5GIOC

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gioC00
3JAMM 3CD6F 1S72F 5GAPK 3CCMF 3J80M 3LWOC 1YJ9F 1T0KB 2AIFA 2JNBA 3CPWF 1K9MH 2QI2A 3SIUA 1VQ9F 3JCMM 1Q81H 4NUTA 3RA5A 3VI6A 3CCVF 1QVFF 1XBIA 1QVGF 2BO1A 3CCUF 1PXWA 1NMUB 3E20B 3LWVC 3CCRF 4BY9D 2LBWA 1DT9A 3J81M 1NJIH 1W3EX 3CMAF 1KD1H 3NK6A 3ON1A 3N4ZA 3CCLF 3LWQC 1VQLF 3CC7F 1YI2F 3O85A 5EO3A 3LWRC 1YITF 3NVIB 1CK2A 2LBXA 5IT9M 3CC4F 3NVKE 2WALA 1W41A 5G4VC 1SDSA 1YJNF 1YJWF 5EWRA 1X7OA 2FC3A 5A2QM 3MCAB 2QA4F 2OTJF 3CMEF 5G4UC 5GIPC 3CCEF 2KG4A 3SIVA 3FFMA 3CCSF 1Q86H 3V7EA 3NK7A 4C4WC 2OHWA 3G6EF 3CC2F 1W2BF 5GANK 2QEXF 3CG6A 5FLXM 3OBWA 3CCJF 1K8AH 2OZBA 3RA6A 1X7PA 3LWPC 1YIJF 3GYQA 1M90H 3VMFB 1YHQF 3AGKA 3OW2F 1W40A 1RA4A 4BW0B 3HJWC 3G4SF 1CN7A 3WXMB 2OTLF 5FJ4C 1VQMF 2VGMA 3N4YA 1KC8H 1VQ7F 5GINC 1GO1A 3CPQA 1VQ8F 1IPAA 4TZZA 3HAXD 1VQKF 1VQNF 2VGNA 4X3MA 2I6DA 2KTVA 1E7KA 1VQOF 2CZWA 3E1YA 1W42A 3CCQF 1K73H 1JJ2F 2HVYD 5DCVA 1VQ6F 3OBYA 1N8RH 1ZWZA 1RLGA 1H7MA 1KQSF 1X52A 3G71F 1GZ0A 3V7QA 2KTUA 3PAFA 3I55F 1Q7YH 4X3LA 3IR9A 1VQ4F 1VQ5F 3PLAC 3J7AR 1M1KH 1VQPF 4LCKA 1GO0A 3NMUC 5GIOC 2ALEA 3LFOA 1Q82H 3CXCF 3I56F
chains in the Genus database with same CATH superfamily
5IJ0A 1COMA 5GAPK 1W5BA 5CA1B 3CCMF 2HX0A 3J80M 3HKBB 1K9MH 2R751 2CHTA 4NUTA 1DBFA 5LXTA 3RA5A 3VI6A 1KNKA 2VAPA 2PHNA 1Z5WA 1NMUB 1XRGA 5BMVB 2AIZP 3FD6A 3IEQA 3TD4A 4ERHA 1W57A 4X20A 4O2BA 4C81A 3F0GA 1X25A 1Z5VA 2Z1EA 3ON1A 4HNAB 5LYJA 4BVQA 3HTNA 3O85A 2FGYA 2UZHA 4X1KB 3LWRC 3NVIB 2R6R1 2K1SA 4BT5A 3VOBA 1FSZA 1Q8RA 3I56F 4WBNA 3B6NA 3SIVA 3QUWA 3FD5A 2LBTA 5JVDA 1Q86H 5GANK 1FFXB 5FLXM 3OBWA 3C9TA 4TUYA 1RQ7A 4O4IB 2VAMA 4O4JB 2HS3A 5JQGA 4RHAA 4X1YA 3D54A 3WGJA 3VMFB 3S06A 3RYFB 3OW2F 1U3PA 4I50A 3DDNA 1IV4A 3HJWC 3JASB 3C9SA 1VQMF 2VGMA 1KC8H 3K14A 3HKCA 5GINC 2Z1TA 1VQ8F 1FNJA 4DXDA 3IKFA 3T80A 3HAXD 2HRYA 5EIBC 2CWJA 4F6RB 5IYZB 2I6DA 1VQOF 3VYTC 5B8FA 3CCQF 1UFYA 5DCVA 3KE1A 5C8YA 1QU9A 3MDOA 1YQNA 4YJ2B 3OBYA 5HP7A 2IQQA 3D00A 1ZWZA 1TUBB 4TV8B 3VOAA 1KQSF 1JFFB 2UYNB 