3HKBB

Tubulin: rb3 stathmin-like domain complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 132
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkbB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkbB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkbB01
4O2AA 4TV8B 5LP6A 5C8YA 5J2TB 4X1KA 4FFBB 4LNUB 3E22A 3JAKB 5KMGB 4X1IA 5KX5A 1RQ2A 3N2GB 3R4VA 3ZBPA 4I55A 5EYPB 2XKBA 5CA1A 1W5EA 4YJ3A 4F6RA 3VPAA 4HNAB 4U3JA 3VO9A 5MN5A 3M89A 1Z5WA 4ZHQA 3HKEA 3UT5B 3M8KA 3JALB 1TUBB 4O4IB 3RYFB 4TV8A 5J2TA 1RLUA 3HKBB 3JATB 4LNUA 3JAKA 4O4LB 5KMGA 3V3TA 3N2GA 5MN6A 4IHJB 4I50B 2BTQB 4EI9A 4YJ2B 5EYPA 2RHLA 4EB6B 2VXYA 3HKDB 1SA0B 5CB4B 4HNAA 3RYCB 5LP6C 5IJ9B 3UT5A 3JALA 5EZYB 3ZIDA 1TUBA 5LOVA 4O4IA 3RYFA 4WBNB 3HKBA 5EIBC 3JATA 4O4LA 4TUYB 5LA6B 5ITZB 5LYJB 2Q1YA 4TV9B 4EI7A 4I50A 4IHJA 2BTQA 3C8LA 4YJ2A 5EIBD 1RQ7A 1W581 4O4HB 4EB6A 4M8IA 2VAMA 3HKDA 5LOVB 4X20B 5BMVB 1SA0A 3JAWB 5CB4A 3ZBQA 1Z5VA 3RYCA 3HKCB 5IJ9A 5LXTB 5J2UA 1W59A 3JARB 5EZYA 5MN4A 5JVDA 4X1YB 5GONB 5FNVA 4WBNA 4ZOLB 5JH7B 4TUYA 5LA6A 5ITZA 5JCOA 4O4JB 5LYJA 2BTOA 4TV9A 3RYHB 4ZI7B 2R6R1 5IYZB 4KWEA 5J2UB 2RHJA 2GVIA 2VAPA 4O4HA 5M7EA 5JVDB 4X20A 5BMVA 1OFUA 3JAWA 5FNVB 3VO8A 3HKCA 5LXTA 3JARA 2R751 1FSZA 4DXDA 4DRXB 3WGMA 4X1YA 5GONA 3N2KB 1TVKB 4XCQA 3JASB 2VAWA 4ZOLA 5JH7A 2Q1XA 3RYIB 4IIJB 4O4JA 3RYHA 4ZI7A 5IJ0B 4B45A 4U39A 5IYZA 4E6EA 4EI8A 5CA0A 1W5AA 4I4TA 3WGJA 1W5BA 3WGLA 4B46A 3VOAA 4O2BB 1JFFB 1FFXB 5JQGB 3WGKA 4DRXA 3N2KA 1TVKA 5JCOC 5KX5B 5CA0B 4O2AB 3JASA 4I4TB 2RHHA 3VOBA 5LP6B 3RYIA 5C8YB 4IIJA 1W5FA 4X1KB 5IJ0A 2RHOA 3E22B 4X1IB 4I55B 3RB8A 4FFBA 4O2BA 1JFFA 5CA1B 1FFXA 5JQGA 4YJ3B 2XKAA 4F6RB 3WGNA 4U3JB 4ZHQB 3HKEB 3CB2A
chains in the Genus database with same CATH superfamily
