5GIOC

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 34
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5gioC00
3LWVC 2BO1A 3CMAF 1VQKF 3CCQF 3LWQC 4X3MA 3FFMA 1VQPF 1YJWF 2FC3A 1NMUB 3CPQA 1VQ6F 5GIOC 4BY9D 1H7MA 1KD1H 1NJIH 3CC4F 1KQSF 3NK6A 1CK2A 2LBWA 3CCSF 1VQ8F 5FJ4C 3I56F 1T0KB 3PAFA 3N4ZA 1M1KH 1QVFF 2LBXA 3CG6A 1KC8H 2KTUA 1N8RH 2CZWA 2HVYD 1YITF 3NMUC 3CD6F 3JAMM 1GO1A 1RLGA 3CCVF 5DCVA 3VMFB 1S72F 1VQ7F 2OTJF 1X7OA 1K8AH 1X52A 3CCMF 3NK7A 3OBWA 3J81M 1W40A 2I6DA 3JCMM 3LWPC 1Q7YH 1PXWA 1VQLF 4LCKA 3RA5A 3SIVA 1ZWZA 3E1YA 5G4UC 3CCRF 5GAPK 5IT9M 4X3LA 1YI2F 1YIJF 3I55F 3CC7F 2QA4F 3N4YA 3AGKA 5GINC 2KG4A 2QI2A 3OBYA 1X7PA 1Q82H 3O85A 3CCUF 2OHWA 1YJNF 2VGMA 1K73H 5GIPC 3ON1A 1GZ0A 3CCLF 3V7EA 3SIUA 1GO0A 1YJ9F 3WXMB 3V7QA 3RA6A 1VQOF 2VGNA 1VQ5F 4NUTA 1W3EX 3G4SF 3CXCF 1VQ4F 3NVIB 1VQMF 5EWRA 1K9MH 3LWRC 3GYQA 2KTVA 3CMEF 1Q81H 2AIFA 1VQNF 3NVKE 2OZBA 3LFOA 3LWOC 4BW0B 1E7KA 1SDSA 1DT9A 3HAXD 3J7AR 5FLXM 3VI6A 1JJ2F 1W2BF 1CN7A 3OW2F 2OTLF 3G6EF 1W42A 2QEXF 1QVGF 3CCEF 1W41A 1IPAA 5EO3A 5A2QM 3CCJF 3PLAC 3CPWF 1YHQF 1XBIA 1RA4A 2WALA 3MCAB 1Q86H 5G4VC 5GANK 4C4WC 3IR9A 2JNBA 3E20B 4TZZA 3CC2F 1VQ9F 2ALEA 3HJWC 3J80M 1M90H 3G71F
chains in the Genus database with same CATH superfamily
3LWVC 2BO1A 2HRUA 4O4JA 3S02A 3CMAF 2EWCA 2CWJA 3WGNA 3ZO8A 4X3MA 3L7QA 1RQ2A 3TD4A 5LYJA 1VQ6F 2YYEA 2UYNA 5MN4A 1TUBA 2NMUA 3JAKA 3N2GB 2Q1XA 3PAFA 1KNKA 4B62A 3JATB 2H8CA 5EB0A 1U3LA 2R6R1 1N8RH 3DC2A 5B8FA 1YITF 3NMUC 1NQ3A 1GO1A 3E22B 1QD9A 3CCVF 1XRGA 1S72F 3CYPB 1Z5VA 2GLZA 3WPXA 1VQ7F 1JD1A 4BT4A 5HY4A 1K8AH 3ZOPA 5HY0A 2FGYA 2Z1FA 3D00A 3NK7A 2I6DA 2VAWA 3HKEB 1VH8A 3LWPC 3RYIA 2RHOA 5IJ9B 4IIJA 2Z1TA 4NWOB 1W55A 1YIJF 3I55F 2R751 3CC7F 3N4YA 4O4LA 5LXTB 2KG4A 3DDNA 3JASA 2QI2A 3OBYA 4BT3A 5AVMA 2UZHA 5EYPA 3VCZA 2VGMA 5EYPB 4WBNA 4YJ3B 4O4IA 3BYQA 4X1YA 2ZAUA 3SIUA 1YJ9F 5KMGA 2QTPA 2VGNA 4X1KB 3G4SF 1YQNA 3HKCA 4X1IB 3S0HA 1VQMF 5EWRA 1UFYA 2I6RA 3GYQA 1VQNF 4BT2A 3VTIC 1COMA 3VYSC 3P4EA 1E7KA 3N2KB 1DT9A 3HAXD 3UT5B 4EI7A 