3U0OA 1GZ0A 1Q7YH 2G9IA 3I55F 4X3LA 1VQ5F 4C82A 3PLAC 1VQPF 1T0AA 3VO8A 4TV9B 5HXZA 4G4VA 1TVKB 3LFOA 3P10A 4LNUA 4ZOLA 2N48A 2GLZA 4C8EA 3LDTA 4BVRA 3KIZA 5FNVB 5KMGA 1YJ9F 3MQWA 3JAKB 3RYIB 4EI9A 4PWTA 1VQ9F 2IG8A 2ZVZA 3HKEB 5LXTB 3K2XA 1U3LA 1RQ2A 2RHHA 1SZQA 2DT4A 4EB6B 4YJ3A 3CCUF 4FFBA 5LOVA 3S0YA 2HRUA 2I6RA 3CCRF 4X1IB 2LBWA 3J81M 3F0FA 4ZHYB 5IJ9A 5LA6B 1SA0B 5HY0A 4KWEA 5EB1B 3NK6A 3VYSC 4ZI7A 3WJPA 3N2GA 1VQLF 5EO3A 2EWCA 2W8BC 4O4LA 3WGNA 2LBXA 4IIJB 5EZYA 3V3TA 5IT9M 3ERNA 1GX1A 3ZOPA 1YJWF 3JALB 2OTJF 3MCAB 2QA4F 3MCQA 3CMEF 5GIPC 3I3FA 2HP3A 3JATB 3P4EA 3NK7A 2CW4A 1H48A 1QD9A 5J2UA 1YGYA 3D01A 1OAPA 3CCJF 3RE3A 2GZLA 4O4HB 4RQOA 3JAWA 2Z01A 5GONA 5CB4B 5EYPB 3DC2A 4EI7A 1IV2A 1KNJA 4O2AB 4BW0B 5MN6A 3QHDA 3RYCB 3G4SF 5J2TB 5JH7B 4M8IA 4NWOB 3N2KB 3F0DA 1VQVA 3CPQA 3C9RA 3S0HA 4BT2A 3K0TA 2ZOVA 5AVMA 4ZHWA 4U3JB 4I55A 4IHJB 5KX5A 3VIUA 1VQNF 3E22A 3VYUC 1W59A 2KTVA 2YYEA 2CZWA 1W42A 5CA1A 3K12A 2YXZA 3HKBA 4C8IA 2HP0B 1VQ6F 2IAFA 5HP8A 1N8RH 2NMUA 5HY2A 3V7QA 4G4XA 5LP6B 3J7AR 2DYYA 2Z1UA 1M1KH 5BMVA 3ELCA 3VCZA 3NMUC 3WPWA 3GHZA 2UYPA 2ALEA 3WGLA 4G4WA 5HY1A 4LNUB 4HNAA 3C8LA 4R40B 4X1KA 2L26A 3CD6F 1S72F 3ZO8A 5KMGB 3LWOC 2AIFA 2JNBA 2CSLA 2OTMA 3CPWF 3VTIC 3HKDB 1W5AA 2BTQB 3JCMM 2RHJA 3CCVF 5ITZA 3WGMA 1QVFF 3GTZA 1VHAA 2HS0A 4ZHVA 1QVGF 2BO1A 3KJKA 4I4TB 3UT5B 5JCOA 3MBMA 3WPXA 1FFXA 2V9YA 2H6LA 1IV3A 3S03A 3CMAF 4O4JA 4DRXA 3FBAA 4G4YA 4U39A 4BT4A 1PF5A 3RYHA 3RYFA 3LWQC 2VAWA 3N2GB 1YI2F 5IJ0B 1YITF 4B5CA 2QTPA 3JASA 2HQSC 1XHOA 1W41A 5G4VC 1SDSA 1YJNF 5CA0A 1X7OA 2FC3A 3JARA 2ZF8A 1JD1A 4C4WC 2OHWA 3M1XA 1W2BF 1IV1A 4F6RA 2QEXF 5IYZA 1K8AH 4EI8A 2Q1YA 3OONA 4X20B 4O2BB 3RA6A 2Z1FA 1X7PA 1W5FA 3LWPC 3JAWB 3R0PA 1YIJF 4C8GA 3Q8HA 5MN5A 1W5EA 1YHQF 5LYJB 4YJ2A 3AGKA 2CHSA 2P6YA 1W40A 1RA4A 1CLIA 4NQ3A 5LP6C 1TUBA 1JY8A 4TV8A 1CN7A 5FJ4C 1JFFA 2UYNA 2F9ZC 2BTUA 2RB9A 1GO1A 3ZP4A 1IPAA 4WBNB 4TZZA 3WJRA 5JVDB 3CYQA 4TV9A 2VGNA 4X3MA 3S02A 1TVKA 4BVSA 1E7KA 2H8EA 4TUYB 3E1YA 1NQ3A 4ZK7A 1K73H 5JQGB 5FNVA 4X1YB 