2KTVA

Human erf1 c-domain, "open" conformer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
164
structure length
164
Chain Sequence
NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 32
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktvA00
3FFMA 1IPAA 3PLAC 2I6DA 5FLXM 3LWRC 1H7MA 3CC7F 3I56F 3N4YA 1KC8H 3CD6F 1Q81H 3CCQF 1K73H 3HJWC 3CCRF 3CCMF 3CCEF 1Q86H 1W2BF 2ALEA 4NUTA 3CMAF 1VQNF 1CK2A 2QI2A 1YJWF 1VQOF 3G6EF 3CCJF 3J7AR 5G4VC 3O85A 2VGMA 2OHWA 1X52A 2VGNA 1W41A 3GYQA 4BY9D 2QA4F 1E7KA 3CCVF 1YITF 3CCUF 1NMUB 5EO3A 1W42A 3JAMM 1Q82H 3LWPC 1DT9A 3CMEF 3NK6A 1GZ0A 1YHQF 3RA5A 3LWOC 1K9MH 3NVKE 1VQ9F 3SIVA 5IT9M 3JCMM 3VI6A 3MCAB 1K8AH 1GO0A 1VQ7F 3NMUC 3ON1A 2KTVA 1VQ8F 2BO1A 3OBYA 4TZZA 1S72F 3LFOA 3OBWA 1JJ2F 1VQ5F 2OTLF 3SIUA 3G71F 1KD1H 2WALA 2KG4A 1XBIA 1N8RH 3CCSF 3CCLF 5GIOC 1RLGA 3OW2F 1YI2F 1GO1A 1VQLF 1PXWA 1RA4A 1W3EX 3VMFB 2CZWA 1T0KB 5GIPC 4C4WC 3PAFA 3N4ZA 2HVYD 2LBXA 1VQ6F 1M90H 3CPQA 5A2QM 5GINC 1NJIH 3E1YA 3RA6A 3CG6A 3CC2F 3WXMB 1QVGF 3V7QA 1Q7YH 1VQ4F 2LBWA 5GANK 5G4UC 2OTJF 2FC3A 2AIFA 1SDSA 5DCVA 2QEXF 3LWVC 5GAPK 3CXCF 1X7PA 1X7OA 2OZBA 1VQKF 1QVFF 4X3LA 1VQPF 2KTUA 3CC4F 5EWRA 3CPWF 3J81M 2JNBA 3G4SF 4BW0B 1YJNF 1KQSF 3HAXD 1YJ9F 1VQMF 3I55F 3E20B 1ZWZA 3LWQC 3J80M 1YIJF 1CN7A 3AGKA 3NVIB 3V7EA 4LCKA 3IR9A 3NK7A 5FJ4C 4X3MA 1W40A 1M1KH
chains in the Genus database with same CATH superfamily
1UFYA 5MN4A 3QHDA 1W57A 2OTMA 4O4IA 1TVKA 3FD6A 2Z1EA 4TUYA 1ODEA 3BYQA 3WJPA 5KMGB 3CD6F 1Q81H 3CCRF 1W5BA 1Q86H 1GX1A 2ALEA 5LYJB 1CK2A 2H8CA 3HKCB 5LOVB 1QD9A 5JVDB 2CVLA 3F0DA 3J7AR 2VGMA 4ZHQA 1X52A 3CB2A 2VGNA 4LNUB 2PHNA 2UYNA 4ERHA 2UZHA 3WGLA 1W5EA 3K0TA 5HP8A 1M1KH 1YITF 3CCUF 5EO3A 4X20B 3LWPC 1DT9A 1IV4A 3WPWA 3TD5A 2GVIA 1YHQF 1K9MH 3NVKE 4O2BB 5IT9M 1ONIA 1VQVA 5JH7B 5J2TB 1GO0A 4HNAB 1VQ7F 3NMUC 3JARB 2ZODA 3HKDB 5HY4A 3ERNA 5LYJA 3LFOA 3OBWA 2OTLF 3DC2A 3HKCA 5LOVA 3IKFA 2GLZA 5JVDA 2WALA 1QAHA 1JN1A 3CCSF 3V4DA 4LNUA 5GIOC 3CCLF 5HY2A 4M8IA 4WBNA 2ZAUA 1U3PA 1RA4A 2R751 3WJRA 3RE3A 1T0KB 2AIZP 3OONA 2RHOA 