2UYPA

Crystal structure of e. coli tdcf with bound propionate
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
126
Chain Sequence
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords PROTEIN TDCF
publication title The Crystal Structure of Escherichia Coli Tdcf, a Member of the Highly Conserved Yjgf/Yer057C/Uk114 Family.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 126
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2uypA00
1UI9A 5HP8A 2CWJA 2OTMA 3LMEA 1XHOA 2EWCA 2UYJA 5HP7A 1QD9A 2DYYA 1QU9A 2B33A 3I3FA 1FNJA 3K0TA 3KJJA 1COMA 3VCZA 1QAHA 3K12A 3QUWA 3ZOPA 2CVLA 2UYKA 2IG8A 1X25A 3ZP4A 3V4DA 3L7QA 3LYBA 3MQWA 1XRGA 2UYNB 2CHSA 4NWOB 3M1XA 3ZO8A 1J7HA 3I7TA 1JD1A 3D01A 3KJKA 2CHTA 4ZK7A 1UFYA 2UYNA 3R0PA 3M4SA 1DBFA 1NQ3A 3ZP7A 1ONIA 1FNKA 2UYPA 1ODEA 2CSLA 2CW4A 1PF5A 3GTZA
chains in the Genus database with same CATH superfamily
3J81M 1YIJF 2ZOVA 4IHJA 1VK3A 3JARA 5EIBC 4BT4A 2GLZA 1FNJA 3G71F 5LOVA 3KJJA 3CC4F 1GZ0A 5CB4A 5MN6A 3ZP4A 3L7QA 4I4TA 3MQWA 4BVRA 5KX5A 1XRGA 2ZVYA 3JALA 2CHTA 4O4HB 3R0PA 5GAPK 5HY4A 3LWRC 4G4YA 2UYJA 5EO3A 4O2BA 5B8FA 4I50A 5LXTB 2ZAUA 5HWEA 1GO0A 2CWJA 1NJIH 2AIZP 4EI9A 5HP7A 3C8LA 1W5FA 1Z5VA 4O2AB 1W2BF 2IG8A 4ZHQB 2I6RA 1VH8A 3E22B 3CPWF 3ON1A 1FFXA 4ERHA 3HKBB 3OW2F 2VXYA 5GIPC 1YJ9F 2RHOA 1W3EX 3VOBA 4B46A 1KD1H 1JFFB 1VQ8F 2K1SA 3WXMB 4KWEA 4O4LB 2LBXA 5J2UA 3M84A 1YHQF 1VQ9F 1H7MA 5JCOA 4C8GA 5G4UC 3I55F 2BTQB 1SA0B 3EORA 4X1YA 2OHWA 5FJ4C 4HNAB 3QUWA 2BTOA 1M90H 1VHAA 1X25A 1NMUB 3FBAA 3LWVC 5DCVA 2MQEA 5EIBD 3TD5A 3F0DA 1PXWA 5JVDB 5GONB 2VAWA 2YYEA 5C8YB 3JATA 4WBNB 4NQ3A 3RYFB 3WJQA 3ELCA 2IQQA 4I55A 2HRYA 3S0WA 4O4HA 4X20B 3V3TA 5LXTA 2DYYA 3VI6A 4X1KB 3RYCB 3IEWA 3D00A 3KHNA 2VAPA 4EI7A 5KX5B 2HX0A 1TUBB 1Q86H 1VQ4F 3SIUA 2AMTA 1RLGA 3NK6A 5EB0A 2PMPA 1W5AA 4O2AA 3AGKA 4ZHQA 3JCMM 1CLIA 4ZK7A 3FPIA 4BT3A 4LCKA 1NQ3A 4XCQA 1W40A 3HKBA 1IV3A 1N8RH 5KMGB 1CN7A 3JVHA 2CZWA 3OBYA 5ITZB 5LA6A 1JFFA 4O4LA 4ZHYB 3N4ZA 3KE1A 3K0TA 4B5CA 3CCSF 3QTYA 3VTIC 2H6LA 3C9UA 3RA6A 2Z1EA 1Q82H 4X1IB 3NMUC 1SA0A 3J80M 5IJ0B 3ZO8A 3N2GB 5HY0A 4HNAA 3UT5B 3GHZA 1JD1A 3OBWA 