2KTVA

Human erf1 c-domain, "open" conformer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
164
structure length
164
Chain Sequence
NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 32
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktvA00
1VQ4F 2OTLF 3LWOC 1Q82H 3MCAB 3LWQC 4X3MA 3OBYA 1VQNF 2OTJF 5G4UC 3AGKA 3G6EF 1H7MA 1Q81H 3CC7F 3G4SF 5G4VC 2QA4F 3WXMB 3NK6A 3RA5A 3SIVA 4BW0B 1N8RH 1VQPF 2WALA 1IPAA 1W41A 3CMAF 1W3EX 3VI6A 2AIFA 1NJIH 2VGNA 3OW2F 1KD1H 1X52A 1SDSA 3J80M 3E1YA 1YJ9F 3GYQA 3PLAC 3V7QA 2JNBA 1Q7YH 3FFMA 1X7OA 3LWPC 2KTVA 1VQLF 3CMEF 1GO1A 3JCMM 3HAXD 5A2QM 2I6DA 3NK7A 5GINC 1XBIA 1Q86H 5GANK 4LCKA 3CCJF 2KG4A 1M90H 3E20B 3PAFA 1KC8H 1QVGF 1KQSF 2LBWA 4TZZA 3CC4F 1VQ5F 2CZWA 1VQ9F 1QVFF 3CXCF 1K9MH 1T0KB 5DCVA 1W42A 3J7AR 3J81M 3LWRC 3CCEF 1S72F 1RA4A 1K73H 1VQOF 2BO1A 1YI2F 1JJ2F 4X3LA 5GIPC 5EWRA 1RLGA 1PXWA 3CD6F 3NVIB 5FJ4C 3LWVC 3I55F 1GO0A 1YJNF 1NMUB 1W40A 1VQMF 1CN7A 3LFOA 3CCRF 1YJWF 2KTUA 3N4YA 1E7KA 2LBXA 3CPQA 4NUTA 3O85A 5GAPK 3NMUC 3I56F 1YITF 3CCVF 3SIUA 2OHWA 1K8AH 1ZWZA 1VQ7F 3VMFB 1VQ8F 4BY9D 3V7EA 3CCSF 3N4ZA 3ON1A 2QEXF 1DT9A 3IR9A 3JAMM 3CCMF 1YIJF 3CC2F 3CCUF 1YHQF 1VQ6F 1CK2A 2QI2A 1W2BF 3CCLF 2VGMA 5EO3A 5IT9M 3G71F 4C4WC 1X7PA 3HJWC 3CG6A 3OBWA 3CCQF 1GZ0A 5FLXM 3NVKE 1VQKF 1M1KH 2HVYD 3RA6A 2FC3A 2ALEA 5GIOC 3CPWF 2OZBA
chains in the Genus database with same CATH superfamily
1VQ4F 3WJPA 2OTLF 4G4XA 4TV9B 4M8IA 3MCAB 5EIBD 3LWQC 3OBYA 3C9SA 1VQNF 3G6EF 3D54A 3VO8A 5KMGB 2HP3A 2QA4F 5MN4A 4IIJB 4I55A 3CYPB 3S0HA 4ZHYB 4BVQA 3JALB 3N2GB 4YJ3B 2HP0B 2WALA 3MDOA 4LNUA 1W41A 3RYHB 1J7HA 3OW2F 5HP7A 1SDSA 1X52A 5LXTA 4O4LA 3HKCA 2H8CA 3LWPC 4U3JA 1XV2A 1GO1A 5IYZA 5JQGB 4RHAA 1JD1A 5A2QM 3KHNA 5IJ0B 3GTZA 3VYSC 5KX5A 5CA0A 4X1IB 1YQNA 3IMPA 5CA1A 5GANK 2YYEA 4I50B 2KG4A 3RYIB 1M90H 1KC8H 3IEWA 5C8YB 1FFXB 3CC4F 2UYNB 4BT2A 3RYCB 1W55A 4WBNA 2CZWA 2Q1XA 1VQ9F 3P4EA 5DCVA 3HKBB 1W42A 2ZAUA 3J81M 3GHZA 4X1YA 4X1KB 5EZYA 2BO1A 3DDNA 5J2UA 1YI2F 3LYBA 5GIPC 3KE1A 3HWUA 5HY1A 1RLGA 3CD6F 1JFFB 3I55F 1W40A 