3K14A

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 535, ethyl 3-methyl-5,6-dihydroimidazo[2,1-b][1,3]thiazole-2-carboxylate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3k14A00
3JVHA 3T80A 3EORA 3ESJA 3ERNA 3IEQA 3K14A 3P0ZA 3QHDA 3F0FA 3IKFA 3K2XA 4C8IA 1JY8A 1JN1A 1IV2A 4C81A 1W57A 2GZLA 2PMPA 3B6NA 3GHZA 3F6MA 3F0GA 3KE1A 3F0EA 3F0DA 3Q8HA 3MBMA 1YQNA 2UZHA 1U43A 3P10A 3IKEA 4C82A 1IV4A 4C8EA 4C8GA 1IV3A 1W55A 1H47A 1KNKA 1H48A 3IEWA 1U40A 5B8FA 1T0AA 1GX1A 3RE3A 3ELCA 2AMTA 3FBAA 3FPIA 1IV1A 1VHAA 1VH8A 1KNJA 1U3LA 1U3PA
chains in the Genus database with same CATH superfamily
3JAWB 3IEQA 1TVKB 3K14A 1VQKF 2LBWA 3CG6A 4X1IB 2RHOA 2GVIA 2ZOVA 2UYJA 3QTYA 3WJPA 2VAPA 3WXMB 3HKBA 1W581 4EI8A 3NK6A 2AIZP 3RYHA 4O4IB 3HTNA 1M1KH 4G4YA 3GYQA 3M4SA 4X20A 5HXZA 4YJ3A 1XRGA 5LYJA 4EB6A 4X3MA 1TUBB 3N2GB 4F6RA 3TD5A 1Q8RA 1YJNF 1JJ2F 2BTOA 5J2TB 3WGMA 1GX1A 4HNAA 4TV9A 4DRXA 3VMFB 3BYQA 1VH8A 4O4JA 4TUYA 2DT4A 3R0PA 5LA6A 2B33A 1SZQA 2CVLA 3M84A 4O2BB 2BO1A 3KHNA 3S0YA 3JASA 5ITZB 3VYSC 1YGYA 1K73H 3SIVA 2V9YA 3CCEF 4U39A 4NUTA 3HKDB 2HS3A 1KQSF 5CB4B 2CW4A 4TV8A 3I56F 3CC7F 4G88A 3JVHA 1GZ0A 2CHSA 2FC3A 2KG4A 3JCMM 1VQLF 4BW0B 5MN6A 4ZHWA 2Z1TA 3RYFA 3CCRF 4O2AA 4ZK7A 3C9TA 1PF5A 2HP0A 2VGMA 2ZVZA 4DXDA 1ONIA 3RYCA 5HWEA 5MN4A 1QVGF 3WPWA 1NQ3A 4WBNA 1W5EA 3VOBA 1H48A 3IEWA 2OHWA 4I55B 1VQ9F 1GO0A 5IYZA 3I55F 4G4ZA 3HWUA 3NMUC 2KGWA 1W59A 1SA0B 1XBIA 5EZYB 4X1IA 1VQ5F 1Q86H 3AGKA 2GZLA 3F0DA 1RA4A 3Q8HA 3NK7A 5HY2A 3CCMF 5IJ9A 2HRUA 4O4HB 4BT4A 4ERHA 1U40A 3N2GA 5J2TA 4FFBA 2HX0A 1U3LA 4BVQA 3N2KA 5BMVB 3EORA 3GTZA 4EI7A 3F0FA 2LBXA 3VTIC 5JCOA 2YXZA 2QI2A 1JN1A 4O2BA 5J2UB 2ZF8A 3LYBA 3WGLA 3LFOA 4M8IA 3D00A 1T0KB 3VCZA 3CB2A 5EIBD 2I6DA 3KJKA 2VAWA 4BVTA 1R1MA 3UT5B 1IV3A 3D01A 4C4WC 4U3JA 3PAFA 5IJ0A 3ELCA 3KIZA 1VHAA 4BY9D 3CCQF 5JQGA 4YJ2A 3CCUF 2HS4A 2HP3A 2GLZA 3RA6A 3RYIB 2VGNA 1JY8A 2G9IA 4X1YA 3TD4A 3WPXA 3CXCF 2EWCA 3ZOPA 1FFXB 5KX5B 4B62A 2CWJA 3LDTA 2PHNA 2WALA 3WGKA 1YITF 1YJWF 1W55A 1NJIH 1Z5VA 2UYNB 5G4VC 3C9UA 5EO3A 4BT5A 2KTVA 2FGYA 2N48A 1RLGA 