2UYPA

Crystal structure of e. coli tdcf with bound propionate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
126
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN TDCF
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 35
structure length 126
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uypA00
3L7QA 2UYNB 1XHOA 2UYNA 2UYPA 3K12A 2B33A 3VCZA 3ZO8A 2CHSA 1COMA 3ZP7A 3M4SA 2CHTA 2IG8A 3LYBA 3M1XA 3ZP4A 1JD1A 1XRGA 3D01A 3I7TA 1X25A 3ZOPA 3I3FA 4ZK7A 1QAHA 1QU9A 1PF5A 5HP7A 1J7HA 2UYKA 2CWJA 2UYJA 1DBFA 2EWCA 3KJJA 3LMEA 3R0PA 2CSLA 3QUWA 1NQ3A 1ODEA 1QD9A 3K0TA 2CVLA 2DYYA 2OTMA 1FNJA 3KJKA 4NWOB 3V4DA 1ONIA 1FNKA 5HP8A 3MQWA 1UI9A 3GTZA 2CW4A 1UFYA
chains in the Genus database with same CATH superfamily
1ZWZA 2UYNA 2Z01A 5G4VC 4I4TB 3K12A 4EB6B 1VQ5F 2HP0B 5BMVA 3CPQA 4U3JB 1VQNF 5JCOA 1YHQF 3AGKA 4FFBA 5MN6A 5HP7A 2UYKA 3SIVA 4LNUB 3OW2F 2IAFA 3RYHA 3WJPA 3I56F 3JAKB 1W2BF 4PWTA 2DYYA 3Q8HA 1GO0A 1N8RH 1U3LA 4O4IB 5IT9M 3U0OA 3CC4F 3CYPB 3RYIB 5G4UC 4BY9D 4X1YB 3E22B 4IHJB 3WGMA 3WGNA 1SDSA 2ALEA 4C8EA 1OAPA 3RYCB 4TV9A 3D01A 3GYQA 2V9YA 4O2BA 4DXDA 3LDTA 4O4LA 5ITZB 4G4WA 3JATB 1J7HA 5LYJB 2KG4A 4EI8A 1W42A 3RA5A 3LWPC 3HKEA 3VOBA 3HKBB 2GZLA 1Q82H 1VQOF 3T80A 2YYEA 4ZHQA 3G71F 4O2AA 2BO1A 4X1KB 2L26A 3N2GA 1NMUB 3V7QA 2VAWA 2Z1UA 3ELCA 3NK6A 5IYZB 3LWVC 2ZVYA 1QVGF 3PAFA 5IJ9B 3HAXD 3UT5A 3HKCA 3HKDA 1VQ7F 4I55A 2LCAA 1RA4A 3LMEA 1XBIA 2IQQA 1W59A 3FPIA 3F6MA 5HXUA 3V4DA 4BW0B 1T0KB 5LOVA 2BTOA 2HRUA 5LA6B 2LBWA 4BVTA 4BVQA 1IV2A 5J2TB 1XHOA 4IIJB 3TD5A 1YITF 3VYSC 3M4SA 3ZP4A 4ZI7A 3I7TA 3JASB 2ZODA 1VQ4F 1SA0B 2HVYD 3JAWA 2VAMA 5JVDB 2ZAUA 4I50B 5EIBC 5J2UB 3JCMM 1RLUA 3N2KB 4EI9A 3G4SF 3JARA 4BT4A 4KWEA 5EZYA 1YIJF 1UI9A 3GTZA 3LFOA 2BTQB 5KMGB 4ZHVA 3ON1A 4O4JB 2HQSC 3RYFB 3FD6A 3J81M 1IV4A 2RB9A 3G6EF 4BT7A 1M1KH 3WGKA 2IG8A 2R751 5GONA 1X25A 1W55A 1YJNF 2AIFA 2Q1XA 1QU9A 2KTUA 4X20A 5FLXM 1W5EA 1VK3A 3PLAC 3RA6A 3CCLF 2KTVA 4ZOLA 5LP6B 5HWEA 1K8AH 1KNJA 3IKFA 3GHZA 1FNJA 4TUYA 4O4HB 2H6LA 1K73H 2ZF8A 3DC2A 5C8YA 1Q8RA 2UYNB 1GZ0A 1M90H 5KX5A 1GX1A 2HS0A 2QEXF 2CHSA 5BMVB 