3JVHA 4G88A 4BVTA 3LFOA 4E6EA 4DRXA 2K1SA 1UFYA 2HS0A 3JAKB 4X20B 5GAPK 3RYFA 5LOVB 5GONA 4B62A 3FD6A 1K8AH 3VOBA 1VQ8F 4O4IB 4O4JA 2NMUA 2Q1YA 4XCQA 4EI9A 1TVKA 5BMVB 5CB4A 2GLZA 4TUYA 3DC2A 2Z1FA 2W8BC 1SA0A 4KWEA 5EO3A 4C8EA 3HKDA 3K12A 4O4HB 4HNAB 3M4SA 3JASB 3VYTC 4G4YA 5HP8A 1Q8RA 3CPWF 3E22B 5MN6A 3C9TA 4IHJB 5FNVA 1Q82H 3IEQA 2IAFA 4G4WA 4X3MA 4C8GA 4TV8A 3WJQA 5LA6A 4C82A 3D00A 2ZVZA 3G4SF 5G4VC 4ERHA 5IJ9A 4YJ2A 3SIVA 3RA5A 4U39A 4BW0B 4EB6B 1RLUA 3EORA 5JVDB 1VQPF 3IKFA 2F9ZC 2FGYA 4FFBA 5J2TA 3CMAF 2AIFA 1OFUA 1U40A 1W5FA 3J80M 1NQ3A 3N2KB 5HY4A 3E1YA 3S06A 4B46A 1KNJA 1X25A 1IV3A 2JNBA 1Q7YH 4ZHQB 3C9UA 2OTMA 4BT4A 3ESJA 3JAWA 3WPWA 3WGKA 3JCMM 3WGJA 3HAXD 2B33A 5IJ0A 3ZO8A 1Q86H 4LCKA 3JARA 3ZOPA 5ITZA 2HX0A 1QVGF 1U3PA 2P6YA 4O2AB 4ZHWA 5LP6A 2UYPA 3JATB 2LCAA 1T0KB 5HWEA 3J7AR 1H47A 5EYPB 4B5CA 2CW4A 4X1KA 3TD4A 1RA4A 2AMTA 3F0EA 4G4VA 3LDTA 2GZLA 1JFFA 1PXWA 1RQ2A 5FJ4C 3T80A 3LWVC 4ZHVA 1GO0A 1YJNF 1NMUB 4BT5A 1CN7A 4I4TB 3CCRF 3JAKA 2MQEA 3F0FA 4BT3A 2AIZP 5JCOA 2KGWA 2H8EA 2L26A 3I56F 2ZVYA 3K0TA 2RHHA 1ZWZA 3ZP7A 1W5AA 3ERNA 3VMFB 3V7EA 2RB9A 3CCSF 1YIJF 4EI8A 3FPIA 3P10A 1IV1A 4ZI7A 2G9IA 1CK2A 2QI2A 2EWCA 4RQOA 5LYJA 3CCLF 4I55B 2GVIA 1IV4A 1YGYA 4O4HA 3G71F 2UYKA 4LNUB 3CG6A 5JH7A 3VIUA 5HY0A 5FLXM 3UT5A 5LXTB 2VAMA 2CHSA 4O4LB 2HRYA 2FC3A 3HKCB 2ALEA 2CWJA 3QHDA 4B45A 5GIOC 2OZBA 2RHLA 3LWOC 1JN1A 4BVSA 2ZODA 4U3JB 5EIBC 3VTIC 4C81A 2QTPA 2OTJF 3AGKA 2CSLA 5IYZB 1H7MA 4F6RA 5EAZA 3NK6A 5CA0B 3HKEA 3Q8HA 5CA1B 3VOAA 2HS4A 3VI6A 3WGLA 3U0OA 1TUBA 3QUWA 4ZOLA 4WBNB 3PLAC 2PHNA 2CVLA 3V7QA 4TV9A 1FNKA 2VAWA 3FFMA 1X7OA 3F0GA 2KTVA 3V4DA 3OONA 5EZYB 3M84A 5J2UB 5KMGA 2I6DA 2IQQA 5HXZA 3K14A 1XBIA 5GINC 4IIJA 4R40B 3JALA 3CCJF 3N2GA 4YJ3A 2I6RA 2HP0A 3RYHA 3PAFA 3KJKA 1KNKA 4DRXB 1KQSF 4C8IA 2LBWA 4TZZA 1R1MA 2BTUA 3L7QA 3F0DA 2CHTA 3RYFB 3MQWA 1ODEA 5GONB 5B8FA 5EYPA 3CXCF 1K9MH 2BTQB 2Z1UA 3WJRA 3P0ZA 4NWOB 4G4ZA 1K73H 5JQGA 1VQOF 1TVKB 2HRUA 5CB4B 1JJ2F 2ZF8A 4X3LA 3V3TA 5EWRA 2RHJA 4X1IA 3NVIB 4TUYB 3I3FA 4O2BB 4I50A 5EB1B 