2KTVA

Human erf1 c-domain, "open" conformer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
164
structure length
164
Chain Sequence
NVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ktvA00
1GO0A 3LWVC 2I6DA 4BW0B 1VQPF 1W41A 2KTVA 2LBWA 3VMFB 3PLAC 3NK7A 2OHWA 3AGKA 2OTJF 1YJ9F 3CC7F 2JNBA 2LBXA 5GIPC 3OBWA 3VI6A 3MCAB 1E7KA 1K73H 1K9MH 3G71F 3CCEF 1H7MA 5EWRA 3CCMF 1VQMF 3HAXD 5FLXM 3CG6A 5GINC 5GANK 1YHQF 2BO1A 5G4UC 1Q82H 3CD6F 1QVGF 1X52A 2QA4F 3G6EF 5GAPK 4BY9D 3RA6A 1GZ0A 1N8RH 3LFOA 2QI2A 3N4YA 4NUTA 1NJIH 3NK6A 3CCVF 1VQ5F 1X7PA 3LWQC 3NVKE 5IT9M 3CCRF 1JJ2F 1KQSF 1RLGA 3PAFA 3CCQF 3WXMB 3V7EA 1NMUB 1YI2F 1YJWF 1Q86H 4TZZA 1W2BF 1PXWA 3CC4F 3IR9A 2KTUA 4LCKA 3NVIB 3CCUF 2KG4A 3N4ZA 3CXCF 3FFMA 5EO3A 5G4VC 1W3EX 3CMAF 1X7OA 2HVYD 3CPQA 1DT9A 1Q81H 1W40A 1CN7A 1YITF 3CCSF 2VGNA 1YIJF 1CK2A 3CPWF 1YJNF 1ZWZA 4X3LA 3CCJF 1VQ7F 5A2QM 3V7QA 2VGMA 3CMEF 2QEXF 3JCMM 4X3MA 1KC8H 3I55F 3JAMM 5DCVA 1S72F 2OZBA 2CZWA 1VQ6F 1VQ8F 1KD1H 3OW2F 1GO1A 3G4SF 3RA5A 3HJWC 3SIUA 3E1YA 1M1KH 2ALEA 1XBIA 3GYQA 1K8AH 3J80M 3CCLF 3SIVA 2AIFA 1QVFF 3J7AR 1IPAA 3OBYA 1VQ9F 4C4WC 3E20B 3LWOC 1VQNF 5GIOC 1Q7YH 3LWPC 3LWRC 5FJ4C 1VQ4F 1SDSA 1VQKF 1W42A 1VQLF 3ON1A 2FC3A 3O85A 1RA4A 3I56F 3CC2F 2WALA 1T0KB 2OTLF 1VQOF 3NMUC 1M90H 3J81M
chains in the Genus database with same CATH superfamily
3VO8A 1COMA 3JAWA 1W41A 2KGWA 1W5AA 5CA0A 2LBWA 3VMFB 4G4XA 1VHAA 4O2AA 4ZHVA 3AGKA 1YJ9F 3CC7F 2P6YA 2RHHA 3QTYA 1K73H 1XV2A 3TD4A 3LYBA 5EWRA 4BVRA 1VQMF 3HAXD 2ZODA 1FNJA 1YHQF 2BO1A 4YJ3B 4O4LA 1TUBB 5GAPK 1QD9A 3RYHB 4BY9D 3QUWA 5LOVA 2VAMA 1N8RH 3KJKA 1ONIA 2QI2A 3N4YA 3K0TA 4C8EA 4EI7A 3NK6A 3LDTA 1OAPA 3JAKB 4B5CA 1JFFA 2FGYA 1NQ3A 1RQ2A 1FNKA 1YGYA 1KQSF 3RYFA 1RLGA 4ZI7A 5BMVB 2EWCA 3KIZA 2Q1YA 5EB1B 2DT4A 3S0HA 1FSZA 3M1XA 2IQQA 5MN6A 4C8GA 1TVKA 5JCOA 2VXYA 4I55A 2H6LA 3LMEA 3VTIC 5LP6C 3ZP7A 3CCUF 1RLUA 2CW4A 5EYPB 3ZP4A 3CYQA 3HKDB 2BTQB 3FFMA 1W3EX 1DT9A 3HKCB 4M8IA 1W40A 2BTUA 2CVLA 3MBMA 4WBNB 2NMUA 4G4WA 1YITF 3CPWF 3P4EA 5FNVB 4X3LA 5EAZA 2UYPA 1W5BA 