3LYBA 4XCQA 3KE1A 5GANK 4FFBB 3WGJA 2UZHA 2GLZA 1PF5A 3BYQA 3RYHB 3C8LA 1VH8A 1W5AA 2QI2A 3CB2A 3CG6A 3V3TA 2OTMA 2AIZP 1TUBA 5FNVB 2YXZA 2HS3A 3C9SA 3MQWA 3CCQF 2QTPA 4B5CA 3S03A 1JFFA 4TV8A 2KGWA 1X52A 1W3EX 2ZOVA 4TV9B 4U3JA 4O2BB 4B46A 4BT2A 4ERHA 1FFXB 5GIPC 4BT6A 4O4LB 3CCJF 2EWCA 1VQPF 3HKEB 2AMTA 4BVRA 3CYQA 1JJ2F 1YJ9F 1E7KA 3D00A 2FGYA 2PHNA 4BVSA 4NQ3A 1RQ2A 5HY0A 4ZHQB 1S72F 4O2AB 3VMFB 2Q1YA 3N2GB 3RE3A 3RYIA 3ZO8A 3LWRC 3CXCF 2Z1EA 2CHTA 4B45A 4ZK7A 3UT5B 3HKCB 3HKDB 5CA1A 5IJ0A 3FBAA 3WJQA 4G4XA 3S0YA 2P6YA 2UYJA 3B6NA 5GINC 2HRYA 4YJ2A 4C82A 1KD1H 1QD9A 2QA4F 2I6RA 4NWOB 2VGNA 3QHDA 1CK2A 2R6R1 5LOVB 1YGYA 2CW4A 3MBMA 1Q7YH 4YJ3A 5JQGA 4LCKA 5GAPK 4C4WC 4X1KA 3VCZA 2BTUA 1JN1A 1CLIA 3C9UA 1Z5WA 3F0DA 1H48A 2OTLF 2FC3A 3MCAB 3CCUF 4WBNA 3OBWA 2OHWA 3VTIC 1VHAA 1W57A 3F0FA 2CWJA 3S0HA 5CA0A 2H8EA 3KIZA 4X1IB 3E1YA 3JARB 4BT3A 5CB4B 1IV3A 2LBTA 1ONIA 2CZWA 1TVKA 5EYPA 5EZYB 2I6DA 1XV2A 1UFYA 3E20B 1W40A 2UYPA 4G4ZA 1W5BA 3VYUC 3WJRA 2WALA 3MDOA 2RHOA 5GONB 4BT5A 3I3FA 4HNAA 3S06A 3IKEA 4X3MA 2PMPA 5JVDA 4ZOLB 3VOAA 3CCEF 3JALA 3K0TA 1H7MA 4NUTA 4C81A 3TD3A 1W581 4TUYB 5B8FA 5JH7A 3K2XA 3TD4A 4G4VA 3HTNA 4F6RB 5EIBD 3LWQC 3HWUA 5KMGA 1JY8A 5C8YB 4G4YA 1FSZA 4RHAA 5EAZA 5KX5B 4ZHYB 1U40A 3NVKE 3IEWA 3P0ZA 1XRGA 2MQEA 2RHLA 2HP3A 3NVIB 5LXTA 4RQOA 5LP6A 1NQ3A 1ODEA 3CCSF 3O85A 2CVLA 1TUBB 3JVHA 4DRXA 1VQKF 1YI2F 1U3PA 2VGMA 3L7QA 1JFFB 1U43A 4TV8B 1KQSF 1VQ8F 3KHNA 3N4YA 5MN4A 1VQ6F 5EWRA 3HJWC 3F0GA 4I4TA 1R1MA 4EB6A 4EI7A 2HP0A 3CCVF 2H8CA 5A2QM 3C9RA 1Q81H 2F9ZC 2ZVZA 4LNUA 3R0PA 3VI6A 1DT9A 5DCVA 4ZHWA 2RHJA 5EO3A 3JAKA 3CMEF 3J80M 5FNVA 2OTJF 1QVFF 2OZBA 3CCMF 4O4IA 3M84A 5GIOC 3J7AR 5HY2A 4B62A 2B33A 2RHHA 2VXYA 4X1YA 1COMA 2W8BC 3E22A 4IHJA 1GO1A 4E6EA 3RYCA 1PXWA 1FFXA 5EB1B 4C8GA 5EB0A 5CA1B 3CD6F 5IJ0B 2G9IA 3QTYA 1W5FA 5ITZA 4I55B 2JNBA 3JATA 3F0EA 4YJ2B 5LYJA 3WPXA 3QUWA 2LBXA 3P4EA 3HKBA 3NMUC 1IV1A 1FNKA 3VO8A 3V7EA 4YJ3B 5JQGB 3OONA 3CC7F 1H47A 4M8IA 2N48A 1CN7A 3P10A 3WGLA 5IYZA 3M1XA 3JAMM 1X7OA 4ZI7B 3IR9A 4WBNB 3VYTC 5IJ9A 3JAWB 3VIUA 3K14A 5CA0B 2CSLA 3CC2F 3DDNA 