3RYIA 1VQMF 3HKDB 5AVMA 5C8YA 2KTUA 1FFXA 5EB0A 2LBXA 1CLIA 1T0AA 3LMEA 2UYNA 4NUTA 3RYCA 3O85A 3HKBA 1YITF 1UI9A 3CCVF 1Z5WA 5FNVB 3TD5A 1VQ7F 4BY9D 4TV8B 5LA6B 1DT9A 3CCMF 3CC2F 1VK3A 4YJ2B 5IJ9B 3CYQA 1VQVA 2R751 1SZQA 1H48A 2VGMA 2ZOVA 3R0PA 1COMA 4C4WC 2UYJA 3HJWC 4FFBB 5J2TB 3CCQF 2HQSC 3WPXA 2BTOA 1M1KH 1OAPA 4X20A 5HY2A 3BYQA 3VCZA 3MCQA 3ZP4A 5LOVA 2HVYD 1Z5VA 3VYUC 5G4UC 4O4IA 3JAWB 2Z1EA 3I7TA 5BMVA 4BT7A 1Q81H 3CC7F 3QTYA 3WXMB 2Z01A 2RHOA 2DT4A 5LP6C 1N8RH 1ONIA 3JARB 5ITZB 1QD9A 1IPAA 4HNAA 3B6NA 1W3EX 3F6MA 3JASA 5LP6B 1RQ7A 1NJIH 2VGNA 1KD1H 1W581 1YJ9F 3C9RA 3D01A 3GYQA 3E22A 2PMPA 3FBAA 4IHJA 3KJJA 2DYYA 1VQLF 3CMEF 1W5BA 4NQ3A 2V9YA 1U3LA 3NK7A 3S03A 2HS3A 2LBTA 3TD3A 1FNJA 2R6R1 3S0YA 1W57A 2IG8A 3WGNA 3MBMA 5KX5B 4EB6A 4PWTA 5JVDA 1W5EA 3E20B 2Z1TA 5JCOC 3FD5A 3N2KA 4ZK7A 1VHAA 1U43A 3S0WA 1IV2A 1PF5A 1VQ5F 4DXDA 1QVFF 3ELCA 3KIZA 4ZHQA 1DBFA 2H6LA 3LWRC 3CCEF 1S72F 1XRGA 4X1YB 1JY8A 4ZI7B 4O2BA 1QU9A 1QAHA 5LYJB 1GX1A 5HXUA 2VAPA 1YJWF 3N4YA 4O2AA 1E7KA 5JH7B 3JATA 3CB2A 3CPQA 3UT5B 3M1XA 3NMUC 4EI7A 1W59A 3IKEA 3SIUA 1XHOA 2OHWA 3C8LA 4BT6A 3N4ZA 3ON1A 2QEXF 1VH8A 2VXYA 1FSZA 3IR9A 4O4JB 3JAMM 3CCUF 1YHQF 4F6RB 1VQ6F 3WGMA 5MN5A 3RE3A 2UZHA 3S02A 1W2BF 3HTNA 3HKEB 2N48A 3K2XA 5IT9M 1SA0B 4I4TA 1X7PA 2YXZA 3OBWA 1GZ0A 3NVKE 1TUBB 1VQKF 3RA6A 4ZOLB 4BVRA
chains in the Genus database with same CATH topology
1VQ4F 2OTLF 3LWOC 4BVSA 1Q82H 3MCAB 3LWQC 4X3MA 3OBYA 1VQNF 2OTJF 5G4UC 3AGKA 3G6EF 3D00A 1H7MA 1Q81H 3CC7F 3G4SF 5G4VC 2QA4F 3WXMB 3NK6A 3RA5A 3SIVA 4BW0B 1N8RH 4BVQA 1VQPF 2WALA 1IPAA 1W41A 2F9ZC 2FGYA 3CMAF 3VI6A 1W3EX 2AIFA 1NJIH 2VGNA 3OW2F 1KD1H 1X52A 1SDSA 3J80M 5HY4A 3E1YA 1YJ9F 3GYQA 3PLAC 3V7QA 2JNBA 1Q7YH 3FFMA 1X7OA 3LWPC 2KTVA 1VQLF 3CMEF 1GO1A 4NQ3A 3JCMM 3HAXD 5A2QM 2I6DA 3NK7A 5HXZA 5GINC 1XBIA 1Q86H 5GANK 4LCKA 3CCJF 2KG4A 1M90H 3E20B 3PAFA 1KC8H 1QVGF 1KQSF 2LBWA 4TZZA 3CC4F 1VQ5F 2CZWA 1VQ9F 1QVFF 3CXCF 1K9MH 1T0KB 5DCVA 1W42A 5HWEA 3J7AR 3J81M 3LWRC 3CCEF 1S72F 1RA4A 1K73H 1VQOF 2BO1A 1YI2F 1JJ2F 4X3LA 5GIPC 