3K14A

Co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 535, ethyl 3-methyl-5,6-dihydroimidazo[2,1-b][1,3]thiazole-2-carboxylate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Burkholderia pseudomallei
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
total genus 51
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3k14A00
2UZHA 3B6NA 3IEWA 4C8GA 3IKFA 3MBMA 3F0EA 3F0GA 1T0AA 1U40A 3Q8HA 3ELCA 1JN1A 1U3LA 1H48A 1KNJA 3GHZA 3IEQA 3KE1A 3FPIA 5B8FA 1IV1A 3T80A 1GX1A 1U43A 3RE3A 1W55A 1U3PA 1VHAA 4C81A 3P10A 1IV3A 1H47A 1YQNA 1IV2A 3FBAA 3EORA 1KNKA 3JVHA 4C8IA 1VH8A 3K14A 3QHDA 3F0DA 2GZLA 4C8EA 3F6MA 1W57A 3ESJA 3IKEA 3ERNA 1JY8A 3P0ZA 3F0FA 1IV4A 4C82A 2PMPA 2AMTA 3K2XA
chains in the Genus database with same CATH superfamily
4C8GA 3F0GA 2RHLA 4ZHYB 3MQWA 1QD9A 2Z1EA 2Q1XA 1W2BF 3QTYA 5JQGB 4I55A 4YJ2B 3NVIB 1GX1A 2Q1YA 3JAWB 4O4IB 4HNAA 1VQ6F 1SA0B 3JASA 4KWEA 1UI9A 5JH7A 1X7PA 4F6RA 5EB1B 3RYIB 4ERHA 4TUYA 5CA1A 4B45A 3QHDA 2UYJA 3K12A 4X20B 3TD3A 1JY8A 4B46A 1VQLF 5J2TB 1RQ7A 5HY0A 2IAFA 2OZBA 5C8YB 2CZWA 3NK7A 4IHJB 2ZVYA 5JCOA 2CWJA 3LMEA 3V7EA 5DCVA 4YJ3B 3JAWA 4O4IA 4TV9A 1U3PA 3CPWF 4RHAA 4NQ3A 3ON1A 1KD1H 3U0OA 2LBXA 3CCSF 4F6RB 4O2BB 3M4SA 1COMA 4O4HA 5KMGA 4X20A 4LNUB 3C9TA 1W5FA 3IKEA 1YIJF 3IR9A 3WJRA 1QVFF 1RLUA 2HQSC 3S03A 4G4YA 3CD6F 5GIPC 1XBIA 3P4EA 3RYHB 2AIZP 2CVLA 4ZI7A 1U43A 2FGYA 2QTPA 3MDOA 5LXTA 1JFFA 3CCEF 5EO3A 1K73H 5IYZB 1PXWA 4O4HB 1Q8RA 5CB4B 3S02A 3E20B 4TV8A 4LNUA 2YYEA 5IJ9B 2VGMA 1UFYA 1IV4A 4C82A 3JAKB 3TD4A 3LWOC 4DRXA 1RLGA 3CCLF 3S0WA 4BT3A 5GONB 3LWPC 3N4YA 3UT5B 3ELCA 3IEQA 3RYFA 5EWRA 3VO8A 2HP3A 3CYPB 5HY2A 5LXTB 1JD1A 1YQNA 5ITZB 2PHNA 3WGMA 1FNKA 3VOAA 5JQGA 5LOVA 3VYSC 4C8EA 2LCAA 2AIFA 4ZOLB 4BT2A 3D54A 1W40A 3C9UA 3JAKA 4X1KA 4O4LB 3K2XA 3I7TA 1RQ2A 1FFXA 4B62A 3IEWA 2IQQA 3HKBB 5IJ0B 3UT5A 2OTJF 3HKEB 1U40A 5MN4A 4I50B 3TD5A 1W5AA 2B33A 3JATA 3OBYA 4C4WC 2UYPA 1IPAA 3OONA 4BT5A 3M84A 1KNKA 3CB2A 3E22A 2R751 3K14A 2EWCA 5FNVA 4BVQA 1W41A 4R40B 1K8AH 2W8BC 4LCKA 3CG6A 1XHOA 1TVKA 3F0FA 3V3TA 2K1SA 5GANK 1FFXB 1SA0A 1JN1A 2KTVA 1H48A 