2KTVA

Human erf1 c-domain, "open" conformer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
164
structure length
164
Chain Sequence
NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
total genus 32
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktvA00
2OTJF 1VQ7F 1GO1A 3G6EF 3PLAC 1VQ8F 1KD1H 1VQ6F 1RLGA 3VMFB 3NVIB 1Q81H 2LBXA 1GZ0A 4BY9D 1S72F 1X7PA 2VGNA 4LCKA 5G4VC 3LWVC 3LWQC 3CCLF 1N8RH 1K8AH 1YI2F 3V7EA 3E1YA 3JCMM 1VQ5F 1QVFF 4C4WC 3FFMA 2AIFA 1YIJF 1YJWF 3RA5A 1VQPF 3LWOC 1M1KH 3CCRF 3CD6F 3N4YA 3VI6A 1W2BF 1VQ4F 3HJWC 3SIUA 3IR9A 1W41A 3E20B 3NMUC 3CCVF 4TZZA 3CCSF 5IT9M 1NMUB 3CCUF 3AGKA 1IPAA 2OTLF 1PXWA 1X7OA 3CMEF 5GANK 5DCVA 3CPQA 3SIVA 3NK7A 1CN7A 2VGMA 1X52A 5FLXM 3CC7F 2KTVA 2JNBA 1YJNF 1XBIA 3G71F 2BO1A 1CK2A 1VQKF 1SDSA 2OZBA 2ALEA 1KQSF 1JJ2F 2KG4A 5FJ4C 3MCAB 3OW2F 1GO0A 1T0KB 3I56F 1W40A 1DT9A 1H7MA 3G4SF 3CCMF 1YHQF 3PAFA 3J80M 5G4UC 2QA4F 1E7KA 3CG6A 3LWPC 3LWRC 5GINC 3ON1A 2QEXF 1NJIH 3NK6A 4X3MA 1VQNF 1Q86H 1W42A 4X3LA 2I6DA 4BW0B 1KC8H 1Q7YH 3RA6A 1Q82H 2FC3A 3WXMB 3OBYA 2WALA 1K9MH 2OHWA 3HAXD 5GIPC 3V7QA 3CMAF 5GIOC 3CPWF 1VQ9F 3JAMM 3CXCF 1VQMF 5GAPK 2CZWA 1M90H 5EO3A 3LFOA 4NUTA 3OBWA 2QI2A 3CCJF 3CC2F 2LBWA 3N4ZA 1YITF 1VQLF 1RA4A 3CC4F 1QVGF 3NVKE 3J7AR 3J81M 1W3EX 2HVYD 3GYQA 1VQOF 1K73H 2KTUA 5EWRA 3O85A 3CCQF 1YJ9F 1ZWZA 5A2QM 3I55F 3CCEF
chains in the Genus database with same CATH superfamily
1T0AA 1VQ7F 1CLIA 3D00A 5CA0B 4HNAB 5AVMA 2G9IA 3FBAA 2ZVZA 2Q1XA 4O4LB 5JH7B 5CB4A 3WPWA 4FFBA 2CHTA 4ZHQA 5CA1B 5G4VC 4LCKA 1FFXA 1K8AH 1YI2F 4YJ2A 2VAWA 4YJ2B 5JVDB 3V7EA 1TVKB 5JQGA 4FFBB 1VQVA 1X25A 2Z1EA 3JAWA 5FNVA 3CCRF 5MN5A 3WGNA 3HTNA 2HS3A 3M4SA 1FNJA 1U43A 3E20B 5HP7A 3RYHB 4U3JA 3NMUC 3WGJA 3ELCA 3CCSF 4WBNA 3JAKB 4B5CA 5KMGA 3QTYA 4TV8B 2UYJA 3SIVA 1X52A 3CC7F 4BT5A 4IHJB 1XBIA 4G4YA 1VQKF 4EI9A 2OZBA 1SA0B 5HXZA 4B46A 5LXTA 5LOVA 3VTIC 3JVHA 3MBMA 3HKCA 3HKBB 2IAFA 4YJ3B 3G4SF 2AMTA 3M1XA 5MN4A 2UYPA 2HP0B 1JFFA 3CG6A 3LWPC 3LWRC 5GINC 3VO8A 3M84A 4G4ZA 3QUWA 4KWEA 4X3MA 3JAKA 1Q86H 1W42A 3S0HA 