2BFNA 3T7RA 4DSAA 1M7GA 4IEFB 3H4VA 2CVLA 5FDFA 4D0NA 4DBLE 3O9VA 3ZW8A 3JYCA 4PGAA 5I9NA 3BX1A 3AFNA 1DG1G 4ER7A 2RCVA 3BMQB 2WD7B 2Q8NA 4JQOA 4FDAA 4GPIB 5B1EA 4LCEA 4AS1A 3GGPA 1SC5B 1ISRA 2AZXA 3TZ6A 1MMMA 4DFDA 3ISTA 4HB3A 4G41A 4EITA 2Q3DA 2HYIC 1LW6E 5BMVB 4V1CB 1BZYA 1Z17A 2WU8A 3N8NA 4LMRA 2VBGA 3RU7A 3EASA 3WWDA 2Q5IA 5K20A 3EIXA 1ZC4A 5PNTA 2ZQMA 2UYQA 2WFMA 3G2PA 1E6UA 4E7OA 1IN4A 3A2MA 2R6GA 4QJIA 4LPSA 3C4JA 1QPGA 3KELA 3UKMA 2DULA 1E5QA 3WNZA 4ENTA 3ZYCA 2MSNA 2P69A 3COPA 3HJTA 4FYHA 2EHJA 1L5ZA 3CG4A 2RBKA 2OMEA 1G98A 5K3SA 1PR0A 2HK8A 1L4YA 4G0MA 2XF8A 1GARA 3ELDA 4DY4A 4PHTA 3CUKA 4TT3G 3HKCB 5EUCA 4DMLA 4LA4A 2NADA 5DN6D 2NIPA 2HU7A 1KEPA 4LWZA 2XNJA 2PLAA 3IVGA 4F4DA 4C7BA 1E1QG 2Z2ZA 5IWAO 1DFGA 3B8EA 1R4AA 4IRMA 2JAWA 3L7LA 3W77A 4FW9A 5C4IA 2CTPA 4G07A 3MJRA 2TMGA 1KKLA 2OBBA 3AYZB 4LZJA 3LPAA 3NWEA 2YDYA 3RGGA 2WE7A 4AM8A 1ZLZA 3KEGA 1FDRA 3COSA 1M2GA 4TXJA 1GX1A 1HDXA 3KPYA 3ESAA 4QDJA 1L5MA 1V9CA 3IOMA 1E6LA 1M75A 3FWKA 3T4PA 3TB4A 5AKGA 3OD5A 1SZTA 4I1YA 3CMMA 2LDBA 1JLHA 3GRUA 5EZYB 2Y0EA 4X62B 3K5LA 4UBKA 1H66A 4QOEA 4OHYA 2O7QA 3TLBA 3VUEA 3D8CA 2FYTA 2X7HA 3QNUA 1Z4JA 3LA6A 5FX2A 3MWFA 3H7AA 2R6AA 1SB9A 3GGOA 4CF3A 2VO1A 4GZ5A 1YB2A 1Y4SA 3ONFA 5JYEA 5G4KA 1VHWA 3RVMA 4PSUA 4RXTA 3ND8A 4MV7A 2JD1A 2VHEA 2XA1A 3DG9A 4L0DA 4MUFA 4QOSA 2PZEA 3AHJA 3MWEA 1JA0A 1LTKA 3E22B 2V96A 2VJOA 3IA7A 1OAPA 4C5BA 4XZ3A 2FWAA 1CN7A 5EKUA 4CMEC 4XDYA 1OI3A 3TXXA 7REQA 2H07A 1YVRA 1OROA 3BB4A 4YALA 1Z6AA 1G16A 1ZMRA 3SSAA 4KPEC 3AB7A 4MI3A 5MN6A 3BXFA 3AM1A 3SJCC 3ZRWB 3PGXA 3D2AA 4XXHA 1X0VA 1NDUA 2F1HA 2H3HA 1WUJS 1XZCA 4M1KA 4B7ZA 3H1LH 2ZVYA 4O33A 4AS3A 2J6CA 5AIBA 4JDPA 5FAXA 1B6RA 3WLLA 2ZJOA 1R5JA 2GCIA 3VFDA 4TUYF 4EBFA 4XIYA 2HSJA 2QN6A 3KTOA 