3V3TA 5EWRA 5HY1A 1PXWA 1RLGA 3CD6F 3NVIB 5FJ4C 3LWVC 3I55F 1GO0A 1YJNF 1NMUB 1W40A 4BVTA 5HXUA 1VQMF 1CN7A 3LFOA 3CCRF 1YJWF 2KTUA 3N4YA 1E7KA 2LBXA 3CPQA 4NUTA 3O85A 5GAPK 4EI7A 3NMUC 3I56F 1YITF 3CCVF 3SIUA 2OHWA 1K8AH 1ZWZA 1VQ7F 3VMFB 1VQ8F 4BY9D 3V7EA 3CCSF 3N4ZA 3ON1A 4XCQA 1DT9A 3IR9A 4EI9A 3JAMM 4EI8A 2QEXF 3CCMF 1YIJF 3CC2F 3CCUF 1YHQF 1VQ6F 2GLZA 1CK2A 2QI2A 1W2BF 3CCLF 2VGMA 5EO3A 5IT9M 3G71F 4C4WC 1X7PA 3HJWC 3CG6A 3OBWA 3CCQF 1GZ0A 5HY0A 5FLXM 3NVKE 1VQKF 1M1KH 5HY2A 2HVYD 3RA6A 2FC3A 2ALEA 5GIOC 3CPWF 4BVRA 2OZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 F;  2OTL F;  3LWO C;  1Q82 H;  3MCA B;  3LWQ C;  4X3M A;  3OBY A;  1VQN F;  2OTJ F;  5G4U C;  3AGK A;  3G6E F;  1H7M A;  1Q81 H;  3CC7 F;  3G4S F;  5G4V C;  2QA4 F;  3WXM B;  3NK6 A;  3RA5 A;  3SIV A;  4BW0 B;  1N8R H;  1VQP F;  2WAL A;  1IPA A;  1W41 A;  3CMA F;  1W3E X;  3VI6 A;  2AIF A;  1NJI H;  2VGN A;  3OW2 F;  1KD1 H;  1X52 A;  1SDS A;  3J80 M;  3E1Y A;  1YJ9 F;  3GYQ A;  3PLA C;  3V7Q A;  2JNB A;  1Q7Y H;  3FFM A;  1X7O A;  3LWP C;  2KTV A;  1VQL F;  3CME F;  1GO1 A;  3JCM M;  3HAX D;  5A2Q M;  2I6D A;  3NK7 A;  5GIN C;  1XBI A;  1Q86 H;  5GAN K;  4LCK A;  3CCJ F;  2KG4 A;  1M90 H;  3E20 B;  3PAF A;  1KC8 H;  1QVG F;  1KQS F;  2LBW A;  4TZZ A;  3CC4 F;  1VQ5 F;  2CZW A;  1VQ9 F;  1QVF F;  3CXC F;  1K9M H;  1T0K B;  5DCV A;  1W42 A;  3J7A R;  3J81 M;  3LWR C;  3CCE F;  1S72 F;  1RA4 A;  1K73 H;  1VQO F;  2BO1 A;  1YI2 F;  1JJ2 F;  4X3L A;  5GIP C;  5EWR A;  1RLG A;  1PXW A;  3CD6 F;  3NVI B;  5FJ4 C;  3LWV C;  3I55 F;  1GO0 A;  1YJN F;  1NMU B;  1W40 A;  1VQM F;  1CN7 A;  3LFO A;  3CCR F;  1YJW F;  2KTU A;  3N4Y A;  1E7K A;  2LBX A;  3CPQ A;  4NUT A;  3O85 A;  5GAP K;  3NMU C;  3I56 F;  1YIT F;  3CCV F;  3SIU A;  2OHW A;  1K8A H;  1ZWZ A;  1VQ7 F;  3VMF B;  1VQ8 F;  4BY9 D;  3V7E A;  3CCS F;  3N4Z A;  3ON1 A;  2QEX F;  1DT9 A;  3IR9 A;  3JAM M;  3CCM F;  1YIJ F;  3CC2 F;  3CCU F;  1YHQ F;  1VQ6 F;  1CK2 A;  2QI2 A;  1W2B F;  3CCL F;  2VGM A;  5EO3 A;  5IT9 M;  3G71 F;  4C4W C;  1X7P A;  3HJW C;  3CG6 A;  3OBW A;  3CCQ F;  1GZ0 A;  5FLX M;  3NVK E;  1VQK F;  1M1K H;  2HVY D;  3RA6 A;  2FC3 A;  2ALE A;  5GIO C;  3CPW F;  2OZB A; 