3JAKA 4BT6A 4ZHQA 3RYIA 1RLUA 4I50B 3HKEA 1RLGA 3S0WA 1XV2A 4EB6A 3I7TA 3PAFA 3TD5A 3HKCB 3IR9A 3ZP7A 1VQ4F 2GVIA 2KGWA 4X1IA 1J7HA 1W55A 1GO0A 2MQEA 3BYQA 5LA6A 3WGKA 1SA0A 3P0ZA 1Q82H 3CXCF 2RHLA 5EIBD 3JAMM 3C9UA 2Q1XA 2RHOA 1T0KB 4IIJA 5C8YB 2QI2A 3SIUA 3F0EA 1Q81H 3JALA 2VXYA 3M4SA 3JVHA 5ITZB 1XBIA 3JATA 2AMTA 4BVTA 1OFUA 4G88A 1PXWA 3E20B 3LWVC 4BY9D 1DT9A 1ONIA 1NJIH 3CYPB 1W3EX 1QAHA 1KD1H 4O4HA 4DRXB 3CB2A 5HY4A 3N4ZA 5CB4A 4ZOLB 3CCLF 5EYPA 3RYHB 3LYBA 3M84A 3CC7F 3HWUA 2ZVYA 3L7QA 4O2AA 1CK2A 3RYCA 1R1MA 5J2TA 3CC4F 3NVKE 1UI9A 2WALA 5JH7A 3N2KA 5EWRA 5CA0B 3ESJA 5A2QM 1VK3A 3KJJA 4BT7A 3JARB 3TD3A 5EB0A 5G4UC 3IMPA 3CCEF 2KG4A 2LCAA 4YJ3B 3FFMA 1VH8A 3KHNA 4U3JA 4E6EA 3CCSF 4IHJA 3V7EA 4FFBB 4XCQA 5LOVB 3G6EF 3CC2F 3LMEA 3CG6A 2OZBA 5IJ9B 4O4IA 1U40A 1JN1A 3F6MA 2HP0A 3GYQA 1M90H 4ZI7B 3WJQA 5EAZA 4O4LB 5MN4A 1U43A 5EZYB 3WXMB 2OTLF 3N4YA 3IEWA 2UYJA 1VQ7F 5LP6A 1VQKF 2UYKA 5J2UB 2H8CA 2HS4A 3V4DA 5GONB 3FPIA 1JJ2F 2HVYD 4ZHQB 1FNKA 5HXUA 3HKDA 1ODEA 5JCOC 2PMPA 1H7MA 2BTOA 2ZODA 1X52A 3QTYA 3G71F 4I4TA 2KTUA 3UT5A 1W581 4BT3A 2CVLA 5HWEA 4LCKA 3EORA 4B62A 4I55B 4B45A 2ZAUA 5KX5B 5GIOC 1H47A 3E22B 2B33A 4G4ZA 3IKEA 4B46A
chains in the Genus database with same CATH topology
3JAMM 3CD6F 1S72F 5GAPK 3CCMF 3J80M 3LWOC 1YJ9F 1T0KB 2AIFA 2JNBA 3CPWF 1K9MH 2QI2A 3SIUA 4EI9A 1VQ9F 3JCMM 1Q81H 4NUTA 3RA5A 3VI6A 3CCVF 1QVFF 1XBIA 1QVGF 2BO1A 4BVTA 3CCUF 1PXWA 1NMUB 3E20B 3LWVC 3CCRF 4BY9D 2LBWA 1DT9A 3J81M 1NJIH 1W3EX 5HY0A 3CMAF 1KD1H 5HY4A 3NK6A 3ON1A 3N4ZA 3CCLF 3LWQC 1VQLF 3CC7F 4BVQA 1YI2F 3O85A 5EO3A 2FGYA 3LWRC 1YITF 3NVIB 1CK2A 2LBXA 5IT9M 3V3TA 3CC4F 3NVKE 2WALA 1W41A 5G4VC 1SDSA 1YJNF 1YJWF 5EWRA 1X7OA 2FC3A 5A2QM 3MCAB 2QA4F 2OTJF 3CMEF 5G4UC 5GIPC 3CCEF 2KG4A 3SIVA 3FFMA 3CCSF 1Q86H 3V7EA 3NK7A 4XCQA 4C4WC 2OHWA 3G6EF 3CC2F 1W2BF 5GANK 2QEXF 3CG6A 5FLXM 3OBWA 4EI8A 3CCJF 1K8AH 2OZBA 3RA6A 1X7PA 3LWPC 1YIJF 3GYQA 1M90H 3VMFB 1YHQF 3AGKA 3OW2F 1W40A 1RA4A 4NQ3A 4BW0B 4EI7A 3HJWC 3G4SF 1CN7A 3WXMB 2OTLF 5FJ4C 1VQMF 