1VF7A 3RYHA 4B45A 3L71H 4I4TA 1Z8DA 2WFAA 4R6WA 2OVFA 4CW7A 4J3NA 3MQ4A 1VCNA 4ZK6A 2ZI9A 4B4DA 1Y8AA 3CSSA 4ZAZA 3CG0A 4COOA 3IA2A 4HB0A 2JK1A 1AKEA 1OKKA 5IY5C 4UBJA 3NONA 2X0EA 4RW0A 3IIEA 4ILEA 2AW3A 1SZDA 2O8FA 2E89A 2AF3C 1EN6A 1YQXA 1H2XA 2XZTA 2QWNB 4L4SA 2ECQA 3TD4A 1B16A 1CZLA 3NDJA 4JT9A 1RLMA 1Y9ZA 4GOOD 5LBIA 3VYTB 3D81A 4N0PA 1L6IA 2IE0A 1HPLA 4J16C 4DPLA 3W8DA 1GRNA 2V5AA 2RJZA 1R0LA 4HNVA 4ZFNA 2O1SA 2QLJA 4ESHA 1BQEA 1U3UA 2J0UA 4FMCB 1KZ1A 1UBHS 4G4ZA 1SF9A 3JQ8B 3GLIA 4LECA 4IS3A 2FVYA 3UHAA 2TS1A 1LQ2A 4OKIA 2GBLC 4CBCA 3SSOA 1NF2A 3TE6A 4K3UA 3I9FA 2IYTA 3CLKA 2IRWA 5GINC 3ILHA 2W2VA 2YWRA 1GYPA 5MN5A 1Y80A 5JCPA 3S1AB 3FJYA 1KKMA 2ZRAA 2WKSA 5GZ6A 1JDTA 3RA5A 2LUOA 4RA9B 2EGUA 1Z06A 5AM4A 3L77A 1RFYA 3AG2B 2HHAA 1MVOA 1ZCZA 3QNEA 4TV9B 2JB9A 1VBKA 3WIOA 1X7DA 1PZXA 2WZQA 4MB6A 4Q6WA 1NZJA 5CT8A 3P9RA 2BEWA 5C93A 3U16A 4D0LB 2ZJAA 3C7DB 2Z9DA 3HLTA 1XZNA 5G53C 3OZFA 3PFGA 3VZQA 5HKBA 4Q4JA 5IVHA 4DR3B 2HSGA 4ZU3A 5EI5A 4BFXA 4HDSA 1OPRA 2MTBA 3NV9A 1ZUNA 3PPVA 1VF5B 2GSWA 3H2IA 3VTAA 5BSEA 5L95A 3ZWOA 4L9RA 3SC6A 3SNKA 4TZZA 1GO0A 2XTJA 4OHOA 5HF5A 4FC7A 3D4IA 3RUFA 1HFWA 1Z62A 5DM70 2BZ1A 1AR5A 4O4LB 3DT8A 3FPBA 1VZ2A 2P8JA 2OCPA 3KL4A 3DMGA 1HLDA 3T9FA 3OUZA 2ZI6A 2OLJA 5GONF 3D3NA 2BKLA 1XD2B 4GYCB 5DBOA 3FGZA 4RQTA 4RZUA 1H6CA 5IBQA 2WLNA 4AF8A 1ODSA 4IGIA 3V4SA 4RV4A 3WQSB 3L7QA 1Q20A 4MW9A 1G6OA 2C4WA 2L17A 4RJKA 3CLSC 2JGDB 2WKWA 2Y76A 5JCOC 8OHMA 4FLWA 1E7RA 4WMLA 2WF5A 3ZHZA 2E74B 1SBCA 3O1LA 3ZLVA 3AHEA 2HMWA 2CBXA 3HGMA 1U3GA 4MIEA 4FM2A 2OCIA 3WKCA 1TUIA 3D2BA 4CODB 3H9QA 3WGOA 1G2PA 5FPPA 3S99A 1PDOA 5IAAA 2VCYA 3SPIA 3ZCUA 2DECA 1M67A 3U0OA 4FNGA 3LX8A 3EPJA 4BNNA 4X41A 5DHUA 1E3WA 2WT9A 2Q3JA 4A2CA 4CYMA 3T15A 1QPBA 4JX9A 3J7TA 3OT1B 