4BW0B 1KC8H 1JD1A 1XV2A 4I55A 3RYFA 1XRGA 3U0OA 2FC3A 1OFUA 2LCAA 3ZOPA 3T80A 4ZHWA 5GIOC 1VQMF 3S06A 3C9SA 3K0TA 4BVSA 4O4JA 5GAPK 3JARB 2GLZA 2RHHA 3K2XA 2GVIA 3LFOA 3OBWA 2QI2A 2ZAUA 2I6RA 5KMGB 3CC2F 4I50B 3N4ZA 4EB6B 3WGLA 4F6RA 1RQ2A 3LDTA 5EZYA 2L26A 3I3FA 3J81M 4ERHA 3L7QA 4TV9B 2KTUA 4BT6A 4EB6A 2HS0A 3JALB 2WALA 5A2QM 5LOVB 2OTJF 3RYIB 5JCOC 3RYFB 3PLAC 1TVKA 4BVTA 1VQ8F 1RLGA 5HWEA 2H8EA 5J2TB 2FGYA 3P10A 5HY0A 2LBXA 5HP8A 1JFFB 4O4HA 1GX1A 2NMUA 5HY2A 3LWQC 1N8RH 1VH8A 3MQWA 2HQSC 1VQ5F 4X1YB 1QVFF 4C4WC 3FFMA 3S03A 1SA0A 3WJPA 2H6LA 1VQPF 3CD6F 1KNJA 3N4YA 1XHOA 3HKBA 3N2KA 1VQ4F 4M8IA 4BVRA 3JASB 5B8FA 2P6YA 4TZZA 3UT5A 3KJJA 3CCUF 2CWJA 1PXWA 2BTUA 1RLUA 1YGYA 2HX0A 5GANK 4O2BA 1KNKA 3CPQA 3NK7A 2VGMA 3N2GA 3ESJA 1QAHA 5EZYB 2QTPA 2V9YA 3DC2A 4C8GA 4B62A 2JNBA 1YJNF 1W5AA 5BMVA 1CK2A 3CYQA 5GONB 5ITZB 2CW4A 5J2UA 1KQSF 1H48A 2R751 3RYHA 4LNUB 3JARA 1GO0A 5JVDA 1T0KB 2R6R1 3I56F 2CSLA 4YJ3A 1NQ3A 1YHQF 4ZHQB 3PAFA 2BTQB 4X1IB 4X20B 4X20A 4G4WA 2QA4F 5IJ9B 2ZODA 2ZVYA 2HP3A 3CB2A 1ONIA 4HNAA 1NJIH 1VQNF 5CA0A 4X3LA 5CA1A 3VYSC 2RHLA 1UI9A 1Q7YH 5LYJB 1W5FA 3VCZA 1JY8A 4O4LA 3RYCB 3IEQA 5EAZA 5GIPC 3CMAF 3CPWF 1UFYA 5KX5A 4BVQA 4O4IB 1FNKA 5EIBD 5LYJA 3C8LA 3HKEB 3KHNA 3K12A 1FSZA 4X1KA 1YITF 1RA4A 3JATA 4C8EA 2RHJA 5EB1B 3J7AR 2IQQA 1VK3A 1W3EX 1W57A 3GYQA 2LBTA 3TD4A 1W581 3OONA 3D54A 3ERNA 1YJ9F 1ZWZA 2UYNA 1OAPA 3CCEF 3MCQA 5IJ9A 5HXUA 4IIJB 3G6EF 4EI7A 4X1YA 5CB4B 1JN1A 4BT3A 3F0EA 3B6NA 4I4TB 4BT7A 1U3LA 1GZ0A 3N2GB 1S72F 2VGNA 1W5EA 2ZF8A 5LA6A 5J2UB 5LP6B 3CCLF 4EI8A 3E1YA 2PHNA 1FFXB 4I50A 2HRYA 1YIJF 1PF5A 1YJWF 3RA5A 3V3TA 4X1IA 1TUBA 4ZI7B 3VI6A 1W2BF 1ODEA 4RQOA 3VIUA 3IR9A 5HY1A 3HKEA 3CCVF 5JCOA 1NMUB 5GONA 5ITZA 3AGKA 1SZQA 2YYEA 1X7OA 3TD3A 3CMEF 4DRXB 5HY4A 4PWTA 2KTVA 4O2BB 4R40B 5EB0A 2BO1A 5J2TA 2RHOA 3HKCB 5IYZA 1SDSA 3ZP4A 4XCQA 2ALEA 3C9TA 5FJ4C 2KG4A 3MCAB 3OW2F 3LMEA 4NQ3A 4O4HB 1U40A 3FD6A 1W40A 3CYPB 1H7MA 3K14A 2F9ZC 3RYCA 4DXDA 5IJ0A 3F0FA 3J80M 3S0WA 4LNUA 5EIBC 4C82A 5G4UC 1E7KA 2HP0A 3VYUC 2Z01A 2DYYA 2QEXF 