5CA0B 4O4IB 2FGYA 1FNKA 5GONA 3GTZA 5C8YA 2Z1UA 4WBNA 3JAKB 2OZBA 3S0HA 3RYFA 4YJ2A 1VQOF 4X1YB 2EWCA 3S02A 1QD9A 4M8IA 1JN1A 3VCZA 5MN4A 5MN5A 3I56F 4X20A 3CCMF 4X1KA 3IKFA 3JATB 3OONA 3RYCA 3CMAF 2ALEA 5BMVB 5FLXM 1TUBA 4I55B 4TZZA 1FSZA 2HP0B 2F9ZC 3M4SA 1RQ2A 2KG4A 2UYPA 2CW4A 3WJRA 2ZVZA 4G4XA 2LCAA 2JNBA 1W5EA 1KNJA 4EB6A 3CCJF 4E6EA 1VQLF 2GVIA 4C8IA 3PLAC 3HAXD 3VYUC 5KMGA 2OTJF 1YJWF 4BY9D 5ITZA 1JJ2F 5G4VC 3LWOC 1JY8A 1ZWZA 3CG6A 3ESJA 3BYQA 3TD3A 3CXCF 1YI2F 2BO1A 2Z01A 3JASA 2HS0A 3CYQA 4BT6A 5JH7B 3CCUF 1VQ6F 3S03A 3KJKA 4X1IA 2RHHA 3ZP7A 5IJ0A 1ONIA 3N2GA 5LA6B 1ODEA 2BTUA 3UT5A 3CCEF 1X52A 5CA0A 1DT9A 1U43A 4O4IA 5EYPB 3TD4A 4DRXB 3VMFB 4TV8B 3FFMA 2OTLF 1W42A 3MDOA 3I3FA 5EB1B 5AVMA 3WPWA 3JAKA 3HKCA 4BT7A 4BT2A 2KTUA 1KNKA 4LNUA 3CMEF 5A2QM 4B45A 3I7TA 3CD6F 3C9SA 1W41A 3U0OA 3WJPA 3C9RA 1DBFA 2LBTA 2UZHA 4YJ2B 5BMVA 5HP8A 4C8EA 1UI9A 2HP0A 2AIFA 1YITF 3IEQA 3FD5A 3CCRF 1VQNF 1K73H 4G4ZA 3CCVF 1OFUA 2VGNA 2UYKA 4NUTA 2WALA 3KIZA 3O85A 3F0GA 1J7HA 1T0KB 1W55A 3HWUA 1H48A 3VO8A 1E7KA 2Q1YA 1UFYA 4EI8A 4X3MA 4EB6B 2HRUA 2CVLA 5JH7A 3CC2F 5LP6C 3SIVA 1VQPF 2PHNA 3VOAA 1XHOA 1VQMF 2DT4A 3V7QA 3S06A 1RQ7A 1VQVA 3JAWB 4G4WA 2LBWA 5EYPA 4DRXA 5JQGB 4TV8A 4F6RB 3RYIA 5LYJA 3C9TA 3JASB 4FFBB 1X7OA 1M1KH 4C4WC 2HQSC 5GINC 3MCQA 4ZHWA 3CC7F 4TV9B 1K9MH 2KGWA 5IT9M 5GANK 4C81A 3HJWC 2L26A 1IPAA 1U3PA 2V9YA 3F0EA 5EWRA 2ZODA 4B62A 2YXZA 2H8EA 2OTMA 1IV1A 2ZF8A 1VQ5F 3HKCB 5J2TB 2GZLA 3P4EA 4LNUB 4G88A 2QI2A 3G6EF 3CCQF 4ZHVA 2NMUA 1U3LA 3HTNA 3E20B 4ZOLA 4NWOB 5CA1B 3PAFA 4U3JB 4PWTA 1RLUA 2G9IA 1KQSF 1QVGF 1QVFF 2UYNA 2VAMA 3WGKA 5HY1A 1IV2A 3F0FA 4IIJB 5FNVA 3QHDA 3HKEA 2P6YA 3HKDB 3NVKE 4U39A 3DC2A 3CPQA 2HP3A 1SZQA 1VQ7F 1YGYA 1GO1A 3RA5A 3JAWA 5JQGA 4O4JB 1GX1A 1S72F 4F6RA 4ZI7B 3DDNA 4BVSA 1Q81H 3J7AR 4FFBA 3D01A 4G4VA 3CB2A 2IAFA 1XBIA 4BVTA 4TV9A 3K14A 4R40B 3N2KB 1TVKB 3P0ZA 3RYIB 2RHJA 5LYJB 4BW0B 4YJ3A 5IJ9B 3IR9A 2RHLA 3VYSC 5JCOC 5J2TA 3D54A 3RE3A 1VQKF 1XV2A 3RYHB 5IYZB 5LP6B 2W8BC 3T80A 2R751 2Z1FA 3M1XA 3WGLA 3B6NA 1Q7YH 2QTPA 3MBMA 2R6R1 5EZYA 5CA1A 1SDSA 1PF5A 4U3JA 2QA4F 1YJNF 1Q8RA 2KTVA 3VYTC 3LMEA 