#chains in the Genus database with same CATH topology
 1VQ4 F;  3WJP A;  2OTL F;  4G4X A;  4TV9 B;  4M8I A;  3MCA B;  5EIB D;  3LWQ C;  3OBY A;  3C9S A;  1VQN F;  3G6E F;  3D54 A;  3VO8 A;  5KMG B;  2HP3 A;  2QA4 F;  5MN4 A;  4IIJ B;  4I55 A;  3CYP B;  3S0H A;  4ZHY B;  4BVQ A;  3JAL B;  3N2G B;  4YJ3 B;  2HP0 B;  2WAL A;  3MDO A;  4LNU A;  1W41 A;  3RYH B;  1J7H A;  3OW2 F;  5HP7 A;  1SDS A;  1X52 A;  5LXT A;  4O4L A;  3HKC A;  2H8C A;  3LWP C;  4U3J A;  1XV2 A;  1GO1 A;  5IYZ A;  5JQG B;  4RHA A;  1JD1 A;  5A2Q M;  3KHN A;  5IJ0 B;  3GTZ A;  3VYS C;  5KX5 A;  5CA0 A;  4X1I B;  1YQN A;  3IMP A;  5CA1 A;  5GAN K;  2YYE A;  4I50 B;  2KG4 A;  3RYI B;  1M90 H;  1KC8 H;  3IEW A;  5C8Y B;  1FFX B;  3CC4 F;  2UYN B;  4BT2 A;  3RYC B;  1W55 A;  4WBN A;  2CZW A;  2Q1X A;  1VQ9 F;  3P4E A;  5DCV A;  3HKB B;  1W42 A;  2ZAU A;  3J81 M;  3GHZ A;  4X1Y A;  4X1K B;  5EZY A;  2BO1 A;  3DDN A;  5J2U A;  1YI2 F;  3LYB A;  5GIP C;  3KE1 A;  3HWU A;  5HY1 A;  1RLG A;  3CD6 F;  1JFF B;  3I55 F;  1W40 A;  3JVH A;  4G88 A;  4BVT A;  3LFO A;  4E6E A;  4DRX A;  2K1S A;  1UFY A;  2HS0 A;  3JAK B;  4X20 B;  5GAP K;  3RYF A;  5LOV B;  5GON A;  4B62 A;  3FD6 A;  1K8A H;  3VOB A;  1VQ8 F;  4O4I B;  4O4J A;  2NMU A;  2Q1Y A;  4XCQ A;  4EI9 A;  1TVK A;  5BMV B;  5CB4 A;  2GLZ A;  4TUY A;  3DC2 A;  2Z1F A;  2W8B C;  1SA0 A;  4KWE A;  5EO3 A;  4C8E A;  3HKD A;  3K12 A;  4O4H B;  4HNA B;  3M4S A;  3JAS B;  3VYT C;  4G4Y A;  5HP8 A;  1Q8R A;  3CPW F;  3E22 B;  5MN6 A;  3C9T A;  4IHJ B;  5FNV A;  1Q82 H;  3IEQ A;  2IAF A;  4G4W A;  4X3M A;  4C8G A;  4TV8 A;  3WJQ A;  5LA6 A;  4C82 A;  3D00 A;  2ZVZ A;  3G4S F;  5G4V C;  4ERH A;  5IJ9 A;  4YJ2 A;  3SIV A;  3RA5 A;  4U39 A;  4BW0 B;  4EB6 B;  1RLU A;  3EOR A;  5JVD B;  1VQP F;  3IKF A;  2F9Z C;  2FGY A;  4FFB A;  5J2T A;  3CMA F;  2AIF A;  1OFU A;  1U40 A;  1W5F A;  3J80 M;  1NQ3 