5CA0B 3ZO8A 1UFYA 1CLIA 2Q1XA 3IKFA 1VQ4F 4I55A 3C9SA 4IIJB 4C8IA 3CC4F 3FD6A 1X7PA 3C9RA 3E22B 4ZHYB 2MQEA 3OW2F 5LXTA 1W57A 2K1SA 1ZWZA 3JAKA 3N4ZA 4RQOA 4ZI7B 5C8YB 4ZHQB 1COMA 5KMGB 3JALA 4BVRA 4C8GA 5HXUA 1KNKA 3CCSF 3RE3A 5FNVB 3G71F 4XCQA 2HQSC 5AVMA 5GONA 3OBYA 1IPAA 1X7OA 1RQ2A 5HP7A 4LNUA 5EB1B 5JVDA 1W5FA 2ALEA 5EIBC 3JATB 1JFFB 3VOAA 4TZZA 5LOVB 3V4DA 2H8EA 3SIUA 5LP6A 5J2UA 3WGNA 3LWVC 1VQ6F 3E20B 4ZOLB 5EYPB 3J7AR 2ZAUA 5JH7B 1K8AH 3S03A 4X1KB 5GIOC 3LMEA 1X25A 3CD6F 4I50B 1KNJA 3LWRC 4NWOB 2UYKA 3CCJF 3HKBB 3P0ZA 5HY1A 1W2BF 3V7EA 3V3TA 3JARB 4X3LA 3RYHB 3JAWA 4LCKA 1TVKA 2Z1EA 2OTJF 4X20B 2UYPA 3RYIA 1VQMF 4YJ3B 2RB9A 4BVSA 3KJJA 4I4TB 2CZWA 3F6MA 4F6RB 4O4IA 4G4VA 1W3EX 4O4LB 5KX5A 4TV9B 3TD3A 1W41A 1IV4A 1XHOA 1XV2A 4NQ3A 2LCAA 4O4JB 1Q82H 1TUBA 4BT3A 1VQ7F 3FPIA 1YHQF 2IG8A 1DBFA 1OAPA 3CYPB 3ERNA 4G4XA 2QTPA 3JASB 1SDSA 3E1YA 3S0WA 4IIJA 3E22A 4BT7A 4TV8B 3HKCB 3GHZA 2RHHA 4G4WA 5C8YA 4ZI7A 5ITZA 5JCOC 3S02A 1YQNA 4ZHQA 2BTQB 3HKDA 3DC2A 1H47A 5CB4A 2CSLA 1DT9A 5FLXM 3P4EA 2HS0A 2RHJA 3VI6A 5HP8A 2Z01A 1KD1H 3DDNA 3K2XA 3G4SF 2HP0B 5GAPK 1H7MA 3VO8A 2L26A 1VQ8F 2Z1FA 2R751 4C81A 4RHAA 4WBNB 3B6NA 3KE1A 1VQNF 3LWQC 1FSZA 2HVYD 4ZOLA 3I3FA 5EAZA 5EYPA 1Q81H 2HRYA 5JH7A 3MCQA 4X1KA 3HAXD 2CHTA 4I50A 3WJRA 1QAHA 1YJ9F 1VQVA 3HKEB 2F9ZC 1QD9A 1VQOF 1OFUA 3JARA 1IV2A 4R40B 1SA0A 5EZYA 1KC8H 2YYEA 4IHJB 3CYQA 5IJ9B 2VAMA 3WGJA 4I4TA 4KWEA 2KTUA 1U43A 3O85A 5IT9M 5GINC 3M1XA 4BT2A 4FFBB 4O4LA 5B8FA 3N2KB 3J81M 2LBTA 2AMTA 2OTMA 2IQQA 5CA1B 4O4HA 5G4UC 3NVKE 4B46A 3FFMA 1U3PA 5EB0A 1N8RH 3ON1A 5GIPC 1CK2A 3VYTC 3K0TA 5BMVA 4E6EA 1GO1A 5GANK 1UI9A 3K12A 3WJQA 1FNJA 1FNKA 3CMEF 3CPWF 3HKCA 4U3JB 1VQPF 5IJ0B 3CCLF 5LP6C 2JNBA 3UT5A 5JQGB 3FBAA 5MN5A 4YJ2B 1J7HA 1QU9A 3S06A 3J80M 1X52A 4X1YB 3PLAC 1RLUA 3OONA 3L7QA 1W42A 3LWPC 5HY0A 3G6EF 2ZVYA 5LYJB 3MDOA 4EB6B 2NMUA 3F0GA 4EI9A 3MBMA 2UZHA 3MQWA 1FFXA 3P10A 1M90H 4HNAB 4DRXB 3ZP4A 2AIFA 3RA5A 4TUYB 3QUWA 1QVFF 1ODEA 1IV1A 2UYNA 3MCAB 3CMAF 5LA6B 3T80A 3ESJA 1VK3A 3S0HA 5CA0A 1PXWA 5EWRA 2OZBA 3U0OA 2BTUA 2I6RA 5LXTB 