1VQ7F 2R751 2VGMA 4TV9A 2Z1FA 5CA1B 4PWTA 4X20B 3MDOA 3JALA 1T0AA 4BT4A 3D00A 3P0ZA 3I55F 3CB2A 3I3FA 2AMTA 4U3JA 2RHLA 5MN4A 1Q8RA 3GTZA 1R1MA 2ZAUA 1VQ6F 4F6RB 3OW2F 2CSLA 2RHOA 5LYJB 2MQEA 1W581 1U3PA 1IV1A 4ZHQA 3E22B 3ELCA 4LNUB 1M1KH 2ALEA 1XBIA 3I7TA 3GYQA 5EZYB 1DBFA 4G4YA 4BT5A 3F0EA 4O4HA 3ESJA 3OBYA 3LWOC 4IHJB 5GIOC 3JALB 3LWPC 4IIJB 1VQ4F 1SDSA 3JASA 1JD1A 4I50B 3R0PA 3O85A 5B8FA 1H47A 5JQGA 3NMUC 1M90H 3IEWA 4O2BA 2UYKA 1W57A 2I6DA 4BW0B 4TV8B 2KTVA 2R6R1 3RYCB 3NK7A 2OHWA 1IV2A 2JNBA 2HP0A 1IV3A 1H7MA 5IJ9A 1J7HA 5GINC 5G4UC 3JASB 1Q82H 3FD6A 1QVGF 5LA6A 2QA4F 1U3LA 3G6EF 3GHZA 3RE3A 1YQNA 3RA6A 3C9RA 4EB6B 2IAFA 3LFOA 2RB9A 5IJ0A 3WGMA 4DRXA 3CCVF 4NWOB 3L7QA 1VQ5F 2BTOA 4YJ2A 3JATA 5EIBC 5CB4A 3FBAA 3U0OA 2HS3A 5AVMA 5C8YA 5LXTA 4FFBA 4X1IB 3VIUA 3KHNA 3IR9A 3NVIB 5KMGB 3DC2A 1IV4A 3N2GA 4I4TB 3CMAF 4BT7A 3VYSC 2AIZP 2ZVYA 3WGLA 5J2UB 5LP6A 1RQ7A 3JAWB 4ZOLA 5CA0B 4C82A 4O2AB 5IYZA 5A2QM 4G88A 3V7QA 3FD5A 4HNAA 3D01A 4X3MA 4RQOA 2DYYA 5JVDA 3HKBA 3JAMM 5DCVA 1QU9A 3S03A 3JARA 4BT3A 1JN1A 4X1KA 4O4LB 2OZBA 3N2KA 2CZWA 3K14A 5HP8A 4B46A 5LOVB 3EORA 4BVTA 2YXZA 2HS4A 4DXDA 1JFFB 3DDNA 3J80M 3CCLF 2AIFA 3OONA 1QVFF 3RYFB 3F0DA 3WJPA 4ZI7B 5J2TA 4R40B 1VQ9F 3E20B 1TVKB 5FJ4C 1VQKF 3S0WA 2V9YA 2UYNA 4I55B 1FFXA 3K2XA 1VK3A 1JY8A 2YYEA 2WALA 2OTLF 4G4VA 1SA0A 2VAPA 1VQOF 3ZO8A 2HP3A 5HXUA 5ITZA 2IG8A 1H48A 1U40A 4O4JA 3IKFA 2N48A 3PLAC 2LBXA 5GIPC 3OBWA 2VAWA 4TV9B 2ZOVA 3M84A 3VI6A 3MCAB 1E7KA 3RYIA 1GX1A 1XRGA 1Z5VA 3CCMF 3TD3A 5GANK 2UYNB 5GONA 5KX5A 4U3JB 3VYUC 3VYTC 3F0FA 4TUYA 4ZK7A 2F9ZC 5HY0A 4BT2A 5J2UA 2HRUA 1GZ0A 3WGJA 5EB0A 3V4DA 1UFYA 1VH8A 4ZHQB 4EI8A 3HKEA 3B6NA 2Z1EA 1X7PA 2GZLA 3LWQC 1KNKA 2RHJA 4O4IA 3S0YA 3CCRF 1JJ2F 3PAFA 4X1YA 3WXMB 3V7EA 4O4HB 1YI2F 3MQWA 3ZOPA 4C8IA 4EI9A 4TZZA 2Q1XA 1PXWA 2HX0A 3CC4F 2KTUA 4LCKA 2GVIA 3N4ZA 2PMPA 5EO3A 1X7OA 2HVYD 2Z1TA 5JQGB 1W59A 3CCSF 1XHOA 4O2BB 3IMPA 3K12A 3CCJF 2G9IA 2W8BC 3WPXA 2QEXF 3FPIA 3JCMM 2HP0B 2Z1UA 1KC8H 5HY4A 2L26A 5IJ9B 4ZHWA 1W5FA 2H8CA 2CHSA 2ZVZA 4YJ3A 5JH7A 