A;  3N2K B;  5HY4 A;  3E1Y A;  3S06 A;  4B46 A;  1KNJ A;  1X25 A;  1IV3 A;  2JNB A;  1Q7Y H;  4ZHQ B;  3C9U A;  2OTM A;  4BT4 A;  3ESJ A;  3JAW A;  3WPW A;  3WGK A;  3JCM M;  3WGJ A;  3HAX D;  2B33 A;  5IJ0 A;  3ZO8 A;  1Q86 H;  4LCK A;  3JAR A;  3ZOP A;  5ITZ A;  2HX0 A;  1QVG F;  1U3P A;  2P6Y A;  4O2A B;  4ZHW A;  5LP6 A;  2UYP A;  3JAT B;  2LCA A;  1T0K B;  5HWE A;  3J7A R;  1H47 A;  5EYP B;  4B5C A;  2CW4 A;  4X1K A;  3TD4 A;  1RA4 A;  2AMT A;  3F0E A;  4G4V A;  3LDT A;  2GZL A;  1JFF A;  1PXW A;  1RQ2 A;  5FJ4 C;  3T80 A;  3LWV C;  4ZHV A;  1GO0 A;  1YJN F;  1NMU B;  4BT5 A;  1CN7 A;  4I4T B;  3CCR F;  3JAK A;  2MQE A;  3F0F A;  4BT3 A;  2AIZ P;  5JCO A;  2KGW A;  2H8E A;  2L26 A;  3I56 F;  2ZVY A;  3K0T A;  2RHH A;  1ZWZ A;  3ZP7 A;  1W5A A;  3ERN A;  3VMF B;  3V7E A;  2RB9 A;  3CCS F;  1YIJ F;  4EI8 A;  3FPI A;  3P10 A;  1IV1 A;  4ZI7 A;  2G9I A;  1CK2 A;  2QI2 A;  2EWC A;  4RQO A;  5LYJ A;  3CCL F;  4I55 B;  2GVI A;  1IV4 A;  1YGY A;  4O4H A;  3G71 F;  2UYK A;  4LNU B;  3CG6 A;  5JH7 A;  3VIU A;  5HY0 A;  5FLX M;  3UT5 A;  5LXT B;  2VAM A;  2CHS A;  4O4L B;  2HRY A;  2FC3 A;  3HKC B;  2ALE A;  2CWJ A;  3QHD A;  4B45 A;  5GIO C;  2OZB A;  2RHL A;  3LWO C;  1JN1 A;  4BVS A;  2ZOD A;  4U3J B;  5EIB C;  3VTI C;  4C81 A;  2QTP A;  2OTJ F;  3AGK A;  2CSL A;  5IYZ B;  1H7M A;  4F6R A;  5EAZ A;  3NK6 A;  5CA0 B;  3HKE A;  3Q8H A;  5CA1 B;  3VOA A;  2HS4 A;  3VI6 A;  3WGL A;  3U0O A;  1TUB A;  3QUW A;  4ZOL A;  4WBN B;  3PLA C;  2PHN A;  2CVL A;  3V7Q A;  4TV9 A;  1FNK A;  2VAW A;  3FFM A;  1X7O A;  3F0G A;  2KTV A;  3V4D A;  3OON A;  5EZY B;  3M84 A;  5J2U B;  5KMG A;  2I6D A;  2IQQ A;  5HXZ A;  3K14 A;  1XBI A;  5GIN C;  4IIJ A;  4R40 B;  3JAL A;  3CCJ F;  3N2G A;  4YJ3 A;  2I6R A;  2HP0 A;  3RYH A;  3PAF A;  3KJK A;  1KNK A;  4DRX B;  1KQS F;  4C8I A;  2LBW A;  4TZZ A;  1R1M A;  2BTU A;  3L7Q A;  3F0D A;  2CHT A;  3RYF B;  3MQW A;  1ODE A;  5GON B;  5B8F A;  5EYP A;  3CXC F;  1K9M H;  2BTQ B;  2Z1U A;  3WJR A;  3P0Z A;  4NWO B;  4G4Z A;  1K73 H;  