5GIOC

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gioC00
1GO0A 3VI6A 3CMEF 3E1YA 5GANK 1YITF 3CC4F 3E20B 2OHWA 3PAFA 3LWVC 1VQ8F 3N4YA 3MCAB 3V7QA 1W2BF 3CCEF 1NMUB 2I6DA 3OW2F 1YJNF 1E7KA 3CCJF 2KTUA 5GINC 1VQLF 3NVIB 1VQ9F 1RLGA 1VQKF 1K8AH 5GIPC 3CC2F 4BY9D 3G71F 1IPAA 2BO1A 2VGMA 1KC8H 2KTVA 3LWOC 3LWQC 1N8RH 1YJWF 1M90H 1VQOF 5FJ4C 1W42A 3ON1A 3JAMM 1QVGF 2OTJF 3CCRF 3CPQA 3G4SF 3CCSF 3CPWF 1VQPF 5GAPK 3NK7A 1JJ2F 3I55F 4LCKA 3GYQA 3N4ZA 3CCQF 3CMAF 2CZWA 1PXWA 1X52A 3I56F 1Q82H 3NMUC 3V7EA 3HAXD 3LWRC 1CN7A 5FLXM 3AGKA 1T0KB 1X7PA 5EO3A 1ZWZA 1NJIH 1Q7YH 3CCMF 5DCVA 5IT9M 2WALA 3PLAC 1H7MA 1RA4A 2VGNA 1QVFF 1VQ5F 2LBWA 3WXMB 1Q86H 3SIVA 1XBIA 1YI2F 3CCLF 5G4VC 1GZ0A 3CCVF 4X3MA 3IR9A 1YIJF 1K73H 3RA6A 3J81M 2QI2A 4NUTA 1CK2A 1S72F 3NK6A 1SDSA 1DT9A 5GIOC 1KQSF 3CCUF 2LBXA 5G4UC 2OTLF 3J80M 3CG6A 2HVYD 2FC3A 1W41A 3J7AR 4X3LA 3OBYA 1Q81H 3VMFB 1YJ9F 1M1KH 3HJWC 3LWPC 4C4WC 2ALEA 3LFOA 4BW0B 3CD6F 3O85A 1GO1A 2QA4F 2AIFA 2KG4A 1X7OA 3CC7F 3FFMA 3OBWA 3RA5A 1VQ6F 1VQNF 1W40A 1K9MH 3SIUA 3CXCF 2QEXF 3JCMM 5A2QM 4TZZA 1KD1H 1VQ7F 2JNBA 1VQMF 1YHQF 1VQ4F 3G6EF 5EWRA 3NVKE 2OZBA 1W3EX
chains in the Genus database with same CATH superfamily
3FD5A 5B8FA 1YITF 5JQGB 3LWVC 3N4YA 3MCAB 3V7QA 3U0OA 3DDNA 1R1MA 3HKCB 1U3LA 1NMUB 5JH7A 3IMPA 4B46A 2B33A 5LXTB 2I6DA 4I4TA 3RYIA 1YJNF 3WGJA 2KTUA 1IV2A 1VQLF 1VQ9F 1KNJA 4TUYB 2LBTA 3WPWA 5J2TA 3G71F 2BO1A 1KC8H 2KTVA 4I55B 1M90H 2VAPA 2FGYA 1FNKA 5KMGB 5FJ4C 2HS3A 3M4SA 3N2KB 3VYSC 2RB9A 3WJRA 4R40B 2Q1XA 2AMTA 4U3JB 3CCSF 5GAPK 4BT3A 4LNUB 5LP6B 3F0DA 4X20B 3HTNA 2VAMA 5KX5A 2CSLA 4O4HB 3GYQA 5HY2A 3P4EA 3CYQA 3HKCA 4G4ZA 1X52A 2UYKA 1Q82H 3MQWA 1TVKB 3CYPB 5LXTA 3ERNA 4X1IA 3LWRC 3HAXD 3TD5A 1X7PA 1YQNA 3HKEB 1Q7YH 5DCVA 4DXDA 3JALB 1ODEA 3M84A 1W581 3JAWB 3KJKA 2DT4A 4I55A 1Q86H 5KMGA 3SIVA 2RHOA 1GZ0A 3N2KA 3S0YA 5EIBC 4ZHYB 3D00A 1K73H 3RA6A 1CK2A 4U3JA 2R6R1 1SDSA 4C8EA 1DT9A 5GIOC 4LNUA 5LP6A 3CCUF 3RYCB 3GHZA 2HS0A 4X20A 1PF5A 2Q1YA 4O4HA 3C9TA 3CG6A 2QTPA 1W41A 1IV1A 