3K14A

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 535, ethyl 3-methyl-5,6-dihydroimidazo[2,1-b][1,3]thiazole-2-carboxylate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3k14A00
5B8FA 1YQNA 1IV2A 3F0GA 1U3LA 3IEWA 3P10A 1H48A 3FBAA 1JN1A 1W55A 3F0DA 3IKFA 3JVHA 4C8IA 4C82A 1W57A 3F6MA 4C8GA 3B6NA 2PMPA 3Q8HA 3ELCA 1JY8A 3IEQA 1U3PA 3EORA 1IV3A 1KNJA 3K14A 1H47A 4C8EA 1VHAA 3FPIA 1T0AA 3MBMA 1VH8A 3P0ZA 1U43A 2AMTA 3ESJA 1IV4A 1U40A 3KE1A 3QHDA 3F0FA 1GX1A 1IV1A 3F0EA 1KNKA 3T80A 2UZHA 3GHZA 3IKEA 3RE3A 4C81A 3K2XA 2GZLA 3ERNA
chains in the Genus database with same CATH superfamily
3N2GA 1VQ8F 1W2BF 1W55A 3HTNA 1QAHA 3IR9A 4TV9B 3VYSC 3JARB 2Q1YA 4ZHWA 3HKEA 2HVYD 4BT6A 3UT5B 1RLUA 4YJ3B 4BVSA 5HP8A 2UYJA 3C9RA 1XHOA 3S06A 4F6RB 3G6EF 1OAPA 3FD5A 1W5EA 3NK6A 2GLZA 1IPAA 3G71F 3RA5A 1YJWF 4NUTA 1H48A 3RYFA 4ZK7A 5KX5B 1CK2A 3NVKE 4LNUB 3VI6A 4EI9A 2UYNA 4IIJA 3MQWA 5EAZA 3RYHB 3S02A 2F9ZC 4TV8B 5EZYB 5LP6A 2IG8A 5J2TB 3LDTA 1VQNF 1VHAA 2UYKA 3JALB 2HS3A 1K73H 4TUYA 1RQ7A 4BT5A 1XBIA 2HRYA 2R751 3RA6A 3M1XA 2CHTA 5CB4B 3WPXA 4X1KB 1KQSF 4IHJB 2AIFA 5MN6A 2IAFA 1ONIA 1GZ0A 1W5FA 3E20B 4LCKA 2QTPA 3N4ZA 3WGJA 2VAWA 3C9TA 4I55B 1M90H 4YJ2A 2BO1A 5LXTA 3CPWF 2OTMA 3IKFA 3JAKB 5AVMA 1VQPF 2HP0A 3K12A 3IEQA 2RB9A 2GVIA 3LWVC 1JJ2F 3ZP7A 4NWOB 3K0TA 1XV2A 1FSZA 4X20A 3P4EA 2CSLA 1M1KH 5IJ9A 4BT3A 1X7PA 5LA6A 4G88A 5CA1B 3WGNA 4DRXA 5HWEA 4EB6A 2MQEA 4C8EA 5A2QM 2L26A 4XCQA 5IJ0A 3JAWA 3RYCA 1KC8H 1QVFF 5IYZB 3JVHA 3I55F 2OTLF 1W57A 3HWUA 3GYQA 4TV9A 4FFBB 3G4SF 3R0PA 2CVLA 3JARA 2VGNA 2OZBA 1VQ4F 2HS0A 1OFUA 1W42A 2QEXF 3TD4A 4YJ3A 2DYYA 3LFOA 2CZWA 3WGKA 1VQKF 4F6RA 3VTIC 3CD6F 2CHSA 4TZZA 4KWEA 3E1YA 2Q1XA 4O4IB 5FJ4C 4R40B 1H7MA 5B8FA 1W581 4O4HB 3IEWA 3O85A 3FBAA 3V7EA 4ZOLB 3F0DA 5GANK 5JCOC 3CCMF 2K1SA 1FFXB 4U3JB 4C8GA 5EB1B 5KX5A 4LNUA 1N8RH 3K14A 2QI2A 1QD9A 3RYHA 4G4WA 4TV8A 5J2TA 3JALA 1CLIA 1DBFA 5GINC 1W5BA 3F0EA 5EWRA 3T80A 2UZHA 5CB4A 4X1KA 1T0KB 4IHJA 3LWRC 4BVRA 1VK3A 4U39A 2B33A 4ERHA 4I55A 4C8IA 1RQ2A 5LOVB 5J2UB 3JAKA 5EIBD 1Z5VA 1SA0B 2HS4A 4G4VA 