2UYPA

Crystal structure of e. coli tdcf with bound propionate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
126
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords PROTEIN TDCF
total genus 35
structure length 126
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uypA00
2UYNA 1PF5A 1ONIA 2CHSA 1UI9A 3GTZA 1COMA 3I7TA 2EWCA 4NWOB 3VCZA 1JD1A 2CVLA 3QUWA 3K0TA 1X25A 4ZK7A 2IG8A 3KJKA 2CSLA 5HP7A 3I3FA 5HP8A 3ZP4A 1NQ3A 1ODEA 2B33A 1QU9A 3M4SA 2CW4A 1UFYA 1QAHA 2CHTA 3LYBA 1FNJA 3L7QA 3ZO8A 1XHOA 3D01A 1J7HA 2CWJA 3R0PA 2DYYA 3ZP7A 1DBFA 2UYJA 1QD9A 2UYKA 3KJJA 3M1XA 2OTMA 3ZOPA 3V4DA 3LMEA 2UYNB 1FNKA 1XRGA 2UYPA 3K12A 3MQWA
chains in the Genus database with same CATH superfamily
1IPAA 2BTOA 4YJ2B 5EYPA 3EORA 2GZLA 5FNVB 3VCZA 5CA0B 4I55A 1VQ4F 1TVKA 2H8CA 3KHNA 1PXWA 1M1KH 2JNBA 3JVHA 2VXYA 1U3PA 1VQ5F 3GHZA 2AIFA 2Z1TA 1KD1H 2L26A 1Q8RA 1IV1A 5EAZA 3E22B 4IIJA 1M90H 3CC2F 3WJRA 3RYIB 1W59A 2EWCA 2VGNA 4RQOA 2NMUA 1X25A 2CSLA 3RA5A 5IJ9A 1K8AH 3WGLA 3IKFA 5IT9M 5GONA 4EI7A 3C9TA 3P10A 4B45A 2FC3A 5C8YA 4BT6A 3R0PA 1GZ0A 2DYYA 1QD9A 5GIPC 3ON1A 1SZQA 3CPQA 2OTJF 1FSZA 3JATB 1W5EA 3HKDB 5GIOC 1KQSF 1T0KB 4ZK7A 2P6YA 5LYJA 5HXZA 3WPXA 3GTZA 5LOVB 2UZHA 2WALA 3JAWA 4I55B 1VK3A 3WGKA 2Z1UA 5JH7B 3MCAB 3MDOA 4B46A 3VTIC 2BTQB 3C9SA 3CXCF 1KC8H 3LWOC 3CD6F 2HS3A 1CLIA 4O2AA 1YQNA 5EZYB 1X52A 1DT9A 4X1YA 4NQ3A 3CG6A 2I6DA 5FLXM 4WBNB 4IIJB 5EIBC 4DRXA 2RHHA 3RYHA 3JAMM 3S06A 5HXUA 5MN4A 5GANK 4U3JA 3S0WA 3QUWA 5CA0A 4E6EA 4G4YA 3TD4A 5IJ9B 2VAMA 1TVKB 3CC7F 3I3FA 3LFOA 3QHDA 4G4VA 4TV8A 4C82A 3JAKA 3FD6A 3C8LA 4FFBA 4X20B 1YHQF 2KTVA 3N2GA 1SA0A 2QA4F 3BYQA 4IHJA 5A2QM 3RYCB 3CYPB 2CWJA 1ZWZA 3RYFB 3GYQA 3HKEB 2AIZP 2GVIA 4X3LA 4O4LA 3NK7A 4TV9A 2N48A 1W5AA 3TD5A 3FPIA 3OONA 1VQKF 5J2UB 4G88A 2AMTA 2CHSA 4NWOB 3VOBA 5IYZB 1Q86H 1VQMF 4LNUB 1TUBA 4G4ZA 3WJPA 5G4UC 5HP8A 3SIVA 4ZHYB 2Q1YA 1ODEA 3HKBB 3VYUC 1QAHA 2RB9A 2Z1EA 2ZODA 5CB4B 2ZOVA 3V7EA 3ZO8A 3T80A 3C9RA 1W2BF 3K2XA 4C4WC 1W5FA 1W57A 3QTYA 2LCAA 3OBYA 1X7PA 1JFFB 5B8FA 5JVDA 3N2KB 4KWEA 3CCSF 3CMEF 1NMUB 3RYHB 2UYPA 5LYJB 2UYNA 