5CA1A 5KX5A 3ELCA 4EI9A 2VAPA 1U40A 4O4HB 3C9SA 3S0WA 3VOBA 2HP0A 5JQGA 4TV8A 1IPAA 2CHSA 5HXUA 3C8LA 3IKFA 3P10A 2H6LA 2LBTA 5JH7A 5CA0A 2V9YA 3CPWF 3RYHA 4WBNB 1RA4A 4I50B 5ITZB 4O2BB 2JNBA 3JASB 1RQ7A 1GX1A 4G4YA 3HKBA 1H47A 3HKDA 5JVDA 5FNVB 4G4XA 3KJKA 1SA0A 5BMVA 5HY1A 4G88A 4BT5A 1YJWF 3M4SA 3JALB 2FC3A 1NMUB 5GONA 4BY9D 1YGYA 1H7MA 4FFBA 1KD1H 2RHHA 3MCQA 3MQWA 1CK2A 1VQ8F 3N4ZA 3JARB 5HWEA 1W5AA 3RYFA 4ZHYB 3F0DA 4ZK7A 2KTUA 2DT4A 3WPWA 2LCAA 4DRXA 4NQ3A 5EIBD 4EB6B 2RB9A 4O4HA 3S0YA 1J7HA 1RLGA 2VAMA 5DCVA 3VMFB 5C8YA 3EORA 2OTJF 1X7OA 3V4DA 3OBWA 5LP6A 2UYKA 3FD5A 1W40A 5LXTA 1JY8A 1Q7YH 2F9ZC 3IEQA 1VQLF 5LA6A 5HXZA 5IJ0B 3RA5A 5MN6A 2N48A 2AIZP 3SIVA 1ZWZA 5IT9M 5G4UC 4KWEA 3RE3A 4X3LA 4XCQA 4TV9B 3AGKA 1TVKB 3C9UA 1IV2A 4RQOA 5BMVB 1ONIA 4O4IB 3K0TA 4F6RB 3I3FA 1VQVA 4O4JB 3JALA 3V7EA 1GO0A 5KMGB 5HP8A 3WGJA 4I55B 3RA6A 1W5BA 5EZYA 5EZYB 1W3EX 3FBAA 3T80A 3JAKB 4ZI7A 1IV1A 3ZP4A 1FNJA 4C82A 3NVKE 2VXYA 4I55A 3LFOA 4B46A 4BW0B 2ZOVA 4O2AB 2UYNB 3J7AR 2Q1YA 3D01A 3VI6A 5FLXM 5CA1B 5HY2A 1SZQA 3WJPA 2Z1EA 3OW2F 2OTLF 2RHJA 3IEWA 1W57A 1H48A 5JQGB 3CYQA 1QVGF 3CCEF 1W41A 1XHOA 5EO3A 4BVRA 4BVQA 5ITZA 3HKEA 3GHZA 3M84A 5KX5B 4ZOLA 4G4ZA 4ZOLB 4G4WA 2P6YA 3WJRA 1YHQF 2BTOA 1XBIA 3WGMA 2WALA 5CB4A 3MCAB 3WGLA 1Q86H 5LP6B 5G4VC 4O2BA 4TV8B 2K1SA 4B45A 5J2TA 3JVHA 3F0GA 3FPIA 4TZZA 4M8IA 3KE1A 3HJWC 3J80M 2DYYA 1R1MA 4YJ3A 5EB1B 4G4VA 4YJ2A 3LWQC 2ZVZA 3K12A 3FFMA 1VQPF 4ZHVA 5LYJB 3WJQA 4ZHWA 1IV3A 3C9TA 3CPQA 4FFBB 4ERHA 3ERNA 3ZP7A 2OTMA 1NJIH 2LBWA 2G9IA 3CCSF 4TUYB 3MDOA 3I56F 1U3PA 1M1KH 2HQSC 1QAHA 3RYFB 2LBXA 1KC8H 2HS0A 2HVYD 3UT5A 3JAWB 5MN5A 3R0PA 4R40B 2HRYA 2L26A 5IYZA 3VYUC 3TD3A 5J2UA 1PF5A 3JCMM 4DRXB 4EB6A 1PXWA 3JAWA 5JCOC 1Q8RA 3TD5A 4ZHQA 4LCKA 3M1XA 1ODEA 2HS4A 5LA6B 3RYHB 5IJ0A 1JFFB 3CCRF 4TV9A 1VHAA 2QA4F 2KGWA 5GINC 4I4TB 1X7PA 1Q82H 3F0EA 3O85A 4C8EA 1TVKA 2IQQA 2MQEA 3B6NA 4BT7A 5GIPC 3ON1A 4B5CA 5LP6C 2GZLA 4U39A 2BTQB 3V7QA 4LNUB 2ZODA 1X25A 2HP3A 3S03A 4NUTA 4X20B 1JN1A 3CXCF 1VQ4F 5LOVB 3NVIB 1OFUA 