1TUBA 2LCAA 2OTMA 5LA6B 3F6MA 1S72F 4G4ZA 3RYHA 3M4SA 1GO1A 3G4SF 3ERNA 3T80A 3VOAA 3E1YA 3JAKA 5MN5A 3HJWC 5IJ0B 3SIUA 4DRXB 3WPWA 2ZF8A 3C9SA 5HWEA 3WJQA 1K8AH 4YJ2B 3SIVA 3JATB 5BMVA 1IPAA 5CB4B 4C4WC 5C8YB 4XCQA 4ERHA 1Q7YH 5LXTB 3LWRC 2GLZA 2UYJA 4FFBB 5JH7B 5EYPA 3ON1A 4U39A 2FC3A 3HKDA 1RA4A 3KJJA 1T0KB 3N2GB 3HKCA 4WBNA 1CLIA 3J81M 1GO0A 3LWVC 3HTNA 5LP6B 1VQPF 1OFUA 3WJRA 5FNVA 3IKEA 4ZOLB 5HXZA 3S02A 2LBTA 5IYZB 5CA1A 2OTJF 1Z5WA 3CYPB 1PF5A 4X20A 1ODEA 4HNAB 2HS0A 4B45A 1K9MH 2Z01A 3G71F 3CCEF 3IEQA 2K1SA 2UZHA 1X25A 3P10A 3TD5A 3CG6A 5FLXM 5JVDB 3HKBB 3CD6F 3JARB 4RHAA 1KNJA 1X52A 5HY1A 4X1KB 1SZQA 4F6RA 3N2KB 5LYJA 5EIBD 2H8EA 2I6RA 2HQSC 4NUTA 3E22A 1NJIH 4LNUA 1U43A 3VOBA 4KWEA 5JCOC 5EZYA 3NVKE 5IT9M 3CCQF 1NMUB 5J2TB 4NQ3A 4IHJA 1YJWF 4IIJA 3BYQA 1W2BF 1Q86H 3UT5A 2KG4A 1FFXB 4I50A 3MCQA 3CXCF 5G4VC 1QAHA 4BVSA 3CPQA 1SA0B 1Q81H 1CN7A 3V3TA 2HRYA 1YIJF 2VGNA 1CK2A 4TV8A 3WGNA 1YJNF 5HY2A 1ZWZA 5ITZB 1W55A 3RYCA 4O4JB 1W5EA 3CMEF 1VQVA 4ZHYB 3RYIB 3D54A 3S06A 3C9TA 4BT6A 5GONB 3C8LA 3UT5B 5KX5B 3JVHA 4TUYB 1VQ8F 1KD1H 2PHNA 3QHDA 4EB6A 4C81A 3RA5A 3WGKA 3KE1A 2CWJA 5HP7A 3HKEB 2QTPA 3HWUA 4O4IB 3J7AR 4X1YB 4E6EA 2B33A 1VQNF 4X1IA 4B62A 1UI9A 3Q8HA 3F0GA 4BVQA 1W42A 5KMGA 2CHTA 1VQLF 4I4TA 3I56F 3CC2F 3C9UA 3VCZA
chains in the Genus database with same CATH topology
1GO0A 3LWVC 2I6DA 4BW0B 1VQPF 1W41A 5HXUA 2KTVA 2LBWA 3VMFB 3PLAC 5HXZA 3NK7A 2OHWA 3AGKA 2OTJF 1YJ9F 3CC7F 2JNBA 2LBXA 5GIPC 3OBWA 3VI6A 3MCAB 1E7KA 1K73H 1K9MH 3G71F 3CCEF 1H7MA 5EWRA 4BVRA 3CCMF 1VQMF 3HAXD 5FLXM 3CG6A 5GINC 5GANK 1YHQF 2BO1A 5G4UC 1Q82H 3CD6F 1QVGF 1X52A 2QA4F 5HY1A 5HY0A 2F9ZC 3G6EF 5GAPK 4BY9D 3RA6A 1GZ0A 1N8RH 3LFOA 2QI2A 3N4YA 4NUTA 4EI7A 1NJIH 3NK6A 3CCVF 4EI8A 2FGYA 1VQ5F 1X7PA 3LWQC 3NVKE 5IT9M 3CCRF 1JJ2F 1KQSF 1RLGA 3PAFA 3CCQF 3WXMB 3V7EA 1NMUB 1YI2F 4NQ3A 1YJWF 1Q86H 4EI9A 4TZZA 1W2BF 1PXWA 3CC4F 3IR9A 2KTUA 4LCKA 3NVIB 3CCUF 2KG4A 3N4ZA 3CXCF 3FFMA 5EO3A 5G4VC 1W3EX 3CMAF 1X7OA 2HVYD 4BVSA 3CPQA 1DT9A 1Q81H 1W40A 1CN7A 3V3TA 1YITF 