3T80A 3MDOA 3J7AR 3F0GA 3V4DA 5IJ0B 1YJ9F 1M1KH 3K2XA 1VH8A 1TVKA 2ALEA 3LFOA 3CD6F 5EAZA 3HWUA 4DRXA 4G4WA 4G4VA 3HKEA 3FFMA 3OBWA 2IQQA 3R0PA 1VQNF 1K9MH 1VK3A 1Z5WA 3VOAA 4F6RB 1Q8RA 3IEQA 3K14A 3WGKA 3WGNA 3CXCF 1RQ2A 3S0WA 4C82A 5MN5A 2JNBA 4ERHA 1YHQF 2HP0B 1DBFA 5HY1A 1GO0A 5EB1B 3UT5B 5JH7B 1H48A 3RYIB 3RYCA 2K1SA 2DYYA 3PAFA 3JASB 3RYFA 1VQ8F 1W55A 3ZP4A 1YGYA 2V9YA 2UYJA 3LYBA 3TD3A 1VQVA 3OW2F 1E7KA 3CCJF 2GVIA 5HY4A 5IJ0A 5EYPB 1VQKF 4NQ3A 3I7TA 1IPAA 4IHJB 3S06A 4FFBB 4HNAA 2G9IA 3LWQC 1N8RH 3C8LA 3I3FA 4O4LB 5CB4B 3Q8HA 1CLIA 4F6RA 1U43A 3K0TA 3ON1A 2UZHA 3CCRF 3CPQA 2ZODA 5KX5B 3G4SF 1W5AA 2GLZA 4EI8A 3CPWF 2HP0A 3IEWA 1QD9A 3VOBA 3OONA 3UT5A 3VTIC 2IAFA 4LCKA 4O2BB 4RHAA 4X1IB 1TUBA 4IIJB 3S0HA 1U40A 3JASA 3JAKB 4O2AB 5JCOC 1PXWA 1SA0B 4ZHQB 2Z1UA 1CN7A 5AVMA 1T0KB 1ZWZA 5EYPA 2LCAA 1XRGA 2WALA 2HX0A 1JN1A 2N48A 3RYHB 4TV8B 1H7MA 1RA4A 4IHJA 4C81A 4FFBA 1FFXB 3WXMB 4O4LA 5BMVA 4B45A 5CB4A 3CCLF 3CCVF 1W57A 4ZHVA 1YIJF 2UYNA 4C8GA 1H47A 2HRUA 4BT5A 1S72F 1VHAA 1KQSF 2VAWA 5LOVA 3KE1A 3J80M 1JFFA 1W5BA 1KNKA 2MQEA 4O2BA 4IIJA 2ZOVA 4X3LA 4YJ3B 4DRXB 3JAKA 4O2AA 3VCZA 1SA0A 2CW4A 1Q81H 4EB6B 4ZI7B 4ZHQA 3D54A 3HKDB 4C4WC 2YXZA 3K12A 4KWEA 4G4XA 4BVQA 3RA5A 5MN4A 1ONIA 1W40A 3RYHA 3ZOPA 1IV4A 4TV8A 3FD6A 1FFXA 2HP3A 2QEXF 1OAPA 3L7QA 2YYEA 1KD1H 2Z01A 2H8CA 3RYFB 5J2UB 2CWJA 3G6EF 4X1YB 3NVKE 5HY0A 3GTZA 3E22B 3CC4F 2OHWA 2HS4A 2EWCA 1GX1A 4M8IA 3ZP7A 4YJ3A 2HRYA 2VXYA 4HNAB 2ZVYA 2OTMA 4EB6A 4ZI7A 5GINC 3JVHA 5LP6C 3HKDA 1RLGA 1T0AA 1K8AH 3VIUA 3CC2F 3VYUC 2NMUA 4B5CA 5ITZB 2F9ZC 4XCQA 4WBNB 3TD4A 1QVGF 2OTJF 4PWTA 3QTYA 1TUBB 1RQ7A 1VQPF 5J2UA 3C9SA 3F6MA 4X1YA 3NK7A 1JJ2F 3E22A 1FNJA 1JY8A 3I55F 3N4ZA 3CCQF 3WPXA 3CMAF 2CZWA 4RQOA 4G88A 3I56F 5LYJB 5FLXM 3AGKA 5EO3A 1X25A 1NJIH 2H6LA 4O4JB 5BMVB 2CVLA 5CA1A 3JARA 5HWEA 2UYNB 2VGNA 4YJ2B 1J7HA 5ITZA 1VQ5F 3BYQA 5GONB 4NWOB 4WBNA 1XBIA 2RHLA 1XV2A 1Z5VA 5LOVB 4X3MA 1W59A 5CA0B 2ZVZA 5IYZB 5JVDB 2Z1EA 2H8EA 1JFFB 4NUTA 1W5FA 3NK6A 3FPIA 3C9UA 1UI9A 4BT4A 5JCOA 2BTOA 