2VGMA 3N4YA 1KC8H 1VQ7F 2F9ZC 5GINC 1GO1A 3CPQA 1VQ8F 1IPAA 4TZZA 3HAXD 1VQKF 1VQNF 2VGNA 4X3MA 2I6DA 2KTVA 4BVSA 1E7KA 1VQOF 2CZWA 3E1YA 1W42A 3CCQF 1K73H 1JJ2F 2HVYD 5DCVA 1VQ6F 5HXUA 3OBYA 3D00A 1N8RH 1ZWZA 1RLGA 1H7MA 5HY2A 1KQSF 1X52A 3G71F 1GZ0A 3V7QA 2KTUA 3PAFA 3I55F 1Q7YH 4X3LA 3IR9A 1VQ4F 1VQ5F 3PLAC 3J7AR 1M1KH 5HWEA 1VQPF 4LCKA 1GO0A 3NMUC 5GIOC 2ALEA 5HXZA 3LFOA 5HY1A 1Q82H 2GLZA 3CXCF 3I56F 4BVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM M;  3CD6 F;  1S72 F;  5GAP K;  3CCM F;  3J80 M;  3LWO C;  1YJ9 F;  1T0K B;  2AIF A;  2JNB A;  3CPW F;  1K9M H;  2QI2 A;  3SIU A;  1VQ9 F;  3JCM M;  1Q81 H;  4NUT A;  3RA5 A;  3VI6 A;  3CCV F;  1QVF F;  1XBI A;  1QVG F;  2BO1 A;  3CCU F;  1PXW A;  1NMU B;  3E20 B;  3LWV C;  3CCR F;  4BY9 D;  2LBW A;  1DT9 A;  3J81 M;  1NJI H;  1W3E X;  3CMA F;  1KD1 H;  3NK6 A;  3ON1 A;  3N4Z A;  3CCL F;  3LWQ C;  1VQL F;  3CC7 F;  1YI2 F;  3O85 A;  5EO3 A;  3LWR C;  1YIT F;  3NVI B;  1CK2 A;  2LBX A;  5IT9 M;  3CC4 F;  3NVK E;  2WAL A;  1W41 A;  5G4V C;  1SDS A;  1YJN F;  1YJW F;  5EWR A;  1X7O A;  2FC3 A;  5A2Q M;  3MCA B;  2QA4 F;  2OTJ F;  3CME F;  5G4U C;  5GIP C;  3CCE F;  2KG4 A;  3SIV A;  3FFM A;  3CCS F;  1Q86 H;  3V7E A;  3NK7 A;  4C4W C;  2OHW A;  3G6E F;  3CC2 F;  1W2B F;  5GAN K;  2QEX F;  3CG6 A;  5FLX M;  3OBW A;  3CCJ F;  1K8A H;  2OZB A;  3RA6 A;  1X7P A;  3LWP C;  1YIJ F;  3GYQ A;  1M90 H;  3VMF B;  1YHQ F;  3AGK A;  3OW2 F;  1W40 A;  1RA4 A;  4BW0 B;  3HJW C;  3G4S F;  1CN7 A;  3WXM B;  2OTL F;  5FJ4 C;  1VQM F;  2VGM A;  3N4Y A;  1KC8 H;  1VQ7 F;  5GIN C;  1GO1 A;  3CPQ A;  1VQ8 F;  1IPA A;  4TZZ A;  3HAX D;  1VQK F;  1VQN F;  2VGN A;  4X3M A;  2I6D A;  2KTV A;  1E7K A;  1VQO F;  2CZW A;  3E1Y A;  1W42 A;  3CCQ F;  1K73 H;  1JJ2 F;  2HVY D;  5DCV A;  1VQ6 F;  3OBY A;  1N8R H;  1ZWZ A;  1RLG A;  1H7M A;  1KQS F;  1X52 A;  3G71 F;  1GZ0 A;  3V7Q A;  2KTU A;  3PAF A;  3I55 F;  1Q7Y H;  4X3L A;  3IR9 A;  1VQ4 F;  1VQ5 F;  3PLA C;  3J7A R;  1M1K H;  1VQP F;  4LCK A;  1GO0 A;  3NMU C;  5GIO C;  2ALE A;  3LFO A;  1Q82 H;  3CXC F;  3I56 F; 