3EORA 3ZP4A 5JH7B 5LYJB 4BY9D 1PF5A 4BW0B 1S72F 5FLXM 3JAMM 2I6DA 5HY2A 3CCEF 3ESJA 5MN5A 3CC2F 1NQ3A 1RA4A 3WGLA 1Q81H 3VIUA 3IKEA 1FNJA 4I50B 3PAFA 4O2AB 3ERNA 3VYTC 1YQNA 3VMFB 5CA1A 2P6YA 1GO1A 1NMUB 3SIVA 4BVQA 5GONB 3CCLF 1E7KA 3VO8A 5IYZA 1J7HA 1X25A 4WBNB 3CCRF 2VAMA 3CCVF 3J80M 1VQ6F 4FFBA 3MBMA 1VH8A 4EI7A 4I4TB 2OTJF 1JFFB 3N2KB 4RQOA 3CC4F 3TD5A 5EO3A 4O4LB 1Q7YH 2Z1TA 5JVDB 3CYQA 2W8BC 5ITZB 4O4IA 3CB2A 4O4HA 3V3TA 4ZI7B 3WGMA 5GIPC 3V4DA 2PMPA 4ZOLA 3ZO8A 3ELCA 1VQVA 3BYQA 1FFXA 5EYPB 4U3JA 5HY1A 3WJQA 1YIJF 1YJ9F 1X52A 1YHQF 2Z1UA 5C8YB 3JCMM 4ZHYB 1YGYA 3IMPA 3HKBB 3NK7A 3E22B 1YJNF 3RE3A 4G4YA 5BMVB 3OBWA 1VQOF 2WALA 3C8LA 4BT4A 3N4YA 3VCZA 1VQMF 3V7QA 1Q86H 1IV3A 1KNJA 2NMUA 2CWJA 5J2UA 1T0AA 4X3LA 1SA0A 5LYJA 5JH7A 3UT5A 2RHJA 1W40A 3QHDA 3PLAC 3SIUA 1KNKA 1JD1A 3KIZA 3F0GA 3KJJA 4I50A 4IIJB 4O2AA 1VQLF 5JQGB 3U0OA 3HAXD 3JATB 1JY8A 2H6LA 5GONA 3VOAA 5HY0A 3RYIB 2KTVA 5KMGB 2H8CA 2HX0A 4WBNA 3D01A 3P0ZA 5EZYA 2HRUA 4HNAB 4O4JB 4I4TA 1JFFA 3FD6A 3N2KA 4RHAA 2Z01A 3KJKA 3K2XA 5MN4A 4O4LA 5HXZA 3VYUC 2VXYA 3HKDB 5JVDA 3OW2F 2RHHA 2G9IA 5ITZA 3WXMB 3CYPB 3CCUF 2CW4A 2QA4F 1W59A 4ZI7A 3S03A 3NVIB 1CN7A 1TUBB 1QVGF 5GIOC 2JNBA 5G4UC 4M8IA 2HP3A 5EYPA 4ZHQB 5CA0B 5LA6B 2BTOA 2H8EA 3DDNA 3MCAB 3KE1A 1IV4A 3S0HA 4EB6B 2KTUA 5LP6C 5C8YA 5HXUA 3CXCF 3HKBA 3VOBA 3E22A 4DXDA 3S0WA 1U3LA 5BMVA 2FGYA 5IT9M 4G4XA 3WJRA 4B5CA 1H47A 4NQ3A 1R1MA 2Z1EA 4B46A 2ZVZA 2ZODA 1UI9A 1U43A 3CCQF 3NMUC 2N48A 3I56F 3HKCB 3GHZA 2AIZP 2ZVYA 5EIBC 1Q82H 2GZLA 2IQQA 3CCJF 3M84A 3JASB 5HY4A 3TD3A 4BT7A 3WPWA 5JQGA 2R6R1 3B6NA 4X1YB 3CMEF 2KGWA 3C9SA 1KD1H 3QUWA 1FNKA 2HQSC 2DT4A 4X1IB 3FFMA 3JATA 1Z5WA 3FPIA 1TVKB 4O2BB 5FNVB 3ZOPA 1VQ7F 3CC7F 3RYIA 2YYEA 2KG4A 5KMGA 2Z1FA 3AGKA 4HNAA 4O4JA 4E6EA 5EB0A 1PXWA 1QU9A 3N2GB 1GO0A 3LYBA 1UFYA 3D00A 3M4SA 2BTQB 4C4WC 4PWTA 1YI2F 3HKEB 5DCVA 3HKDA 1W3EX 3CMAF 2ZOVA 3MDOA 1U3PA 3DC2A 5G4VC 3CPQA 2LBTA 5LOVA 1TUBA 1U40A 3D54A 4ZHQA 3F0FA 5CA0A 1IV1A 2EWCA 3LWQC 1VQ5F 3J7AR 1NJIH 3CCSF 2I6RA 2BTUA 3RYFB 4B45A 2LBWA 2YXZA 3P10A 1SZQA 2UYNB 1JN1A 1W41A 