3MCQA 5EYPB 1TVKB 3FD5A 5LP6C 5HY4A 3WXMB 5LA6A 3IEQA 5J2TA 1VQ9F 1Z5VA 4IIJA 4U39A 3S0WA 3N4ZA 3WPWA 1VQLF 1SZQA 3LWOC 3ZP7A 1YJWF 2Z1TA 1Q86H 1JD1A 2Z1FA 3CCRF 4HNAB 2K1SA 3ESJA 1T0AA 3JASA 3OBYA 1SA0A 5HXZA 1QAHA 1RLGA 4X20B 5MN5A 5FJ4C 3NK7A 1DBFA 4C8IA 3JALB 4X1IA 4I50A 5JCOC 1W41A 4R40B 5J2UA 3CPWF 5CB4A 2HX0A 5JH7B 3N2KA 2HS4A 2GVIA 1RQ7A 5HY1A 3FFMA 4O4JA 3S02A 2DT4A 2VAPA 3D54A 4G88A 1VQMF 3SIUA 3RYFA 1NJIH 1KNKA 3EORA 3ZOPA 3C9TA 2NMUA 1OFUA 3I55F 5LXTB 1KC8H 3KJJA 4X3LA 3ERNA 3CMAF 1VQVA 1X7PA 3KJKA 4TZZA 4DRXB 1YQNA 5AVMA 4F6RA 5HP8A 4O4HA 1K9MH 1IPAA 3IMPA
chains in the Genus database with same CATH topology
3L7QA 2UYNB 1XHOA 2UYNA 2UYPA 3K12A 2B33A 3VCZA 3ZO8A 2CHSA 1COMA 3ZP7A 3M4SA 2CHTA 2IG8A 3LYBA 3M1XA 3ZP4A 1JD1A 1XRGA 3D01A 3I7TA 1X25A 3ZOPA 3I3FA 4ZK7A 1QAHA 1QU9A 1PF5A 5HP7A 1J7HA 2UYKA 2CWJA 2UYJA 1DBFA 2EWCA 3KJJA 3LMEA 3R0PA 2CSLA 3QUWA 1NQ3A 1ODEA 1QD9A 3K0TA 2CVLA 2DYYA 2OTMA 1FNJA 3KJKA 4NWOB 3V4DA 1ONIA 1FNKA 5HP8A 3MQWA 1UI9A 3GTZA 2CW4A 1UFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7Q A;  2UYN B;  1XHO A;  2UYN A;  2UYP A;  3K12 A;  2B33 A;  3VCZ A;  3ZO8 A;  2CHS A;  1COM A;  3ZP7 A;  3M4S A;  2CHT A;  2IG8 A;  3LYB A;  3M1X A;  3ZP4 A;  1JD1 A;  1XRG A;  3D01 A;  3I7T A;  1X25 A;  3ZOP A;  3I3F A;  4ZK7 A;  1QAH A;  1QU9 A;  1PF5 A;  5HP7 A;  1J7H A;  2UYK A;  2CWJ A;  2UYJ A;  1DBF A;  2EWC A;  3KJJ A;  3LME A;  3R0P A;  2CSL A;  3QUW A;  1NQ3 A;  1ODE A;  1QD9 A;  3K0T A;  2CVL A;  2DYY A;  2OTM A;  1FNJ A;  3KJK A;  4NWO B;  3V4D A;  1ONI A;  1FNK A;  5HP8 A;  3MQW A;  1UI9 A;  3GTZ A;  2CW4 A;  1UFY A; 
#chains in the Genus database with same CATH topology
 1ZWZ A;  2UYN A;  2Z01 A;  5G4V C;  4I4T B;  3K12 A;  4EB6 B;  1VQ5 F;  2HP0 B;  5BMV A;  3CPQ A;  4U3J B;  1VQN F;  5JCO A;  1YHQ F;  3AGK A;  4FFB A;  5MN6 A;  5HP7 A;  2UYK A;  3SIV A;  4LNU B;  3OW2 F;  2IAF A;  3RYH A;  3WJP A;  3I56 F;  3JAK B;  1W2B F;  4PWT A;  2DYY A;  3Q8H A;  1GO0 A;  1N8R H;  1U3L A;  4O4I B;  5IT9 M;  3U0O A;  3CC4 F;  3CYP B;  3RYI B;  5G4U C;  4BY9 D;  4X1Y B;  3E22 B;  