3KE1A 3JARA 3CCQF 1DT9A 3N2GB 2G9IA 3D01A 3R0PA 4DXDA 1E7KA 1CLIA 4BT7A 1IV3A 5HWEA 5HP8A 3HKCB 2HS0A 4ZHWA 5CA0A 1W42A 2DT4A 2HS4A 3JVHA 5FNVB 3ZO8A 2GZLA 1FSZA 3VTIC 1XRGA 3ZOPA 2RHJA 1VQKF 1TVKB 4X1YB 2I6RA 2GVIA 5BMVB 5JVDA 2QEXF 1FNJA 2ALEA 4TV8B 4BVRA 3IMPA 5GAPK 5FJ4C 1W5BA 3ZP7A 1QVGF 2NMUA 1ZWZA 2BTUA 1GO1A 5B8FA 1KQSF 3CMEF 5EIBC 1VHAA 4O2AB 4C81A 3WGLA 1SDSA 1OAPA 3RYFB 4C8IA 3SIVA 3C9RA 3WGKA 3WJQA 5J2UA 5BMVA 4ZI7B 2PMPA 4E6EA 3S06A 5LA6A 4WBNA 1DBFA 2ZVZA 1VQPF 5LOVB 1T0AA 3PLAC 5CB4A 3I55F 1Q81H 3K0TA 2OHWA 1R1MA 4X1KB 5AVMA 1TUBB 4YJ2A 2Z1UA 3ZP4A 2VAMA 4G4WA 4EB6B 1W5EA 3M1XA 2RB9A 3JAMM 2HVYD 3E1YA 3KJJA 2RHHA 3CCMF 3F0DA 3GTZA 3DC2A 3HTNA 1K9MH 1X7OA 1PF5A 2ZOVA 3LWRC 1ONIA 4WBNB 2RHOA 3B6NA 3HJWC 3HWUA 3VCZA 3CC2F 2N48A 4U39A 3FPIA 5LP6B 5LP6C 4ZHQB 3WJPA 3VYUC 3D00A 3WPWA 1Q86H 3EORA 4BT6A 1CK2A 3FD6A 2YXZA 4O2BA 4IIJA 3BYQA 4FFBB 3HKEA 1GO0A 2KG4A 2BTOA 3G4SF 3KJKA 5EYPA 2R6R1 3I56F 2CW4A 3KHNA 1N8RH 4ZHVA 4G88A 2AMTA 2H6LA 5JCOC 5CA0B 5IT9M 1YJWF 3E22B 3CCVF 4X1YA 3VYTC 2BTQB 3CXCF 2I6DA 4O4JA 4ZHQA 3RE3A 1NQ3A 3N2KB 3S0YA 1YHQF 2JNBA 2UYKA 1W59A 3WXMB 3FBAA 3JALA 1M1KH 2HP0A 3CPQA 5CA1B 1VQNF 2WALA 4FFBA 3C8LA 5EYPB 4BVSA 2H8EA 3J81M 3OBWA 1VQVA 3GYQA 2LBWA 2L26A 1YJ9F 3FD5A 3PAFA 3CYQA 3HKCA 3LFOA 2Z1TA 2KTUA 4BVTA 2VAPA 3MCAB 4X1IA 5MN6A 4I4TB 2HRYA 5JVDB 2HP0B 1YGYA 3FFMA 2IG8A 3RYCA 3CC4F 2GLZA 4X3LA 3WGJA 3HKDB 3CC7F 3P0ZA 1VQ5F 4O4LA 3SIUA 4O2AA 4TZZA 3CCJF 5A2QM 2DYYA 1YITF 3Q8HA 5HP7A 2UYNA 2CSLA 3CCRF 3HAXD 1IV1A 5HXUA 4I4TA 1YJNF 1JFFB 1T0KB 1Q82H 4U3JA 5KX5B 5IYZA 3NK6A 2ZODA 1VQOF 3L7QA 3DDNA 1VH8A 5IJ9A 3ESJA 2HRUA 2OTLF 3LWVC 3RA6A 1J7HA 1X25A 3JASB 3J80M 4BY9D 3RYIA 4EB6A 3LWQC 2UZHA 3WGNA 4ZK7A 2UYNB 3V7QA 3AGKA 3JARB 1X52A 4G4XA 3N4ZA 3S0HA 5HXZA 1GZ0A 4U3JB 1OFUA 3OW2F 1NJIH 3P10A 5LYJA 1ODEA 5ITZA 1IV2A 2CHTA 2V9YA 1QU9A 4RQOA 1XV2A 4BT4A 1YI2F 4NWOB 5C8YA 1RA4A 1VK3A 2QI2A 1JJ2F 3KIZA 4YJ3A 5EB0A 3MCQA 3N2KA 3ERNA 3VI6A 5G4VC 4I55B 5LP6A 2P6YA 5EIBD 4HNAB 1VQ4F 5KMGB 2VXYA 3CMAF 3GHZA 1KNJA 5FLXM 4TUYB 2BO1A 3T80A 3CCUF 1W55A 5LYJB 3I3FA 1NMUB 1H7MA 3RYHA 