5EAZA 1K9MH 2ZVYA 3CMEF 5GONB 2OZBA 3LWOC 4U3JA 5EIBC 4U3JB 1FFXA 1SDSA 3RYCB 4O2AA 2BTUA 2CHTA 3N2GA 3MBMA 1JJ2F 3F6MA 4C8IA 1W2BF 3U0OA 1VK3A 1CN7A 2HP0B 3G6EF 2PMPA 3QUWA 2Z1UA 2HS3A 3HTNA 3LYBA 2QEXF 4PWTA 4E6EA 5J2UB 1DBFA 5J2TB 4HNAB 3CCJF 3PLAC 5IJ9A 2YXZA 1KNJA 3GTZA 5GANK 4O4LB 3E20B 1Z5WA 2W8BC 3VIUA 4HNAA 3VYTC 3V3TA 3HKBB 3KIZA 5CA0B 3CC2F 2HX0A 1VQ9F 2ALEA 1W5FA 4C8GA 1SA0B 1YI2F 1M90H 5FNVA 3G71F 3KHNA 1VQKF 3CCQF 4X1YB 2ZF8A 2GVIA 3CB2A 3VO8A 4BT6A 4LNUA 2RHLA 5GIOC 3CC4F 3WGKA 1KQSF 3ESJA 3NK6A 1TUBB 5FJ4C 3JARA 1T0KB 1QVFF 3K2XA 3LMEA 3CG6A 3QTYA 2Z01A 2CZWA 3C9RA 3VOAA 3HKCB 4X1IA 3KJJA 3LDTA 3CD6F 3HWUA 3IMPA 3JAMM 3RYIB 1X52A 3CCMF 3RYCA 5JCOA 3J81M 5IYZB 1W5EA 5JH7B 1RLUA 1FSZA 4I4TA 4IIJB 3Q8HA 1JFFA 3E1YA 1T0AA 5GAPK 4I50A 1IV4A 2IG8A 2CW4A 4ZHQB 3I7TA 3CCUF 1UI9A 2OHWA 1YJNF 1K73H 2PHNA 4IHJA 4IHJB 5HP7A 5LOVA 4YJ2B 2UYJA 4ZI7B 1GZ0A 3CCLF 2CSLA 3FD6A 3WXMB 3JATA 1VQOF 1VQ5F 5JVDB 4X1KA 2IAFA 3IKEA 3LWRC 2KTVA 1Q81H 2AIFA 4TUYA 1QU9A 3D54A 3QHDA 5C8YB 4BVSA 3N2KA 4DXDA 3K14A 1FNKA 2B33A 1W581 3E22A 3S06A 3OONA 1OAPA 2UYPA 3F0FA 1FFXB 1W42A 2H8EA 4C81A 1XV2A 2CVLA 5A2QM 1CLIA 4RHAA 4BVTA 1W59A 5CB4B 1U43A 4F6RA 4C4WC 3IR9A 4EI8A 3HKDB 2AMTA 4X20A 3P0ZA
chains in the Genus database with same CATH topology
3LWVC 2BO1A 5HY1A 3CMAF 1VQKF 3CCQF 3LWQC 4X3MA 3FFMA 1VQPF 1YJWF 2FC3A 1NMUB 3CPQA 1VQ6F 5GIOC 4BY9D 1H7MA 1KD1H 1NJIH 3CC4F 1KQSF 3NK6A 1CK2A 2LBWA 3CCSF 1VQ8F 5FJ4C 3I56F 1T0KB 3PAFA 3N4ZA 5HWEA 1M1KH 1QVFF 2LBXA 3CG6A 1KC8H 2KTUA 1N8RH 2CZWA 2HVYD 1YITF 4NQ3A 3NMUC 3CD6F 3JAMM 1GO1A 1RLGA 3CCVF 5DCVA 3VMFB 1S72F 1VQ7F 2GLZA 2OTJF 1X7OA 5HY4A 1K8AH 1X52A 5HY0A 2FGYA 3D00A 3NK7A 3CCMF 3OBWA 3J81M 1W40A 2I6DA 3JCMM 2F9ZC 3LWPC 1PXWA 1Q7YH 1VQLF 4LCKA 5HXZA 3RA5A 3SIVA 1ZWZA 3E1YA 5G4UC 3CCRF 5GAPK 5IT9M 4X3LA 4XCQA 1YI2F 1YIJF 3I55F 3CC7F 2QA4F 3N4YA 3AGKA 5GINC 2KG4A 2QI2A 3OBYA 1X7PA 1Q82H 3O85A 3CCUF 2OHWA 1YJNF 2VGMA 1K73H 5GIPC 3ON1A 1GZ0A 3CCLF 3V7EA 3SIUA 1GO0A 1YJ9F 3WXMB 3V7QA 3RA6A 1VQOF 2VGNA 1VQ5F 