2LBXA 4BVRA 3F0FA 3QUWA 2AIZP 2OTLF 2FC3A 4ZK7A 4BT7A 3ELCA 5C8YB 4I50A 3B6NA 5LA6B 5LYJA 3HJWC 2GZLA 4BW0B 5EIBD 1GO1A 2QA4F 4O4JA 3LMEA 1X7OA 3CC7F 1VQ6F 3HKBA 3S02A 4BT2A 3N2GA 5IJ9B 1QAHA 4BT6A 4YJ2A 1QU9A 5GONA 3CB2A 3JCMM 5A2QM 3WJPA 3F0EA 3MBMA 5CA0A 1VQMF 5IYZA 3RE3A 5JVDA 3V3TA 1VQ4F 3D01A 4U39A 2KGWA 4BVTA 2OZBA 1W3EX 4E6EA 3VI6A 4X1KB 3P10A 3MCQA 3E1YA 3WJQA 5GANK 3CMEF 4TV9B 3E20B 2P6YA 1W2BF 1COMA 3CCEF 1FSZA 2BTQB 3ESJA 3ZO8A 5JQGA 5C8YA 5MN6A 3NVIB 5LA6A 3DC2A 5GIPC 2CHSA 4BY9D 2VGMA 3LWOC 1YJWF 1VQOF 3VO8A 4TUYA 5IJ9A 5FNVB 1W42A 3JAMM 3M1XA 4O4IB 5HP7A 1XHOA 4ZHWA 4X1KA 3JATB 4TV9A 3FBAA 3KIZA 1IV3A 2RHJA 4B62A 5CA1B 3JARB 3NMUC 3V7EA 3C9RA 3QHDA 1NQ3A 1U3PA 3WGLA 5EZYB 3CCMF 5IT9M 3PLAC 1QVFF 1SZQA 2PHNA 3WGMA 2LBWA 5HXUA 2IG8A 4G4YA 5FNVA 1YI2F 3VYTC 5G4VC 4ZOLB 3IR9A 3KJJA 2Z1TA 3JALA 4BVSA 3J81M 2QI2A 2HQSC 3JAWA 4O4IA 1JD1A 3P0ZA 3LDTA 1OFUA 2UYPA 4I50B 5G4UC 1RLUA 3IKFA 1W5EA 2CHTA 3JATA 2HVYD 3OBYA 4C8IA 4I4TB 1UFYA 3VMFB 3HKBB 5EB0A 3N2GB 3LWPC 3KHNA 2RHHA 3S03A 2ZF8A 2I6RA 3O85A 5J2TB 2ZAUA 2Z1FA 2AIFA 2W8BC 2KG4A 3EORA 5EZYA 5HP8A 5HXZA 2BTUA 2R751 4EI7A 3SIUA 2L26A 2PMPA 3IKEA 4TZZA 4ZOLA 1VQ7F 4EI9A 5EWRA
chains in the Genus database with same CATH topology
1GO0A 3VI6A 3CMEF 3E1YA 5GANK 1YITF 3CC4F 3E20B 2OHWA 3PAFA 3LWVC 1VQ8F 3N4YA 3MCAB 3V7QA 1W2BF 3CCEF 1NMUB 2I6DA 3OW2F 1YJNF 1E7KA 3CCJF 2KTUA 5HY4A 5GINC 1VQLF 3NVIB 1VQ9F 1RLGA 1VQKF 1K8AH 4NQ3A 5GIPC 3CC2F 4BY9D 3G71F 1IPAA 2BO1A 2VGMA 1KC8H 2KTVA 3LWOC 3LWQC 1N8RH 1YJWF 2F9ZC 1M90H 4XCQA 1VQOF 2FGYA 5FJ4C 1W42A 3ON1A 3JAMM 1QVGF 2OTJF 3CCRF 3CPQA 3G4SF 2GLZA 4EI8A 3CPWF 3CCSF 1VQPF 5GAPK 3NK7A 1JJ2F 3I55F 4LCKA 3GYQA 3N4ZA 3CCQF 5HY2A 3CMAF 2CZWA 1PXWA 1X52A 3I56F 1Q82H 3NMUC 3V7EA 3HAXD 3LWRC 1CN7A 5FLXM 3AGKA 1T0KB 1X7PA 5EO3A 1ZWZA 1NJIH 1Q7YH 3CCMF 5DCVA 5IT9M 2WALA 3PLAC 1H7MA 1RA4A 5HWEA 2VGNA 1QVFF 1VQ5F 2LBWA 3WXMB 5HXUA 1Q86H 3SIVA 1XBIA 1YI2F 3CCLF 5G4VC 1GZ0A 3CCVF 4X3MA 3IR9A 1YIJF 3D00A 1K73H 3RA6A 4BVSA 3J81M 2QI2A 4NUTA 1CK2A 