3CCSF 2VGNA 1YIJF 1CK2A 3CPWF 1YJNF 5HY2A 1ZWZA 4X3LA 3CCJF 1VQ7F 5A2QM 3V7QA 2VGMA 3CMEF 2QEXF 3JCMM 4X3MA 1KC8H 5HY4A 3D00A 3I55F 3JAMM 5DCVA 1S72F 2OZBA 2CZWA 1VQ6F 1VQ8F 1KD1H 3OW2F 1GO1A 3G4SF 3RA5A 3HJWC 4BVTA 3E1YA 3SIUA 1M1KH 2ALEA 1XBIA 3GYQA 5HWEA 1K8AH 3J80M 3CCLF 3SIVA 2AIFA 1QVFF 3J7AR 1IPAA 3OBYA 1VQ9F 4C4WC 3E20B 3LWOC 4XCQA 1VQNF 5GIOC 1Q7YH 3LWPC 3LWRC 2GLZA 5FJ4C 1VQ4F 1SDSA 4BVQA 1VQKF 1W42A 1VQLF 3ON1A 2FC3A 3O85A 1RA4A 3I56F 3CC2F 2WALA 1T0KB 2OTLF 1VQOF 3NMUC 1M90H 3J81M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO0 A;  3LWV C;  2I6D A;  4BW0 B;  1VQP F;  1W41 A;  2KTV A;  2LBW A;  3VMF B;  3PLA C;  3NK7 A;  2OHW A;  3AGK A;  2OTJ F;  1YJ9 F;  3CC7 F;  2JNB A;  2LBX A;  5GIP C;  3OBW A;  3VI6 A;  3MCA B;  1E7K A;  1K73 H;  1K9M H;  3G71 F;  3CCE F;  1H7M A;  5EWR A;  3CCM F;  1VQM F;  3HAX D;  5FLX M;  3CG6 A;  5GIN C;  5GAN K;  1YHQ F;  2BO1 A;  5G4U C;  1Q82 H;  3CD6 F;  1QVG F;  1X52 A;  2QA4 F;  3G6E F;  5GAP K;  4BY9 D;  3RA6 A;  1GZ0 A;  1N8R H;  3LFO A;  2QI2 A;  3N4Y A;  4NUT A;  1NJI H;  3NK6 A;  3CCV F;  1VQ5 F;  1X7P A;  3LWQ C;  3NVK E;  5IT9 M;  3CCR F;  1JJ2 F;  1KQS F;  1RLG A;  3PAF A;  3CCQ F;  3WXM B;  3V7E A;  1NMU B;  1YI2 F;  1YJW F;  1Q86 H;  4TZZ A;  1W2B F;  1PXW A;  3CC4 F;  3IR9 A;  2KTU A;  4LCK A;  3NVI B;  3CCU F;  2KG4 A;  3N4Z A;  3CXC F;  3FFM A;  5EO3 A;  5G4V C;  1W3E X;  3CMA F;  1X7O A;  2HVY D;  3CPQ A;  1DT9 A;  1Q81 H;  1W40 A;  1CN7 A;  1YIT F;  3CCS F;  2VGN A;  1YIJ F;  1CK2 A;  3CPW F;  1YJN F;  1ZWZ A;  4X3L A;  3CCJ F;  1VQ7 F;  5A2Q M;  3V7Q A;  2VGM A;  3CME F;  2QEX F;  3JCM M;  4X3M A;  1KC8 H;  3I55 F;  3JAM M;  5DCV A;  1S72 F;  2OZB A;  2CZW A;  1VQ6 F;  1VQ8 F;  1KD1 H;  3OW2 F;  1GO1 A;  3G4S F;  3RA5 A;  3HJW C;  3SIU A;  3E1Y A;  1M1K H;  2ALE A;  1XBI A;  3GYQ A;  1K8A H;  3J80 M;  3CCL F;  3SIV A;  2AIF A;  1QVF F;  3J7A R;  1IPA A;  3OBY A;  1VQ9 F;  4C4W C;  3E20 B;  3LWO C;  1VQN F;  5GIO C;  1Q7Y H;  3LWP C;  3LWR C;  5FJ4 C;  1VQ4 F;  1SDS A;  1VQK F;  1W42 A;  1VQL F;  3ON1 A;  2FC3 A;  3O85 A;  1RA4 A;  3I56 F;  3CC2 F;  2WAL A;  1T0K B;  2OTL F;  1VQO F;  3NMU C;  1M90 H;  3J81 M; 