4NUTA 1W3EX 3G4SF 3CXCF 1VQ4F 3NVIB 1VQMF 5EWRA 1K9MH 3LWRC 3GYQA 2KTVA 3CMEF 1Q81H 2AIFA 1VQNF 3NVKE 2OZBA 3LFOA 3LWOC 4BW0B 1E7KA 1SDSA 4BVSA 1DT9A 3HAXD 3J7AR 5FLXM 3VI6A 1JJ2F 4EI7A 4EI9A 5HY2A 1W2BF 1CN7A 3OW2F 2OTLF 3G6EF 1W42A 2QEXF 1QVGF 3CCEF 1W41A 4BVRA 1IPAA 5EO3A 4BVQA 5HXUA 5A2QM 3CCJF 3PLAC 3CPWF 1YHQF 1XBIA 1RA4A 2WALA 4BVTA 3MCAB 1Q86H 5G4VC 5GANK 4C4WC 3IR9A 2JNBA 3E20B 3V3TA 4EI8A 4TZZA 3CC2F 1VQ9F 2ALEA 3HJWC 3J80M 1M90H 3G71F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV C;  2BO1 A;  3CMA F;  1VQK F;  3CCQ F;  3LWQ C;  4X3M A;  3FFM A;  1VQP F;  1YJW F;  2FC3 A;  1NMU B;  3CPQ A;  1VQ6 F;  5GIO C;  4BY9 D;  1H7M A;  1KD1 H;  1NJI H;  3CC4 F;  1KQS F;  3NK6 A;  1CK2 A;  2LBW A;  3CCS F;  1VQ8 F;  5FJ4 C;  3I56 F;  1T0K B;  3PAF A;  3N4Z A;  1M1K H;  1QVF F;  2LBX A;  3CG6 A;  1KC8 H;  2KTU A;  1N8R H;  2CZW A;  2HVY D;  1YIT F;  3NMU C;  3CD6 F;  3JAM M;  1GO1 A;  1RLG A;  3CCV F;  5DCV A;  3VMF B;  1S72 F;  1VQ7 F;  2OTJ F;  1X7O A;  1K8A H;  1X52 A;  3CCM F;  3NK7 A;  3OBW A;  3J81 M;  1W40 A;  2I6D A;  3JCM M;  3LWP C;  1Q7Y H;  1PXW A;  1VQL F;  4LCK A;  3RA5 A;  3SIV A;  1ZWZ A;  3E1Y A;  5G4U C;  3CCR F;  5GAP K;  5IT9 M;  4X3L A;  1YI2 F;  1YIJ F;  3I55 F;  3CC7 F;  2QA4 F;  3N4Y A;  3AGK A;  5GIN C;  2KG4 A;  2QI2 A;  3OBY A;  1X7P A;  1Q82 H;  3O85 A;  3CCU F;  2OHW A;  1YJN F;  2VGM A;  1K73 H;  5GIP C;  3ON1 A;  1GZ0 A;  3CCL F;  3V7E A;  3SIU A;  1GO0 A;  1YJ9 F;  3WXM B;  3V7Q A;  3RA6 A;  1VQO F;  2VGN A;  1VQ5 F;  4NUT A;  1W3E X;  3G4S F;  3CXC F;  1VQ4 F;  3NVI B;  1VQM F;  5EWR A;  1K9M H;  3LWR C;  3GYQ A;  2KTV A;  3CME F;  1Q81 H;  2AIF A;  1VQN F;  3NVK E;  2OZB A;  3LFO A;  3LWO C;  4BW0 B;  1E7K A;  1SDS A;  1DT9 A;  3HAX D;  3J7A R;  5FLX M;  3VI6 A;  1JJ2 F;  1W2B F;  1CN7 A;  3OW2 F;  2OTL F;  3G6E F;  1W42 A;  2QEX F;  1QVG F;  3CCE F;  1W41 A;  1IPA A;  5EO3 A;  5A2Q M;  3CCJ F;  3PLA C;  3CPW F;  1YHQ F;  1XBI A;  1RA4 A;  2WAL A;  3MCA B;  1Q86 H;  5G4V C;  5GAN K;  4C4W C;  3IR9 A;  2JNB A;  3E20 B;  4TZZ A;  3CC2 F;  1VQ9 F;  2ALE A;  3HJW C;  3J80 M;  1M90 H;  3G71 F; 
