; 
#chains in the Genus database with same CATH homology
 3F0G A;  4C82 A;  4C8G A;  1U40 A;  1KNJ A;  1IV3 A;  3ERN A;  3JVH A;  1KNK A;  1YQN A;  1H47 A;  1W57 A;  3B6N A;  3P0Z A;  3T80 A;  4C8I A;  3IEQ A;  3FBA A;  2PMP A;  3QHD A;  2AMT A;  5B8F A;  3EOR A;  1T0A A;  1U3L A;  4C81 A;  2GZL A;  3ESJ A;  3F6M A;  3RE3 A;  1IV1 A;  1JN1 A;  3K2X A;  1VHA A;  3Q8H A;  1GX1 A;  1JY8 A;  3IEW A;  4C8E A;  3F0D A;  3F0E A;  3GHZ A;  3IKF A;  3F0F A;  3K14 A;  3P10 A;  1IV2 A;  1IV4 A;  1W55 A;  1H48 A;  1U3P A;  1VH8 A;  3MBM A;  1U43 A;  3FPI A;  3KE1 A;  2UZH A;  3ELC A;  3IKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...