#chains in the Genus database with same CATH topology
 5IJ0 A;  1COM A;  5GAP K;  1W5B A;  5CA1 B;  3CCM F;  2HX0 A;  3J80 M;  3HKB B;  1K9M H;  2R75 1;  2CHT A;  4NUT A;  1DBF A;  5LXT A;  3RA5 A;  3VI6 A;  1KNK A;  2VAP A;  2PHN A;  1Z5W A;  1NMU B;  1XRG A;  5BMV B;  2AIZ P;  3FD6 A;  3IEQ A;  3TD4 A;  4ERH A;  1W57 A;  4X20 A;  4O2B A;  4C81 A;  3F0G A;  1X25 A;  1Z5V A;  2Z1E A;  3ON1 A;  4HNA B;  5LYJ A;  4BVQ A;  3HTN A;  3O85 A;  2FGY A;  2UZH A;  4X1K B;  3LWR C;  3NVI B;  2R6R 1;  2K1S A;  4BT5 A;  3VOB A;  1FSZ A;  1Q8R A;  3I56 F;  4WBN A;  3B6N A;  3SIV A;  3QUW A;  3FD5 A;  2LBT A;  5JVD A;  1Q86 H;  5GAN K;  1FFX B;  5FLX M;  3OBW A;  3C9T A;  4TUY A;  1RQ7 A;  4O4I B;  2VAM A;  4O4J B;  2HS3 A;  5JQG A;  4RHA A;  4X1Y A;  3D54 A;  3WGJ A;  3VMF B;  3S06 A;  3RYF B;  3OW2 F;  1U3P A;  4I50 A;  3DDN A;  1IV4 A;  3HJW C;  3JAS B;  3C9S A;  1VQM F;  2VGM A;  1KC8 H;  3K14 A;  3HKC A;  5GIN C;  2Z1T A;  1VQ8 F;  1FNJ A;  4DXD A;  3IKF A;  3T80 A;  3HAX D;  2HRY A;  5EIB C;  2CWJ A;  4F6R B;  5IYZ B;  2I6D A;  1VQO F;  3VYT C;  5B8F A;  3CCQ F;  1UFY A;  5DCV A;  3KE1 A;  5C8Y A;  1QU9 A;  3MDO A;  1YQN A;  4YJ2 B;  3OBY A;  5HP7 A;  2IQQ A;  3D00 A;  1ZWZ A;  1TUB B;  4TV8 B;  3VOA A;  1KQS F;  1JFF B;  2UYN B;  3U0O A;  1GZ0 A;  1Q7Y H;  2G9I A;  3I55 F;  4X3L A;  1VQ5 F;  4C82 A;  3PLA C;  1VQP F;  1T0A A;  3VO8 A;  4TV9 B;  5HXZ A;  4G4V A;  1TVK B;  3LFO A;  3P10 A;  4LNU A;  4ZOL A;  2N48 A;  2GLZ A;  4C8E A;  3LDT A;  4BVR A;  3KIZ A;  5FNV B;  5KMG A;  1YJ9 F;  3MQW A;  3JAK B;  3RYI B;  4EI9 A;  4PWT A;  1VQ9 F;  2IG8 A;  2ZVZ A;  3HKE B;  5LXT B;  3K2X A;  1U3L A;  1RQ2 A;  2RHH A;  1SZQ A;  2DT4 A;  4EB6 B;  4YJ3 A;  3CCU F;  4FFB A;  5LOV A;  3S0Y A;  2HRU A;  2I6R A;  3CCR F;  4X1I B;  2LBW A;  3J81 M;  3F0F A;  4ZHY B;  5IJ9 A;  5LA6 B;  1SA0 B;  5HY0 A;  4KWE A;  5EB1 B;  3NK6 A;  3VYS C;  4ZI7 A;  3WJP A;  3N2G A;  1VQL F;  5EO3 A;  