4IHJ B;  3WGM A;  3WGN A;  1SDS A;  2ALE A;  4C8E A;  1OAP A;  3RYC B;  4TV9 A;  3D01 A;  3GYQ A;  2V9Y A;  4O2B A;  4DXD A;  3LDT A;  4O4L A;  5ITZ B;  4G4W A;  3JAT B;  1J7H A;  5LYJ B;  2KG4 A;  4EI8 A;  1W42 A;  3RA5 A;  3LWP C;  3HKE A;  3VOB A;  3HKB B;  2GZL A;  1Q82 H;  1VQO F;  3T80 A;  2YYE A;  4ZHQ A;  3G71 F;  4O2A A;  2BO1 A;  4X1K B;  2L26 A;  3N2G A;  1NMU B;  3V7Q A;  2VAW A;  2Z1U A;  3ELC A;  3NK6 A;  5IYZ B;  3LWV C;  2ZVY A;  1QVG F;  3PAF A;  5IJ9 B;  3HAX D;  3UT5 A;  3HKC A;  3HKD A;  1VQ7 F;  4I55 A;  2LCA A;  1RA4 A;  3LME A;  1XBI A;  2IQQ A;  1W59 A;  3FPI A;  3F6M A;  5HXU A;  3V4D A;  4BW0 B;  1T0K B;  5LOV A;  2BTO A;  2HRU A;  5LA6 B;  2LBW A;  4BVT A;  4BVQ A;  1IV2 A;  5J2T B;  1XHO A;  4IIJ B;  3TD5 A;  1YIT F;  3VYS C;  3M4S A;  3ZP4 A;  4ZI7 A;  3I7T A;  3JAS B;  2ZOD A;  1VQ4 F;  1SA0 B;  2HVY D;  3JAW A;  2VAM A;  5JVD B;  2ZAU A;  4I50 B;  5EIB C;  5J2U B;  3JCM M;  1RLU A;  3N2K B;  4EI9 A;  3G4S F;  3JAR A;  4BT4 A;  4KWE A;  5EZY A;  1YIJ F;  1UI9 A;  3GTZ A;  3LFO A;  2BTQ B;  5KMG B;  4ZHV A;  3ON1 A;  4O4J B;  2HQS C;  3RYF B;  3FD6 A;  3J81 M;  1IV4 A;  2RB9 A;  3G6E F;  4BT7 A;  1M1K H;  3WGK A;  2IG8 A;  2R75 1;  5GON A;  1X25 A;  1W55 A;  1YJN F;  2AIF A;  2Q1X A;  1QU9 A;  2KTU A;  4X20 A;  5FLX M;  1W5E A;  1VK3 A;  3PLA C;  3RA6 A;  3CCL F;  2KTV A;  4ZOL A;  5LP6 B;  5HWE A;  1K8A H;  1KNJ A;  3IKF A;  3GHZ A;  1FNJ A;  4TUY A;  4O4H B;  2H6L A;  1K73 H;  2ZF8 A;  3DC2 A;  5C8Y A;  1Q8R A;  2UYN B;  1GZ0 A;  1M90 H;  5KX5 A;  1GX1 A;  2HS0 A;  2QEX F;  2CHS A;  5BMV B;  3LYB A;  4XCQ A;  3KE1 A;  5GAN K;  4FFB B;  3WGJ A;  2UZH A;  2GLZ A;  1PF5 A;  3BYQ A;  3RYH B;  3C8L A;  1VH8 A;  1W5A A;  2QI2 A;  3CB2 A;  3CG6 A;  3V3T A;  2OTM A;  2AIZ P;  1TUB A;  5FNV B;  2YXZ A;  2HS3 A;  3C9S A;  3MQW A;  3CCQ F;  2QTP A;  4B5C A;  3S03 A;  1JFF A;  4TV8 A;  2KGW A;  1X52 A;  1W3E X;  2ZOV A;  4TV9 B;  4U3J A;  4O2B B;  4B46 A;  4BT2 A;  4ERH A;  1FFX B;  5GIP C;  4BT6 A;  4O4L B;  3CCJ F;  2EWC A;  1VQP F;  3HKE B;  2AMT A;  4BVR A;  3CYQ A;  1JJ2 F;  