5JQG A;  1VQO F;  1TVK B;  2HRU A;  5CB4 B;  1JJ2 F;  2ZF8 A;  4X3L A;  3V3T A;  5EWR A;  2RHJ A;  4X1I A;  3NVI B;  4TUY B;  3I3F A;  4O2B B;  4I50 A;  5EB1 B;  3RYI A;  1VQM F;  3HKD B;  5AVM A;  5C8Y A;  2KTU A;  1FFX A;  5EB0 A;  2LBX A;  1CLI A;  1T0A A;  3LME A;  2UYN A;  4NUT A;  3RYC A;  3O85 A;  3HKB A;  1YIT F;  1UI9 A;  3CCV F;  1Z5W A;  5FNV B;  3TD5 A;  1VQ7 F;  4BY9 D;  4TV8 B;  5LA6 B;  1DT9 A;  3CCM F;  3CC2 F;  1VK3 A;  4YJ2 B;  5IJ9 B;  3CYQ A;  1VQV A;  2R75 1;  1SZQ A;  1H48 A;  2VGM A;  2ZOV A;  3R0P A;  1COM A;  4C4W C;  2UYJ A;  3HJW C;  4FFB B;  5J2T B;  3CCQ F;  2HQS C;  3WPX A;  2BTO A;  1M1K H;  1OAP A;  4X20 A;  5HY2 A;  3BYQ A;  3VCZ A;  3MCQ A;  3ZP4 A;  5LOV A;  2HVY D;  1Z5V A;  3VYU C;  5G4U C;  4O4I A;  3JAW B;  2Z1E A;  3I7T A;  5BMV A;  4BT7 A;  1Q81 H;  3CC7 F;  3QTY A;  3WXM B;  2Z01 A;  2RHO A;  2DT4 A;  5LP6 C;  1N8R H;  1ONI A;  3JAR B;  5ITZ B;  1QD9 A;  1IPA A;  4HNA A;  3B6N A;  1W3E X;  3F6M A;  3JAS A;  5LP6 B;  1RQ7 A;  1NJI H;  2VGN A;  1KD1 H;  1W58 1;  1YJ9 F;  3C9R A;  3D01 A;  3GYQ A;  3E22 A;  2PMP A;  3FBA A;  4IHJ A;  3KJJ A;  2DYY A;  1VQL F;  3CME F;  1W5B A;  4NQ3 A;  2V9Y A;  1U3L A;  3NK7 A;  3S03 A;  2HS3 A;  2LBT A;  3TD3 A;  1FNJ A;  2R6R 1;  3S0Y A;  1W57 A;  2IG8 A;  3WGN A;  3MBM A;  5KX5 B;  4EB6 A;  4PWT A;  5JVD A;  1W5E A;  3E20 B;  2Z1T A;  5JCO C;  3FD5 A;  3N2K A;  4ZK7 A;  1VHA A;  1U43 A;  3S0W A;  1IV2 A;  1PF5 A;  1VQ5 F;  4DXD A;  1QVF F;  3ELC A;  3KIZ A;  4ZHQ A;  1DBF A;  2H6L A;  3LWR C;  3CCE F;  1S72 F;  1XRG A;  4X1Y B;  1JY8 A;  4ZI7 B;  4O2B A;  1QU9 A;  1QAH A;  5LYJ B;  1GX1 A;  5HXU A;  2VAP A;  1YJW F;  3N4Y A;  4O2A A;  1E7K A;  5JH7 B;  3JAT A;  3CB2 A;  3CPQ A;  3UT5 B;  3M1X A;  3NMU C;  4EI7 A;  1W59 A;  3IKE A;  3SIU A;  1XHO A;  2OHW A;  3C8L A;  4BT6 A;  3N4Z A;  3ON1 A;  2QEX F;  1VH8 A;  2VXY A;  1FSZ A;  3IR9 A;  4O4J B;  3JAM M;  3CCU F;  1YHQ F;  4F6R B;  1VQ6 F;  3WGM A;  5MN5 A;  3RE3 A;  2UZH A;  3S02 A;  1W2B F;  3HTN A;  3HKE B;  2N48 A;  3K2X A;  5IT9 M;  1SA0 B;  4I4T A;  1X7P A;  2YXZ A;  3OBW A;  1GZ0 A;  3NVK E;  1TUB B;  1VQK F;  3RA6 A;  4ZOL B;  4BVR A; 