3N4ZA 3CPQA 1JFFB 1NJIH 5LXTB 3CG6A 4BVSA 4C8IA 3F6MA 2I6RA 5GANK 5EYPB 3U0OA 3DDNA 5JH7A 5J2TA 2RHHA 3I3FA 1R1MA 4HNAA 4F6RA 3JARA 1IV3A 3I7TA 2HP0B 3HKDA 1COMA 3LYBA 4EI8A 2OZBA 1QVFF 4U39A 2H6LA 1U3LA 1XRGA 3WGKA 2CWJA 3VIUA 3IKEA 2KTUA 3TD4A 3CC4F 4I50B 5EWRA 3ESJA 3J81M 3L7QA 3HAXD 4KWEA 4ZHVA 3I55F 3E20B 3JAKB 1YIJF 1FSZA 2FGYA 3NVIB 5LXTA 3N2GA 2G9IA 4I55B 4BVTA 2L26A 3QUWA 1JY8A 3LWRC 4G4XA 2CSLA 1H7MA 4X1IA 1KNKA 1K73H 3HJWC 3HKEA 1W2BF 1NQ3A 4NUTA 2Q1XA 1VQNF 1VQOF 3S0HA 3G6EF 1OFUA 4I50A 4G4VA 4X1KB 5G4VC 3JASB 4YJ2B 4R40B 2NMUA 5AVMA 4ZHYB 4BY9D 2P6YA 3JAKA 1NMUB 3VO8A 5HXZA 3CMEF 1W5FA 1GZ0A 2V9YA 4I55A 4I4TB 3F0FA 3K14A 3MBMA 3P10A 3E22B 3IEQA 3Q8HA 3IEWA 1CLIA 3FBAA 3D00A 1VK3A 2EWCA 5EB1B 5CA1B 3FPIA 4B46A 1IV1A 5MN5A 1VQ8F 4TZZA 3OBYA 1X25A 3RYIB 3SIUA 4WBNB 4X1KA 2Z01A 5EIBC 3S06A 4PWTA 3JASA 3HKBB 2PMPA 4YJ2A 1RLGA 2K1SA 3OW2F 3LMEA 1VQLF 3GHZA 1W3EX 3C8LA 3VMFB 4O2AA 2CZWA 5GIPC 3JATB 4C4WC 3RYHB 2RHJA 2IQQA 2UYKA 5A2QM 5IJ0B 4I4TA 3WXMB 5LP6C 4G4WA 1IV2A 3RYCB 3E22A 3VOAA 4BT5A 5IJ9B 4F6RB 2FC3A 4G4ZA 2AIFA 2KGWA 4FFBB 4C8EA 5BMVB 5J2UB 5CA1A 5DCVA 2QEXF 3LWVC 3RYIA 3KHNA 1QU9A 2VAPA 1VQPF 5EZYB 4O4JB 1RQ7A 2CHSA 2Z1FA 5HP7A 3HKBA 3S02A 4TV9B 4BW0B 4G88A 1YJ9F 3JATA 3WPXA 3N2GB 3RYHA 1VQMF 1ZWZA 3LWQC 3J80M 2HS3A 1OAPA 2HP3A 4LCKA 5IJ0A 4ZOLB 5LA6A 2Z1UA 4X1IB 5CA0B 3RYCA 5IJ9A 2CHTA 1IPAA 3C9UA 2I6DA 3HKEB 3PLAC 2N48A 4FFBA 5BMVA 4O4LB 5CB4B 5J2UA 4BT6A 4DXDA 4RHAA 3CCQF 3CCMF 3HTNA 2ZOVA 3WGMA 2F9ZC 4ZI7B 5EZYA 4O4JA 2QI2A 3ZO8A 4RQOA 3CCJF 3O85A 2OHWA 4TV9A 2BTQB 2HRYA 1Q8RA 1RQ2A 2HX0A 1W41A 4XCQA 2Z1TA 2QA4F 4IHJA 1E7KA 3CCVF 1KNJA 1W42A 1PF5A 1TUBB 3C9TA 5EIBD 3S0WA 5JCOC 3JAMM 4ZK7A 3KIZA 4ZOLA 3ZP4A 2DT4A 2YXZA 5CA0A 3RA5A 1DBFA 3JVHA 1VQ9F 3SIVA 3TD3A 2BTUA 2UYPA 3GTZA 3JCMM 3K2XA 2BTOA 4O4LA 5CB4A 2UYJA 3JAWB 3MCAB 1K8AH 3F0GA 1VH8A 4TV8B 3ON1A 2KTVA 2BO1A 1JJ2F 4ZI7A 5C8YB 3M84A 4C82A 1VQ5F 3G71F 3LDTA 1FNJA 2RB9A 4O2AB 1XBIA 4BT2A 3VYSC 2DYYA 1YI2F 1GO1A 1PXWA 2LBTA 4B5CA 1U40A 2HQSC 3C9RA 1TUBA 1YQNA 2MQEA 3FD5A 