1Z5WA 1J7HA 1VHAA 4TV9A 1Q82H 3RA6A 3RYIA 3P0ZA 1H47A 1K9MH 3HAXD 3V7QA 1R1MA 3ZP7A 1VQ9F 3WJQA 3LYBA 2Z1UA 3FD5A 3JAWB 2CZWA 1M90H 5EO3A 3HKDB 4NUTA 4G4VA 3R0PA 5JQGB 5LP6C 4G88A 5BMVB 3F0GA 2VAPA 4B45A 3N2KB 1VQLF 1DBFA 2B33A 2Q1YA 3HKDA 3ZO8A 2HVYD 1YQNA 3KE1A 1VQOF 1K73H 4I55B 1QD9A 1W5BA 5MN6A 3CCQF 3I55F 2IG8A 1GO1A 1KD1H 1VQ6F 1IV4A 3VMFB 3NVIB 3VOBA 1Q81H 3E22B 4C81A 4BY9D 3WGKA 2HRUA 2MQEA 4O2AA 5IJ0B 1X7PA 3IKEA 5C8YB 3LWVC 3HWUA 2PMPA 3EORA 3GTZA 4NWOB 3JCMM 2K1SA 2AIFA 3Q8HA 3DDNA 1W55A 3KJKA 3TD5A 4O2AB 4ZK7A 2UYNB 3WJRA 2CVLA 5IYZB 3LWOC 1M1KH 4TV8A 1IV1A 2OTMA 1IV2A 1TUBB 3FPIA 3V4DA 4F6RB 4ZI7A 3HJWC 3SIUA 2VAMA 1W41A 4E6EA 1W59A 2UZHA 3JATB 5IT9M 3JALA 3S02A 1IPAA 1Z5VA 2OTLF 3GHZA 3VYTC 2VXYA 4G4XA 4IHJA 4RHAA 5DCVA 5FNVB 1CN7A 4U3JB 3C9RA 1COMA 5FLXM 3RE3A 3IEWA 3P4EA 3G71F 1U3PA 2N48A 4C8IA 4WBNB 2W8BC 4ZHVA 3KIZA 3VOAA 3QHDA 2BTOA 3MDOA 5EYPA 5EYPB 3C9UA 1JJ2F 2AIZP 2KGWA 2UYKA 4O4JB 1RQ7A 3WGMA 1IV3A 1DT9A 3CCMF 2RB9A 3F6MA 5LXTB 5JH7A 4IIJA 4I4TA 3ON1A 1QU9A 4ZHYB 3NK6A 2HS4A 3I7TA 3IMPA 2I6DA 5LA6B 3UT5B 5LP6A 3F0DA 3JASA 3WXMB 3OBYA 2OHWA 2EWCA 3WPXA 4ZOLB 4BT4A 2H8CA 4U39A 5KX5B 3JAMM 3CXCF 4DRXA 4BT2A 2ZOVA 3CCJF 3IKFA 4TUYB 3D01A 2Z1TA 2LBWA 2Z1FA 3BYQA 2GZLA 5C8YA 2DT4A 4ZOLA 3S0YA 3CC4F 1QVGF 3NVKE 4O4IA 3E22A 4X1KB 5EWRA 1Q8RA 3O85A 2CHSA 2YXZA 4TUYA
chains in the Genus database with same CATH topology
2OTJF 5HXUA 1VQ7F 1GO1A 3G6EF 4EI7A 3PLAC 1VQ8F 4BVTA 3D00A 1KD1H 1VQ6F 1RLGA 5HWEA 3VMFB 3NVIB 2FGYA 5HY0A 1Q81H 2LBXA 1GZ0A 4BY9D 1S72F 1X7PA 2VGNA 4LCKA 5HY2A 5G4VC 3LWVC 3LWQC 4EI8A 3CCLF 1N8RH 1K8AH 1YI2F 3V7EA 3E1YA 3JCMM 1VQ5F 1QVFF 4C4WC 3FFMA 2AIFA 1YIJF 1YJWF 3RA5A 3V3TA 1VQPF 3LWOC 1M1KH 3CCRF 3CD6F 3N4YA 3VI6A 1W2BF 1VQ4F 3HJWC 3SIUA 3IR9A 1W41A 3E20B 5HY1A 4BVRA 3NMUC 3CCVF 4TZZA 3CCSF 5IT9M 1NMUB 3CCUF 3AGKA 1IPAA 2OTLF 1PXWA 1X7OA 3CMEF 5GANK 5HY4A 5DCVA 3CPQA 3SIVA 3NK7A 1CN7A 2VGMA 1X52A 5FLXM 3CC7F 2KTVA 2JNBA 1YJNF 1XBIA 3G71F 2BO1A 1CK2A 1VQKF 1SDSA 4EI9A 2OZBA 4XCQA 2ALEA 1KQSF 5HXZA 1JJ2F 2KG4A 5FJ4C 