1S72F 5J2TA 1KC8H 3NVKE 3V4DA 2ZAUA 2F9ZC 4IHJA 5J2UB 5MN5A 3O85A 4EI8A 4O4JB 4TV9B 3G6EF 3J7AR 2FC3A 3VIUA 3RYCB 3IKFA 3MBMA 3F0EA 2LBTA 1VQ9F 1Z5WA 3JALB 3HKDA 5HY1A 1W3EX 1VQ8F 3N2GA 5GIOC 3JCMM 5G4UC 1W581 1TUBA 4X3MA 5GINC 3NMUC 5HY4A 2MQEA 5EAZA 5EZYB 4M8IA 3WPXA 3VMFB 4B5CA 1W57A 2HS3A 1QAHA 1CN7A 2H8CA 1SZQA 4EI9A 5KX5A 3LYBA 4X1IB 1M90H 2VGNA 2OTMA 2Z1FA 4PWTA 1U3LA 2Z01A 4ZOLA 3VOBA 3RA5A 4NUTA 4XCQA 2VAWA 3C9SA 2KGWA 4BW0B 1VQ7F 2HX0A 1H47A 3HKBA 5IJ0A 5JH7B 4DRXB 4I50A 3LDTA 5EZYA 5GONA 4IIJB 3JATB 2ZF8A 3F6MA 4G4ZA 2CHSA 2QA4F 1VQMF 1Z5VA 3G71F 4EI7A 1Q7YH 3QUWA 5LA6B 4G4VA
chains in the Genus database with same CATH topology
2UZHA 3B6NA 3IEWA 4C8GA 3IKFA 3MBMA 3F0EA 3F0GA 1T0AA 1U40A 3Q8HA 3ELCA 1JN1A 1U3LA 1H48A 1KNJA 3GHZA 3IEQA 3KE1A 3FPIA 5B8FA 1IV1A 3T80A 1GX1A 1U43A 3RE3A 1W55A 1U3PA 1VHAA 4C81A 3P10A 1IV3A 1H47A 1YQNA 1IV2A 3FBAA 3EORA 1KNKA 3JVHA 4C8IA 1VH8A 3K14A 3QHDA 3F0DA 2GZLA 4C8EA 3F6MA 1W57A 3ESJA 3IKEA 3ERNA 1JY8A 3P0ZA 3F0FA 1IV4A 4C82A 2PMPA 2AMTA 3K2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZH A;  3B6N A;  3IEW A;  4C8G A;  3IKF A;  3MBM A;  3F0E A;  3F0G A;  1T0A A;  1U40 A;  3Q8H A;  3ELC A;  1JN1 A;  1U3L A;  1H48 A;  1KNJ A;  3GHZ A;  3IEQ A;  3KE1 A;  3FPI A;  5B8F A;  1IV1 A;  3T80 A;  1GX1 A;  1U43 A;  3RE3 A;  1W55 A;  1U3P A;  1VHA A;  4C81 A;  3P10 A;  1IV3 A;  1H47 A;  1YQN A;  1IV2 A;  3FBA A;  3EOR A;  1KNK A;  3JVH A;  4C8I A;  1VH8 A;  3K14 A;  3QHD A;  3F0D A;  2GZL A;  4C8E A;  3F6M A;  1W57 A;  3ESJ A;  3IKE A;  3ERN A;  1JY8 A;  3P0Z A;  3F0F A;  1IV4 A;  4C82 A;  2PMP A;  2AMT A;  3K2X A; 
#chains in the Genus database with same CATH topology
 4C8G A;  3F0G A;  2RHL A;  4ZHY B;  3MQW A;  1QD9 A;  2Z1E A;  2Q1X A;  1W2B F;  3QTY A;  5JQG B;  4I55 A;  4YJ2 B;  3NVI B;  1GX1 A;  2Q1Y A;  3JAW B;  4O4I B;  4HNA A;  1VQ6 F;  1SA0 B;  3JAS A;  4KWE A;  1UI9 A;  5JH7 A;  1X7P A;  4F6R A;  5EB1 B;  3RYI B;  4ERH A;  4TUY A;  5CA1 A;  4B45 A;  3QHD A;  2UYJ A;  3K12 A;  4X20 B;  3TD3 A;  1JY8 A;  4B46 A;  1VQL F;  5J2T B;  1RQ7 A;  5HY0 A;  