3F6MA 4TUYB 4IIJA 4ZOLB 2HS4A 3K12A 3JAMM 3ERNA 3E1YA 2N48A 3HKDA 3K2XA 3WGNA 1X7PA 2UYNB 2CHSA 3LFOA 1RA4A 4X3LA 5GIOC 4O4JA 4IHJB 4ZI7A 3MCAB 3JARB 5FNVB 3NVIB 1R1MA 3HKEB 1OAPA 3WGJA 5LOVB 3CYPB 5CB4B 1CK2A 1IV4A 3NK7A 3FD6A 3LDTA 2Q1XA 3G4SF 5EAZA 1K8AH 1W59A 2HS3A 3IKEA 4I4TB 5HXZA 1COMA 3N2KA 1H47A 4RHAA 4BVQA 1TVKA 3JALB 2I6DA 5IJ9A 3V4DA 3Q8HA 2QEXF 3LYBA 1YQNA 3CCLF 1Z5WA 4O2BB 4I50B 3RYHA 5IYZA 5LP6A 3E22A 3GYQA 3LWPC 5HXUA 1T0AA 1W5BA 2CSLA 2H8CA 4YJ3B 2HVYD 2RB9A 3S0YA 1W581 3WPXA 1U40A 2VGMA 1QU9A 2B33A 4BT5A 4C82A 3N4YA 5HY2A 1FFXB 1QAHA 3P10A 3ZOPA 2Z1TA 3V7EA 1W57A 4RQOA 4TUYA 3IMPA 3LWQC 5EZYB 5J2UB 5JVDA 3WGMA 2FC3A 3VIUA 1KC8H 4DXDA
chains in the Genus database with same CATH topology
1UI9A 5HP8A 2CWJA 2OTMA 3LMEA 1XHOA 2EWCA 2UYJA 5HP7A 1QD9A 2DYYA 1QU9A 2B33A 3I3FA 1FNJA 3K0TA 3KJJA 1COMA 3VCZA 1QAHA 3K12A 3QUWA 3ZOPA 2CVLA 2UYKA 2IG8A 1X25A 3ZP4A 3V4DA 3L7QA 3LYBA 3MQWA 1XRGA 2UYNB 2CHSA 4NWOB 3M1XA 3ZO8A 1J7HA 3I7TA 1JD1A 3D01A 3KJKA 2CHTA 4ZK7A 1UFYA 2UYNA 3R0PA 3M4SA 1DBFA 1NQ3A 3ZP7A 1ONIA 1FNKA 2UYPA 1ODEA 2CSLA 2CW4A 1PF5A 3GTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UI9 A;  5HP8 A;  2CWJ A;  2OTM A;  3LME A;  1XHO A;  2EWC A;  2UYJ A;  5HP7 A;  1QD9 A;  2DYY A;  1QU9 A;  2B33 A;  3I3F A;  1FNJ A;  3K0T A;  3KJJ A;  1COM A;  3VCZ A;  1QAH A;  3K12 A;  3QUW A;  3ZOP A;  2CVL A;  2UYK A;  2IG8 A;  1X25 A;  3ZP4 A;  3V4D A;  3L7Q A;  3LYB A;  3MQW A;  1XRG A;  2UYN B;  2CHS A;  4NWO B;  3M1X A;  3ZO8 A;  1J7H A;  3I7T A;  1JD1 A;  3D01 A;  3KJK A;  2CHT A;  4ZK7 A;  1UFY A;  2UYN A;  3R0P A;  3M4S A;  1DBF A;  1NQ3 A;  3ZP7 A;  1ONI A;  1FNK A;  2UYP A;  1ODE A;  2CSL A;  2CW4 A;  1PF5 A;  3GTZ A; 
#chains in the Genus database with same CATH topology
 3J81 M;  1YIJ F;  2ZOV A;  4IHJ A;  1VK3 A;  3JAR A;  5EIB C;  4BT4 A;  2GLZ A;  1FNJ A;  3G71 F;  5LOV A;  3KJJ A;  3CC4 F;  1GZ0 A;  5CB4 A;  5MN6 A;  3ZP4 A;  3L7Q A;  4I4T A;  3MQW A;  4BVR A;  5KX5 A;  1XRG A;  2ZVY A;  3JAL A;  2CHT A;  4O4H B;  3R0P A;  5GAP K;  5HY4 A;  3LWR C;  4G4Y A;  2UYJ A;  5EO3 A;  4O2B A;  5B8F A;  4I50 