#chains in the Genus database with same CATH topology
 3VO8 A;  1COM A;  3JAW A;  1W41 A;  2KGW A;  1W5A A;  5CA0 A;  2LBW A;  3VMF B;  4G4X A;  1VHA A;  4O2A A;  4ZHV A;  3AGK A;  1YJ9 F;  3CC7 F;  2P6Y A;  2RHH A;  3QTY A;  1K73 H;  1XV2 A;  3TD4 A;  3LYB A;  5EWR A;  4BVR A;  1VQM F;  3HAX D;  2ZOD A;  1FNJ A;  1YHQ F;  2BO1 A;  4YJ3 B;  4O4L A;  1TUB B;  5GAP K;  1QD9 A;  3RYH B;  4BY9 D;  3QUW A;  5LOV A;  2VAM A;  1N8R H;  3KJK A;  1ONI A;  2QI2 A;  3N4Y A;  3K0T A;  4C8E A;  4EI7 A;  3NK6 A;  3LDT A;  1OAP A;  3JAK B;  4B5C A;  1JFF A;  2FGY A;  1NQ3 A;  1RQ2 A;  1FNK A;  1YGY A;  1KQS F;  3RYF A;  1RLG A;  4ZI7 A;  5BMV B;  2EWC A;  3KIZ A;  2Q1Y A;  5EB1 B;  2DT4 A;  3S0H A;  1FSZ A;  3M1X A;  2IQQ A;  5MN6 A;  4C8G A;  1TVK A;  5JCO A;  2VXY A;  4I55 A;  2H6L A;  3LME A;  3VTI C;  5LP6 C;  3ZP7 A;  3CCU F;  1RLU A;  2CW4 A;  5EYP B;  3ZP4 A;  3CYQ A;  3HKD B;  2BTQ B;  3FFM A;  1W3E X;  1DT9 A;  3HKC B;  4M8I A;  1W40 A;  2BTU A;  2CVL A;  3MBM A;  4WBN B;  2NMU A;  4G4W A;  1YIT F;  3CPW F;  3P4E A;  5FNV B;  4X3L A;  5EAZ A;  2UYP A;  1W5B A;  1VQ7 F;  2R75 1;  2VGM A;  4TV9 A;  2Z1F A;  5CA1 B;  4PWT A;  4X20 B;  3MDO A;  3JAL A;  1T0A A;  4BT4 A;  3D00 A;  3P0Z A;  3I55 F;  3CB2 A;  3I3F A;  2AMT A;  4U3J A;  2RHL A;  5MN4 A;  1Q8R A;  3GTZ A;  1R1M A;  2ZAU A;  1VQ6 F;  4F6R B;  3OW2 F;  2CSL A;  2RHO A;  5LYJ B;  2MQE A;  1W58 1;  1U3P A;  1IV1 A;  4ZHQ A;  3E22 B;  3ELC A;  4LNU B;  1M1K H;  2ALE A;  1XBI A;  3I7T A;  3GYQ A;  5EZY B;  1DBF A;  4G4Y A;  4BT5 A;  3F0E A;  4O4H A;  3ESJ A;  3OBY A;  3LWO C;  4IHJ B;  5GIO C;  3JAL B;  3LWP C;  4IIJ B;  1VQ4 F;  1SDS A;  3JAS A;  1JD1 A;  4I50 B;  3R0P A;  3O85 A;  5B8F A;  1H47 A;  5JQG A;  3NMU C;  1M90 H;  3IEW A;  4O2B A;  2UYK A;  1W57 A;  2I6D A;  4BW0 B;  4TV8 B;  2KTV A;  2R6R 1;  3RYC B;  3NK7 A;  2OHW A;  1IV2 A;  2JNB A;  2HP0 A;  1IV3 