1S72F 3NK6A 1SDSA 1DT9A 5GIOC 1KQSF 3CCUF 2LBXA 4BVRA 5G4UC 2OTLF 3J80M 3CG6A 2HVYD 2FC3A 1W41A 3J7AR 4X3LA 3OBYA 1Q81H 3VMFB 1YJ9F 1M1KH 3HJWC 3LWPC 4C4WC 2ALEA 3LFOA 4BW0B 2OZBA 3CD6F 3O85A 1GO1A 2QA4F 2AIFA 2KG4A 1X7OA 5HXZA 3CC7F 4BVQA 3FFMA 3OBWA 3RA5A 1VQ6F 1VQNF 1W40A 1K9MH 4EI7A 3SIUA 3CXCF 2QEXF 3JCMM 5A2QM 4TZZA 1KD1H 1VQ7F 2JNBA 4EI9A 1VQMF 1YHQF 3V3TA 1VQ4F 3G6EF 5EWRA 5HY1A 3NVKE 4BVTA 5HY0A 1W3EX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO0 A;  3VI6 A;  3CME F;  3E1Y A;  5GAN K;  1YIT F;  3CC4 F;  3E20 B;  2OHW A;  3PAF A;  3LWV C;  1VQ8 F;  3N4Y A;  3MCA B;  3V7Q A;  1W2B F;  3CCE F;  1NMU B;  2I6D A;  3OW2 F;  1YJN F;  1E7K A;  3CCJ F;  2KTU A;  5GIN C;  1VQL F;  3NVI B;  1VQ9 F;  1RLG A;  1VQK F;  1K8A H;  5GIP C;  3CC2 F;  4BY9 D;  3G71 F;  1IPA A;  2BO1 A;  2VGM A;  1KC8 H;  2KTV A;  3LWO C;  3LWQ C;  1N8R H;  1YJW F;  1M90 H;  1VQO F;  5FJ4 C;  1W42 A;  3ON1 A;  3JAM M;  1QVG F;  2OTJ F;  3CCR F;  3CPQ A;  3G4S F;  3CCS F;  3CPW F;  1VQP F;  5GAP K;  3NK7 A;  1JJ2 F;  3I55 F;  4LCK A;  3GYQ A;  3N4Z A;  3CCQ F;  3CMA F;  2CZW A;  1PXW A;  1X52 A;  3I56 F;  1Q82 H;  3NMU C;  3V7E A;  3HAX D;  3LWR C;  1CN7 A;  5FLX M;  3AGK A;  1T0K B;  1X7P A;  5EO3 A;  1ZWZ A;  1NJI H;  1Q7Y H;  3CCM F;  5DCV A;  5IT9 M;  2WAL A;  3PLA C;  1H7M A;  1RA4 A;  2VGN A;  1QVF F;  1VQ5 F;  2LBW A;  3WXM B;  1Q86 H;  3SIV A;  1XBI A;  1YI2 F;  3CCL F;  5G4V C;  1GZ0 A;  3CCV F;  4X3M A;  3IR9 A;  1YIJ F;  1K73 H;  3RA6 A;  3J81 M;  2QI2 A;  4NUT A;  1CK2 A;  1S72 F;  3NK6 A;  1SDS A;  1DT9 A;  5GIO C;  1KQS F;  3CCU F;  2LBX A;  5G4U C;  2OTL F;  3J80 M;  3CG6 A;  2HVY D;  2FC3 A;  1W41 A;  3J7A R;  4X3L A;  3OBY A;  1Q81 H;  3VMF B;  1YJ9 F;  1M1K H;  3HJW C;  3LWP C;  4C4W C;  2ALE A;  3LFO A;  4BW0 B;  3CD6 F;  3O85 A;  1GO1 A;  2QA4 F;  2AIF A;  2KG4 A;  1X7O A;  3CC7 F;  3FFM A;  3OBW A;  3RA5 A;  1VQ6 F;  1VQN F;  1W40 A;  1K9M H;  3SIU A;  3CXC F;  2QEX F;  3JCM M;  5A2Q M;  4TZZ A;  1KD1 H;  1VQ7 F;  2JNB A;  1VQM F;  1YHQ F;  1VQ4 F;  3G6E F;  5EWR A;  3NVK E;  2OZB A;  1W3E X; 