3JAKB 1S72F 3V7QA 1JD1A 3HKEA 4ZHVA 1Q7YH 2OTLF 2PMPA 3JALB 3HJWC 1K9MH 1CN7A 4IHJA 3IR9A 3IKEA 4C82A 5GONB 3D54A 3IMPA 3N4YA 5A2QM 5KMGA 3CPQA 4LNUB 4B5CA 5JVDB 5CA1A 2Z1UA 5FNVA 2Q1YA 1YI2F 3I7TA 1W5BA 3QHDA 2IAFA 3RYFB 4O2AB 4PWTA 2ZODA 3VIUA 4BT6A 1YIJF 2R6R1 3RYCB 3FD5A 5LP6B 1E7KA 5DCVA 3CC2F 5FJ4C 3C8LA 3LWOC 2QA4F 1W40A 3VYUC 3JATA 2QEXF 2P6YA 1JFFA 3F0EA 3OBWA 1W5AA 5LOVA 3NVIB 3ZP7A 1RQ7A 4C8EA 1NMUB 3JAMM 1Z5WA 2H6LA 1T0AA 4B45A 2DYYA 2VXYA 5IYZB 2H8CA 2RHLA 3CCVF 5HY4A 2W8BC
chains in the Genus database with same CATH topology
3JVHA 3T80A 3EORA 3ESJA 3ERNA 3IEQA 3K14A 3P0ZA 3QHDA 3F0FA 3IKFA 3K2XA 4C8IA 1JY8A 1JN1A 1IV2A 4C81A 1W57A 2GZLA 2PMPA 3B6NA 3GHZA 3F6MA 3F0GA 3KE1A 3F0EA 3F0DA 3Q8HA 3MBMA 1YQNA 2UZHA 1U43A 3P10A 3IKEA 4C82A 1IV4A 4C8EA 4C8GA 1IV3A 1W55A 1H47A 1KNKA 1H48A 3IEWA 1U40A 5B8FA 1T0AA 1GX1A 3RE3A 3ELCA 2AMTA 3FBAA 3FPIA 1IV1A 1VHAA 1VH8A 1KNJA 1U3LA 1U3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVH A;  3T80 A;  3EOR A;  3ESJ A;  3ERN A;  3IEQ A;  3K14 A;  3P0Z A;  3QHD A;  3F0F A;  3IKF A;  3K2X A;  4C8I A;  1JY8 A;  1JN1 A;  1IV2 A;  4C81 A;  1W57 A;  2GZL A;  2PMP A;  3B6N A;  3GHZ A;  3F6M A;  3F0G A;  3KE1 A;  3F0E A;  3F0D A;  3Q8H A;  3MBM A;  1YQN A;  2UZH A;  1U43 A;  3P10 A;  3IKE A;  4C82 A;  1IV4 A;  4C8E A;  4C8G A;  1IV3 A;  1W55 A;  1H47 A;  1KNK A;  1H48 A;  3IEW A;  1U40 A;  5B8F A;  1T0A A;  1GX1 A;  3RE3 A;  3ELC A;  2AMT A;  3FBA A;  3FPI A;  1IV1 A;  1VHA A;  1VH8 A;  1KNJ A;  1U3L A;  1U3P A; 
#chains in the Genus database with same CATH topology
 3JAW B;  3IEQ A;  1TVK B;  3K14 A;  1VQK F;  2LBW A;  3CG6 A;  4X1I B;  2RHO A;  2GVI A;  2ZOV A;  2UYJ A;  3QTY A;  3WJP A;  2VAP A;  3WXM B;  3HKB A;  1W58 1;  4EI8 A;  3NK6 A;  2AIZ P;  3RYH A;  4O4I B;  3HTN A;  1M1K H;  4G4Y A;  3GYQ A;  3M4S A;  4X20 A;  5HXZ A;  4YJ3 A;  1XRG A;  5LYJ A;  4EB6 A;  4X3M A;  1TUB B;  3N2G B;  4F6R A;  3TD5 A;  1Q8R A;  1YJN F;  1JJ2 F;  2BTO A;  5J2T B;  3WGM A;  1GX1 A;  4HNA A;  4TV9 A;  4DRX A;  3VMF B;  3BYQ A;  1VH8 A;  4O4J