1YJ9 F;  1E7K A;  3D00 A;  2FGY A;  2PHN A;  4BVS A;  4NQ3 A;  1RQ2 A;  5HY0 A;  4ZHQ B;  1S72 F;  4O2A B;  3VMF B;  2Q1Y A;  3N2G B;  3RE3 A;  3RYI A;  3ZO8 A;  3LWR C;  3CXC F;  2Z1E A;  2CHT A;  4B45 A;  4ZK7 A;  3UT5 B;  3HKC B;  3HKD B;  5CA1 A;  5IJ0 A;  3FBA A;  3WJQ A;  4G4X A;  3S0Y A;  2P6Y A;  2UYJ A;  3B6N A;  5GIN C;  2HRY A;  4YJ2 A;  4C82 A;  1KD1 H;  1QD9 A;  2QA4 F;  2I6R A;  4NWO B;  2VGN A;  3QHD A;  1CK2 A;  2R6R 1;  5LOV B;  1YGY A;  2CW4 A;  3MBM A;  1Q7Y H;  4YJ3 A;  5JQG A;  4LCK A;  5GAP K;  4C4W C;  4X1K A;  3VCZ A;  2BTU A;  1JN1 A;  1CLI A;  3C9U A;  1Z5W A;  3F0D A;  1H48 A;  2OTL F;  2FC3 A;  3MCA B;  3CCU F;  4WBN A;  3OBW A;  2OHW A;  3VTI C;  1VHA A;  1W57 A;  3F0F A;  2CWJ A;  3S0H A;  5CA0 A;  2H8E A;  3KIZ A;  4X1I B;  3E1Y A;  3JAR B;  4BT3 A;  5CB4 B;  1IV3 A;  2LBT A;  1ONI A;  2CZW A;  1TVK A;  5EYP A;  5EZY B;  2I6D A;  1XV2 A;  1UFY A;  3E20 B;  1W40 A;  2UYP A;  4G4Z A;  1W5B A;  3VYU C;  3WJR A;  2WAL A;  3MDO A;  2RHO A;  5GON B;  4BT5 A;  3I3F A;  4HNA A;  3S06 A;  3IKE A;  4X3M A;  2PMP A;  5JVD A;  4ZOL B;  3VOA A;  3CCE F;  3JAL A;  3K0T A;  1H7M A;  4NUT A;  4C81 A;  3TD3 A;  1W58 1;  4TUY B;  5B8F A;  5JH7 A;  3K2X A;  3TD4 A;  4G4V A;  3HTN A;  4F6R B;  5EIB D;  3LWQ C;  3HWU A;  5KMG A;  1JY8 A;  5C8Y B;  4G4Y A;  1FSZ A;  4RHA A;  5EAZ A;  5KX5 B;  4ZHY B;  1U40 A;  3NVK E;  3IEW A;  3P0Z A;  1XRG A;  2MQE A;  2RHL A;  2HP3 A;  3NVI B;  5LXT A;  4RQO A;  5LP6 A;  1NQ3 A;  1ODE A;  3CCS F;  3O85 A;  2CVL A;  1TUB B;  3JVH A;  4DRX A;  1VQK F;  1YI2 F;  1U3P A;  2VGM A;  3L7Q A;  1JFF B;  1U43 A;  4TV8 B;  1KQS F;  1VQ8 F;  3KHN A;  3N4Y A;  5MN4 A;  1VQ6 F;  5EWR A;  3HJW C;  3F0G A;  4I4T A;  1R1M A;  4EB6 A;  4EI7 A;  2HP0 A;  3CCV F;  2H8C A;  5A2Q M;  3C9R A;  1Q81 H;  2F9Z C;  2ZVZ A;  4LNU A;  3R0P A;  3VI6 A;  1DT9 A;  5DCV A;  4ZHW A;  2RHJ A;  5EO3 A;  3JAK A;  3CME F;  3J80 M;  5FNV A;  2OTJ F;  1QVF F;  2OZB A;  3CCM F;  4O4I A;  3M84 A;  5GIO C;  3J7A R;  5HY2 A;  4B62 A;  2B33 A;  2RHH A;  2VXY A;  4X1Y A;  1COM A;  2W8B C;  3E22 