A;  5LXT B;  2ZAU A;  5HWE A;  1GO0 A;  2CWJ A;  1NJI H;  2AIZ P;  4EI9 A;  5HP7 A;  3C8L A;  1W5F A;  1Z5V A;  4O2A B;  1W2B F;  2IG8 A;  4ZHQ B;  2I6R A;  1VH8 A;  3E22 B;  3CPW F;  3ON1 A;  1FFX A;  4ERH A;  3HKB B;  3OW2 F;  2VXY A;  5GIP C;  1YJ9 F;  2RHO A;  1W3E X;  3VOB A;  4B46 A;  1KD1 H;  1JFF B;  1VQ8 F;  2K1S A;  3WXM B;  4KWE A;  4O4L B;  2LBX A;  5J2U A;  3M84 A;  1YHQ F;  1VQ9 F;  1H7M A;  5JCO A;  4C8G A;  5G4U C;  3I55 F;  2BTQ B;  1SA0 B;  3EOR A;  4X1Y A;  2OHW A;  5FJ4 C;  4HNA B;  3QUW A;  2BTO A;  1M90 H;  1VHA A;  1X25 A;  1NMU B;  3FBA A;  3LWV C;  5DCV A;  2MQE A;  5EIB D;  3TD5 A;  3F0D A;  1PXW A;  5JVD B;  5GON B;  2VAW A;  2YYE A;  5C8Y B;  3JAT A;  4WBN B;  4NQ3 A;  3RYF B;  3WJQ A;  3ELC A;  2IQQ A;  4I55 A;  2HRY A;  3S0W A;  4O4H A;  4X20 B;  3V3T A;  5LXT A;  2DYY A;  3VI6 A;  4X1K B;  3RYC B;  3IEW A;  3D00 A;  3KHN A;  2VAP A;  4EI7 A;  5KX5 B;  2HX0 A;  1TUB B;  1Q86 H;  1VQ4 F;  3SIU A;  2AMT A;  1RLG A;  3NK6 A;  5EB0 A;  2PMP A;  1W5A A;  4O2A A;  3AGK A;  4ZHQ A;  3JCM M;  1CLI A;  4ZK7 A;  3FPI A;  4BT3 A;  4LCK A;  1NQ3 A;  4XCQ A;  1W40 A;  3HKB A;  1IV3 A;  1N8R H;  5KMG B;  1CN7 A;  3JVH A;  2CZW A;  3OBY A;  5ITZ B;  5LA6 A;  1JFF A;  4O4L A;  4ZHY B;  3N4Z A;  3KE1 A;  3K0T A;  4B5C A;  3CCS F;  3QTY A;  3VTI C;  2H6L A;  3C9U A;  3RA6 A;  2Z1E A;  1Q82 H;  4X1I B;  3NMU C;  1SA0 A;  3J80 M;  5IJ0 B;  3ZO8 A;  3N2G B;  5HY0 A;  4HNA A;  3UT5 B;  3GHZ A;  1JD1 A;  3OBW A;  5CA0 B;  4O4I B;  2FGY A;  1FNK A;  5GON A;  3GTZ A;  5C8Y A;  2Z1U A;  4WBN A;  3JAK B;  2OZB A;  3S0H A;  3RYF A;  4YJ2 A;  1VQO F;  4X1Y B;  2EWC A;  3S02 A;  1QD9 A;  4M8I A;  1JN1 A;  3VCZ A;  5MN4 A;  5MN5 A;  3I56 F;  4X20 A;  3CCM F;  4X1K A;  3IKF A;  3JAT B;  3OON A;  3RYC A;  3CMA F;  2ALE A;  5BMV B;  5FLX M;  1TUB A;  4I55 B;  4TZZ A;  1FSZ A;  2HP0 B;  2F9Z C;  3M4S A;  1RQ2 A;  2KG4 A;  2UYP A;  2CW4 A;  3WJR A;  2ZVZ A;  4G4X A;  2LCA A;  2JNB A;  1W5E A;  1KNJ A;  4EB6 A;  3CCJ F;  4E6E A;  1VQL F;  2GVI A;  4C8I A;  3PLA C;  3HAX D;  3VYU C;  5KMG A;  2OTJ F;  1YJW F;  4BY9 D;  5ITZ A;  