#chains in the Genus database with same CATH topology
 3FD5 A;  5B8F A;  1YIT F;  5JQG B;  3LWV C;  3N4Y A;  3MCA B;  3V7Q A;  3U0O A;  3DDN A;  1R1M A;  3HKC B;  1U3L A;  1NMU B;  5JH7 A;  3IMP A;  4B46 A;  2B33 A;  5LXT B;  2I6D A;  4I4T A;  3RYI A;  1YJN F;  3WGJ A;  2KTU A;  1IV2 A;  1VQL F;  1VQ9 F;  1KNJ A;  4TUY B;  2LBT A;  3WPW A;  5J2T A;  3G71 F;  2BO1 A;  1KC8 H;  2KTV A;  4I55 B;  1M90 H;  2VAP A;  2FGY A;  1FNK A;  5KMG B;  5FJ4 C;  2HS3 A;  3M4S A;  3N2K B;  3VYS C;  2RB9 A;  3WJR A;  4R40 B;  2Q1X A;  2AMT A;  4U3J B;  3CCS F;  5GAP K;  4BT3 A;  4LNU B;  5LP6 B;  3F0D A;  4X20 B;  3HTN A;  2VAM A;  5KX5 A;  2CSL A;  4O4H B;  3GYQ A;  5HY2 A;  3P4E A;  3CYQ A;  3HKC A;  4G4Z A;  1X52 A;  2UYK A;  1Q82 H;  3MQW A;  1TVK B;  3CYP B;  5LXT A;  3ERN A;  4X1I A;  3LWR C;  3HAX D;  3TD5 A;  1X7P A;  1YQN A;  3HKE B;  1Q7Y H;  5DCV A;  4DXD A;  3JAL B;  1ODE A;  3M84 A;  1W58 1;  3JAW B;  3KJK A;  2DT4 A;  4I55 A;  1Q86 H;  5KMG A;  3SIV A;  2RHO A;  1GZ0 A;  3N2K A;  3S0Y A;  5EIB C;  4ZHY B;  3D00 A;  1K73 H;  3RA6 A;  1CK2 A;  4U3J A;  2R6R 1;  1SDS A;  4C8E A;  1DT9 A;  5GIO C;  4LNU A;  5LP6 A;  3CCU F;  3RYC B;  3GHZ A;  2HS0 A;  4X20 A;  1PF5 A;  2Q1Y A;  4O4H A;  3C9T A;  3CG6 A;  2QTP A;  1W41 A;  1IV1 A;  3T80 A;  3MDO A;  3J7A R;  3F0G A;  3V4D A;  5IJ0 B;  1YJ9 F;  1M1K H;  3K2X A;  1VH8 A;  1TVK A;  2ALE A;  3LFO A;  3CD6 F;  5EAZ A;  3HWU A;  4DRX A;  4G4W A;  4G4V A;  3HKE A;  3FFM A;  3OBW A;  2IQQ A;  3R0P A;  1VQN F;  1K9M H;  1VK3 A;  1Z5W A;  3VOA A;  4F6R B;  1Q8R A;  3IEQ A;  3K14 A;  3WGK A;  3WGN A;  3CXC F;  1RQ2 A;  3S0W A;  4C82 A;  5MN5 A;  2JNB A;  4ERH A;  1YHQ F;  2HP0 B;  1DBF A;  5HY1 A;  1GO0 A;  5EB1 B;  3UT5 B;  5JH7 B;  1H48 A;  3RYI B;  3RYC A;  2K1S A;  2DYY A;  3PAF A;  3JAS B;  3RYF A;  1VQ8 F;  1W55 A;  3ZP4 A;  1YGY A;  2V9Y A;  2UYJ A;  3LYB A;  3TD3 A;  1VQV A;  3OW2 F;  1E7K A;  3CCJ F;  2GVI A;  5HY4 A;  5IJ0 