3MCAB 3OW2F 4NQ3A 1GO0A 1T0KB 3I56F 1W40A 1DT9A 1H7MA 3G4SF 2F9ZC 3CCMF 3PAFA 1YHQF 3J80M 5G4UC 2QA4F 1E7KA 3CG6A 3LWPC 3LWRC 5GINC 3ON1A 2QEXF 1NJIH 3NK6A 4X3MA 1VQNF 1Q86H 1W42A 4X3LA 2I6DA 4BW0B 1KC8H 1Q7YH 3RA6A 1Q82H 2FC3A 3WXMB 3OBYA 2WALA 1K9MH 2OHWA 3HAXD 3V7QA 5GIPC 3CMAF 5GIOC 3CPWF 1VQ9F 3JAMM 3CXCF 1VQMF 4BVSA 5GAPK 2GLZA 2CZWA 4BVQA 5EO3A 1M90H 3LFOA 4NUTA 3OBWA 2QI2A 3CCJF 3CC2F 2LBWA 3N4ZA 1YITF 1VQLF 1RA4A 3CC4F 1QVGF 3NVKE 3J7AR 3J81M 1W3EX 2HVYD 3GYQA 1VQOF 1K73H 2KTUA 5EWRA 3O85A 3CCQF 1YJ9F 1ZWZA 5A2QM 3I55F 3CCEF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ F;  1VQ7 F;  1GO1 A;  3G6E F;  3PLA C;  1VQ8 F;  1KD1 H;  1VQ6 F;  1RLG A;  3VMF B;  3NVI B;  1Q81 H;  2LBX A;  1GZ0 A;  4BY9 D;  1S72 F;  1X7P A;  2VGN A;  4LCK A;  5G4V C;  3LWV C;  3LWQ C;  3CCL F;  1N8R H;  1K8A H;  1YI2 F;  3V7E A;  3E1Y A;  3JCM M;  1VQ5 F;  1QVF F;  4C4W C;  3FFM A;  2AIF A;  1YIJ F;  1YJW F;  3RA5 A;  1VQP F;  3LWO C;  1M1K H;  3CCR F;  3CD6 F;  3N4Y A;  3VI6 A;  1W2B F;  1VQ4 F;  3HJW C;  3SIU A;  3IR9 A;  1W41 A;  3E20 B;  3NMU C;  3CCV F;  4TZZ A;  3CCS F;  5IT9 M;  1NMU B;  3CCU F;  3AGK A;  1IPA A;  2OTL F;  1PXW A;  1X7O A;  3CME F;  5GAN K;  5DCV A;  3CPQ A;  3SIV A;  3NK7 A;  1CN7 A;  2VGM A;  1X52 A;  5FLX M;  3CC7 F;  2KTV A;  2JNB A;  1YJN F;  1XBI A;  3G71 F;  2BO1 A;  1CK2 A;  1VQK F;  1SDS A;  2OZB A;  2ALE A;  1KQS F;  1JJ2 F;  2KG4 A;  5FJ4 C;  3MCA B;  3OW2 F;  1GO0 A;  1T0K B;  3I56 F;  1W40 A;  1DT9 A;  1H7M A;  3G4S F;  3CCM F;  1YHQ F;  3PAF A;  3J80 M;  5G4U C;  2QA4 F;  1E7K A;  3CG6 A;  3LWP C;  3LWR C;  5GIN C;  3ON1 A;  2QEX F;  1NJI H;  3NK6 A;  4X3M A;  1VQN F;  1Q86 H;  1W42 A;  4X3L A;  2I6D A;  4BW0 B;  1KC8 H;  1Q7Y H;  3RA6 A;  1Q82 H;  2FC3 A;  3WXM B;  3OBY A;  2WAL A;  1K9M H;  2OHW A;  3HAX D;  5GIP C;  3V7Q A;  3CMA F;  5GIO C;  3CPW F;  1VQ9 F;  3JAM M;  3CXC F;  1VQM F;  5GAP K;  2CZW A;  1M90 H;  5EO3 A;  3LFO A;  4NUT A;  3OBW A;  2QI2 A;  3CCJ F;  3CC2 F;  2LBW A;  3N4Z A;  1YIT F;  1VQL F;  1RA4 A;  3CC4 F;  1QVG F;  3NVK E;  3J7A R;  3J81 M;  1W3E X;  2HVY D;  3GYQ A;  1VQO F;  1K73 H;  2KTU A;  5EWR A;  3O85 A;  3CCQ F;  1YJ9 F;  1ZWZ A;  5A2Q M;  3I55 F;  3CCE F; 