2EWC A;  2W8B C;  4O4L A;  3WGN A;  2LBX A;  4IIJ B;  5EZY A;  3V3T A;  5IT9 M;  3ERN A;  1GX1 A;  3ZOP A;  1YJW F;  3JAL B;  2OTJ F;  3MCA B;  2QA4 F;  3MCQ A;  3CME F;  5GIP C;  3I3F A;  2HP3 A;  3JAT B;  3P4E A;  3NK7 A;  2CW4 A;  1H48 A;  1QD9 A;  5J2U A;  1YGY A;  3D01 A;  1OAP A;  3CCJ F;  3RE3 A;  2GZL A;  4O4H B;  4RQO A;  3JAW A;  2Z01 A;  5GON A;  5CB4 B;  5EYP B;  3DC2 A;  4EI7 A;  1IV2 A;  1KNJ A;  4O2A B;  4BW0 B;  5MN6 A;  3QHD A;  3RYC B;  3G4S F;  5J2T B;  5JH7 B;  4M8I A;  4NWO B;  3N2K B;  3F0D A;  1VQV A;  3CPQ A;  3C9R A;  3S0H A;  4BT2 A;  3K0T A;  2ZOV A;  5AVM A;  4ZHW A;  4U3J B;  4I55 A;  4IHJ B;  5KX5 A;  3VIU A;  1VQN F;  3E22 A;  3VYU C;  1W59 A;  2KTV A;  2YYE A;  2CZW A;  1W42 A;  5CA1 A;  3K12 A;  2YXZ A;  3HKB A;  4C8I A;  2HP0 B;  1VQ6 F;  2IAF A;  5HP8 A;  1N8R H;  2NMU A;  5HY2 A;  3V7Q A;  4G4X A;  5LP6 B;  3J7A R;  2DYY A;  2Z1U A;  1M1K H;  5BMV A;  3ELC A;  3VCZ A;  3NMU C;  3WPW A;  3GHZ A;  2UYP A;  2ALE A;  3WGL A;  4G4W A;  5HY1 A;  4LNU B;  4HNA A;  3C8L A;  4R40 B;  4X1K A;  2L26 A;  3CD6 F;  1S72 F;  3ZO8 A;  5KMG B;  3LWO C;  2AIF A;  2JNB A;  2CSL A;  2OTM A;  3CPW F;  3VTI C;  3HKD B;  1W5A A;  2BTQ B;  3JCM M;  2RHJ A;  3CCV F;  5ITZ A;  3WGM A;  1QVF F;  3GTZ A;  1VHA A;  2HS0 A;  4ZHV A;  1QVG F;  2BO1 A;  3KJK A;  4I4T B;  3UT5 B;  5JCO A;  3MBM A;  3WPX A;  1FFX A;  2V9Y A;  2H6L A;  1IV3 A;  3S03 A;  3CMA F;  4O4J A;  4DRX A;  3FBA A;  4G4Y A;  4U39 A;  4BT4 A;  1PF5 A;  3RYH A;  3RYF A;  3LWQ C;  2VAW A;  3N2G B;  1YI2 F;  5IJ0 B;  1YIT F;  4B5C A;  2QTP A;  3JAS A;  2HQS C;  1XHO A;  1W41 A;  5G4V C;  1SDS A;  1YJN F;  5CA0 A;  1X7O A;  2FC3 A;  3JAR A;  2ZF8 A;  1JD1 A;  4C4W C;  2OHW A;  3M1X A;  1W2B F;  1IV1 A;  4F6R A;  2QEX F;  5IYZ A;  1K8A H;  4EI8 A;  2Q1Y A;  3OON A;  4X20 B;  4O2B B;  3RA6 A;  2Z1F A;  1X7P A;  1W5F A;  3LWP C;  3JAW B;  3R0P A;  1YIJ F;  4C8G A;  3Q8H A;  5MN5 A;  1W5E A;  1YHQ F;  5LYJ B;  4YJ2 A;  3AGK A;  2CHS A;  2P6Y A;  1W40 A;  1RA4 A;  