2HVYD 2LBXA 1VQ6F 3T80A 4C81A 1M90H 1H47A 2HS0A 3E1YA 3CC2F 3S03A 5JCOA 2LBWA 3M4SA 2IG8A 3UT5B 3CYPB 3JAWA 4O4HB 3VYTC 1RLUA 4TV8A 1XV2A 2Q1YA 1X7OA 5C8YA 4X3LA 5IYZB 1UI9A 5GONB 3RYFA 2VAMA 3CPWF 2JNBA 1W59A 4X1YB 1YJNF 1KQSF 2AMTA 4EB6B 3CYQA 5LA6B 2ZVZA 4IIJA 5KX5B 3AGKA 4BVRA 3IR9A 5FJ4C 5B8FA 5LP6B 4BT4A 5HXUA 1JD1A 1W40A 3FFMA 2VXYA 2RHLA 3UT5A 5FLXM 3JALA 3CC7F 3I56F 1SA0B 2H8EA 3N4YA 4O4HA 1KC8H 2B33A 4EI7A 3K12A 5MN6A 3KE1A 1FFXB 3CCEF 5IYZA 5GONA 5KMGA 3CMAF 5HY0A 4G4YA 1YJWF 3S0YA 3MDOA 4IHJB 5HWEA 4X1YA 3GYQA 4EB6A 1SZQA 5ITZB 1YGYA 3MCQA 4BT3A 5KX5A 1Q82H 3IMPA 2YYEA 4YJ3B 3NK6A 3V3TA 5LP6A 4X20A 5FNVB 3LWOC 1W55A 3HWUA 2HS4A 3WJQA 4DRXB 5JQGB 1U43A 4ZHWA 3VI6A 1SA0A 4B45A 4O2BA 2QTPA 4EI9A 3P0ZA 1FFXA 4BVQA 1S72F 3MQWA 4BT7A 1KD1H 3KJKA 1H48A 2ZVYA 3WGNA 3D54A 2KG4A 2R6R1 1N8RH 3EORA 3ZOPA 4B62A 3P4EA 5ITZA 3PAFA 3N2KB 4YJ3A 2IAFA 3ELCA 1Z5WA 1W581 4U3JB 5EAZA 5FNVA 5GINC 1J7HA 3RA6A 3D01A 3M1XA 2VAWA 1QVGF 3V7QA 3KJJA 1Q7YH 4DRXA 1VQ4F 5JQGA 5G4UC 3B6NA 1JFFA 2OTJF 3C9SA 1SDSA 4O4IB 1TVKB 3WGJA 3ZP7A 4TUYB 5EYPA 5GAPK 3CXCF 1X7PA 3F0EA 3RYFB 1VQKF 2W8BC 5EB0A 5HY1A 1XHOA 2HP0A 3QTYA 3G4SF 4ZHQB 4E6EA 1FNKA 2UYNB 4IIJB 1VHAA 2CW4A 3VOBA 4NQ3A 3N2KA 1Z5VA 2HRUA 2ZF8A 1CN7A 4U3JA 3R0PA 3V7EA 4C8GA 3NK7A 4NWOB 2LCAA 3VTIC 3JALB 3VCZA 1T0AA 4X3MA 2GZLA 3VYUC 1W5AA
chains in the Genus database with same CATH topology
3FFMA 1IPAA 3PLAC 2I6DA 5FLXM 3LWRC 1H7MA 3CC7F 3I56F 3N4YA 1KC8H 4EI7A 3CD6F 1Q81H 3CCQF 1K73H 3HJWC 3CCRF 3CCMF 3CCEF 1Q86H 1W2BF 2ALEA 4NUTA 2F9ZC 3CMAF 1VQNF 5HY0A 1CK2A 2QI2A 1YJWF 1VQOF 3G6EF 3CCJF 3J7AR 5G4VC 3O85A 2VGMA 5HWEA 2OHWA 1X52A 4XCQA 2VGNA 1W41A 3GYQA 4BY9D 2QA4F 1E7KA 3CCVF 1YITF 3CCUF 1NMUB 5EO3A 1W42A 3JAMM 1Q82H 3LWPC 1DT9A 5HXZA 3CMEF 3NK6A 1GZ0A 3V3TA 1YHQF 3RA5A 3LWOC 1K9MH 3NVKE 1VQ9F 3SIVA 5IT9M 3JCMM 3VI6A 3MCAB 1K8AH 3D00A 1GO0A 4EI9A 1VQ7F 3NMUC 3ON1A 2KTVA 4BVQA 1VQ8F 5HY4A 2BO1A 3OBYA 4TZZA 3LFOA 3OBWA 1S72F 1JJ2F 1VQ5F 2OTLF 3SIUA 3G71F 2GLZA 1KD1H 2WALA 2KG4A 1XBIA 1N8RH 3CCSF 3CCLF 5GIOC 1RLGA 