#chains in the Genus database with same CATH topology
 1T0A A;  1VQ7 F;  1CLI A;  3D00 A;  5CA0 B;  4HNA B;  5AVM A;  2G9I A;  3FBA A;  2ZVZ A;  2Q1X A;  4O4L B;  5JH7 B;  5CB4 A;  3WPW A;  4FFB A;  2CHT A;  4ZHQ A;  5CA1 B;  5G4V C;  4LCK A;  1FFX A;  1K8A H;  1YI2 F;  4YJ2 A;  2VAW A;  4YJ2 B;  5JVD B;  3V7E A;  1TVK B;  5JQG A;  4FFB B;  1VQV A;  1X25 A;  2Z1E A;  3JAW A;  5FNV A;  3CCR F;  5MN5 A;  3WGN A;  3HTN A;  2HS3 A;  3M4S A;  1FNJ A;  1U43 A;  3E20 B;  5HP7 A;  3RYH B;  4U3J A;  3NMU C;  3WGJ A;  3ELC A;  3CCS F;  4WBN A;  3JAK B;  4B5C A;  5KMG A;  3QTY A;  4TV8 B;  2UYJ A;  3SIV A;  1X52 A;  3CC7 F;  4BT5 A;  4IHJ B;  1XBI A;  4G4Y A;  1VQK F;  4EI9 A;  2OZB A;  1SA0 B;  5HXZ A;  4B46 A;  5LXT A;  5LOV A;  3VTI C;  3JVH A;  3MBM A;  3HKC A;  3HKB B;  2IAF A;  4YJ3 B;  3G4S F;  2AMT A;  3M1X A;  5MN4 A;  2UYP A;  2HP0 B;  1JFF A;  3CG6 A;  3LWP C;  3LWR C;  5GIN C;  3VO8 A;  3M84 A;  4G4Z A;  3QUW A;  4KWE A;  4X3M A;  3JAK A;  1Q86 H;  1W42 A;  3S0H A;  4BW0 B;  1KC8 H;  1JD1 A;  1XV2 A;  4I55 A;  3RYF A;  1XRG A;  3U0O A;  2FC3 A;  1OFU A;  2LCA A;  3ZOP A;  3T80 A;  4ZHW A;  5GIO C;  1VQM F;  3S06 A;  3C9S A;  3K0T A;  4BVS A;  4O4J A;  5GAP K;  3JAR B;  2GLZ A;  2RHH A;  3K2X A;  2GVI A;  3LFO A;  3OBW A;  2QI2 A;  2ZAU A;  2I6R A;  5KMG B;  3CC2 F;  4I50 B;  3N4Z A;  4EB6 B;  3WGL A;  4F6R A;  1RQ2 A;  3LDT A;  5EZY A;  2L26 A;  3I3F A;  3J81 M;  4ERH A;  3L7Q A;  4TV9 B;  2KTU A;  4BT6 A;  4EB6 A;  2HS0 A;  3JAL B;  2WAL A;  5A2Q M;  5LOV B;  2OTJ F;  3RYI B;  5JCO C;  3RYF B;  3PLA C;  1TVK A;  4BVT A;  1VQ8 F;  1RLG A;  5HWE A;  2H8E A;  5J2T B;  2FGY A;  3P10 A;  5HY0 A;  2LBX A;  5HP8 A;  1JFF B;  4O4H A;  1GX1 A;  2NMU A;  5HY2 A;  3LWQ C;  1N8R H;  1VH8 A;  3MQW A;  2HQS C;  1VQ5 F;  4X1Y B;  1QVF F;  4C4W C;  3FFM A;  3S03 A;  1SA0 A;  3WJP A;  2H6L A;  1VQP F;  