A;  4TUY A;  2DT4 A;  3R0P A;  5LA6 A;  2B33 A;  1SZQ A;  2CVL A;  3M84 A;  4O2B B;  2BO1 A;  3KHN A;  3S0Y A;  3JAS A;  5ITZ B;  3VYS C;  1YGY A;  1K73 H;  3SIV A;  2V9Y A;  3CCE F;  4U39 A;  4NUT A;  3HKD B;  2HS3 A;  1KQS F;  5CB4 B;  2CW4 A;  4TV8 A;  3I56 F;  3CC7 F;  4G88 A;  3JVH A;  1GZ0 A;  2CHS A;  2FC3 A;  2KG4 A;  3JCM M;  1VQL F;  4BW0 B;  5MN6 A;  4ZHW A;  2Z1T A;  3RYF A;  3CCR F;  4O2A A;  4ZK7 A;  3C9T A;  1PF5 A;  2HP0 A;  2VGM A;  2ZVZ A;  4DXD A;  1ONI A;  3RYC A;  5HWE A;  5MN4 A;  1QVG F;  3WPW A;  1NQ3 A;  4WBN A;  1W5E A;  3VOB A;  1H48 A;  3IEW A;  2OHW A;  4I55 B;  1VQ9 F;  1GO0 A;  5IYZ A;  3I55 F;  4G4Z A;  3HWU A;  3NMU C;  2KGW A;  1W59 A;  1SA0 B;  1XBI A;  5EZY B;  4X1I A;  1VQ5 F;  1Q86 H;  3AGK A;  2GZL A;  3F0D A;  1RA4 A;  3Q8H A;  3NK7 A;  5HY2 A;  3CCM F;  5IJ9 A;  2HRU A;  4O4H B;  4BT4 A;  4ERH A;  1U40 A;  3N2G A;  5J2T A;  4FFB A;  2HX0 A;  1U3L A;  4BVQ A;  3N2K A;  5BMV B;  3EOR A;  3GTZ A;  4EI7 A;  3F0F A;  2LBX A;  3VTI C;  5JCO A;  2YXZ A;  2QI2 A;  1JN1 A;  4O2B A;  5J2U B;  2ZF8 A;  3LYB A;  3WGL A;  3LFO A;  4M8I A;  3D00 A;  1T0K B;  3VCZ A;  3CB2 A;  5EIB D;  2I6D A;  3KJK A;  2VAW A;  4BVT A;  1R1M A;  3UT5 B;  1IV3 A;  3D01 A;  4C4W C;  4U3J A;  3PAF A;  5IJ0 A;  3ELC A;  3KIZ A;  1VHA A;  4BY9 D;  3CCQ F;  5JQG A;  4YJ2 A;  3CCU F;  2HS4 A;  2HP3 A;  2GLZ A;  3RA6 A;  3RYI B;  2VGN A;  1JY8 A;  2G9I A;  4X1Y A;  3TD4 A;  3WPX A;  3CXC F;  2EWC A;  3ZOP A;  1FFX B;  5KX5 B;  4B62 A;  2CWJ A;  3LDT A;  2PHN A;  2WAL A;  3WGK A;  1YIT F;  1YJW F;  1W55 A;  1NJI H;  1Z5V A;  2UYN B;  5G4V C;  3C9U A;  5EO3 A;  4BT5 A;  2KTV A;  2FGY A;  2N48 A;  1RLG A;  5CA0 B;  3ZO8 A;  1UFY A;  1CLI A;  2Q1X A;  3IKF A;  1VQ4 F;  4I55 A;  3C9S A;  4IIJ B;  4C8I A;  3CC4 F;  3FD6 A;  1X7P A;  3C9R A;  3E22 B;  4ZHY B;  2MQE A;  3OW2 F;  5LXT A;  1W57 A;  2K1S A;  1ZWZ A;  3JAK A;  3N4Z A;  4RQO A;  4ZI7 B;  5C8Y B;  4ZHQ B;  1COM A;  5KMG B;  3JAL A;  4BVR A;  4C8G A;  5HXU A;  1KNK A;  3CCS F;  3RE3 A;  5FNV B;  3G71 F;  4XCQ A;  2HQS