A;  1H7M A;  5IJ9 A;  1J7H A;  5GIN C;  5G4U C;  3JAS B;  1Q82 H;  3FD6 A;  1QVG F;  5LA6 A;  2QA4 F;  1U3L A;  3G6E F;  3GHZ A;  3RE3 A;  1YQN A;  3RA6 A;  3C9R A;  4EB6 B;  2IAF A;  3LFO A;  2RB9 A;  5IJ0 A;  3WGM A;  4DRX A;  3CCV F;  4NWO B;  3L7Q A;  1VQ5 F;  2BTO A;  4YJ2 A;  3JAT A;  5EIB C;  5CB4 A;  3FBA A;  3U0O A;  2HS3 A;  5AVM A;  5C8Y A;  5LXT A;  4FFB A;  4X1I B;  3VIU A;  3KHN A;  3IR9 A;  3NVI B;  5KMG B;  3DC2 A;  1IV4 A;  3N2G A;  4I4T B;  3CMA F;  4BT7 A;  3VYS C;  2AIZ P;  2ZVY A;  3WGL A;  5J2U B;  5LP6 A;  1RQ7 A;  3JAW B;  4ZOL A;  5CA0 B;  4C82 A;  4O2A B;  5IYZ A;  5A2Q M;  4G88 A;  3V7Q A;  3FD5 A;  4HNA A;  3D01 A;  4X3M A;  4RQO A;  2DYY A;  5JVD A;  3HKB A;  3JAM M;  5DCV A;  1QU9 A;  3S03 A;  3JAR A;  4BT3 A;  1JN1 A;  4X1K A;  4O4L B;  2OZB A;  3N2K A;  2CZW A;  3K14 A;  5HP8 A;  4B46 A;  5LOV B;  3EOR A;  4BVT A;  2YXZ A;  2HS4 A;  4DXD A;  1JFF B;  3DDN A;  3J80 M;  3CCL F;  2AIF A;  3OON A;  1QVF F;  3RYF B;  3F0D A;  3WJP A;  4ZI7 B;  5J2T A;  4R40 B;  1VQ9 F;  3E20 B;  1TVK B;  5FJ4 C;  1VQK F;  3S0W A;  2V9Y A;  2UYN A;  4I55 B;  1FFX A;  3K2X A;  1VK3 A;  1JY8 A;  2YYE A;  2WAL A;  2OTL F;  4G4V A;  1SA0 A;  2VAP A;  1VQO F;  3ZO8 A;  2HP3 A;  5HXU A;  5ITZ A;  2IG8 A;  1H48 A;  1U40 A;  4O4J A;  3IKF A;  2N48 A;  3PLA C;  2LBX A;  5GIP C;  3OBW A;  2VAW A;  4TV9 B;  2ZOV A;  3M84 A;  3VI6 A;  3MCA B;  1E7K A;  3RYI A;  1GX1 A;  1XRG A;  1Z5V A;  3CCM F;  3TD3 A;  5GAN K;  2UYN B;  5GON A;  5KX5 A;  4U3J B;  3VYU C;  3VYT C;  3F0F A;  4TUY A;  4ZK7 A;  2F9Z C;  5HY0 A;  4BT2 A;  5J2U A;  2HRU A;  1GZ0 A;  3WGJ A;  5EB0 A;  3V4D A;  1UFY A;  1VH8 A;  4ZHQ B;  4EI8 A;  3HKE A;  3B6N A;  2Z1E A;  1X7P A;  2GZL A;  3LWQ C;  1KNK A;  2RHJ A;  4O4I A;  3S0Y A;  3CCR F;  1JJ2 F;  3PAF A;  4X1Y A;  3WXM B;  3V7E A;  4O4H B;  1YI2 F;  3MQW A;  3ZOP A;  4C8I A;  4EI9 A;  4TZZ A;  2Q1X A;  1PXW A;  2HX0 A;  3CC4 F;  2KTU A;  4LCK A;  2GVI A;  3N4Z A;  2PMP A;  5EO3 A;  1X7O A;  2HVY D;  2Z1T A;  5JQG B;  1W59 A;  3CCS