3CD6 F;  1KNJ A;  3N4Y A;  1XHO A;  3HKB A;  3N2K A;  1VQ4 F;  4M8I A;  4BVR A;  3JAS B;  5B8F A;  2P6Y A;  4TZZ A;  3UT5 A;  3KJJ A;  3CCU F;  2CWJ A;  1PXW A;  2BTU A;  1RLU A;  1YGY A;  2HX0 A;  5GAN K;  4O2B A;  1KNK A;  3CPQ A;  3NK7 A;  2VGM A;  3N2G A;  3ESJ A;  1QAH A;  5EZY B;  2QTP A;  2V9Y A;  3DC2 A;  4C8G A;  4B62 A;  2JNB A;  1YJN F;  1W5A A;  5BMV A;  1CK2 A;  3CYQ A;  5GON B;  5ITZ B;  2CW4 A;  5J2U A;  1KQS F;  1H48 A;  2R75 1;  3RYH A;  4LNU B;  3JAR A;  1GO0 A;  5JVD A;  1T0K B;  2R6R 1;  3I56 F;  2CSL A;  4YJ3 A;  1NQ3 A;  1YHQ F;  4ZHQ B;  3PAF A;  2BTQ B;  4X1I B;  4X20 B;  4X20 A;  4G4W A;  2QA4 F;  5IJ9 B;  2ZOD A;  2ZVY A;  2HP3 A;  3CB2 A;  1ONI A;  4HNA A;  1NJI H;  1VQN F;  5CA0 A;  4X3L A;  5CA1 A;  3VYS C;  2RHL A;  1UI9 A;  1Q7Y H;  5LYJ B;  1W5F A;  3VCZ A;  1JY8 A;  4O4L A;  3RYC B;  3IEQ A;  5EAZ A;  5GIP C;  3CMA F;  3CPW F;  1UFY A;  5KX5 A;  4BVQ A;  4O4I B;  1FNK A;  5EIB D;  5LYJ A;  3C8L A;  3HKE B;  3KHN A;  3K12 A;  1FSZ A;  4X1K A;  1YIT F;  1RA4 A;  3JAT A;  4C8E A;  2RHJ A;  5EB1 B;  3J7A R;  2IQQ A;  1VK3 A;  1W3E X;  1W57 A;  3GYQ A;  2LBT A;  3TD4 A;  1W58 1;  3OON A;  3D54 A;  3ERN A;  1YJ9 F;  1ZWZ A;  2UYN A;  1OAP A;  3CCE F;  3MCQ A;  5IJ9 A;  5HXU A;  4IIJ B;  3G6E F;  4EI7 A;  4X1Y A;  5CB4 B;  1JN1 A;  4BT3 A;  3F0E A;  3B6N A;  4I4T B;  4BT7 A;  1U3L A;  1GZ0 A;  3N2G B;  1S72 F;  2VGN A;  1W5E A;  2ZF8 A;  5LA6 A;  5J2U B;  5LP6 B;  3CCL F;  4EI8 A;  3E1Y A;  2PHN A;  1FFX B;  4I50 A;  2HRY A;  1YIJ F;  1PF5 A;  1YJW F;  3RA5 A;  3V3T A;  4X1I A;  1TUB A;  4ZI7 B;  3VI6 A;  1W2B F;  1ODE A;  4RQO A;  3VIU A;  3IR9 A;  5HY1 A;  3HKE A;  3CCV F;  5JCO A;  1NMU B;  5GON A;  5ITZ A;  3AGK A;  1SZQ A;  2YYE A;  1X7O A;  3TD3 A;  3CME F;  4DRX B;  5HY4 A;  4PWT A;  2KTV A;  4O2B B;  4R40 B;  5EB0 A;  2BO1 A;  5J2T A;  2RHO A;  3HKC B;  5IYZ A;  1SDS A;  3ZP4 A;  4XCQ A;  2ALE A;  3C9T A;  5FJ4 C;  2KG4 A;  3MCA B;  3OW2 F;  3LME A;  4NQ3 A;  4O4H B;  1U40 A;  3FD6 A;  1W40 A;  3CYP B;  1H7M A;  3K14 