C;  5AVM A;  5GON A;  3OBY A;  1IPA A;  1X7O A;  1RQ2 A;  5HP7 A;  4LNU A;  5EB1 B;  5JVD A;  1W5F A;  2ALE A;  5EIB C;  3JAT B;  1JFF B;  3VOA A;  4TZZ A;  5LOV B;  3V4D A;  2H8E A;  3SIU A;  5LP6 A;  5J2U A;  3WGN A;  3LWV C;  1VQ6 F;  3E20 B;  4ZOL B;  5EYP B;  3J7A R;  2ZAU A;  5JH7 B;  1K8A H;  3S03 A;  4X1K B;  5GIO C;  3LME A;  1X25 A;  3CD6 F;  4I50 B;  1KNJ A;  3LWR C;  4NWO B;  2UYK A;  3CCJ F;  3HKB B;  3P0Z A;  5HY1 A;  1W2B F;  3V7E A;  3V3T A;  3JAR B;  4X3L A;  3RYH B;  3JAW A;  4LCK A;  1TVK A;  2Z1E A;  2OTJ F;  4X20 B;  2UYP A;  3RYI A;  1VQM F;  4YJ3 B;  2RB9 A;  4BVS A;  3KJJ A;  4I4T B;  2CZW A;  3F6M A;  4F6R B;  4O4I A;  4G4V A;  1W3E X;  4O4L B;  5KX5 A;  4TV9 B;  3TD3 A;  1W41 A;  1IV4 A;  1XHO A;  1XV2 A;  4NQ3 A;  2LCA A;  4O4J B;  1Q82 H;  1TUB A;  4BT3 A;  1VQ7 F;  3FPI A;  1YHQ F;  2IG8 A;  1DBF A;  1OAP A;  3CYP B;  3ERN A;  4G4X A;  2QTP A;  3JAS B;  1SDS A;  3E1Y A;  3S0W A;  4IIJ A;  3E22 A;  4BT7 A;  4TV8 B;  3HKC B;  3GHZ A;  2RHH A;  4G4W A;  5C8Y A;  4ZI7 A;  5ITZ A;  5JCO C;  3S02 A;  1YQN A;  4ZHQ A;  2BTQ B;  3HKD A;  3DC2 A;  1H47 A;  5CB4 A;  2CSL A;  1DT9 A;  5FLX M;  3P4E A;  2HS0 A;  2RHJ A;  3VI6 A;  5HP8 A;  2Z01 A;  1KD1 H;  3DDN A;  3K2X A;  3G4S F;  2HP0 B;  5GAP K;  1H7M A;  3VO8 A;  2L26 A;  1VQ8 F;  2Z1F A;  2R75 1;  4C81 A;  4RHA A;  4WBN B;  3B6N A;  3KE1 A;  1VQN F;  3LWQ C;  1FSZ A;  2HVY D;  4ZOL A;  3I3F A;  5EAZ A;  5EYP A;  1Q81 H;  2HRY A;  5JH7 A;  3MCQ A;  4X1K A;  3HAX D;  2CHT A;  4I50 A;  3WJR A;  1QAH A;  1YJ9 F;  1VQV A;  3HKE B;  2F9Z C;  1QD9 A;  1VQO F;  1OFU A;  3JAR A;  1IV2 A;  4R40 B;  1SA0 A;  5EZY A;  1KC8 H;  2YYE A;  4IHJ B;  3CYQ A;  5IJ9 B;  2VAM A;  3WGJ A;  4I4T A;  4KWE A;  2KTU A;  1U43 A;  3O85 A;  5IT9 M;  5GIN C;  3M1X A;  4BT2 A;  4FFB B;  4O4L A;  5B8F A;  3N2K B;  3J81 M;  2LBT A;  2AMT A;  2OTM A;  2IQQ A;  5CA1 B;  4O4H A;  5G4U C;  3NVK E;  4B46 A;  3FFM A;  1U3P A;  5EB0 A;  1N8R H;  3ON1 A;  5GIP C;  1CK2 A;  3VYT C;  3K0T A;  5BMV A;  4E6E A;  1GO1 A;  5GAN K;  1UI9 A;  3K12 