F;  1XHO A;  4O2B B;  3IMP A;  3K12 A;  3CCJ F;  2G9I A;  2W8B C;  3WPX A;  2QEX F;  3FPI A;  3JCM M;  2HP0 B;  2Z1U A;  1KC8 H;  5HY4 A;  2L26 A;  5IJ9 B;  4ZHW A;  1W5F A;  2H8C A;  2CHS A;  2ZVZ A;  4YJ3 A;  5JH7 A;  1TUB A;  2LCA A;  2OTM A;  5LA6 B;  3F6M A;  1S72 F;  4G4Z A;  3RYH A;  3M4S A;  1GO1 A;  3G4S F;  3ERN A;  3T80 A;  3VOA A;  3E1Y A;  3JAK A;  5MN5 A;  3HJW C;  5IJ0 B;  3SIU A;  4DRX B;  3WPW A;  2ZF8 A;  3C9S A;  5HWE A;  3WJQ A;  1K8A H;  4YJ2 B;  3SIV A;  3JAT B;  5BMV A;  1IPA A;  5CB4 B;  4C4W C;  5C8Y B;  4XCQ A;  4ERH A;  1Q7Y H;  5LXT B;  3LWR C;  2GLZ A;  2UYJ A;  4FFB B;  5JH7 B;  5EYP A;  3ON1 A;  4U39 A;  2FC3 A;  3HKD A;  1RA4 A;  3KJJ A;  1T0K B;  3N2G B;  3HKC A;  4WBN A;  1CLI A;  3J81 M;  1GO0 A;  3LWV C;  3HTN A;  5LP6 B;  1VQP F;  1OFU A;  3WJR A;  5FNV A;  3IKE A;  4ZOL B;  5HXZ A;  3S02 A;  2LBT A;  5IYZ B;  5CA1 A;  2OTJ F;  1Z5W A;  3CYP B;  1PF5 A;  4X20 A;  1ODE A;  4HNA B;  2HS0 A;  4B45 A;  1K9M H;  2Z01 A;  3G71 F;  3CCE F;  3IEQ A;  2K1S A;  2UZH A;  1X25 A;  3P10 A;  3TD5 A;  3CG6 A;  5FLX M;  5JVD B;  3HKB B;  3CD6 F;  3JAR B;  4RHA A;  1KNJ A;  1X52 A;  5HY1 A;  4X1K B;  1SZQ A;  4F6R A;  3N2K B;  5LYJ A;  5EIB D;  2H8E A;  2I6R A;  2HQS C;  4NUT A;  3E22 A;  1NJI H;  4LNU A;  1U43 A;  3VOB A;  4KWE A;  5JCO C;  5EZY A;  3NVK E;  5IT9 M;  3CCQ F;  1NMU B;  5J2T B;  4NQ3 A;  4IHJ A;  1YJW F;  4IIJ A;  3BYQ A;  1W2B F;  1Q86 H;  3UT5 A;  2KG4 A;  1FFX B;  4I50 A;  3MCQ A;  3CXC F;  5G4V C;  1QAH A;  4BVS A;  3CPQ A;  1SA0 B;  1Q81 H;  1CN7 A;  3V3T A;  2HRY A;  1YIJ F;  2VGN A;  1CK2 A;  4TV8 A;  3WGN A;  1YJN F;  5HY2 A;  1ZWZ A;  5ITZ B;  1W55 A;  3RYC A;  4O4J B;  1W5E A;  3CME F;  1VQV A;  4ZHY B;  3RYI B;  3D54 A;  3S06 A;  3C9T A;  4BT6 A;  5GON B;  3C8L A;  3UT5 B;  5KX5 B;  3JVH A;  4TUY B;  1VQ8 F;  1KD1 H;  2PHN A;  3QHD A;  4EB6 A;  4C81 A;  3RA5 A;  3WGK A;  3KE1 A;  2CWJ A;  5HP7 A;  3HKE B;  2QTP A;  3HWU A;  4O4I B;  3J7A R;  4X1Y B;  4E6E A;  2B33 A;  1VQN F;  4X1I A;  4B62 A;  1UI9 A;  3Q8H A;  3F0G A;  4BVQ A;  1W42 A;  5KMG A;  2CHT A;  1VQL F;  4I4T A;  3I56 F;  3CC2 F;  3C9U A;  3VCZ A; 