2I6RA 5HY1A 5ITZB 3G71F 2OTLF 1JD1A 1VQPF 3KJKA 1JN1A 5LA6B 1NQ3A 3CCVF 4R40B 3P4EA 3RE3A 2CW4A 5HWEA 1RLGA 1VQVA 3N4YA 1VQNF 3V3TA 4O2AB 4C8GA 3LDTA 2KGWA 1VHAA 2R751 3WXMB 1YI2F 3RYFA 3HAXD 4O4LB 3KE1A 4BVRA 5C8YB 3U0OA 3HWUA 4F6RB 1XBIA 3IR9A 4DRXB 4I50A 3PAFA 5GAPK 4ZI7B 3SIUA 2HX0A 1RQ7A 3K14A 2QTPA 3IEWA 2HRYA 1CN7A 3MBMA 2Z01A 1OAPA 5LOVA 4HNAA 2CHTA 1U43A 3NK6A 4ZOLB 3WJQA 1SA0B 3JASB 4X3MA 5DCVA 3N2KA 3ZP7A 3KJJA 3HKEA 1RQ2A 2HP0A 5JQGA 5G4VC 4TUYA 5BMVB 3HKCB 1U3LA 1VH8A 1Z5WA 1GX1A 2RHOA 1PF5A 3J7AR 3LWPC 3CCRF 1COMA 3WPWA 4O2BA 1Z5VA 1XV2A 3TD3A 5JCOA 5KX5A 3VYTC 2B33A 5CA1B 5CB4A 3RA6A 3D01A 3VOAA 1J7HA 4FFBB 1JFFA 1DBFA 1JY8A 5JVDB 3WGMA 3IMPA 4U39A 4X1IB 4TZZA 3LWRC 2KTUA 2RHJA 4ZHWA 4I50B 3S02A 3CB2A 1GO0A 1FFXB 1QVGF 5GONB 3VMFB 1VQOF 5J2TB 2VGMA 4BW0B 5J2UA 4ZOLA 1R1MA 3D00A 3VYSC 1XHOA 3KIZA 3E1YA 1H48A 4BT4A 3CCEF 5JQGB 4M8IA 4TUYB 5BMVA 1H7MA 3ZOPA 4B5CA 4BT2A 3V4DA 1FNKA 4C81A 4LCKA 2MQEA 3Q8HA 2HVYD 1IV4A 5EB1B 4I4TA 3C9UA 3I55F 4EI8A 2G9IA 5KX5B 3K0TA 4YJ2A 4O4JB 5EZYA 4C8EA 3JASA 2R6R1 3JARA 3I56F 2OZBA 2DT4A 4WBNA 2HP0B 5LP6A 1W581 1W55A 3IEQA 4ERHA 2PMPA 3F6MA 3IKEA 3E22A 3O85A 4TV8B 1H47A 3LWQC 1X7OA 4O2BB 2KG4A 3ZP4A 2QEXF 3N2GB 1YIJF 2HS4A 3PLAC 1KNKA 5MN6A 1GO1A 3CMAF 3N4ZA 2LBXA 4O4HB 5IJ0B 3FD5A 1Q7YH 1IV2A 2OTMA 4EI9A 2BTUA 2CZWA 3JALA 4EB6A 1XRGA 1W5BA 3MQWA 2ZF8A 2GLZA 1IV3A 4DXDA 5LP6C 3JATA 4BVSA 4O4IA 3HKCA 1UI9A 1W41A 3HKBA 4BVQA 3HTNA 5J2TA 1YJNF 3UT5B 2YYEA 5LXTB 1T0AA 1UFYA 3LYBA 3LWVC 4G4XA 1YJ9F 5EWRA 3VIUA 1YGYA 3F0GA 4YJ3A 3B6NA 3LMEA 2UYNB 5HY4A 3J80M 1VQ8F 5FNVA 4RHAA 5ITZA 1K73H 5KMGB 1W40A 3ESJA 1VQ7F 4X1IA 1ONIA 5LA6A 3J81M 3I7TA 3G4SF 2CVLA 2IG8A 4ZHQA 4O4JA 1VQ6F 3FFMA 5AVMA 1FFXA 1S72F 1NJIH 1QVFF 2H8EA 3CCMF 2ZAUA 4BY9D 2ZVYA 2HP3A 4X20A 3CC4F 2W8BC 2ZVZA 3OBWA 2UYKA 4X1KB 3VO8A 2IQQA 3RYIA 3HJWC 3F0EA 3AGKA 3CCLF 3CCQF 2YXZA 3F0DA 3CYQA 3V7QA 2Q1XA 3ERNA 3WGJA 1YJWF 4NUTA 3VI6A 1SDSA 5EIBD 3UT5A 5IYZA 5JCOC 5FJ4C 4I4TB 4LNUA 1TUBB 4G4WA 1W42A 5GINC 3DC2A 4PWTA 1FNJA 3L7QA 3E20B 3F0FA 1RA4A 4YJ3B 4O4HA 5IJ0A 3ELCA 2UYJA 2H6LA 1KNJA 4BVTA 