A;  2F9Z C;  3RYC A;  4DXD A;  5IJ0 A;  3F0F A;  3J80 M;  3S0W A;  4LNU A;  5EIB C;  4C82 A;  5G4U C;  1E7K A;  2HP0 A;  3VYU C;  2Z01 A;  2DYY A;  2QEX F;  1Z5W A;  1J7H A;  1VHA A;  4TV9 A;  1Q82 H;  3RA6 A;  3RYI A;  3P0Z A;  1H47 A;  1K9M H;  3HAX D;  3V7Q A;  1R1M A;  3ZP7 A;  1VQ9 F;  3WJQ A;  3LYB A;  2Z1U A;  3FD5 A;  3JAW B;  2CZW A;  1M90 H;  5EO3 A;  3HKD B;  4NUT A;  4G4V A;  3R0P A;  5JQG B;  5LP6 C;  4G88 A;  5BMV B;  3F0G A;  2VAP A;  4B45 A;  3N2K B;  1VQL F;  1DBF A;  2B33 A;  2Q1Y A;  3HKD A;  3ZO8 A;  2HVY D;  1YQN A;  3KE1 A;  1VQO F;  1K73 H;  4I55 B;  1QD9 A;  1W5B A;  5MN6 A;  3CCQ F;  3I55 F;  2IG8 A;  1GO1 A;  1KD1 H;  1VQ6 F;  1IV4 A;  3VMF B;  3NVI B;  3VOB A;  1Q81 H;  3E22 B;  4C81 A;  4BY9 D;  3WGK A;  2HRU A;  2MQE A;  4O2A A;  5IJ0 B;  1X7P A;  3IKE A;  5C8Y B;  3LWV C;  3HWU A;  2PMP A;  3EOR A;  3GTZ A;  4NWO B;  3JCM M;  2K1S A;  2AIF A;  3Q8H A;  3DDN A;  1W55 A;  3KJK A;  3TD5 A;  4O2A B;  4ZK7 A;  2UYN B;  3WJR A;  2CVL A;  5IYZ B;  3LWO C;  1M1K H;  4TV8 A;  1IV1 A;  2OTM A;  1IV2 A;  1TUB B;  3FPI A;  3V4D A;  4F6R B;  4ZI7 A;  3HJW C;  3SIU A;  2VAM A;  1W41 A;  4E6E A;  1W59 A;  2UZH A;  3JAT B;  5IT9 M;  3JAL A;  3S02 A;  1IPA A;  1Z5V A;  2OTL F;  3GHZ A;  3VYT C;  2VXY A;  4G4X A;  4IHJ A;  4RHA A;  5DCV A;  5FNV B;  1CN7 A;  4U3J B;  3C9R A;  1COM A;  5FLX M;  3RE3 A;  3IEW A;  3P4E A;  3G71 F;  1U3P A;  2N48 A;  4C8I A;  4WBN B;  2W8B C;  4ZHV A;  3KIZ A;  3VOA A;  3QHD A;  2BTO A;  3MDO A;  5EYP A;  5EYP B;  3C9U A;  1JJ2 F;  2AIZ P;  2KGW A;  2UYK A;  4O4J B;  1RQ7 A;  3WGM A;  1IV3 A;  1DT9 A;  3CCM F;  2RB9 A;  3F6M A;  5LXT B;  5JH7 A;  4IIJ A;  4I4T A;  3ON1 A;  1QU9 A;  4ZHY B;  3NK6 A;  2HS4 A;  3I7T A;  3IMP A;  2I6D A;  5LA6 B;  3UT5 B;  5LP6 A;  3F0D A;  3JAS A;  3WXM B;  3OBY A;  2OHW A;  2EWC A;  3WPX A;  4ZOL B;  4BT4 A;  2H8C A;  4U39 A;  5KX5 B;  3JAM M;  3CXC F;  4DRX A;  4BT2 A;  2ZOV A;  3CCJ F;  3IKF A;  4TUY B;  3D01 A;  2Z1T A;  2LBW A;  2Z1F A;  3BYQ A;  2GZL A;  5C8Y A;  2DT4 A;  4ZOL A;  3S0Y A;  3CC4 F;  1QVG F;  3NVK E;  4O4I A;  3E22 A;  4X1K B;  5EWR A;  1Q8R A;  3O85 A;  2CHS A;  2YXZ A;  4TUY A; 