A;  5EYP B;  1VQK F;  4NQ3 A;  3I7T A;  1IPA A;  4IHJ B;  3S06 A;  4FFB B;  4HNA A;  2G9I A;  3LWQ C;  1N8R H;  3C8L A;  3I3F A;  4O4L B;  5CB4 B;  3Q8H A;  1CLI A;  4F6R A;  1U43 A;  3K0T A;  3ON1 A;  2UZH A;  3CCR F;  3CPQ A;  2ZOD A;  5KX5 B;  3G4S F;  1W5A A;  2GLZ A;  4EI8 A;  3CPW F;  2HP0 A;  3IEW A;  1QD9 A;  3VOB A;  3OON A;  3UT5 A;  3VTI C;  2IAF A;  4LCK A;  4O2B B;  4RHA A;  4X1I B;  1TUB A;  4IIJ B;  3S0H A;  1U40 A;  3JAS A;  3JAK B;  4O2A B;  5JCO C;  1PXW A;  1SA0 B;  4ZHQ B;  2Z1U A;  1CN7 A;  5AVM A;  1T0K B;  1ZWZ A;  5EYP A;  2LCA A;  1XRG A;  2WAL A;  2HX0 A;  1JN1 A;  2N48 A;  3RYH B;  4TV8 B;  1H7M A;  1RA4 A;  4IHJ A;  4C81 A;  4FFB A;  1FFX B;  3WXM B;  4O4L A;  5BMV A;  4B45 A;  5CB4 A;  3CCL F;  3CCV F;  1W57 A;  4ZHV A;  1YIJ F;  2UYN A;  4C8G A;  1H47 A;  2HRU A;  4BT5 A;  1S72 F;  1VHA A;  1KQS F;  2VAW A;  5LOV A;  3KE1 A;  3J80 M;  1JFF A;  1W5B A;  1KNK A;  2MQE A;  4O2B A;  4IIJ A;  2ZOV A;  4X3L A;  4YJ3 B;  4DRX B;  3JAK A;  4O2A A;  3VCZ A;  1SA0 A;  2CW4 A;  1Q81 H;  4EB6 B;  4ZI7 B;  4ZHQ A;  3D54 A;  3HKD B;  4C4W C;  2YXZ A;  3K12 A;  4KWE A;  4G4X A;  4BVQ A;  3RA5 A;  5MN4 A;  1ONI A;  1W40 A;  3RYH A;  3ZOP A;  1IV4 A;  4TV8 A;  3FD6 A;  1FFX A;  2HP3 A;  2QEX F;  1OAP A;  3L7Q A;  2YYE A;  1KD1 H;  2Z01 A;  2H8C A;  3RYF B;  5J2U B;  2CWJ A;  3G6E F;  4X1Y B;  3NVK E;  5HY0 A;  3GTZ A;  3E22 B;  3CC4 F;  2OHW A;  2HS4 A;  2EWC A;  1GX1 A;  4M8I A;  3ZP7 A;  4YJ3 A;  2HRY A;  2VXY A;  4HNA B;  2ZVY A;  2OTM A;  4EB6 A;  4ZI7 A;  5GIN C;  3JVH A;  5LP6 C;  3HKD A;  1RLG A;  1T0A A;  1K8A H;  3VIU A;  3CC2 F;  3VYU C;  2NMU A;  4B5C A;  5ITZ B;  2F9Z C;  4XCQ A;  4WBN B;  3TD4 A;  1QVG F;  2OTJ F;  4PWT A;  3QTY A;  1TUB B;  1RQ7 A;  1VQP F;  5J2U A;  3C9S A;  3F6M A;  4X1Y A;  3NK7 A;  1JJ2 F;  3E22 A;  1FNJ A;  1JY8 A;  3I55 F;  3N4Z A;  3CCQ F;  3WPX A;  3CMA F;  2CZW A;  4RQO A;  4G88 A;  3I56 F;  5LYJ B;  5FLX M;  3AGK A;  5EO3 A;  1X25 A;  1NJI H;  2H6L A;  4O4J B;  5BMV B;  