3ABZA 1ZJ4A 3FSRA 4G1CA 2BTOA 5GGYA 3NATA 2X0IA 1LC3A 2GAFA 2NPIA 2XTAA 5K1XA 4EF6A 2OLEA 4YBZA 1WBBA 4Y2VA 3CZ4A 3H8WA 1JQAA 4PZPA 2V7QD 2NYVA 3BS4A 4QEZA 3KAQA 3A1TA 1XKXA 3HB3B 1WCWA 2PUVA 3GARA 1GQ2A 3A0RB 1FXWA 3TI9A 4M1EA 2DFKB 2XYHA 1ZM9A 3WMWA 4NU5A 3H83A 1NUUA 4JB2A 2PMEA 1M3SA 5CU7A 1USWA 1YE3A 3O6VA 4BMZA 2NP6A 2VHWA 3QUWA 4QTUB 2YS7A 5FIUA 2OYRA 2HGZA 2EBFX 2OYCA 4M6WB 1G19A 3C6QA 3MUEA 4QBKA 3T3HA 2HBQA 2V7TA 2I2AA 2XCRB 3RRZA 1GO3F 5ALRA 1G9XA 3OQIB 4BWYA 3JALA 4DV7O 3FROA 1NOKA 4AZTA 1TM1E 2ZAMA 1O94D 1JS1X 2ZR2A 3T3EA 4JP1A 2EILB 1JDBB 4KN9S 4L8LA 2ID4A 3EMKA 4C4YA 3GMSA 3SHVA 3NPAA 2P7HA 5J2UB 4FJCC 4LJ8A 3N2IA 3GAFA 1A8UA 2Q3EA 1Q22A 4DV0O 3SZGA 4QUDA 3VNBA 1YCGA 4FE7A 1AHNA 1JVBA 1UKEA 2IP1A 3PF9A 1JU3A 1RPJA 4DRXA 2OC4A 3LLVA 4JI8O 4RWZA 1QVVA 3FX7A 1MC4A 3ZLBA 4J0FA 5DSZA 3PX2A 1W48A 3P30A 3BWMA 3UIEA 3ROEA 1T5LA 3DBRA 3QLEA 2CWDA 3W7VA 4BYMA 4PPQA 1CUGA 4TTPA 2QDXA 5T4EA 1KVQA 2LV8A 2Y0BA 3ZV6A 3N1UA 3SX4A 3PKZA 1DOAA 1S9HA 3OF5A 1N6IA 2VDWA 4C0JA 1N0VC 1YAHA 1ZVVA 1MB3A 1NU6A 2ZWIA 3SEZA 1CQJA 2J09A 3TM4A 4LFAB 4Q6GA 2AX3A 2H7YA 5F9MA 2IUUA 4WN9B 4QWWA 3I4FA 2EG9A 3GYGA 5ADVA 4YONB 5HP7A 4Q4HA 1QC5A 3B3JA 1UIMA 1JXQA 2JFFA 3WB9A 1O08A 2I3AA 3WYNA 1O58A 4JP8A 3AG1B 2D7CA 1JEJA 4R5MA 2IYOA 5CEFA 1P7GA 2ZRMA 4FB4A 5A06A 4UBOA 1G21B 3TMAA 1JFFA 5E6SA 1NMZA 4PIPA 4KWIA 5LP6A 3PHHA 1FFWA 4PHCA 4L4ZA 3HPRA 1HGXA 2EBOA 3T7EA 2WSIA 5AD1A 3H5TA 2HM7A 4TWBA 4D25A 4MR7A 2YVUA 3R5JA 3NHUA 2CBZA 2E6UX 5IJZA 3V7FA 2FN4A 1MABG 4DXHA 1TJ3A 1WA8A 2QNIA 2D0DA 3K57A 4OXYA 3GEPA 1CUWA 4UNQA 2HMAA 3B3GA 2C5EA 1W4CA 5ERYA 2OCLA 3UFXA 5FNVB 4HDRB 3IPLA 5HIJA 5KREA 4XJSA 4TTSA 4JI1O 1MIHA 5TQ2A 2DWEC 3PHJA 3OCVA 1GTG1 2WMDA 3WAKA 3QWAA 1KH1A 4LF9O 3PUYA 1EEHA 4ZO9A 1ZPDA 3TLXA 