1JJ2 F;  5G4V C;  3LWO C;  1JY8 A;  1ZWZ A;  3CG6 A;  3ESJ A;  3BYQ A;  3TD3 A;  3CXC F;  1YI2 F;  2BO1 A;  2Z01 A;  3JAS A;  2HS0 A;  3CYQ A;  4BT6 A;  5JH7 B;  3CCU F;  1VQ6 F;  3S03 A;  3KJK A;  4X1I A;  2RHH A;  3ZP7 A;  5IJ0 A;  1ONI A;  3N2G A;  5LA6 B;  1ODE A;  2BTU A;  3UT5 A;  3CCE F;  1X52 A;  5CA0 A;  1DT9 A;  1U43 A;  4O4I A;  5EYP B;  3TD4 A;  4DRX B;  3VMF B;  4TV8 B;  3FFM A;  2OTL F;  1W42 A;  3MDO A;  3I3F A;  5EB1 B;  5AVM A;  3WPW A;  3JAK A;  3HKC A;  4BT7 A;  4BT2 A;  2KTU A;  1KNK A;  4LNU A;  3CME F;  5A2Q M;  4B45 A;  3I7T A;  3CD6 F;  3C9S A;  1W41 A;  3U0O A;  3WJP A;  3C9R A;  1DBF A;  2LBT A;  2UZH A;  4YJ2 B;  5BMV A;  5HP8 A;  4C8E A;  1UI9 A;  2HP0 A;  2AIF A;  1YIT F;  3IEQ A;  3FD5 A;  3CCR F;  1VQN F;  1K73 H;  4G4Z A;  3CCV F;  1OFU A;  2VGN A;  2UYK A;  4NUT A;  2WAL A;  3KIZ A;  3O85 A;  3F0G A;  1J7H A;  1T0K B;  1W55 A;  3HWU A;  1H48 A;  3VO8 A;  1E7K A;  2Q1Y A;  1UFY A;  4EI8 A;  4X3M A;  4EB6 B;  2HRU A;  2CVL A;  5JH7 A;  3CC2 F;  5LP6 C;  3SIV A;  1VQP F;  2PHN A;  3VOA A;  1XHO A;  1VQM F;  2DT4 A;  3V7Q A;  3S06 A;  1RQ7 A;  1VQV A;  3JAW B;  4G4W A;  2LBW A;  5EYP A;  4DRX A;  5JQG B;  4TV8 A;  4F6R B;  3RYI A;  5LYJ A;  3C9T A;  3JAS B;  4FFB B;  1X7O A;  1M1K H;  4C4W C;  2HQS C;  5GIN C;  3MCQ A;  4ZHW A;  3CC7 F;  4TV9 B;  1K9M H;  2KGW A;  5IT9 M;  5GAN K;  4C81 A;  3HJW C;  2L26 A;  1IPA A;  1U3P A;  2V9Y A;  3F0E A;  5EWR A;  2ZOD A;  4B62 A;  2YXZ A;  2H8E A;  2OTM A;  1IV1 A;  2ZF8 A;  1VQ5 F;  3HKC B;  5J2T B;  2GZL A;  3P4E A;  4LNU B;  4G88 A;  2QI2 A;  3G6E F;  3CCQ F;  4ZHV A;  2NMU A;  1U3L A;  3HTN A;  3E20 B;  4ZOL A;  4NWO B;  5CA1 B;  3PAF A;  4U3J B;  4PWT A;  1RLU A;  2G9I A;  1KQS F;  1QVG F;  1QVF F;  2UYN A;  2VAM A;  3WGK A;  5HY1 A;  1IV2 A;  3F0F A;  4IIJ B;  5FNV A;  3QHD A;  3HKE A;  2P6Y A;  3HKD B;  3NVK E;  4U39 A;  3DC2 A;  3CPQ A;  2HP3 A;  1SZQ A;  1VQ7 F;  1YGY A;  1GO1 A;  3RA5 A;  3JAW A;  5JQG A;  4O4J B;  1GX1 A;  1S72 F;  4F6R A;  4ZI7 B;  3DDN A;  4BVS A;  1Q81 H;  3J7A R;  4FFB A;  3D01 A;  4G4V A;  3CB2 A;  2IAF A;  1XBI A;  