2VAPA 3JARB 1K9MH 3CCJF 3JAWB 5HY2A 3S0YA 1N8RH 3P0ZA 2F9ZC 1VQLF 5LP6B 5CA1A 3NVKE 5EYPB 2LBTA 5HP7A 2Z1FA 1QU9A 4BT3A 1VQ9F 3FBAA 3M84A 4B62A 2PHNA 3OW2F 1JJ2F 3CCUF 3MCQA 4BT7A 5MN5A 2QI2A 3CPWF 3M1XA 5HY0A 1RLUA 3NVIB 2FGYA 4U3JB 3JCMM 2VAWA 1Q82H 3K12A 2HS0A 5KMGA 2LBWA 4F6RA 4C8IA 3JALB 1W3EX 3DDNA 3JAKB 4EB6B 4ZHVA 1CK2A 1E7KA 4BT5A 3S03A 2IAFA 4ZHQB 3S0HA 4ZI7A 5JH7A 1U40A 2K1SA 4IHJB 4O4IB 3M4SA 5EO3A 3RYCA 2BO1A 1OFUA 2HQSC 4XCQA 3D54A 2OHWA 5EB0A 3NMUC 2RHLA 4TV9B 4HNAB 1Q81H 3WGNA 5LXTA 1YITF 4X1YB 4X1KA 3G6EF 2ALEA 2HRUA 2V9YA 3HKDA
chains in the Genus database with same CATH topology
2UYNA 1PF5A 1ONIA 2CHSA 1UI9A 3GTZA 1COMA 3I7TA 2EWCA 4NWOB 3VCZA 1JD1A 2CVLA 3QUWA 3K0TA 1X25A 4ZK7A 2IG8A 3KJKA 2CSLA 5HP7A 3I3FA 5HP8A 3ZP4A 1NQ3A 1ODEA 2B33A 1QU9A 3M4SA 2CW4A 1UFYA 1QAHA 2CHTA 3LYBA 1FNJA 3L7QA 3ZO8A 1XHOA 3D01A 1J7HA 2CWJA 3R0PA 2DYYA 3ZP7A 1DBFA 2UYJA 1QD9A 2UYKA 3KJJA 3M1XA 2OTMA 3ZOPA 3V4DA 3LMEA 2UYNB 1FNKA 1XRGA 2UYPA 3K12A 3MQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYN A;  1PF5 A;  1ONI A;  2CHS A;  1UI9 A;  3GTZ A;  1COM A;  3I7T A;  2EWC A;  4NWO B;  3VCZ A;  1JD1 A;  2CVL A;  3QUW A;  3K0T A;  1X25 A;  4ZK7 A;  2IG8 A;  3KJK A;  2CSL A;  5HP7 A;  3I3F A;  5HP8 A;  3ZP4 A;  1NQ3 A;  1ODE A;  2B33 A;  1QU9 A;  3M4S A;  2CW4 A;  1UFY A;  1QAH A;  2CHT A;  3LYB A;  1FNJ A;  3L7Q A;  3ZO8 A;  1XHO A;  3D01 A;  1J7H A;  2CWJ A;  3R0P A;  2DYY A;  3ZP7 A;  1DBF A;  2UYJ A;  1QD9 A;  2UYK A;  3KJJ A;  3M1X A;  2OTM A;  3ZOP A;  3V4D A;  3LME A;  2UYN B;  1FNK A;  1XRG A;  2UYP A;  3K12 A;  3MQW A; 
#chains in the Genus database with same CATH topology
 1IPA A;  2BTO A;  4YJ2 B;  5EYP A;  3EOR A;  2GZL A;  5FNV B;  3VCZ A;  5CA0 B;  4I55 A;  1VQ4 F;  1TVK A;  2H8C A;  3KHN A;  1PXW A;  1M1K H;  2JNB A;  3JVH A;  2VXY A;  1U3P A;  1VQ5 F;  3GHZ A;  2AIF A;  2Z1T A;  1KD1 H;  2L26 A;  1Q8R A;  1IV1 A;  5EAZ A;  3E22 B;  4IIJ A;  1M90 H;  3CC2 F;  3WJR A;  3RYI B;  1W59 A;  2EWC A;  2VGN A;  4RQO A;  2NMU A;  1X25 A;  2CSL A;  3RA5 A;  5IJ9 A;  1K8A H;  3WGL A;  3IKF