2RHOA 4BVTA 4BT2A 5LP6B 4B62A 1SDSA 1K9MH 3CG6A 3QTYA 2OHWA 4TUYB 1ODEA 3C9UA 4EI8A 2LBXA 5HP7A 2ZAUA 2ZF8A 3WJPA 1K8AH 4YJ2B 3HKCA 5LXTB 3ON1A 2FC3A 1IV2A 2PHNA 2HP0B 2VAPA 3OBYA 3JASA 1COMA 3OONA 3KHNA 2VGMA 1X7OA 3I7TA 1RLGA 3L7QA 2LCAA 4C82A 1YITF 3F6MA 1Q8RA 3Q8HA 2RHLA 3HJWC 3I3FA 4X3MA 1XRGA 1DT9A 3GTZA 4X1YA 4ZHVA 2ALEA 4X20B 3S0YA 3J81M 1ZWZA 3LWOC 2V9YA 1W5AA 4X1IA 5IJ9B 2AMTA 1TVKA 4O2BA 5FNVA 4DRXB 1GX1A 3MCQA 2UYPA 5GAPK 3LWPC 5JCOA 5IJ0B 3JAWB 3LMEA 4G4ZA 4C81A 3RYCB 1VQ9F
chains in the Genus database with same CATH topology
5B8FA 1YQNA 1IV2A 3F0GA 1U3LA 3IEWA 3P10A 1H48A 3FBAA 1JN1A 1W55A 3F0DA 3IKFA 3JVHA 4C8IA 4C82A 1W57A 3F6MA 4C8GA 3B6NA 2PMPA 3Q8HA 3ELCA 1JY8A 3IEQA 1U3PA 3EORA 1IV3A 1KNJA 3K14A 1H47A 4C8EA 1VHAA 3FPIA 1T0AA 3MBMA 1VH8A 3P0ZA 1U43A 2AMTA 3ESJA 1IV4A 1U40A 3KE1A 3QHDA 3F0FA 1GX1A 1IV1A 3F0EA 1KNKA 3T80A 2UZHA 3GHZA 3IKEA 3RE3A 4C81A 3K2XA 2GZLA 3ERNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B8F A;  1YQN A;  1IV2 A;  3F0G A;  1U3L A;  3IEW A;  3P10 A;  1H48 A;  3FBA A;  1JN1 A;  1W55 A;  3F0D A;  3IKF A;  3JVH A;  4C8I A;  4C82 A;  1W57 A;  3F6M A;  4C8G A;  3B6N A;  2PMP A;  3Q8H A;  3ELC A;  1JY8 A;  3IEQ A;  1U3P A;  3EOR A;  1IV3 A;  1KNJ A;  3K14 A;  1H47 A;  4C8E A;  1VHA A;  3FPI A;  1T0A A;  3MBM A;  1VH8 A;  3P0Z A;  1U43 A;  2AMT A;  3ESJ A;  1IV4 A;  1U40 A;  3KE1 A;  3QHD A;  3F0F A;  1GX1 A;  1IV1 A;  3F0E A;  1KNK A;  3T80 A;  2UZH A;  3GHZ A;  3IKE A;  3RE3 A;  4C81 A;  3K2X A;  2GZL A;  3ERN A; 
#chains in the Genus database with same CATH topology
 3N2G A;  1VQ8 F;  1W2B F;  1W55 A;  3HTN A;  1QAH A;  3IR9 A;  4TV9 B;  3VYS C;  3JAR B;  2Q1Y A;  4ZHW A;  3HKE A;  2HVY D;  4BT6 A;  3UT5 B;  1RLU A;  4YJ3 B;  4BVS A;  5HP8 A;  2UYJ A;  3C9R A;  1XHO A;  3S06 A;  4F6R B;  3G6E F;  1OAP A;  3FD5 A;  1W5E A;  3NK6 A;  2GLZ A;  1IPA A;  3G71 F;  3RA5 A;  1YJW F;  4NUT A;  1H48 A;  3RYF A;  4ZK7 A;  5KX5 B;  1CK2 A;  3NVK E;  4LNU B;  3VI6 A;  4EI9 A;  2UYN A;  4IIJ A;  3MQW A;  5EAZ A;  3RYH B;  3S02 A;  2F9Z C;  4TV8 