2IAF A;  2OZB A;  5C8Y B;  2CZW A;  3NK7 A;  4IHJ B;  2ZVY A;  5JCO A;  2CWJ A;  3LME A;  3V7E A;  5DCV A;  4YJ3 B;  3JAW A;  4O4I A;  4TV9 A;  1U3P A;  3CPW F;  4RHA A;  4NQ3 A;  3ON1 A;  1KD1 H;  3U0O A;  2LBX A;  3CCS F;  4F6R B;  4O2B B;  3M4S A;  1COM A;  4O4H A;  5KMG A;  4X20 A;  4LNU B;  3C9T A;  1W5F A;  3IKE A;  1YIJ F;  3IR9 A;  3WJR A;  1QVF F;  1RLU A;  2HQS C;  3S03 A;  4G4Y A;  3CD6 F;  5GIP C;  1XBI A;  3P4E A;  3RYH B;  2AIZ P;  2CVL A;  4ZI7 A;  1U43 A;  2FGY A;  2QTP A;  3MDO A;  5LXT A;  1JFF A;  3CCE F;  5EO3 A;  1K73 H;  5IYZ B;  1PXW A;  4O4H B;  1Q8R A;  5CB4 B;  3S02 A;  3E20 B;  4TV8 A;  4LNU A;  2YYE A;  5IJ9 B;  2VGM A;  1UFY A;  1IV4 A;  4C82 A;  3JAK B;  3TD4 A;  3LWO C;  4DRX A;  1RLG A;  3CCL F;  3S0W A;  4BT3 A;  5GON B;  3LWP C;  3N4Y A;  3UT5 B;  3ELC A;  3IEQ A;  3RYF A;  5EWR A;  3VO8 A;  2HP3 A;  3CYP B;  5HY2 A;  5LXT B;  1JD1 A;  1YQN A;  5ITZ B;  2PHN A;  3WGM A;  1FNK A;  3VOA A;  5JQG A;  5LOV A;  3VYS C;  4C8E A;  2LCA A;  2AIF A;  4ZOL B;  4BT2 A;  3D54 A;  1W40 A;  3C9U A;  3JAK A;  4X1K A;  4O4L B;  3K2X A;  3I7T A;  1RQ2 A;  1FFX A;  4B62 A;  3IEW A;  2IQQ A;  3HKB B;  5IJ0 B;  3UT5 A;  2OTJ F;  3HKE B;  1U40 A;  5MN4 A;  4I50 B;  3TD5 A;  1W5A A;  2B33 A;  3JAT A;  3OBY A;  4C4W C;  2UYP A;  1IPA A;  3OON A;  4BT5 A;  3M84 A;  1KNK A;  3CB2 A;  3E22 A;  2R75 1;  3K14 A;  2EWC A;  5FNV A;  4BVQ A;  1W41 A;  4R40 B;  1K8A H;  2W8B C;  4LCK A;  3CG6 A;  1XHO A;  1TVK A;  3F0F A;  3V3T A;  2K1S A;  5GAN K;  1FFX B;  1SA0 A;  1JN1 A;  2KTV A;  1H48 A;  3KE1 A;  3JAR A;  3CCQ F;  1DT9 A;  3N2G B;  2G9I A;  3D01 A;  3R0P A;  4DXD A;  1E7K A;  1CLI A;  4BT7 A;  1IV3 A;  5HWE A;  5HP8 A;  3HKC B;  2HS0 A;  4ZHW A;  5CA0 A;  1W42 A;  2DT4 A;  2HS4 A;  3JVH A;  5FNV B;  3ZO8 A;  2GZL A;  1FSZ A;  3VTI C;  1XRG A;  3ZOP A;  2RHJ A;  1VQK F;  1TVK B;  4X1Y B;  2I6R A;  2GVI A;  5BMV B;  5JVD A;  2QEX F;  1FNJ A;  2ALE A;  4TV8 B;  4BVR A;  3IMP A;  5GAP K;  5FJ4 C;  1W5B A;  3ZP7 A;  1QVG F;  2NMU A;  1ZWZ A;  2BTU A;  1GO1 A;  5B8F A;  1KQS F;  3CME F;  5EIB C;  