4BVT A;  4TV9 A;  3K14 A;  4R40 B;  3N2K B;  1TVK B;  3P0Z A;  3RYI B;  2RHJ A;  5LYJ B;  4BW0 B;  4YJ3 A;  5IJ9 B;  3IR9 A;  2RHL A;  3VYS C;  5JCO C;  5J2T A;  3D54 A;  3RE3 A;  1VQK F;  1XV2 A;  3RYH B;  5IYZ B;  5LP6 B;  2W8B C;  3T80 A;  2R75 1;  2Z1F A;  3M1X A;  3WGL A;  3B6N A;  1Q7Y H;  2QTP A;  3MBM A;  2R6R 1;  5EZY A;  5CA1 A;  1SDS A;  1PF5 A;  4U3J A;  2QA4 F;  1YJN F;  1Q8R A;  2KTV A;  3VYT C;  3LME A;  3F6M A;  4TUY B;  4IIJ A;  4ZOL B;  2HS4 A;  3K12 A;  3JAM M;  3ERN A;  3E1Y A;  2N48 A;  3HKD A;  3K2X A;  3WGN A;  1X7P A;  2UYN B;  2CHS A;  3LFO A;  1RA4 A;  4X3L A;  5GIO C;  4O4J A;  4IHJ B;  4ZI7 A;  3MCA B;  3JAR B;  5FNV B;  3NVI B;  1R1M A;  3HKE B;  1OAP A;  3WGJ A;  5LOV B;  3CYP B;  5CB4 B;  1CK2 A;  1IV4 A;  3NK7 A;  3FD6 A;  3LDT A;  2Q1X A;  3G4S F;  5EAZ A;  1K8A H;  1W59 A;  2HS3 A;  3IKE A;  4I4T B;  5HXZ A;  1COM A;  3N2K A;  1H47 A;  4RHA A;  4BVQ A;  1TVK A;  3JAL B;  2I6D A;  5IJ9 A;  3V4D A;  3Q8H A;  2QEX F;  3LYB A;  1YQN A;  3CCL F;  1Z5W A;  4O2B B;  4I50 B;  3RYH A;  5IYZ A;  5LP6 A;  3E22 A;  3GYQ A;  3LWP C;  5HXU A;  1T0A A;  1W5B A;  2CSL A;  2H8C A;  4YJ3 B;  2HVY D;  2RB9 A;  3S0Y A;  1W58 1;  3WPX A;  1U40 A;  2VGM A;  1QU9 A;  2B33 A;  4BT5 A;  4C82 A;  3N4Y A;  5HY2 A;  1FFX B;  1QAH A;  3P10 A;  3ZOP A;  2Z1T A;  3V7E A;  1W57 A;  4RQO A;  4TUY A;  3IMP A;  3LWQ C;  5EZY B;  5J2U B;  5JVD A;  3WGM A;  2FC3 A;  3VIU A;  1KC8 H;  4DXD A; 
#chains in the Genus database with same CATH homology
 1UI9 A;  5HP8 A;  2CWJ A;  2OTM A;  3LME A;  1XHO A;  2EWC A;  2UYJ A;  5HP7 A;  1QD9 A;  2DYY A;  1QU9 A;  2B33 A;  3I3F A;  1FNJ A;  3K0T A;  3KJJ A;  1COM A;  3VCZ A;  1QAH A;  3K12 A;  3QUW A;  3ZOP A;  2CVL A;  2UYK A;  2IG8 A;  1X25 A;  3ZP4 A;  3V4D A;  3L7Q A;  3LYB A;  3MQW A;  1XRG A;  2UYN B;  2CHS A;  4NWO B;  3M1X A;  3ZO8 A;  1J7H A;  3I7T A;  1JD1 A;  3D01 A;  3KJK A;  2CHT A;  4ZK7 A;  1UFY A;  2UYN A;  3R0P A;  3M4S A;  1DBF A;  1NQ3 A;  3ZP7 A;  1ONI A;  1FNK A;  2UYP A;  1ODE A;  2CSL A;  2CW4 A;  1PF5 A;  3GTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...