#chains in the Genus database with same CATH homology
 2OTJ F;  5HXU A;  1VQ7 F;  1GO1 A;  3G6E F;  4EI7 A;  3PLA C;  1VQ8 F;  4BVT A;  3D00 A;  1KD1 H;  1VQ6 F;  1RLG A;  5HWE A;  3VMF B;  3NVI B;  2FGY A;  5HY0 A;  1Q81 H;  2LBX A;  1GZ0 A;  4BY9 D;  1S72 F;  1X7P A;  2VGN A;  4LCK A;  5HY2 A;  5G4V C;  3LWV C;  3LWQ C;  4EI8 A;  3CCL F;  1N8R H;  1K8A H;  1YI2 F;  3V7E A;  3E1Y A;  3JCM M;  1VQ5 F;  1QVF F;  4C4W C;  3FFM A;  2AIF A;  1YIJ F;  1YJW F;  3RA5 A;  3V3T A;  1VQP F;  3LWO C;  1M1K H;  3CCR F;  3CD6 F;  3N4Y A;  3VI6 A;  1W2B F;  1VQ4 F;  3HJW C;  3SIU A;  3IR9 A;  1W41 A;  3E20 B;  5HY1 A;  4BVR A;  3NMU C;  3CCV F;  4TZZ A;  3CCS F;  5IT9 M;  1NMU B;  3CCU F;  3AGK A;  1IPA A;  2OTL F;  1PXW A;  1X7O A;  3CME F;  5GAN K;  5HY4 A;  5DCV A;  3CPQ A;  3SIV A;  3NK7 A;  1CN7 A;  2VGM A;  1X52 A;  5FLX M;  3CC7 F;  2KTV A;  2JNB A;  1YJN F;  1XBI A;  3G71 F;  2BO1 A;  1CK2 A;  1VQK F;  1SDS A;  4EI9 A;  2OZB A;  4XCQ A;  2ALE A;  1KQS F;  5HXZ A;  1JJ2 F;  2KG4 A;  5FJ4 C;  3MCA B;  3OW2 F;  4NQ3 A;  1GO0 A;  1T0K B;  3I56 F;  1W40 A;  1DT9 A;  1H7M A;  3G4S F;  2F9Z C;  3CCM F;  3PAF A;  1YHQ F;  3J80 M;  5G4U C;  2QA4 F;  1E7K A;  3CG6 A;  3LWP C;  3LWR C;  5GIN C;  3ON1 A;  2QEX F;  1NJI H;  3NK6 A;  4X3M A;  1VQN F;  1Q86 H;  1W42 A;  4X3L A;  2I6D A;  4BW0 B;  1KC8 H;  1Q7Y H;  3RA6 A;  1Q82 H;  2FC3 A;  3WXM B;  3OBY A;  2WAL A;  1K9M H;  2OHW A;  3HAX D;  3V7Q A;  5GIP C;  3CMA F;  5GIO C;  3CPW F;  1VQ9 F;  3JAM M;  3CXC F;  1VQM F;  4BVS A;  5GAP K;  2GLZ A;  2CZW A;  4BVQ A;  5EO3 A;  1M90 H;  3LFO A;  4NUT A;  3OBW A;  2QI2 A;  3CCJ F;  3CC2 F;  2LBW A;  3N4Z A;  1YIT F;  1VQL F;  1RA4 A;  3CC4 F;  1QVG F;  3NVK E;  3J7A R;  3J81 M;  1W3E X;  2HVY D;  3GYQ A;  1VQO F;  1K73 H;  2KTU A;  5EWR A;  3O85 A;  3CCQ F;  1YJ9 F;  1ZWZ A;  5A2Q M;  3I55 F;  3CCE F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...