2CVL A;  5CA1 A;  3JAR A;  5HWE A;  2UYN B;  2VGN A;  4YJ2 B;  1J7H A;  5ITZ A;  1VQ5 F;  3BYQ A;  5GON B;  4NWO B;  4WBN A;  1XBI A;  2RHL A;  1XV2 A;  1Z5V A;  5LOV B;  4X3M A;  1W59 A;  5CA0 B;  2ZVZ A;  5IYZ B;  5JVD B;  2Z1E A;  2H8E A;  1JFF B;  4NUT A;  1W5F A;  3NK6 A;  3FPI A;  3C9U A;  1UI9 A;  4BT4 A;  5JCO A;  2BTO A;  2LBX A;  4BVR A;  3F0F A;  3QUW A;  2AIZ P;  2OTL F;  2FC3 A;  4ZK7 A;  4BT7 A;  3ELC A;  5C8Y B;  4I50 A;  3B6N A;  5LA6 B;  5LYJ A;  3HJW C;  2GZL A;  4BW0 B;  5EIB D;  1GO1 A;  2QA4 F;  4O4J A;  3LME A;  1X7O A;  3CC7 F;  1VQ6 F;  3HKB A;  3S02 A;  4BT2 A;  3N2G A;  5IJ9 B;  1QAH A;  4BT6 A;  4YJ2 A;  1QU9 A;  5GON A;  3CB2 A;  3JCM M;  5A2Q M;  3WJP A;  3F0E A;  3MBM A;  5CA0 A;  1VQM F;  5IYZ A;  3RE3 A;  5JVD A;  3V3T A;  1VQ4 F;  3D01 A;  4U39 A;  2KGW A;  4BVT A;  2OZB A;  1W3E X;  4E6E A;  3VI6 A;  4X1K B;  3P10 A;  3MCQ A;  3E1Y A;  3WJQ A;  5GAN K;  3CME F;  4TV9 B;  3E20 B;  2P6Y A;  1W2B F;  1COM A;  3CCE F;  1FSZ A;  2BTQ B;  3ESJ A;  3ZO8 A;  5JQG A;  5C8Y A;  5MN6 A;  3NVI B;  5LA6 A;  3DC2 A;  5GIP C;  2CHS A;  4BY9 D;  2VGM A;  3LWO C;  1YJW F;  1VQO F;  3VO8 A;  4TUY A;  5IJ9 A;  5FNV B;  1W42 A;  3JAM M;  3M1X A;  4O4I B;  5HP7 A;  1XHO A;  4ZHW A;  4X1K A;  3JAT B;  4TV9 A;  3FBA A;  3KIZ A;  1IV3 A;  2RHJ A;  4B62 A;  5CA1 B;  3JAR B;  3NMU C;  3V7E A;  3C9R A;  3QHD A;  1NQ3 A;  1U3P A;  3WGL A;  5EZY B;  3CCM F;  5IT9 M;  3PLA C;  1QVF F;  1SZQ A;  2PHN A;  3WGM A;  2LBW A;  5HXU A;  2IG8 A;  4G4Y A;  5FNV A;  1YI2 F;  3VYT C;  5G4V C;  4ZOL B;  3IR9 A;  3KJJ A;  2Z1T A;  3JAL A;  4BVS A;  3J81 M;  2QI2 A;  2HQS C;  3JAW A;  4O4I A;  1JD1 A;  3P0Z A;  3LDT A;  1OFU A;  2UYP A;  4I50 B;  5G4U C;  1RLU A;  3IKF A;  1W5E A;  2CHT A;  3JAT A;  2HVY D;  3OBY A;  4C8I A;  4I4T B;  1UFY A;  3VMF B;  3HKB B;  5EB0 A;  3N2G B;  3LWP C;  3KHN A;  2RHH A;  3S03 A;  2ZF8 A;  2I6R A;  3O85 A;  5J2T B;  2ZAU A;  2Z1F A;  2AIF A;  2W8B C;  2KG4 A;  3EOR A;  5EZY A;  5HP8 A;  5HXZ A;  2BTU A;  2R75 1;  4EI7 A;  3SIU A;  2L26 A;  2PMP A;  3IKE A;  4TZZ A;  4ZOL A;  1VQ7 F;  4EI9 A;  5EWR A; 