4YJFA 1THZA 3REQB 1TM5E 1S3GA 3RUEA 5E4JA 4YRKA 1C4XA 3P9YA 2DF8A 5FBKA 1A3CA 2LIVA 5KMGB 3H5IA 4CQJA 3D7KA 1MG0A 3DPIA 3V7QA 5DOZA 1ECPA 2C2ZA 1Q44A 3AUSA 5EC1C 4H0FA 4Z9BA 1U6KA 2DBVO 2R6JA 3U40A 2CXNA 3X1ZA 2ZT5A 1MAVA 1XNQB 5FFMA 1QORA 3B1KA 3MN1A 4LRXA 1QP8A 2X1LA 5IBCA 3FFAA 2QEXF 4HQKA 2JAOA 3P0HA 1QIMA 2JGKA 1SQ0A 2J5BA 2WILA 3B6MA 5B3SC 3A1UA 1D0IA 2G08A 1G8PA 3NOOA 1ST3A 4WEOA 2CLCX 1B42A 2LTAA 3MG9A 4NPHA 1FDVA 4I08A 4PC7A 5HQJA 3P27A 1FDOA 3TZQA 4NC9A 3NBZC 1E2IA 4LDQA 2H3OA 1PO7A 2E6KA 1NN0A 2HS3A 4NOJA 1W2GA 1E2DA 1F1JA 1NXPA 2E5FA 4B3SB 3HYNA 3W7AA 3ZXIA 4UVHA 2HXGA 4URXR 3JVHA 3IOYA 1SCUA 1QBGA 1YK1A 1EA7A 1MGPA 2FUCA 4YAOA 4CQMB 1T5OA 3M6LA 2ZXEA 5EWRA 5H80A 4QBHA 3HPQA 4E03A 2X0DA 5CB8A 4LS3A 2PD6A 2JAPA 1V48A 1TB4A 1XTJA 4MUHA 2E37A 2VIIA 4JITA 1RJGA 1SQ5A 2ZE7A 4BAUA 1BVUA 5AVSA 1PJBA 3CEIA 4ZOEA 3MK31 1Q83A 3SBEA 3L8CA 5K1ZA 5BWOA 2G1UA 1WCYA 5A4DA 4NCAA 2GBCA 2XB4A 1HFEL 4FYPA 2NUBA 3ZJUA 4FQ8A 2Y1CA 3FR7A 2XE7A 2W6PA 2P90A 1WCV1 1V5GA 3OEHG 5TF4A 2W2KB 2GF9A 1ZM3A 3AHGA 2V1DA 3ABSB 1T1SA 2O23A 2UYNB 3R2JA 2Q5JA 3O4RA 5D7BA 2HA6A 2JNWA 2ZBRA 3GX1A 3W8FA 1N1EA 4MV5A 5E95A 4HDNA 3NEYA 4LX8A 4W63A 3A6EA 3I9JA 3S3WA 4A6XA 3F7YC 3O8BA 1U2DC 1O0SA 5JSHA 1UINA 4DT1A 1LV8A 3BE4A 2FPIA 2O3SA 2G1PA 3CUUA 2IKQA 2REBA 2EIJC 2DZDA 4BNYA 4CKXA 2FY8A 1MX9A 2W6IA 4BZXA 2Q0HA 4EHLA 4KSYA 1BKSB 4FYJA 1XFDA 5CT4A 1G5QA 1NJIW 1TGYA 2BKVA 3DS8A 4ER3A 1GPNA 1N9ZA 2XB2A 4KP4A 5IWCA 2PBLA 1JU4A 1XILA 1E4VA 4XTRA 3ZZ0A 4DLWA 1RHRA 4NMMA 5A6SA 3F4KA 4RMNA 2EWVA 4B87A 4ZCRA 2JI9A 1PDVA 4MWOA 3WK7A 3WP1B 4TQFA 3HEAA 4RD4A 3TIIA 4YJ3B 1JHOA 1NTOA 2PUJA 4I8XA 5G0SA 4AY4A 5A0VA 3BDAA 2VYQA 4CCSA 2V4UA 1WWKA 1Z0FA 4FXOA 2P06A 3VQWA 4XYBA 4RZ3A 1WDKA 1IXBA 3EW7A 3DWGA 1NVEA 4LCUC 