A;  5IT9 M;  5GON A;  4EI7 A;  3C9T A;  3P10 A;  4B45 A;  2FC3 A;  5C8Y A;  4BT6 A;  3R0P A;  1GZ0 A;  2DYY A;  1QD9 A;  5GIP C;  3ON1 A;  1SZQ A;  3CPQ A;  2OTJ F;  1FSZ A;  3JAT B;  1W5E A;  3HKD B;  5GIO C;  1KQS F;  1T0K B;  4ZK7 A;  2P6Y A;  5LYJ A;  5HXZ A;  3WPX A;  3GTZ A;  5LOV B;  2UZH A;  2WAL A;  3JAW A;  4I55 B;  1VK3 A;  3WGK A;  2Z1U A;  5JH7 B;  3MCA B;  3MDO A;  4B46 A;  3VTI C;  2BTQ B;  3C9S A;  3CXC F;  1KC8 H;  3LWO C;  3CD6 F;  2HS3 A;  1CLI A;  4O2A A;  1YQN A;  5EZY B;  1X52 A;  1DT9 A;  4X1Y A;  4NQ3 A;  3CG6 A;  2I6D A;  5FLX M;  4WBN B;  4IIJ B;  5EIB C;  4DRX A;  2RHH A;  3RYH A;  3JAM M;  3S06 A;  5HXU A;  5MN4 A;  5GAN K;  4U3J A;  3S0W A;  3QUW A;  5CA0 A;  4E6E A;  4G4Y A;  3TD4 A;  5IJ9 B;  2VAM A;  1TVK B;  3CC7 F;  3I3F A;  3LFO A;  3QHD A;  4G4V A;  4TV8 A;  4C82 A;  3JAK A;  3FD6 A;  3C8L A;  4FFB A;  4X20 B;  1YHQ F;  2KTV A;  3N2G A;  1SA0 A;  2QA4 F;  3BYQ A;  4IHJ A;  5A2Q M;  3RYC B;  3CYP B;  2CWJ A;  1ZWZ A;  3RYF B;  3GYQ A;  3HKE B;  2AIZ P;  2GVI A;  4X3L A;  4O4L A;  3NK7 A;  4TV9 A;  2N48 A;  1W5A A;  3TD5 A;  3FPI A;  3OON A;  1VQK F;  5J2U B;  4G88 A;  2AMT A;  2CHS A;  4NWO B;  3VOB A;  5IYZ B;  1Q86 H;  1VQM F;  4LNU B;  1TUB A;  4G4Z A;  3WJP A;  5G4U C;  5HP8 A;  3SIV A;  4ZHY B;  2Q1Y A;  1ODE A;  3HKB B;  3VYU C;  1QAH A;  2RB9 A;  2Z1E A;  2ZOD A;  5CB4 B;  2ZOV A;  3V7E A;  3ZO8 A;  3T80 A;  3C9R A;  1W2B F;  3K2X A;  4C4W C;  1W5F A;  1W57 A;  3QTY A;  2LCA A;  3OBY A;  1X7P A;  1JFF B;  5B8F A;  5JVD A;  3N2K B;  4KWE A;  3CCS F;  3CME F;  1NMU B;  3RYH B;  2UYP A;  5LYJ B;  2UYN A;  2I6R A;  5HY1 A;  5ITZ B;  3G71 F;  2OTL F;  1JD1 A;  1VQP F;  3KJK A;  1JN1 A;  5LA6 B;  1NQ3 A;  3CCV F;  4R40 B;  3P4E A;  3RE3 A;  2CW4 A;  5HWE A;  1RLG A;  1VQV A;  3N4Y A;  1VQN F;  3V3T A;  4O2A B;  4C8G A;  3LDT A;  2KGW A;  1VHA A;  2R75 1;  3WXM B;  1YI2 F;  3RYF A;  3HAX D;  4O4L B;  3KE1 A;  4BVR A;  5C8Y B;  3U0O A;  3HWU A;  4F6R B;  1XBI A;  3IR9 A;  4DRX B;  4I50 A;  3PAF A;  5GAP K;  4ZI7 B;  3SIU A;  2HX0 A;  1RQ7 A;  3K14 A;  2QTP A;  