#chains in the Genus database with same CATH homology
 1GO0 A;  3LWV C;  2I6D A;  4BW0 B;  1VQP F;  1W41 A;  5HXU A;  2KTV A;  2LBW A;  3VMF B;  3PLA C;  5HXZ A;  3NK7 A;  2OHW A;  3AGK A;  2OTJ F;  1YJ9 F;  3CC7 F;  2JNB A;  2LBX A;  5GIP C;  3OBW A;  3VI6 A;  3MCA B;  1E7K A;  1K73 H;  1K9M H;  3G71 F;  3CCE F;  1H7M A;  5EWR A;  4BVR A;  3CCM F;  1VQM F;  3HAX D;  5FLX M;  3CG6 A;  5GIN C;  5GAN K;  1YHQ F;  2BO1 A;  5G4U C;  1Q82 H;  3CD6 F;  1QVG F;  1X52 A;  2QA4 F;  5HY1 A;  5HY0 A;  2F9Z C;  3G6E F;  5GAP K;  4BY9 D;  3RA6 A;  1GZ0 A;  1N8R H;  3LFO A;  2QI2 A;  3N4Y A;  4NUT A;  4EI7 A;  1NJI H;  3NK6 A;  3CCV F;  4EI8 A;  2FGY A;  1VQ5 F;  1X7P A;  3LWQ C;  3NVK E;  5IT9 M;  3CCR F;  1JJ2 F;  1KQS F;  1RLG A;  3PAF A;  3CCQ F;  3WXM B;  3V7E A;  1NMU B;  1YI2 F;  4NQ3 A;  1YJW F;  1Q86 H;  4EI9 A;  4TZZ A;  1W2B F;  1PXW A;  3CC4 F;  3IR9 A;  2KTU A;  4LCK A;  3NVI B;  3CCU F;  2KG4 A;  3N4Z A;  3CXC F;  3FFM A;  5EO3 A;  5G4V C;  1W3E X;  3CMA F;  1X7O A;  2HVY D;  4BVS A;  3CPQ A;  1DT9 A;  1Q81 H;  1W40 A;  1CN7 A;  3V3T A;  1YIT F;  3CCS F;  2VGN A;  1YIJ F;  1CK2 A;  3CPW F;  1YJN F;  5HY2 A;  1ZWZ A;  4X3L A;  3CCJ F;  1VQ7 F;  5A2Q M;  3V7Q A;  2VGM A;  3CME F;  2QEX F;  3JCM M;  4X3M A;  1KC8 H;  5HY4 A;  3D00 A;  3I55 F;  3JAM M;  5DCV A;  1S72 F;  2OZB A;  2CZW A;  1VQ6 F;  1VQ8 F;  1KD1 H;  3OW2 F;  1GO1 A;  3G4S F;  3RA5 A;  3HJW C;  4BVT A;  3E1Y A;  3SIU A;  1M1K H;  2ALE A;  1XBI A;  3GYQ A;  5HWE A;  1K8A H;  3J80 M;  3CCL F;  3SIV A;  2AIF A;  1QVF F;  3J7A R;  1IPA A;  3OBY A;  1VQ9 F;  4C4W C;  3E20 B;  3LWO C;  4XCQ A;  1VQN F;  5GIO C;  1Q7Y H;  3LWP C;  3LWR C;  2GLZ A;  5FJ4 C;  1VQ4 F;  1SDS A;  4BVQ A;  1VQK F;  1W42 A;  1VQL F;  3ON1 A;  2FC3 A;  3O85 A;  1RA4 A;  3I56 F;  3CC2 F;  2WAL A;  1T0K B;  2OTL F;  1VQO F;  3NMU C;  1M90 H;  3J81 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...