1YQEA 4AJEA 2JKYA 1HMPA 3AJ9A 4E3WA 3G2MA 3EZLA 2PBFA 2GYYA 2HFEC 2FMFA 1RXYA 5JH7F 1SKYE 2ETXA 3NHKA 2J5QA 4O4JB 1F51E 5BW4A 4DW0A 1EXNA 3FTPA 2R0QC 3JARA 4OB6A 4WFQA 1XMSA 1N8TA 1YQDA 1SBNE 3M6FA 1U97A 2XHEA 4Q3CA 4E6EA 1IJKA 4OHKA 3H5RA 5JY1A 1Y8ZA 4YR7A 5TMDA 2PAAA 4ZAVA 5F9FA 2FP4B 3DDHA 4C3VA 3OOSA 1GZ3A 2Z4RA 4MQUA 4HBGA 3L0OA 3M33A 4QDUA 1NQOA 4EX7A 1N8RH 4ER5A 4A5UB 4QBGB 3T3DA 1C0KA 1KOJA 5K0TA 2WT4A 2V97A 2ZJ5A 1MX1A 5J2TF 4OOEA 4JLMA 4MEAA 3LW7A 3U39A 3HVUA 4JKYA 4KWTA 4OXSA 5FPTA 5IVIA 4ZEOA 4IIFA 2X5OA 1RWQA 1KYIA 3O8DA 3WRYA 4FE3A 3I12A 1JQJC 3IP9A 1IH8A 4G23A 3L4BC 1YNSA 4PAWA 1I5EA 1O2DA 3WA7A 3WHKA 4AB1A 1NQXA 3EAQA 1Z47A 3AG5A 2Y67A 3FFXA 3D0OA 3IESA 4EHHA 3N86A 4QJBA 1ZDMA 2EKZA 1WHTA 2KM1A 3C8MA 3FAVA 2QSZA 4EL0A 1IUPA 5B5EZ 4QECA 1QG4A 5EZQA 2D7DA 3V1LA 2ZKOA 4OX9O 3LWBA 2QA4F 5BXYA 1SH7A 3VVCA 2IHUA 1DWQA 2W2QA 2KLHA 3EVEA 4KNWA 1RWWA 2EX3A 4LTDA 1Z2EA 16PKA 2FJ0A 3WJPA 3B40A 1MZPA 1BX3A 4XUCA 3ENNA 3A1SA 3EGWA 1ZWLA 3ELCA 1I3NA 1T1GA 5AVQA 1D5NA 5AI9A 3U7QB 2W83A 4RMGA 4IHJA 4ZCTA 1SM4A 3OY7A 4M1QA 1ZIPA 4D79A 4K0KO 3IIMA 4LJ6A 5FTMA 1DRWA 3K59A 2ACEA 1H47A 1U28A 1XL4A 3ANSA 2PBRA 1M0EA 1TADA 3X0DA 1U3TA 3PGKA 2XR1A 2WMNB 1K5GA 3H5WA 3PQ5A 3WJAA 1NXSA 5D8DA 4XDJA 1C3XA 1NWHA 5GPBA 1BQZA 4L5IA 4W6QA 4AKSA 3N8IA 3OIWA 2R65A 1X1RA 3CZ5A 1LPOA 2C92A 3K8QA 4IIGA 4X3LA 3UHJA 3OLQA 4BQPA 3DFMA 1H5QA 4AJIA 1MD9A 3D59A 2VP9A 3TD9A 2KS6A 1KSGA 2VHCA 5F2NA 3PFBA 1YJAA 1V5WA 1MOFA 2UZ1A 5FTKA 3WKBA 3DKKA 2LCFA 1KXJA 4S1VA 4AUNA 3PQEA 4OY3A 4UUNA 5DN6A 1NUAA 3U49A 2CJWB 3EG5A 2G0NA 1Q82W 1M1KH 2GS9A 4BTLA 3FNGA 4EY5A 1ZW1A 1VKJA 3F3MA 2IHKA 3AXSA 5H3HA 4G63A 4JQZA 2VCHA 3DBOB 1UT5A 4Q1BA 4E2LA 3KVRA 2WUWE 2FUNB 1SCNE 2LP4Y 4WAUA 3KYCB 4YTEA 2UXBO 5KTPA 3KAKA 