B;  5EZY B;  5LP6 A;  2IG8 A;  5J2T B;  3LDT A;  1VQN F;  1VHA A;  2UYK A;  3JAL B;  2HS3 A;  1K73 H;  4TUY A;  1RQ7 A;  4BT5 A;  1XBI A;  2HRY A;  2R75 1;  3RA6 A;  3M1X A;  2CHT A;  5CB4 B;  3WPX A;  4X1K B;  1KQS F;  4IHJ B;  2AIF A;  5MN6 A;  2IAF A;  1ONI A;  1GZ0 A;  1W5F A;  3E20 B;  4LCK A;  2QTP A;  3N4Z A;  3WGJ A;  2VAW A;  3C9T A;  4I55 B;  1M90 H;  4YJ2 A;  2BO1 A;  5LXT A;  3CPW F;  2OTM A;  3IKF A;  3JAK B;  5AVM A;  1VQP F;  2HP0 A;  3K12 A;  3IEQ A;  2RB9 A;  2GVI A;  3LWV C;  1JJ2 F;  3ZP7 A;  4NWO B;  3K0T A;  1XV2 A;  1FSZ A;  4X20 A;  3P4E A;  2CSL A;  1M1K H;  5IJ9 A;  4BT3 A;  1X7P A;  5LA6 A;  4G88 A;  5CA1 B;  3WGN A;  4DRX A;  5HWE A;  4EB6 A;  2MQE A;  4C8E A;  5A2Q M;  2L26 A;  4XCQ A;  5IJ0 A;  3JAW A;  3RYC A;  1KC8 H;  1QVF F;  5IYZ B;  3JVH A;  3I55 F;  2OTL F;  1W57 A;  3HWU A;  3GYQ A;  4TV9 A;  4FFB B;  3G4S F;  3R0P A;  2CVL A;  3JAR A;  2VGN A;  2OZB A;  1VQ4 F;  2HS0 A;  1OFU A;  1W42 A;  2QEX F;  3TD4 A;  4YJ3 A;  2DYY A;  3LFO A;  2CZW A;  3WGK A;  1VQK F;  4F6R A;  3VTI C;  3CD6 F;  2CHS A;  4TZZ A;  4KWE A;  3E1Y A;  2Q1X A;  4O4I B;  5FJ4 C;  4R40 B;  1H7M A;  5B8F A;  1W58 1;  4O4H B;  3IEW A;  3O85 A;  3FBA A;  3V7E A;  4ZOL B;  3F0D A;  5GAN K;  5JCO C;  3CCM F;  2K1S A;  1FFX B;  4U3J B;  4C8G A;  5EB1 B;  5KX5 A;  4LNU A;  1N8R H;  3K14 A;  2QI2 A;  1QD9 A;  3RYH A;  4G4W A;  4TV8 A;  5J2T A;  3JAL A;  1CLI A;  1DBF A;  5GIN C;  1W5B A;  3F0E A;  5EWR A;  3T80 A;  2UZH A;  5CB4 A;  4X1K A;  1T0K B;  4IHJ A;  3LWR C;  4BVR A;  1VK3 A;  4U39 A;  2B33 A;  4ERH A;  4I55 A;  4C8I A;  1RQ2 A;  5LOV B;  5J2U B;  3JAK A;  5EIB D;  1Z5V A;  1SA0 B;  2HS4 A;  4G4V A;  3EOR A;  3ZP4 A;  5JH7 B;  5LYJ B;  4BY9 D;  1PF5 A;  4BW0 B;  1S72 F;  5FLX M;  3JAM M;  2I6D A;  5HY2 A;  3CCE F;  3ESJ A;  5MN5 A;  3CC2 F;  1NQ3 A;  1RA4 A;  3WGL A;  1Q81 H;  3VIU A;  3IKE A;  1FNJ A;  4I50 B;  3PAF A;  4O2A B;  3ERN A;  3VYT C;  1YQN A;  3VMF B;  5CA1 A;  2P6Y A;  1GO1 A;  1NMU B;  3SIV A;  4BVQ A;  5GON B;  3CCL F;  1E7K A;  3VO8 A;  5IYZ A;  1J7H