#chains in the Genus database with same CATH topology
 3LWV C;  2BO1 A;  2HRU A;  4O4J A;  3S02 A;  3CMA F;  2EWC A;  2CWJ A;  3WGN A;  3ZO8 A;  4X3M A;  3L7Q A;  1RQ2 A;  3TD4 A;  5LYJ A;  1VQ6 F;  2YYE A;  2UYN A;  5MN4 A;  1TUB A;  2NMU A;  3JAK A;  3N2G B;  2Q1X A;  3PAF A;  1KNK A;  4B62 A;  3JAT B;  2H8C A;  5EB0 A;  1U3L A;  2R6R 1;  1N8R H;  3DC2 A;  5B8F A;  1YIT F;  3NMU C;  1NQ3 A;  1GO1 A;  3E22 B;  1QD9 A;  3CCV F;  1XRG A;  1S72 F;  3CYP B;  1Z5V A;  2GLZ A;  3WPX A;  1VQ7 F;  1JD1 A;  4BT4 A;  5HY4 A;  1K8A H;  3ZOP A;  5HY0 A;  2FGY A;  2Z1F A;  3D00 A;  3NK7 A;  2I6D A;  2VAW A;  3HKE B;  1VH8 A;  3LWP C;  3RYI A;  2RHO A;  5IJ9 B;  4IIJ A;  2Z1T A;  4NWO B;  1W55 A;  1YIJ F;  3I55 F;  2R75 1;  3CC7 F;  3N4Y A;  4O4L A;  5LXT B;  2KG4 A;  3DDN A;  3JAS A;  2QI2 A;  3OBY A;  4BT3 A;  5AVM A;  2UZH A;  5EYP A;  3VCZ A;  2VGM A;  5EYP B;  4WBN A;  4YJ3 B;  4O4I A;  3BYQ A;  4X1Y A;  2ZAU A;  3SIU A;  1YJ9 F;  5KMG A;  2QTP A;  2VGN A;  4X1K B;  3G4S F;  1YQN A;  3HKC A;  4X1I B;  3S0H A;  1VQM F;  5EWR A;  1UFY A;  2I6R A;  3GYQ A;  1VQN F;  4BT2 A;  3VTI C;  1COM A;  3VYS C;  3P4E A;  1E7K A;  3N2K B;  1DT9 A;  3HAX D;  3UT5 B;  4EI7 A;  5CA1 A;  5KX5 A;  3ELC A;  4EI9 A;  2VAP A;  1U40 A;  4O4H B;  3C9S A;  3S0W A;  3VOB A;  2HP0 A;  5JQG A;  4TV8 A;  1IPA A;  2CHS A;  5HXU A;  3C8L A;  3IKF A;  3P10 A;  2H6L A;  2LBT A;  5JH7 A;  5CA0 A;  2V9Y A;  3CPW F;  3RYH A;  4WBN B;  1RA4 A;  4I50 B;  5ITZ B;  4O2B B;  2JNB A;  3JAS B;  1RQ7 A;  1GX1 A;  4G4Y A;  3HKB A;  1H47 A;  3HKD A;  5JVD A;  5FNV B;  4G4X A;  3KJK A;  1SA0 A;  5BMV A;  5HY1 A;  4G88 A;  4BT5 A;  1YJW F;  3M4S A;  3JAL B;  2FC3 A;  1NMU B;  5GON A;  4BY9 D;  1YGY A;  1H7M A;  4FFB A;  1KD1 H;  2RHH A;  3MCQ A;  3MQW A;  1CK2 A;  1VQ8 F;  3N4Z A;  3JAR B;  5HWE A;  1W5A A;  3RYF A;  4ZHY B;  3F0D A;  4ZK7 A;  2KTU A;  2DT4 A;  3WPW A;  2LCA A;  4DRX A;  4NQ3 A;  