1VHA A;  4O2A B;  4C81 A;  3WGL A;  1SDS A;  1OAP A;  3RYF B;  4C8I A;  3SIV A;  3C9R A;  3WGK A;  3WJQ A;  5J2U A;  5BMV A;  4ZI7 B;  2PMP A;  4E6E A;  3S06 A;  5LA6 A;  4WBN A;  1DBF A;  2ZVZ A;  1VQP F;  5LOV B;  1T0A A;  3PLA C;  5CB4 A;  3I55 F;  1Q81 H;  3K0T A;  2OHW A;  1R1M A;  4X1K B;  5AVM A;  1TUB B;  4YJ2 A;  2Z1U A;  3ZP4 A;  2VAM A;  4G4W A;  4EB6 B;  1W5E A;  3M1X A;  2RB9 A;  3JAM M;  2HVY D;  3E1Y A;  3KJJ A;  2RHH A;  3CCM F;  3F0D A;  3GTZ A;  3DC2 A;  3HTN A;  1K9M H;  1X7O A;  1PF5 A;  2ZOV A;  3LWR C;  1ONI A;  4WBN B;  2RHO A;  3B6N A;  3HJW C;  3HWU A;  3VCZ A;  3CC2 F;  2N48 A;  4U39 A;  3FPI A;  5LP6 B;  5LP6 C;  4ZHQ B;  3WJP A;  3VYU C;  3D00 A;  3WPW A;  1Q86 H;  3EOR A;  4BT6 A;  1CK2 A;  3FD6 A;  2YXZ A;  4O2B A;  4IIJ A;  3BYQ A;  4FFB B;  3HKE A;  1GO0 A;  2KG4 A;  2BTO A;  3G4S F;  3KJK A;  5EYP A;  2R6R 1;  3I56 F;  2CW4 A;  3KHN A;  1N8R H;  4ZHV A;  4G88 A;  2AMT A;  2H6L A;  5JCO C;  5CA0 B;  5IT9 M;  1YJW F;  3E22 B;  3CCV F;  4X1Y A;  3VYT C;  2BTQ B;  3CXC F;  2I6D A;  4O4J A;  4ZHQ A;  3RE3 A;  1NQ3 A;  3N2K B;  3S0Y A;  1YHQ F;  2JNB A;  2UYK A;  1W59 A;  3WXM B;  3FBA A;  3JAL A;  1M1K H;  2HP0 A;  3CPQ A;  5CA1 B;  1VQN F;  2WAL A;  4FFB A;  3C8L A;  5EYP B;  4BVS A;  2H8E A;  3J81 M;  3OBW A;  1VQV A;  3GYQ A;  2LBW A;  2L26 A;  1YJ9 F;  3FD5 A;  3PAF A;  3CYQ A;  3HKC A;  3LFO A;  2Z1T A;  2KTU A;  4BVT A;  2VAP A;  3MCA B;  4X1I A;  5MN6 A;  4I4T B;  2HRY A;  5JVD B;  2HP0 B;  1YGY A;  3FFM A;  2IG8 A;  3RYC A;  3CC4 F;  2GLZ A;  4X3L A;  3WGJ A;  3HKD B;  3CC7 F;  3P0Z A;  1VQ5 F;  4O4L A;  3SIU A;  4O2A A;  4TZZ A;  3CCJ F;  5A2Q M;  2DYY A;  1YIT F;  3Q8H A;  5HP7 A;  2UYN A;  2CSL A;  3CCR F;  3HAX D;  1IV1 A;  5HXU A;  4I4T A;  1YJN F;  1JFF B;  1T0K B;  1Q82 H;  4U3J A;  5KX5 B;  5IYZ A;  3NK6 A;  2ZOD A;  1VQO F;  3L7Q A;  3DDN A;  1VH8 A;  5IJ9 A;  3ESJ A;  2HRU A;  2OTL F;  3LWV C;  3RA6 A;  1J7H A;  1X25 A;  3JAS B;  3J80 M;  4BY9 D;  3RYI A;  4EB6 A;  3LWQ C;  2UZH A;  3WGN A;  4ZK7 A;  2UYN B;  3V7Q A;  3AGK A;  3JAR B;  1X52 A;  4G4X A;  