A;  1X25 A;  4WBN B;  3CCR F;  2VAM A;  3CCV F;  3J80 M;  1VQ6 F;  4FFB A;  3MBM A;  1VH8 A;  4EI7 A;  4I4T B;  2OTJ F;  1JFF B;  3N2K B;  4RQO A;  3CC4 F;  3TD5 A;  5EO3 A;  4O4L B;  1Q7Y H;  2Z1T A;  5JVD B;  3CYQ A;  2W8B C;  5ITZ B;  4O4I A;  3CB2 A;  4O4H A;  3V3T A;  4ZI7 B;  3WGM A;  5GIP C;  3V4D A;  2PMP A;  4ZOL A;  3ZO8 A;  3ELC A;  1VQV A;  3BYQ A;  1FFX A;  5EYP B;  4U3J A;  5HY1 A;  3WJQ A;  1YIJ F;  1YJ9 F;  1X52 A;  1YHQ F;  2Z1U A;  5C8Y B;  3JCM M;  4ZHY B;  1YGY A;  3IMP A;  3HKB B;  3NK7 A;  3E22 B;  1YJN F;  3RE3 A;  4G4Y A;  5BMV B;  3OBW A;  1VQO F;  2WAL A;  3C8L A;  4BT4 A;  3N4Y A;  3VCZ A;  1VQM F;  3V7Q A;  1Q86 H;  1IV3 A;  1KNJ A;  2NMU A;  2CWJ A;  5J2U A;  1T0A A;  4X3L A;  1SA0 A;  5LYJ A;  5JH7 A;  3UT5 A;  2RHJ A;  1W40 A;  3QHD A;  3PLA C;  3SIU A;  1KNK A;  1JD1 A;  3KIZ A;  3F0G A;  3KJJ A;  4I50 A;  4IIJ B;  4O2A A;  1VQL F;  5JQG B;  3U0O A;  3HAX D;  3JAT B;  1JY8 A;  2H6L A;  5GON A;  3VOA A;  5HY0 A;  3RYI B;  2KTV A;  5KMG B;  2H8C A;  2HX0 A;  4WBN A;  3D01 A;  3P0Z A;  5EZY A;  2HRU A;  4HNA B;  4O4J B;  4I4T A;  1JFF A;  3FD6 A;  3N2K A;  4RHA A;  2Z01 A;  3KJK A;  3K2X A;  5MN4 A;  4O4L A;  5HXZ A;  3VYU C;  2VXY A;  3HKD B;  5JVD A;  3OW2 F;  2RHH A;  2G9I A;  5ITZ A;  3WXM B;  3CYP B;  3CCU F;  2CW4 A;  2QA4 F;  1W59 A;  4ZI7 A;  3S03 A;  3NVI B;  1CN7 A;  1TUB B;  1QVG F;  5GIO C;  2JNB A;  5G4U C;  4M8I A;  2HP3 A;  5EYP A;  4ZHQ B;  5CA0 B;  5LA6 B;  2BTO A;  2H8E A;  3DDN A;  3MCA B;  3KE1 A;  1IV4 A;  3S0H A;  4EB6 B;  2KTU A;  5LP6 C;  5C8Y A;  5HXU A;  3CXC F;  3HKB A;  3VOB A;  3E22 A;  4DXD A;  3S0W A;  1U3L A;  5BMV A;  2FGY A;  5IT9 M;  4G4X A;  3WJR A;  4B5C A;  1H47 A;  4NQ3 A;  1R1M A;  2Z1E A;  4B46 A;  2ZVZ A;  2ZOD A;  1UI9 A;  1U43 A;  3CCQ F;  3NMU C;  2N48 A;  3I56 F;  3HKC B;  3GHZ A;  2AIZ P;  2ZVY A;  5EIB C;  1Q82 H;  2GZL A;  2IQQ A;  3CCJ F;  3M84 A;  3JAS B;  5HY4 A;  3TD3 A;  4BT7 A;  3WPW A;  5JQG A;  2R6R 1;  3B6N A;  4X1Y B;  3CME F;  2KGW A;  3C9S A;  1KD1 H;  3QUW A;  1FNK A;  2HQS C;  2DT4 