5EIB D;  4EB6 B;  2RB9 A;  4O4H A;  3S0Y A;  1J7H A;  1RLG A;  2VAM A;  5DCV A;  3VMF B;  5C8Y A;  3EOR A;  2OTJ F;  1X7O A;  3V4D A;  3OBW A;  5LP6 A;  2UYK A;  3FD5 A;  1W40 A;  5LXT A;  1JY8 A;  1Q7Y H;  2F9Z C;  3IEQ A;  1VQL F;  5LA6 A;  5HXZ A;  5IJ0 B;  3RA5 A;  5MN6 A;  2N48 A;  2AIZ P;  3SIV A;  1ZWZ A;  5IT9 M;  5G4U C;  4KWE A;  3RE3 A;  4X3L A;  4XCQ A;  4TV9 B;  3AGK A;  1TVK B;  3C9U A;  1IV2 A;  4RQO A;  5BMV B;  1ONI A;  4O4I B;  3K0T A;  4F6R B;  3I3F A;  1VQV A;  4O4J B;  3JAL A;  3V7E A;  1GO0 A;  5KMG B;  5HP8 A;  3WGJ A;  4I55 B;  3RA6 A;  1W5B A;  5EZY A;  5EZY B;  1W3E X;  3FBA A;  3T80 A;  3JAK B;  4ZI7 A;  1IV1 A;  3ZP4 A;  1FNJ A;  4C82 A;  3NVK E;  2VXY A;  4I55 A;  3LFO A;  4B46 A;  4BW0 B;  2ZOV A;  4O2A B;  2UYN B;  3J7A R;  2Q1Y A;  3D01 A;  3VI6 A;  5FLX M;  5CA1 B;  5HY2 A;  1SZQ A;  3WJP A;  2Z1E A;  3OW2 F;  2OTL F;  2RHJ A;  3IEW A;  1W57 A;  1H48 A;  5JQG B;  3CYQ A;  1QVG F;  3CCE F;  1W41 A;  1XHO A;  5EO3 A;  4BVR A;  4BVQ A;  5ITZ A;  3HKE A;  3GHZ A;  3M84 A;  5KX5 B;  4ZOL A;  4G4Z A;  4ZOL B;  4G4W A;  2P6Y A;  3WJR A;  1YHQ F;  2BTO A;  1XBI A;  3WGM A;  2WAL A;  5CB4 A;  3MCA B;  3WGL A;  1Q86 H;  5LP6 B;  5G4V C;  4O2B A;  4TV8 B;  2K1S A;  4B45 A;  5J2T A;  3JVH A;  3F0G A;  3FPI A;  4TZZ A;  4M8I A;  3KE1 A;  3HJW C;  3J80 M;  2DYY A;  1R1M A;  4YJ3 A;  5EB1 B;  4G4V A;  4YJ2 A;  3LWQ C;  2ZVZ A;  3K12 A;  3FFM A;  1VQP F;  4ZHV A;  5LYJ B;  3WJQ A;  4ZHW A;  1IV3 A;  3C9T A;  3CPQ A;  4FFB B;  4ERH A;  3ERN A;  3ZP7 A;  2OTM A;  1NJI H;  2LBW A;  2G9I A;  3CCS F;  4TUY B;  3MDO A;  3I56 F;  1U3P A;  1M1K H;  2HQS C;  1QAH A;  3RYF B;  2LBX A;  1KC8 H;  2HS0 A;  2HVY D;  3UT5 A;  3JAW B;  5MN5 A;  3R0P A;  4R40 B;  2HRY A;  2L26 A;  5IYZ A;  3VYU C;  3TD3 A;  5J2U A;  1PF5 A;  3JCM M;  4DRX B;  4EB6 A;  1PXW A;  3JAW A;  5JCO C;  1Q8R A;  3TD5 A;  4ZHQ A;  4LCK A;  3M1X A;  1ODE A;  2HS4 A;  5LA6 B;  3RYH B;  5IJ0 A;  1JFF B;  3CCR F;  4TV9 A;  1VHA A;  2QA4 F;  2KGW A;  5GIN C;  4I4T