5HY2A 3OW2F 1GO1A 1YI2F 1PXWA 1VQLF 1RA4A 1W3EX 3VMFB 2CZWA 1T0KB 5GIPC 4C4WC 3PAFA 3N4ZA 2HVYD 2LBXA 1VQ6F 1M90H 3CPQA 5A2QM 5GINC 1NJIH 3E1YA 3RA6A 3CG6A 3CC2F 3WXMB 1QVGF 3V7QA 4BVSA 1Q7YH 1VQ4F 2LBWA 5GANK 5G4UC 2OTJF 2FC3A 2AIFA 1SDSA 5DCVA 2QEXF 3LWVC 5GAPK 3CXCF 1X7PA 1X7OA 4EI8A 2OZBA 1VQKF 1QVFF 4X3LA 5HY1A 1VQPF 2KTUA 3CC4F 5EWRA 3CPWF 3J81M 2JNBA 3G4SF 4BW0B 1YJNF 1KQSF 3HAXD 1YJ9F 4NQ3A 1VQMF 3I55F 3E20B 1ZWZA 3LWQC 3J80M 1YIJF 1CN7A 2FGYA 3AGKA 3NVIB 3V7EA 4LCKA 4BVRA 3IR9A 3NK7A 5FJ4C 4BVTA 4X3MA 5HXUA 1W40A 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFM A;  1IPA A;  3PLA C;  2I6D A;  5FLX M;  3LWR C;  1H7M A;  3CC7 F;  3I56 F;  3N4Y A;  1KC8 H;  3CD6 F;  1Q81 H;  3CCQ F;  1K73 H;  3HJW C;  3CCR F;  3CCM F;  3CCE F;  1Q86 H;  1W2B F;  2ALE A;  4NUT A;  3CMA F;  1VQN F;  1CK2 A;  2QI2 A;  1YJW F;  1VQO F;  3G6E F;  3CCJ F;  3J7A R;  5G4V C;  3O85 A;  2VGM A;  2OHW A;  1X52 A;  2VGN A;  1W41 A;  3GYQ A;  4BY9 D;  2QA4 F;  1E7K A;  3CCV F;  1YIT F;  3CCU F;  1NMU B;  5EO3 A;  1W42 A;  3JAM M;  1Q82 H;  3LWP C;  1DT9 A;  3CME F;  3NK6 A;  1GZ0 A;  1YHQ F;  3RA5 A;  3LWO C;  1K9M H;  3NVK E;  1VQ9 F;  3SIV A;  5IT9 M;  3JCM M;  3VI6 A;  3MCA B;  1K8A H;  1GO0 A;  1VQ7 F;  3NMU C;  3ON1 A;  2KTV A;  1VQ8 F;  2BO1 A;  3OBY A;  4TZZ A;  1S72 F;  3LFO A;  3OBW A;  1JJ2 F;  1VQ5 F;  2OTL F;  3SIU A;  3G71 F;  1KD1 H;  2WAL A;  2KG4 A;  1XBI A;  1N8R H;  3CCS F;  3CCL F;  5GIO C;  1RLG A;  3OW2 F;  1YI2 F;  1GO1 A;  1VQL F;  1PXW A;  1RA4 A;  1W3E X;  3VMF B;  2CZW A;  1T0K B;  5GIP C;  4C4W C;  3PAF A;  3N4Z A;  2HVY D;  2LBX A;  1VQ6 F;  1M90 H;  3CPQ A;  5A2Q M;  5GIN C;  1NJI H;  3E1Y A;  3RA6 A;  3CG6 A;  3CC2 F;  3WXM B;  1QVG F;  3V7Q A;  1Q7Y H;  1VQ4 F;  2LBW A;  5GAN K;  5G4U C;  2OTJ F;  2FC3 A;  2AIF A;  1SDS A;  5DCV A;  2QEX F;  3LWV C;  5GAP K;  3CXC F;  1X7P A;  1X7O A;  2OZB A;  1VQK F;  1QVF F;  4X3L A;  1VQP F;  2KTU A;  3CC4 F;  5EWR A;  3CPW F;  3J81 M;  2JNB A;  3G4S F;  4BW0 B;  1YJN F;  1KQS F;  3HAX D;  1YJ9 F;  1VQM F;  3I55 F;  3E20 B;  1ZWZ A;  3LWQ C;  3J80 M;  1YIJ F;  1CN7 A;  3AGK A;  3NVI B;  3V7E A;  4LCK A;  3IR9 A;  3NK7 A;  5FJ4 C;  4X3M A;  1W40 A;  1M1K H; 