A;  4X1I B;  3FFM A;  3JAT A;  1Z5W A;  3FPI A;  1TVK B;  4O2B B;  5FNV B;  3ZOP A;  1VQ7 F;  3CC7 F;  3RYI A;  2YYE A;  2KG4 A;  5KMG A;  2Z1F A;  3AGK A;  4HNA A;  4O4J A;  4E6E A;  5EB0 A;  1PXW A;  1QU9 A;  3N2G B;  1GO0 A;  3LYB A;  1UFY A;  3D00 A;  3M4S A;  2BTQ B;  4C4W C;  4PWT A;  1YI2 F;  3HKE B;  5DCV A;  3HKD A;  1W3E X;  3CMA F;  2ZOV A;  3MDO A;  1U3P A;  3DC2 A;  5G4V C;  3CPQ A;  2LBT A;  5LOV A;  1TUB A;  1U40 A;  3D54 A;  4ZHQ A;  3F0F A;  5CA0 A;  1IV1 A;  2EWC A;  3LWQ C;  1VQ5 F;  3J7A R;  1NJI H;  3CCS F;  2I6R A;  2BTU A;  3RYF B;  4B45 A;  2LBW A;  2YXZ A;  3P10 A;  1SZQ A;  2UYN B;  1JN1 A;  1W41 A;  2RHO A;  4BVT A;  4BT2 A;  5LP6 B;  4B62 A;  1SDS A;  1K9M H;  3CG6 A;  3QTY A;  2OHW A;  4TUY B;  1ODE A;  3C9U A;  4EI8 A;  2LBX A;  5HP7 A;  2ZAU A;  2ZF8 A;  3WJP A;  1K8A H;  4YJ2 B;  3HKC A;  5LXT B;  3ON1 A;  2FC3 A;  1IV2 A;  2PHN A;  2HP0 B;  2VAP A;  3OBY A;  3JAS A;  1COM A;  3OON A;  3KHN A;  2VGM A;  1X7O A;  3I7T A;  1RLG A;  3L7Q A;  2LCA A;  4C82 A;  1YIT F;  3F6M A;  1Q8R A;  3Q8H A;  2RHL A;  3HJW C;  3I3F A;  4X3M A;  1XRG A;  1DT9 A;  3GTZ A;  4X1Y A;  4ZHV A;  2ALE A;  4X20 B;  3S0Y A;  3J81 M;  1ZWZ A;  3LWO C;  2V9Y A;  1W5A A;  4X1I A;  5IJ9 B;  2AMT A;  1TVK A;  4O2B A;  5FNV A;  4DRX B;  1GX1 A;  3MCQ A;  2UYP A;  5GAP K;  3LWP C;  5JCO A;  5IJ0 B;  3JAW B;  3LME A;  4G4Z A;  4C81 A;  3RYC B;  1VQ9 F; 
#chains in the Genus database with same CATH homology
 5B8F A;  1YQN A;  1IV2 A;  3F0G A;  1U3L A;  3IEW A;  3P10 A;  1H48 A;  3FBA A;  1JN1 A;  1W55 A;  3F0D A;  3IKF A;  3JVH A;  4C8I A;  4C82 A;  1W57 A;  3F6M A;  4C8G A;  3B6N A;  2PMP A;  3Q8H A;  3ELC A;  1JY8 A;  3IEQ A;  1U3P A;  3EOR A;  1IV3 A;  1KNJ A;  3K14 A;  1H47 A;  4C8E A;  1VHA A;  3FPI A;  1T0A A;  3MBM A;  1VH8 A;  3P0Z A;  1U43 A;  2AMT A;  3ESJ A;  1IV4 A;  1U40 A;  3KE1 A;  3QHD A;  3F0F A;  1GX1 A;  1IV1 A;  3F0E A;  1KNK A;  3T80 A;  2UZH A;  3GHZ A;  3IKE A;  3RE3 A;  4C81 A;  3K2X A;  2GZL A;  3ERN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...