3IEW A;  2HRY A;  1CN7 A;  3MBM A;  2Z01 A;  1OAP A;  5LOV A;  4HNA A;  2CHT A;  1U43 A;  3NK6 A;  4ZOL B;  3WJQ A;  1SA0 B;  3JAS B;  4X3M A;  5DCV A;  3N2K A;  3ZP7 A;  3KJJ A;  3HKE A;  1RQ2 A;  2HP0 A;  5JQG A;  5G4V C;  4TUY A;  5BMV B;  3HKC B;  1U3L A;  1VH8 A;  1Z5W A;  1GX1 A;  2RHO A;  1PF5 A;  3J7A R;  3LWP C;  3CCR F;  1COM A;  3WPW A;  4O2B A;  1Z5V A;  1XV2 A;  3TD3 A;  5JCO A;  5KX5 A;  3VYT C;  2B33 A;  5CA1 B;  5CB4 A;  3RA6 A;  3D01 A;  3VOA A;  1J7H A;  4FFB B;  1JFF A;  1DBF A;  1JY8 A;  5JVD B;  3WGM A;  3IMP A;  4U39 A;  4X1I B;  4TZZ A;  3LWR C;  2KTU A;  2RHJ A;  4ZHW A;  4I50 B;  3S02 A;  3CB2 A;  1GO0 A;  1FFX B;  1QVG F;  5GON B;  3VMF B;  1VQO F;  5J2T B;  2VGM A;  4BW0 B;  5J2U A;  4ZOL A;  1R1M A;  3D00 A;  3VYS C;  1XHO A;  3KIZ A;  3E1Y A;  1H48 A;  4BT4 A;  3CCE F;  5JQG B;  4M8I A;  4TUY B;  5BMV A;  1H7M A;  3ZOP A;  4B5C A;  4BT2 A;  3V4D A;  1FNK A;  4C81 A;  4LCK A;  2MQE A;  3Q8H A;  2HVY D;  1IV4 A;  5EB1 B;  4I4T A;  3C9U A;  3I55 F;  4EI8 A;  2G9I A;  5KX5 B;  3K0T A;  4YJ2 A;  4O4J B;  5EZY A;  4C8E A;  3JAS A;  2R6R 1;  3JAR A;  3I56 F;  2OZB A;  2DT4 A;  4WBN A;  2HP0 B;  5LP6 A;  1W58 1;  1W55 A;  3IEQ A;  4ERH A;  2PMP A;  3F6M A;  3IKE A;  3E22 A;  3O85 A;  4TV8 B;  1H47 A;  3LWQ C;  1X7O A;  4O2B B;  2KG4 A;  3ZP4 A;  2QEX F;  3N2G B;  1YIJ F;  2HS4 A;  3PLA C;  1KNK A;  5MN6 A;  1GO1 A;  3CMA F;  3N4Z A;  2LBX A;  4O4H B;  5IJ0 B;  3FD5 A;  1Q7Y H;  1IV2 A;  2OTM A;  4EI9 A;  2BTU A;  2CZW A;  3JAL A;  4EB6 A;  1XRG A;  1W5B A;  3MQW A;  2ZF8 A;  2GLZ A;  1IV3 A;  4DXD A;  5LP6 C;  3JAT A;  4BVS A;  4O4I A;  3HKC A;  1UI9 A;  1W41 A;  3HKB A;  4BVQ A;  3HTN A;  5J2T A;  1YJN F;  3UT5 B;  2YYE A;  5LXT B;  1T0A A;  1UFY A;  3LYB A;  3LWV C;  4G4X A;  1YJ9 F;  5EWR A;  3VIU A;  1YGY A;  3F0G A;  4YJ3 A;  3B6N A;  3LME A;  2UYN B;  5HY4 A;  3J80 M;  1VQ8 F;  5FNV A;  4RHA A;  5ITZ A;  1K73 H;  5KMG B;  1W40 A;  3ESJ A;  1VQ7 F;  4X1I A;  1ONI A;  5LA6 A;  3J81 M;  3I7T A;  3G4S F;  2CVL A;  2IG8 A;  4ZHQ A;  4O4J A;  1VQ6 F;  3FFM A;  5AVM A;  1FFX