1CLI A;  4NQ3 A;  5LP6 C;  1TUB A;  1JY8 A;  4TV8 A;  1CN7 A;  5FJ4 C;  1JFF A;  2UYN A;  2F9Z C;  2BTU A;  2RB9 A;  1GO1 A;  3ZP4 A;  1IPA A;  4WBN B;  4TZZ A;  3WJR A;  5JVD B;  3CYQ A;  4TV9 A;  2VGN A;  4X3M A;  3S02 A;  1TVK A;  4BVS A;  1E7K A;  2H8E A;  4TUY B;  3E1Y A;  1NQ3 A;  4ZK7 A;  1K73 H;  5JQG B;  5FNV A;  4X1Y B;  3JAK A;  4BT6 A;  4ZHQ A;  3RYI A;  1RLU A;  4I50 B;  3HKE A;  1RLG A;  3S0W A;  1XV2 A;  4EB6 A;  3I7T A;  3PAF A;  3TD5 A;  3HKC B;  3IR9 A;  3ZP7 A;  1VQ4 F;  2GVI A;  2KGW A;  4X1I A;  1J7H A;  1W55 A;  1GO0 A;  2MQE A;  3BYQ A;  5LA6 A;  3WGK A;  1SA0 A;  3P0Z A;  1Q82 H;  3CXC F;  2RHL A;  5EIB D;  3JAM M;  3C9U A;  2Q1X A;  2RHO A;  1T0K B;  4IIJ A;  5C8Y B;  2QI2 A;  3SIU A;  3F0E A;  1Q81 H;  3JAL A;  2VXY A;  3M4S A;  3JVH A;  5ITZ B;  1XBI A;  3JAT A;  2AMT A;  4BVT A;  1OFU A;  4G88 A;  1PXW A;  3E20 B;  3LWV C;  4BY9 D;  1DT9 A;  1ONI A;  1NJI H;  3CYP B;  1W3E X;  1QAH A;  1KD1 H;  4O4H A;  4DRX B;  3CB2 A;  5HY4 A;  3N4Z A;  5CB4 A;  4ZOL B;  3CCL F;  5EYP A;  3RYH B;  3LYB A;  3M84 A;  3CC7 F;  3HWU A;  2ZVY A;  3L7Q A;  4O2A A;  1CK2 A;  3RYC A;  1R1M A;  5J2T A;  3CC4 F;  3NVK E;  1UI9 A;  2WAL A;  5JH7 A;  3N2K A;  5EWR A;  5CA0 B;  3ESJ A;  5A2Q M;  1VK3 A;  3KJJ A;  4BT7 A;  3JAR B;  3TD3 A;  5EB0 A;  5G4U C;  3IMP A;  3CCE F;  2KG4 A;  2LCA A;  4YJ3 B;  3FFM A;  1VH8 A;  3KHN A;  4U3J A;  4E6E A;  3CCS F;  4IHJ A;  3V7E A;  4FFB B;  4XCQ A;  5LOV B;  3G6E F;  3CC2 F;  3LME A;  3CG6 A;  2OZB A;  5IJ9 B;  4O4I A;  1U40 A;  1JN1 A;  3F6M A;  2HP0 A;  3GYQ A;  1M90 H;  4ZI7 B;  3WJQ A;  5EAZ A;  4O4L B;  5MN4 A;  1U43 A;  5EZY B;  3WXM B;  2OTL F;  3N4Y A;  3IEW A;  2UYJ A;  1VQ7 F;  5LP6 A;  1VQK F;  2UYK A;  5J2U B;  2H8C A;  2HS4 A;  3V4D A;  5GON B;  3FPI A;  1JJ2 F;  2HVY D;  4ZHQ B;  1FNK A;  5HXU A;  3HKD A;  1ODE A;  5JCO C;  2PMP A;  1H7M A;  2BTO A;  2ZOD A;  1X52 A;  3QTY A;  3G71 F;  4I4T A;  2KTU A;  3UT5 A;  1W58 1;  4BT3 A;  2CVL A;  5HWE A;  4LCK A;  3EOR A;  4B62 A;  4I55 B;  4B45 A;  2ZAU A;  5KX5 B;  5GIO C;  1H47 A;  3E22 B;  2B33 A;  4G4Z A;  3IKE A;  4B46 A; 