#chains in the Genus database with same CATH homology
 1GO0 A;  3VI6 A;  3CME F;  3E1Y A;  5GAN K;  1YIT F;  3CC4 F;  3E20 B;  2OHW A;  3PAF A;  3LWV C;  1VQ8 F;  3N4Y A;  3MCA B;  3V7Q A;  1W2B F;  3CCE F;  1NMU B;  2I6D A;  3OW2 F;  1YJN F;  1E7K A;  3CCJ F;  2KTU A;  5HY4 A;  5GIN C;  1VQL F;  3NVI B;  1VQ9 F;  1RLG A;  1VQK F;  1K8A H;  4NQ3 A;  5GIP C;  3CC2 F;  4BY9 D;  3G71 F;  1IPA A;  2BO1 A;  2VGM A;  1KC8 H;  2KTV A;  3LWO C;  3LWQ C;  1N8R H;  1YJW F;  2F9Z C;  1M90 H;  4XCQ A;  1VQO F;  2FGY A;  5FJ4 C;  1W42 A;  3ON1 A;  3JAM M;  1QVG F;  2OTJ F;  3CCR F;  3CPQ A;  3G4S F;  2GLZ A;  4EI8 A;  3CPW F;  3CCS F;  1VQP F;  5GAP K;  3NK7 A;  1JJ2 F;  3I55 F;  4LCK A;  3GYQ A;  3N4Z A;  3CCQ F;  5HY2 A;  3CMA F;  2CZW A;  1PXW A;  1X52 A;  3I56 F;  1Q82 H;  3NMU C;  3V7E A;  3HAX D;  3LWR C;  1CN7 A;  5FLX M;  3AGK A;  1T0K B;  1X7P A;  5EO3 A;  1ZWZ A;  1NJI H;  1Q7Y H;  3CCM F;  5DCV A;  5IT9 M;  2WAL A;  3PLA C;  1H7M A;  1RA4 A;  5HWE A;  2VGN A;  1QVF F;  1VQ5 F;  2LBW A;  3WXM B;  5HXU A;  1Q86 H;  3SIV A;  1XBI A;  1YI2 F;  3CCL F;  5G4V C;  1GZ0 A;  3CCV F;  4X3M A;  3IR9 A;  1YIJ F;  3D00 A;  1K73 H;  3RA6 A;  4BVS A;  3J81 M;  2QI2 A;  4NUT A;  1CK2 A;  1S72 F;  3NK6 A;  1SDS A;  1DT9 A;  5GIO C;  1KQS F;  3CCU F;  2LBX A;  4BVR A;  5G4U C;  2OTL F;  3J80 M;  3CG6 A;  2HVY D;  2FC3 A;  1W41 A;  3J7A R;  4X3L A;  3OBY A;  1Q81 H;  3VMF B;  1YJ9 F;  1M1K H;  3HJW C;  3LWP C;  4C4W C;  2ALE A;  3LFO A;  4BW0 B;  2OZB A;  3CD6 F;  3O85 A;  1GO1 A;  2QA4 F;  2AIF A;  2KG4 A;  1X7O A;  5HXZ A;  3CC7 F;  4BVQ A;  3FFM A;  3OBW A;  3RA5 A;  1VQ6 F;  1VQN F;  1W40 A;  1K9M H;  4EI7 A;  3SIU A;  3CXC F;  2QEX F;  3JCM M;  5A2Q M;  4TZZ A;  1KD1 H;  1VQ7 F;  2JNB A;  4EI9 A;  1VQM F;  1YHQ F;  3V3T A;  1VQ4 F;  3G6E F;  5EWR A;  5HY1 A;  3NVK E;  4BVT A;  5HY0 A;  1W3E X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...