A;  1S72 F;  1NJI H;  1QVF F;  2H8E A;  3CCM F;  2ZAU A;  4BY9 D;  2ZVY A;  2HP3 A;  4X20 A;  3CC4 F;  2W8B C;  2ZVZ A;  3OBW A;  2UYK A;  4X1K B;  3VO8 A;  2IQQ A;  3RYI A;  3HJW C;  3F0E A;  3AGK A;  3CCL F;  3CCQ F;  2YXZ A;  3F0D A;  3CYQ A;  3V7Q A;  2Q1X A;  3ERN A;  3WGJ A;  1YJW F;  4NUT A;  3VI6 A;  1SDS A;  5EIB D;  3UT5 A;  5IYZ A;  5JCO C;  5FJ4 C;  4I4T B;  4LNU A;  1TUB B;  4G4W A;  1W42 A;  5GIN C;  3DC2 A;  4PWT A;  1FNJ A;  3L7Q A;  3E20 B;  3F0F A;  1RA4 A;  4YJ3 B;  4O4H A;  5IJ0 A;  3ELC A;  2UYJ A;  2H6L A;  1KNJ A;  4BVT A;  2VAP A;  3JAR B;  1K9M H;  3CCJ F;  3JAW B;  5HY2 A;  3S0Y A;  1N8R H;  3P0Z A;  2F9Z C;  1VQL F;  5LP6 B;  5CA1 A;  3NVK E;  5EYP B;  2LBT A;  5HP7 A;  2Z1F A;  1QU9 A;  4BT3 A;  1VQ9 F;  3FBA A;  3M84 A;  4B62 A;  2PHN A;  3OW2 F;  1JJ2 F;  3CCU F;  3MCQ A;  4BT7 A;  5MN5 A;  2QI2 A;  3CPW F;  3M1X A;  5HY0 A;  1RLU A;  3NVI B;  2FGY A;  4U3J B;  3JCM M;  2VAW A;  1Q82 H;  3K12 A;  2HS0 A;  5KMG A;  2LBW A;  4F6R A;  4C8I A;  3JAL B;  1W3E X;  3DDN A;  3JAK B;  4EB6 B;  4ZHV A;  1CK2 A;  1E7K A;  4BT5 A;  3S03 A;  2IAF A;  4ZHQ B;  3S0H A;  4ZI7 A;  5JH7 A;  1U40 A;  2K1S A;  4IHJ B;  4O4I B;  3M4S A;  5EO3 A;  3RYC A;  2BO1 A;  1OFU A;  2HQS C;  4XCQ A;  3D54 A;  2OHW A;  5EB0 A;  3NMU C;  2RHL A;  4TV9 B;  4HNA B;  1Q81 H;  3WGN A;  5LXT A;  1YIT F;  4X1Y B;  4X1K A;  3G6E F;  2ALE A;  2HRU A;  2V9Y A;  3HKD A; 
#chains in the Genus database with same CATH homology
 2UYN A;  1PF5 A;  1ONI A;  2CHS A;  1UI9 A;  3GTZ A;  1COM A;  3I7T A;  2EWC A;  4NWO B;  3VCZ A;  1JD1 A;  2CVL A;  3QUW A;  3K0T A;  1X25 A;  4ZK7 A;  2IG8 A;  3KJK A;  2CSL A;  5HP7 A;  3I3F A;  5HP8 A;  3ZP4 A;  1NQ3 A;  1ODE A;  2B33 A;  1QU9 A;  3M4S A;  2CW4 A;  1UFY A;  1QAH A;  2CHT A;  3LYB A;  1FNJ A;  3L7Q A;  3ZO8 A;  1XHO A;  3D01 A;  1J7H A;  2CWJ A;  3R0P A;  2DYY A;  3ZP7 A;  1DBF A;  2UYJ A;  1QD9 A;  2UYK A;  3KJJ A;  3M1X A;  2OTM A;  3ZOP A;  3V4D A;  3LME A;  2UYN B;  1FNK A;  1XRG A;  2UYP A;  3K12 A;  3MQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...