#chains in the Genus database with same CATH topology
 1UFY A;  5MN4 A;  3QHD A;  1W57 A;  2OTM A;  4O4I A;  1TVK A;  3FD6 A;  2Z1E A;  4TUY A;  1ODE A;  3BYQ A;  3WJP A;  5KMG B;  3CD6 F;  1Q81 H;  3CCR F;  1W5B A;  1Q86 H;  1GX1 A;  2ALE A;  5LYJ B;  1CK2 A;  2H8C A;  3HKC B;  5LOV B;  1QD9 A;  5JVD B;  2CVL A;  3F0D A;  3J7A R;  2VGM A;  4ZHQ A;  1X52 A;  3CB2 A;  2VGN A;  4LNU B;  2PHN A;  2UYN A;  4ERH A;  2UZH A;  3WGL A;  1W5E A;  3K0T A;  5HP8 A;  1M1K H;  1YIT F;  3CCU F;  5EO3 A;  4X20 B;  3LWP C;  1DT9 A;  1IV4 A;  3WPW A;  3TD5 A;  2GVI A;  1YHQ F;  1K9M H;  3NVK E;  4O2B B;  5IT9 M;  1ONI A;  1VQV A;  5JH7 B;  5J2T B;  1GO0 A;  4HNA B;  1VQ7 F;  3NMU C;  3JAR B;  2ZOD A;  3HKD B;  5HY4 A;  3ERN A;  5LYJ A;  3LFO A;  3OBW A;  2OTL F;  3DC2 A;  3HKC A;  5LOV A;  3IKF A;  2GLZ A;  5JVD A;  2WAL A;  1QAH A;  1JN1 A;  3CCS F;  3V4D A;  4LNU A;  5GIO C;  3CCL F;  5HY2 A;  4M8I A;  4WBN A;  2ZAU A;  1U3P A;  1RA4 A;  2R75 1;  3WJR A;  3RE3 A;  1T0K B;  2AIZ P;  3OON A;  2RHO A;  3N4Z A;  3CPQ A;  1JFF B;  1NJI H;  5LXT B;  3CG6 A;  4BVS A;  4C8I A;  3F6M A;  2I6R A;  5GAN K;  5EYP B;  3U0O A;  3DDN A;  5JH7 A;  5J2T A;  2RHH A;  3I3F A;  1R1M A;  4HNA A;  4F6R A;  3JAR A;  1IV3 A;  3I7T A;  2HP0 B;  3HKD A;  1COM A;  3LYB A;  4EI8 A;  2OZB A;  1QVF F;  4U39 A;  2H6L A;  1U3L A;  1XRG A;  3WGK A;  2CWJ A;  3VIU A;  3IKE A;  2KTU A;  3TD4 A;  3CC4 F;  4I50 B;  5EWR A;  3ESJ A;  3J81 M;  3L7Q A;  3HAX D;  4KWE A;  4ZHV A;  3I55 F;  3E20 B;  3JAK B;  1YIJ F;  1FSZ A;  2FGY A;  3NVI B;  5LXT A;  3N2G A;  2G9I A;  4I55 B;  4BVT A;  2L26 A;  3QUW A;  1JY8 A;  3LWR C;  4G4X A;  2CSL A;  1H7M A;  4X1I A;  1KNK A;  1K73 H;  3HJW C;  3HKE A;  1W2B F;  1NQ3 A;  4NUT A;  2Q1X A;  1VQN F;  1VQO F;  3S0H A;  3G6E F;  1OFU A;  4I50 A;  4G4V A;  4X1K B;  5G4V C;  3JAS B;  4YJ2 B;  4R40 B;  2NMU A;  