B;  1X7P A;  1Q82 H;  3F0E A;  3O85 A;  4C8E A;  1TVK A;  2IQQ A;  2MQE A;  3B6N A;  4BT7 A;  5GIP C;  3ON1 A;  4B5C A;  5LP6 C;  2GZL A;  4U39 A;  2BTQ B;  3V7Q A;  4LNU B;  2ZOD A;  1X25 A;  2HP3 A;  3S03 A;  4NUT A;  4X20 B;  1JN1 A;  3CXC F;  1VQ4 F;  5LOV B;  3NVI B;  1OFU A;  5EAZ A;  1K9M H;  2ZVY A;  3CME F;  5GON B;  2OZB A;  3LWO C;  4U3J A;  5EIB C;  4U3J B;  1FFX A;  1SDS A;  3RYC B;  4O2A A;  2BTU A;  2CHT A;  3N2G A;  3MBM A;  1JJ2 F;  3F6M A;  4C8I A;  1W2B F;  3U0O A;  1VK3 A;  1CN7 A;  2HP0 B;  3G6E F;  2PMP A;  3QUW A;  2Z1U A;  2HS3 A;  3HTN A;  3LYB A;  2QEX F;  4PWT A;  4E6E A;  5J2U B;  1DBF A;  5J2T B;  4HNA B;  3CCJ F;  3PLA C;  5IJ9 A;  2YXZ A;  1KNJ A;  3GTZ A;  5GAN K;  4O4L B;  3E20 B;  1Z5W A;  2W8B C;  3VIU A;  4HNA A;  3VYT C;  3V3T A;  3HKB B;  3KIZ A;  5CA0 B;  3CC2 F;  2HX0 A;  1VQ9 F;  2ALE A;  1W5F A;  4C8G A;  1SA0 B;  1YI2 F;  1M90 H;  5FNV A;  3G71 F;  3KHN A;  1VQK F;  3CCQ F;  4X1Y B;  2ZF8 A;  2GVI A;  3CB2 A;  3VO8 A;  4BT6 A;  4LNU A;  2RHL A;  5GIO C;  3CC4 F;  3WGK A;  1KQS F;  3ESJ A;  3NK6 A;  1TUB B;  5FJ4 C;  3JAR A;  1T0K B;  1QVF F;  3K2X A;  3LME A;  3CG6 A;  3QTY A;  2Z01 A;  2CZW A;  3C9R A;  3VOA A;  3HKC B;  4X1I A;  3KJJ A;  3LDT A;  3CD6 F;  3HWU A;  3IMP A;  3JAM M;  3RYI B;  1X52 A;  3CCM F;  3RYC A;  5JCO A;  3J81 M;  5IYZ B;  1W5E A;  5JH7 B;  1RLU A;  1FSZ A;  4I4T A;  4IIJ B;  3Q8H A;  1JFF A;  3E1Y A;  1T0A A;  5GAP K;  4I50 A;  1IV4 A;  2IG8 A;  2CW4 A;  4ZHQ B;  3I7T A;  3CCU F;  1UI9 A;  2OHW A;  1YJN F;  1K73 H;  2PHN A;  4IHJ A;  4IHJ B;  5HP7 A;  5LOV A;  4YJ2 B;  2UYJ A;  4ZI7 B;  1GZ0 A;  3CCL F;  2CSL A;  3FD6 A;  3WXM B;  3JAT A;  1VQO F;  1VQ5 F;  5JVD B;  4X1K A;  2IAF A;  3IKE A;  3LWR C;  2KTV A;  1Q81 H;  2AIF A;  4TUY A;  1QU9 A;  3D54 A;  3QHD A;  5C8Y B;  4BVS A;  3N2K A;  4DXD A;  3K14 A;  1FNK A;  2B33 A;  1W58 1;  3E22 A;  3S06 A;  3OON A;  1OAP A;  2UYP A;  3F0F A;  1FFX B;  1W42 A;  2H8E A;  4C81 A;  1XV2 A;  2CVL A;  5A2Q M;  1CLI A;  4RHA A;  4BVT A;  1W59 A;  5CB4 B;  1U43 A;  4F6R A;  4C4W C;  3IR9 A;  4EI8 A;  3HKD B;  2AMT A;  4X20 A;  3P0Z A; 
#chains in the Genus database with same CATH homology
 3LWV C;  2BO1 A;  5HY1 A;  3CMA F;  1VQK F;  3CCQ F;  3LWQ C;  4X3M A;  3FFM A;  1VQP F;  1YJW F;  2FC3 A;  1NMU B;  3CPQ A;  1VQ6 F;  5GIO C;  4BY9 D;  1H7M A;  1KD1 H;  1NJI H;  3CC4 F;  1KQS F;  3NK6 A;  1CK2 A;  2LBW A;  3CCS F;  1VQ8 F;  5FJ4 C;  3I56 F;  1T0K B;  3PAF A;  3N4Z A;  5HWE A;  1M1K H;  1QVF F;  2LBX A;  3CG6 A;  1KC8 H;  2KTU A;  1N8R H;  2CZW A;  2HVY D;  1YIT F;  4NQ3 A;  3NMU C;  3CD6 F;  3JAM M;  1GO1 A;  1RLG A;  3CCV F;  5DCV A;  3VMF B;  1S72 F;  1VQ7 F;  2GLZ A;  2OTJ F;  1X7O A;  5HY4 A;  1K8A H;  1X52 A;  5HY0 A;  2FGY A;  3D00 A;  3NK7 A;  3CCM F;  3OBW A;  3J81 M;  1W40 A;  2I6D A;  3JCM M;  2F9Z C;  3LWP C;  1PXW A;  1Q7Y H;  1VQL F;  4LCK A;  5HXZ A;  3RA5 A;  3SIV A;  1ZWZ A;  3E1Y A;  5G4U C;  3CCR F;  5GAP K;  5IT9 M;  4X3L A;  4XCQ A;  1YI2 F;  1YIJ F;  3I55 F;  3CC7 F;  2QA4 F;  3N4Y A;  3AGK A;  5GIN C;  2KG4 A;  2QI2 A;  3OBY A;  1X7P A;  1Q82 H;  3O85 A;  3CCU F;  2OHW A;  1YJN F;  2VGM A;  1K73 H;  5GIP C;  3ON1 A;  1GZ0 A;  3CCL F;  3V7E A;  3SIU A;  1GO0 A;  1YJ9 F;  3WXM B;  3V7Q A;  3RA6 A;  1VQO F;  2VGN A;  1VQ5 F;  4NUT A;  1W3E X;  3G4S F;  3CXC F;  1VQ4 F;  3NVI B;  1VQM F;  5EWR A;  1K9M H;  3LWR C;  3GYQ A;  2KTV A;  3CME F;  1Q81 H;  2AIF A;  1VQN F;  3NVK E;  2OZB A;  3LFO A;  3LWO C;  4BW0 B;  1E7K A;  1SDS A;  4BVS A;  1DT9 A;  3HAX D;  3J7A R;  5FLX M;  3VI6 A;  1JJ2 F;  4EI7 A;  4EI9 A;  5HY2 A;  1W2B F;  1CN7 A;  3OW2 F;  2OTL F;  3G6E F;  1W42 A;  2QEX F;  1QVG F;  3CCE F;  1W41 A;  4BVR A;  1IPA A;  5EO3 A;  4BVQ A;  5HXU A;  5A2Q M;  3CCJ F;  3PLA C;  3CPW F;  1YHQ F;  1XBI A;  1RA4 A;  2WAL A;  4BVT A;  3MCA B;  1Q86 H;  5G4V C;  5GAN K;  4C4W C;  3IR9 A;  2JNB A;  3E20 B;  3V3T A;  4EI8 A;  4TZZ A;  3CC2 F;  1VQ9 F;  2ALE A;  3HJW C;  3J80 M;  1M90 H;  3G71 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...