3N4Z A;  3S0H A;  5HXZ A;  1GZ0 A;  4U3J B;  1OFU A;  3OW2 F;  1NJI H;  3P10 A;  5LYJ A;  1ODE A;  5ITZ A;  1IV2 A;  2CHT A;  2V9Y A;  1QU9 A;  4RQO A;  1XV2 A;  4BT4 A;  1YI2 F;  4NWO B;  5C8Y A;  1RA4 A;  1VK3 A;  2QI2 A;  1JJ2 F;  3KIZ A;  4YJ3 A;  5EB0 A;  3MCQ A;  3N2K A;  3ERN A;  3VI6 A;  5G4V C;  4I55 B;  5LP6 A;  2P6Y A;  5EIB D;  4HNA B;  1VQ4 F;  5KMG B;  2VXY A;  3CMA F;  3GHZ A;  1KNJ A;  5FLX M;  4TUY B;  2BO1 A;  3T80 A;  3CCU F;  1W55 A;  5LYJ B;  3I3F A;  1NMU B;  1H7M A;  3RYH A;  1S72 F;  5J2T A;  1KC8 H;  3NVK E;  3V4D A;  2ZAU A;  2F9Z C;  4IHJ A;  5J2U B;  5MN5 A;  3O85 A;  4EI8 A;  4O4J B;  4TV9 B;  3G6E F;  3J7A R;  2FC3 A;  3VIU A;  3RYC B;  3IKF A;  3MBM A;  3F0E A;  2LBT A;  1VQ9 F;  1Z5W A;  3JAL B;  3HKD A;  5HY1 A;  1W3E X;  1VQ8 F;  3N2G A;  5GIO C;  3JCM M;  5G4U C;  1W58 1;  1TUB A;  4X3M A;  5GIN C;  3NMU C;  5HY4 A;  2MQE A;  5EAZ A;  5EZY B;  4M8I A;  3WPX A;  3VMF B;  4B5C A;  1W57 A;  2HS3 A;  1QAH A;  1CN7 A;  2H8C A;  1SZQ A;  4EI9 A;  5KX5 A;  3LYB A;  4X1I B;  1M90 H;  2VGN A;  2OTM A;  2Z1F A;  4PWT A;  1U3L A;  2Z01 A;  4ZOL A;  3VOB A;  3RA5 A;  4NUT A;  4XCQ A;  2VAW A;  3C9S A;  2KGW A;  4BW0 B;  1VQ7 F;  2HX0 A;  1H47 A;  3HKB A;  5IJ0 A;  5JH7 B;  4DRX B;  4I50 A;  3LDT A;  5EZY A;  5GON A;  4IIJ B;  3JAT B;  2ZF8 A;  3F6M A;  4G4Z A;  2CHS A;  2QA4 F;  1VQM F;  1Z5V A;  3G71 F;  4EI7 A;  1Q7Y H;  3QUW A;  5LA6 B;  4G4V A; 
#chains in the Genus database with same CATH homology
 2UZH A;  3B6N A;  3IEW A;  4C8G A;  3IKF A;  3MBM A;  3F0E A;  3F0G A;  1T0A A;  1U40 A;  3Q8H A;  3ELC A;  1JN1 A;  1U3L A;  1H48 A;  1KNJ A;  3GHZ A;  3IEQ A;  3KE1 A;  3FPI A;  5B8F A;  1IV1 A;  3T80 A;  1GX1 A;  1U43 A;  3RE3 A;  1W55 A;  1U3P A;  1VHA A;  4C81 A;  3P10 A;  1IV3 A;  1H47 A;  1YQN A;  1IV2 A;  3FBA A;  3EOR A;  1KNK A;  3JVH A;  4C8I A;  1VH8 A;  3K14 A;  3QHD A;  3F0D A;  2GZL A;  4C8E A;  3F6M A;  1W57 A;  3ESJ A;  3IKE A;  3ERN A;  1JY8 A;  3P0Z A;  3F0F A;  1IV4 A;  4C82 A;  2PMP A;  2AMT A;  3K2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...