5AVM A;  4ZHY B;  4BY9 D;  2P6Y A;  3JAK A;  1NMU B;  3VO8 A;  5HXZ A;  3CME F;  1W5F A;  1GZ0 A;  2V9Y A;  4I55 A;  4I4T B;  3F0F A;  3K14 A;  3MBM A;  3P10 A;  3E22 B;  3IEQ A;  3Q8H A;  3IEW A;  1CLI A;  3FBA A;  3D00 A;  1VK3 A;  2EWC A;  5EB1 B;  5CA1 B;  3FPI A;  4B46 A;  1IV1 A;  5MN5 A;  1VQ8 F;  4TZZ A;  3OBY A;  1X25 A;  3RYI B;  3SIU A;  4WBN B;  4X1K A;  2Z01 A;  5EIB C;  3S06 A;  4PWT A;  3JAS A;  3HKB B;  2PMP A;  4YJ2 A;  1RLG A;  2K1S A;  3OW2 F;  3LME A;  1VQL F;  3GHZ A;  1W3E X;  3C8L A;  3VMF B;  4O2A A;  2CZW A;  5GIP C;  3JAT B;  4C4W C;  3RYH B;  2RHJ A;  2IQQ A;  2UYK A;  5A2Q M;  5IJ0 B;  4I4T A;  3WXM B;  5LP6 C;  4G4W A;  1IV2 A;  3RYC B;  3E22 A;  3VOA A;  4BT5 A;  5IJ9 B;  4F6R B;  2FC3 A;  4G4Z A;  2AIF A;  2KGW A;  4FFB B;  4C8E A;  5BMV B;  5J2U B;  5CA1 A;  5DCV A;  2QEX F;  3LWV C;  3RYI A;  3KHN A;  1QU9 A;  2VAP A;  1VQP F;  5EZY B;  4O4J B;  1RQ7 A;  2CHS A;  2Z1F A;  5HP7 A;  3HKB A;  3S02 A;  4TV9 B;  4BW0 B;  4G88 A;  1YJ9 F;  3JAT A;  3WPX A;  3N2G B;  3RYH A;  1VQM F;  1ZWZ A;  3LWQ C;  3J80 M;  2HS3 A;  1OAP A;  2HP3 A;  4LCK A;  5IJ0 A;  4ZOL B;  5LA6 A;  2Z1U A;  4X1I B;  5CA0 B;  3RYC A;  5IJ9 A;  2CHT A;  1IPA A;  3C9U A;  2I6D A;  3HKE B;  3PLA C;  2N48 A;  4FFB A;  5BMV A;  4O4L B;  5CB4 B;  5J2U A;  4BT6 A;  4DXD A;  4RHA A;  3CCQ F;  3CCM F;  3HTN A;  2ZOV A;  3WGM A;  2F9Z C;  4ZI7 B;  5EZY A;  4O4J A;  2QI2 A;  3ZO8 A;  4RQO A;  3CCJ F;  3O85 A;  2OHW A;  4TV9 A;  2BTQ B;  2HRY A;  1Q8R A;  1RQ2 A;  2HX0 A;  1W41 A;  4XCQ A;  2Z1T A;  2QA4 F;  4IHJ A;  1E7K A;  3CCV F;  1KNJ A;  1W42 A;  1PF5 A;  1TUB B;  3C9T A;  5EIB D;  3S0W A;  5JCO C;  3JAM M;  4ZK7 A;  3KIZ A;  4ZOL A;  3ZP4 A;  2DT4 A;  2YXZ A;  5CA0 A;  3RA5 A;  1DBF A;  3JVH A;  1VQ9 F;  3SIV A;  3TD3 A;  2BTU A;  2UYP A;  3GTZ A;  3JCM M;  3K2X A;  2BTO A;  4O4L A;  5CB4 A;  2UYJ A;  3JAW B;  3MCA B;  1K8A H;  3F0G A;  1VH8 A;  4TV8 B;  3ON1 A;  2KTV A;  2BO1 A;  1JJ2 F;  4ZI7 A;  5C8Y B;  3M84 A;  4C82 A;  1VQ5 F;  3G71 F;  3LDT A;  1FNJ A;  2RB9 A;  4O2A B;  1XBI A;  4BT2 A;  3VYS C;  2DYY A;  1YI2 F;  1GO1 A;  1PXW A;  2LBT A;  4B5C A;  1U40 A;  2HQS C;  3C9R A;  1TUB A;  1YQN A;  2MQE A;  3FD5 A;  2HVY D;  2LBX A;  1VQ6 F;  3T80 A;  4C81 A;  1M90 H;  1H47 A;  2HS0 A;  3E1Y A;  3CC2 F;  3S03 A;  5JCO A;  2LBW A;  3M4S A;  2IG8 A;  3UT5 B;  3CYP B;  3JAW A;  4O4H B;  3VYT C;  1RLU A;  4TV8 A;  1XV2 A;  2Q1Y A;  1X7O A;  5C8Y A;  4X3L A;  5IYZ B;  1UI9 A;  5GON B;  3RYF A;  2VAM A;  3CPW F;  2JNB A;  1W59 A;  4X1Y B;  1YJN F;  1KQS F;  2AMT A;  4EB6 B;  3CYQ A;  5LA6 B;  2ZVZ A;  4IIJ A;  5KX5 B;  3AGK A;  4BVR A;  3IR9 A;  5FJ4 C;  5B8F A;  5LP6 B;  4BT4 A;  5HXU A;  1JD1 A;  1W40 A;  3FFM A;  2VXY A;  2RHL A;  3UT5 A;  5FLX M;  3JAL A;  3CC7 F;  3I56 F;  1SA0 B;  2H8E A;  3N4Y A;  4O4H A;  1KC8 H;  2B33 A;  4EI7 A;  3K12 A;  5MN6 A;  3KE1 A;  1FFX B;  3CCE F;  5IYZ A;  5GON A;  5KMG A;  3CMA F;  5HY0 A;  4G4Y A;  1YJW F;  3S0Y A;  3MDO A;  4IHJ B;  5HWE A;  4X1Y A;  3GYQ A;  4EB6 A;  1SZQ A;  5ITZ B;  1YGY A;  3MCQ A;  4BT3 A;  5KX5 A;  1Q82 H;  3IMP A;  2YYE A;  4YJ3 B;  3NK6 A;  3V3T A;  5LP6 A;  4X20 A;  5FNV B;  3LWO C;  1W55 A;  3HWU A;  2HS4 A;  3WJQ A;  4DRX B;  5JQG B;  1U43 A;  4ZHW A;  3VI6 A;  1SA0 A;  4B45 A;  4O2B A;  2QTP A;  4EI9 A;  3P0Z A;  1FFX A;  4BVQ A;  1S72 F;  3MQW A;  4BT7 A;  1KD1 H;  3KJK A;  1H48 A;  2ZVY A;  3WGN A;  3D54 A;  2KG4 A;  2R6R 1;  1N8R H;  3EOR A;  3ZOP A;  4B62 A;  3P4E A;  5ITZ A;  3PAF A;  3N2K B;  4YJ3 A;  2IAF A;  3ELC A;  1Z5W A;  1W58 1;  4U3J B;  5EAZ A;  5FNV A;  5GIN C;  1J7H A;  3RA6 A;  3D01 A;  3M1X A;  2VAW A;  1QVG F;  3V7Q A;  3KJJ A;  1Q7Y H;  4DRX A;  1VQ4 F;  5JQG A;  5G4U C;  3B6N A;  1JFF A;  2OTJ F;  3C9S A;  1SDS A;  4O4I B;  1TVK B;  3WGJ A;  3ZP7 A;  4TUY B;  5EYP A;  5GAP K;  3CXC F;  1X7P A;  3F0E A;  3RYF B;  1VQK F;  2W8B C;  5EB0 A;  5HY1 A;  1XHO A;  2HP0 A;  3QTY A;  3G4S F;  4ZHQ B;  4E6E A;  1FNK A;  2UYN B;  4IIJ B;  1VHA A;  2CW4 A;  3VOB A;  4NQ3 A;  3N2K A;  1Z5V A;  2HRU A;  2ZF8 A;  1CN7 A;  4U3J A;  3R0P A;  3V7E A;  4C8G A;  3NK7 A;  4NWO B;  2LCA A;  3VTI C;  3JAL B;  3VCZ A;  1T0A A;  4X3M A;  2GZL A;  3VYU C;  1W5A A; 