#chains in the Genus database with same CATH homology
 1VQ4 F;  2OTL F;  3LWO C;  4BVS A;  1Q82 H;  3MCA B;  3LWQ C;  4X3M A;  3OBY A;  1VQN F;  2OTJ F;  5G4U C;  3AGK A;  3G6E F;  3D00 A;  1H7M A;  1Q81 H;  3CC7 F;  3G4S F;  5G4V C;  2QA4 F;  3WXM B;  3NK6 A;  3RA5 A;  3SIV A;  4BW0 B;  1N8R H;  4BVQ A;  1VQP F;  2WAL A;  1IPA A;  1W41 A;  2F9Z C;  2FGY A;  3CMA F;  3VI6 A;  1W3E X;  2AIF A;  1NJI H;  2VGN A;  3OW2 F;  1KD1 H;  1X52 A;  1SDS A;  3J80 M;  5HY4 A;  3E1Y A;  1YJ9 F;  3GYQ A;  3PLA C;  3V7Q A;  2JNB A;  1Q7Y H;  3FFM A;  1X7O A;  3LWP C;  2KTV A;  1VQL F;  3CME F;  1GO1 A;  4NQ3 A;  3JCM M;  3HAX D;  5A2Q M;  2I6D A;  3NK7 A;  5HXZ A;  5GIN C;  1XBI A;  1Q86 H;  5GAN K;  4LCK A;  3CCJ F;  2KG4 A;  1M90 H;  3E20 B;  3PAF A;  1KC8 H;  1QVG F;  1KQS F;  2LBW A;  4TZZ A;  3CC4 F;  1VQ5 F;  2CZW A;  1VQ9 F;  1QVF F;  3CXC F;  1K9M H;  1T0K B;  5DCV A;  1W42 A;  5HWE A;  3J7A R;  3J81 M;  3LWR C;  3CCE F;  1S72 F;  1RA4 A;  1K73 H;  1VQO F;  2BO1 A;  1YI2 F;  1JJ2 F;  4X3L A;  5GIP C;  3V3T A;  5EWR A;  5HY1 A;  1PXW A;  1RLG A;  3CD6 F;  3NVI B;  5FJ4 C;  3LWV C;  3I55 F;  1GO0 A;  1YJN F;  1NMU B;  1W40 A;  4BVT A;  5HXU A;  1VQM F;  1CN7 A;  3LFO A;  3CCR F;  1YJW F;  2KTU A;  3N4Y A;  1E7K A;  2LBX A;  3CPQ A;  4NUT A;  3O85 A;  5GAP K;  4EI7 A;  3NMU C;  3I56 F;  1YIT F;  3CCV F;  3SIU A;  2OHW A;  1K8A H;  1ZWZ A;  1VQ7 F;  3VMF B;  1VQ8 F;  4BY9 D;  3V7E A;  3CCS F;  3N4Z A;  3ON1 A;  4XCQ A;  1DT9 A;  3IR9 A;  4EI9 A;  3JAM M;  4EI8 A;  2QEX F;  3CCM F;  1YIJ F;  3CC2 F;  3CCU F;  1YHQ F;  1VQ6 F;  2GLZ A;  1CK2 A;  2QI2 A;  1W2B F;  3CCL F;  2VGM A;  5EO3 A;  5IT9 M;  3G71 F;  4C4W C;  1X7P A;  3HJW C;  3CG6 A;  3OBW A;  3CCQ F;  1GZ0 A;  5HY0 A;  5FLX M;  3NVK E;  1VQK F;  1M1K H;  5HY2 A;  2HVY D;  3RA6 A;  2FC3 A;  2ALE A;  5GIO C;  3CPW F;  4BVR A;  2OZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...