A;  4IHJ A;  1GO1 A;  4E6E A;  3RYC A;  1PXW A;  1FFX A;  5EB1 B;  4C8G A;  5EB0 A;  5CA1 B;  3CD6 F;  5IJ0 B;  2G9I A;  3QTY A;  1W5F A;  5ITZ A;  4I55 B;  2JNB A;  3JAT A;  3F0E A;  4YJ2 B;  5LYJ A;  3WPX A;  3QUW A;  2LBX A;  3P4E A;  3HKB A;  3NMU C;  1IV1 A;  1FNK A;  3VO8 A;  3V7E A;  4YJ3 B;  5JQG B;  3OON A;  3CC7 F;  1H47 A;  4M8I A;  2N48 A;  1CN7 A;  3P10 A;  3WGL A;  5IYZ A;  3M1X A;  3JAM M;  1X7O A;  4ZI7 B;  3IR9 A;  4WBN B;  3VYT C;  5IJ9 A;  3JAW B;  3VIU A;  3K14 A;  5CA0 B;  2CSL A;  3CC2 F;  3DDN A;  3MCQ A;  5EYP B;  1TVK B;  3FD5 A;  5LP6 C;  5HY4 A;  3WXM B;  5LA6 A;  3IEQ A;  5J2T A;  1VQ9 F;  1Z5V A;  4IIJ A;  4U39 A;  3S0W A;  3N4Z A;  3WPW A;  1VQL F;  1SZQ A;  3LWO C;  3ZP7 A;  1YJW F;  2Z1T A;  1Q86 H;  1JD1 A;  2Z1F A;  3CCR F;  4HNA B;  2K1S A;  3ESJ A;  1T0A A;  3JAS A;  3OBY A;  1SA0 A;  5HXZ A;  1QAH A;  1RLG A;  4X20 B;  5MN5 A;  5FJ4 C;  3NK7 A;  1DBF A;  4C8I A;  3JAL B;  4X1I A;  4I50 A;  5JCO C;  1W41 A;  4R40 B;  5J2U A;  3CPW F;  5CB4 A;  2HX0 A;  5JH7 B;  3N2K A;  2HS4 A;  2GVI A;  1RQ7 A;  5HY1 A;  3FFM A;  4O4J A;  3S02 A;  2DT4 A;  2VAP A;  3D54 A;  4G88 A;  1VQM F;  3SIU A;  3RYF A;  1NJI H;  1KNK A;  3EOR A;  3ZOP A;  3C9T A;  2NMU A;  1OFU A;  3I55 F;  5LXT B;  1KC8 H;  3KJJ A;  4X3L A;  3ERN A;  3CMA F;  1VQV A;  1X7P A;  3KJK A;  4TZZ A;  4DRX B;  1YQN A;  5AVM A;  4F6R A;  5HP8 A;  4O4H A;  1K9M H;  1IPA A;  3IMP A; 
#chains in the Genus database with same CATH homology
 3L7Q A;  2UYN B;  1XHO A;  2UYN A;  2UYP A;  3K12 A;  2B33 A;  3VCZ A;  3ZO8 A;  2CHS A;  1COM A;  3ZP7 A;  3M4S A;  2CHT A;  2IG8 A;  3LYB A;  3M1X A;  3ZP4 A;  1JD1 A;  1XRG A;  3D01 A;  3I7T A;  1X25 A;  3ZOP A;  3I3F A;  4ZK7 A;  1QAH A;  1QU9 A;  1PF5 A;  5HP7 A;  1J7H A;  2UYK A;  2CWJ A;  2UYJ A;  1DBF A;  2EWC A;  3KJJ A;  3LME A;  3R0P A;  2CSL A;  3QUW A;  1NQ3 A;  1ODE A;  1QD9 A;  3K0T A;  2CVL A;  2DYY A;  2OTM A;  1FNJ A;  3KJK A;  4NWO B;  3V4D A;  1ONI A;  1FNK A;  5HP8 A;  3MQW A;  1UI9 A;  3GTZ A;  2CW4 A;  1UFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...