#chains in the Genus database with same CATH homology
 3FFM A;  1IPA A;  3PLA C;  2I6D A;  5FLX M;  3LWR C;  1H7M A;  3CC7 F;  3I56 F;  3N4Y A;  1KC8 H;  4EI7 A;  3CD6 F;  1Q81 H;  3CCQ F;  1K73 H;  3HJW C;  3CCR F;  3CCM F;  3CCE F;  1Q86 H;  1W2B F;  2ALE A;  4NUT A;  2F9Z C;  3CMA F;  1VQN F;  5HY0 A;  1CK2 A;  2QI2 A;  1YJW F;  1VQO F;  3G6E F;  3CCJ F;  3J7A R;  5G4V C;  3O85 A;  2VGM A;  5HWE A;  2OHW A;  1X52 A;  4XCQ A;  2VGN A;  1W41 A;  3GYQ A;  4BY9 D;  2QA4 F;  1E7K A;  3CCV F;  1YIT F;  3CCU F;  1NMU B;  5EO3 A;  1W42 A;  3JAM M;  1Q82 H;  3LWP C;  1DT9 A;  5HXZ A;  3CME F;  3NK6 A;  1GZ0 A;  3V3T A;  1YHQ F;  3RA5 A;  3LWO C;  1K9M H;  3NVK E;  1VQ9 F;  3SIV A;  5IT9 M;  3JCM M;  3VI6 A;  3MCA B;  1K8A H;  3D00 A;  1GO0 A;  4EI9 A;  1VQ7 F;  3NMU C;  3ON1 A;  2KTV A;  4BVQ A;  1VQ8 F;  5HY4 A;  2BO1 A;  3OBY A;  4TZZ A;  3LFO A;  3OBW A;  1S72 F;  1JJ2 F;  1VQ5 F;  2OTL F;  3SIU A;  3G71 F;  2GLZ A;  1KD1 H;  2WAL A;  2KG4 A;  1XBI A;  1N8R H;  3CCS F;  3CCL F;  5GIO C;  1RLG A;  5HY2 A;  3OW2 F;  1GO1 A;  1YI2 F;  1PXW A;  1VQL F;  1RA4 A;  1W3E X;  3VMF B;  2CZW A;  1T0K B;  5GIP C;  4C4W C;  3PAF A;  3N4Z A;  2HVY D;  2LBX A;  1VQ6 F;  1M90 H;  3CPQ A;  5A2Q M;  5GIN C;  1NJI H;  3E1Y A;  3RA6 A;  3CG6 A;  3CC2 F;  3WXM B;  1QVG F;  3V7Q A;  4BVS A;  1Q7Y H;  1VQ4 F;  2LBW A;  5GAN K;  5G4U C;  2OTJ F;  2FC3 A;  2AIF A;  1SDS A;  5DCV A;  2QEX F;  3LWV C;  5GAP K;  3CXC F;  1X7P A;  1X7O A;  4EI8 A;  2OZB A;  1VQK F;  1QVF F;  4X3L A;  5HY1 A;  1VQP F;  2KTU A;  3CC4 F;  5EWR A;  3CPW F;  3J81 M;  2JNB A;  3G4S F;  4BW0 B;  1YJN F;  1KQS F;  3HAX D;  1YJ9 F;  4NQ3 A;  1VQM F;  3I55 F;  3E20 B;  1ZWZ A;  3LWQ C;  3J80 M;  1YIJ F;  1CN7 A;  2FGY A;  3AGK A;  3NVI B;  3V7E A;  4LCK A;  4BVR A;  3IR9 A;  3NK7 A;  5FJ4 C;  4BVT A;  4X3M A;  5HXU A;  1W40 A;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...