#chains in the Genus database with same CATH homology
 3JAM M;  3CD6 F;  1S72 F;  5GAP K;  3CCM F;  3J80 M;  3LWO C;  1YJ9 F;  1T0K B;  2AIF A;  2JNB A;  3CPW F;  1K9M H;  2QI2 A;  3SIU A;  4EI9 A;  1VQ9 F;  3JCM M;  1Q81 H;  4NUT A;  3RA5 A;  3VI6 A;  3CCV F;  1QVF F;  1XBI A;  1QVG F;  2BO1 A;  4BVT A;  3CCU F;  1PXW A;  1NMU B;  3E20 B;  3LWV C;  3CCR F;  4BY9 D;  2LBW A;  1DT9 A;  3J81 M;  1NJI H;  1W3E X;  5HY0 A;  3CMA F;  1KD1 H;  5HY4 A;  3NK6 A;  3ON1 A;  3N4Z A;  3CCL F;  3LWQ C;  1VQL F;  3CC7 F;  4BVQ A;  1YI2 F;  3O85 A;  5EO3 A;  2FGY A;  3LWR C;  1YIT F;  3NVI B;  1CK2 A;  2LBX A;  5IT9 M;  3V3T A;  3CC4 F;  3NVK E;  2WAL A;  1W41 A;  5G4V C;  1SDS A;  1YJN F;  1YJW F;  5EWR A;  1X7O A;  2FC3 A;  5A2Q M;  3MCA B;  2QA4 F;  2OTJ F;  3CME F;  5G4U C;  5GIP C;  3CCE F;  2KG4 A;  3SIV A;  3FFM A;  3CCS F;  1Q86 H;  3V7E A;  3NK7 A;  4XCQ A;  4C4W C;  2OHW A;  3G6E F;  3CC2 F;  1W2B F;  5GAN K;  2QEX F;  3CG6 A;  5FLX M;  3OBW A;  4EI8 A;  3CCJ F;  1K8A H;  2OZB A;  3RA6 A;  1X7P A;  3LWP C;  1YIJ F;  3GYQ A;  1M90 H;  3VMF B;  1YHQ F;  3AGK A;  3OW2 F;  1W40 A;  1RA4 A;  4NQ3 A;  4BW0 B;  4EI7 A;  3HJW C;  3G4S F;  1CN7 A;  3WXM B;  2OTL F;  5FJ4 C;  1VQM F;  2VGM A;  3N4Y A;  1KC8 H;  1VQ7 F;  2F9Z C;  5GIN C;  1GO1 A;  3CPQ A;  1VQ8 F;  1IPA A;  4TZZ A;  3HAX D;  1VQK F;  1VQN F;  2VGN A;  4X3M A;  2I6D A;  2KTV A;  4BVS A;  1E7K A;  1VQO F;  2CZW A;  3E1Y A;  1W42 A;  3CCQ F;  1K73 H;  1JJ2 F;  2HVY D;  5DCV A;  1VQ6 F;  5HXU A;  3OBY A;  3D00 A;  1N8R H;  1ZWZ A;  1RLG A;  1H7M A;  5HY2 A;  1KQS F;  1X52 A;  3G71 F;  1GZ0 A;  3V7Q A;  2KTU A;  3PAF A;  3I55 F;  1Q7Y H;  4X3L A;  3IR9 A;  1VQ4 F;  1VQ5 F;  3PLA C;  3J7A R;  1M1K H;  5HWE A;  1VQP F;  4LCK A;  1GO0 A;  3NMU C;  5GIO C;  2ALE A;  5HXZ A;  3LFO A;  5HY1 A;  1Q82 H;  2GLZ A;  3CXC F;  3I56 F;  4BVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...