A;  3WJQ A;  1FNJ A;  1FNK A;  3CME F;  3CPW F;  3HKC A;  4U3J B;  1VQP F;  5IJ0 B;  3CCL F;  5LP6 C;  2JNB A;  3UT5 A;  5JQG B;  3FBA A;  5MN5 A;  4YJ2 B;  1J7H A;  1QU9 A;  3S06 A;  3J80 M;  1X52 A;  4X1Y B;  3PLA C;  1RLU A;  3OON A;  3L7Q A;  1W42 A;  3LWP C;  5HY0 A;  3G6E F;  2ZVY A;  5LYJ B;  3MDO A;  4EB6 B;  2NMU A;  3F0G A;  4EI9 A;  3MBM A;  2UZH A;  3MQW A;  1FFX A;  3P10 A;  1M90 H;  4HNA B;  4DRX B;  3ZP4 A;  2AIF A;  3RA5 A;  4TUY B;  3QUW A;  1QVF F;  1ODE A;  1IV1 A;  2UYN A;  3MCA B;  3CMA F;  5LA6 B;  3T80 A;  3ESJ A;  1VK3 A;  3S0H A;  5CA0 A;  1PXW A;  5EWR A;  2OZB A;  3U0O A;  2BTU A;  2I6R A;  5LXT B;  3JAK B;  1S72 F;  3V7Q A;  1JD1 A;  3HKE A;  4ZHV A;  1Q7Y H;  2OTL F;  2PMP A;  3JAL B;  3HJW C;  1K9M H;  1CN7 A;  4IHJ A;  3IR9 A;  3IKE A;  4C82 A;  5GON B;  3D54 A;  3IMP A;  3N4Y A;  5A2Q M;  5KMG A;  3CPQ A;  4LNU B;  4B5C A;  5JVD B;  5CA1 A;  2Z1U A;  5FNV A;  2Q1Y A;  1YI2 F;  3I7T A;  1W5B A;  3QHD A;  2IAF A;  3RYF B;  4O2A B;  4PWT A;  2ZOD A;  3VIU A;  4BT6 A;  1YIJ F;  2R6R 1;  3RYC B;  3FD5 A;  5LP6 B;  1E7K A;  5DCV A;  3CC2 F;  5FJ4 C;  3C8L A;  3LWO C;  2QA4 F;  1W40 A;  3VYU C;  3JAT A;  2QEX F;  2P6Y A;  1JFF A;  3F0E A;  3OBW A;  1W5A A;  5LOV A;  3NVI B;  3ZP7 A;  1RQ7 A;  4C8E A;  1NMU B;  3JAM M;  1Z5W A;  2H6L A;  1T0A A;  4B45 A;  2DYY A;  2VXY A;  5IYZ B;  2H8C A;  2RHL A;  3CCV F;  5HY4 A;  2W8B C; 
#chains in the Genus database with same CATH homology
 3JVH A;  3T80 A;  3EOR A;  3ESJ A;  3ERN A;  3IEQ A;  3K14 A;  3P0Z A;  3QHD A;  3F0F A;  3IKF A;  3K2X A;  4C8I A;  1JY8 A;  1JN1 A;  1IV2 A;  4C81 A;  1W57 A;  2GZL A;  2PMP A;  3B6N A;  3GHZ A;  3F6M A;  3F0G A;  3KE1 A;  3F0E A;  3F0D A;  3Q8H A;  3MBM A;  1YQN A;  2UZH A;  1U43 A;  3P10 A;  3IKE A;  4C82 A;  1IV4 A;  4C8E A;  4C8G A;  1IV3 A;  1W55 A;  1H47 A;  1KNK A;  1H48 A;  3IEW A;  1U40 A;  5B8F A;  1T0A A;  1GX1 A;  3RE3 A;  3ELC A;  2AMT A;  3FBA A;  3FPI A;  1IV1 A;  1VHA A;  1VH8 A;  1KNJ A;  1U3L A;  1U3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...