3VNAA 1FUUA 3IMEA 3QG1A 3U4QB 2Q2VA 4R81A 2POQX 3KJJA 1E7YA 4MW1A 4R7ZA 1YKGA 4KAAA 2VRNA 3DTVB 3LQYA 3JCZA 1GM8A 2DPLA 5HXZA 3QLVA 3R24A 4WTOA 3CSUA 3TNDA 3H9GA 4CM4A 2A1TS 4JYYA 4P84A 3ZJZA 2A7WA 4YRPA 2UUAB 2B2XA 3QA3E 3IEPA 3HKBB 1VFPA 5HCNA 5DM60 1KP9A 3SX0A 2XUOA 4UCTA 4BQEA 3U1VA 2WV7A 1R3JC 1PL7A 4BQFA 4FNMA 4RTMA 3Q3EA 1EVLA 3H97A 4I50A 3ITDA 4QQRA 4GVPA 3WDLA 3S2SA 4CLXA 1YIOA 3SF8A 3S0YA 4DL9A 3OCUA 2V58A 3V48A 2R1ZA 1E2FA 1XTRA 4ZYXA 3I4LA 3ND5A 1Y8RB 2BN4A 1XT6A 4KUMA 4C7VA 4TWIA 4ARCA 5LMUB 1E6WA 8ADHA 1JILA 5AK5A 3FNBA 2Y2VA 1TTHA 3ECSA 5E3JA 1HA3A 3F9RA 3GN1A 3QLJA 1UBRS 3TLAA 1E9FA 3OPYB 4DRZA 3HZRA 4JWTA 3ZCRA 1FRQA 5CBKA 2VATA 3PFHA 2ETVA 3GVXA 4DLXA 2VQ3A 1GQRA 3IMFA 5KSOA 4PN7A 3SR3A 4CKCB 2WLIA 1T9ZA 1X1SA 3OFND 2H1FA 3W2IA 2I76A 2PKXA 4NK5A 1C3JA 3CT6A 1Z4OA 1AKUA 2CGNA 5ALIA 2Y27A 4JASA 3BGWA 1LNSA 3IEIA 3UJ7A 1TD1A 1IZ9A 4Y6OA 2MOKA 4DYDA 4TZTA 4AZSA 4GLJA 5L6LB 4B6JA 3WWZA 1B26A 2PFSA 3RVQA 2N1BA 5EPOA 1NXOA 4LAFA 2JDID 4W7HA 1A7UA 1J6UA 1X9GA 2VDVE 3U19A 1PKEA 4GICA 1P33A 4HDCA 3UYKA 4J7JA 4P7BA 4PI2A 1P7VA 2QM3A 4HTFA 4Y2JA 2GXSA 4O2BA 3CCUF 4PZDA 1YS1X 2IEDA 5HIKA 5SZKB 3UYLA 3F6BX 2F55A 4TTTS 3L18A 4NY1A 1E69A 2R1TA 3DOOA 3WLTA 3K72B 2OZLA 1MAWA 2ORED 5JJ5A 4C07A 4I8DA 1L4UA 3F73A 2RHWA 5KAPA 1QK5A 4LSWA 1CFJA 2MHCA 1PZGA 1OXVA 1P5ZB 1USGA 1O6GA 1N4AA 2WFLB 2IDMA 3L1KA 1C9NA 3F8SA 3HEBA 4WQMA 2ETNA 1U43A 3AUUA 2QIPA 5AUQA 2C00A 3H1FA 1XTUA 1F2TB 1ZXXA 5DSTA 5DW3A 5LA6F 3PPYA 2AXTZ 2HJDA 2Y2UA 3WHLA 4WRRA 2JCXA 3W9BA 3EBOA 3S8EA 1GPKA 4CCYB 5I7AA 4UFNA 1KEEA 4O2AF 2HFKA 4HRAA 3AUTA 4DIDA 1ULUA 5CBFA 4Z1MD 3ASOB 3QU5A 1OCRC 5DECA 4PAGA 1ZU5A 4XSHA 1AU9A 1EX6A 4NUTA 4L0CA 1OZFA 3CTMA 2KB1A 5CVDA 3T1NA 4AWXA 2W4QA 3KLNA 4BCBA 4X90A 3FPAA 1KDVA 1ZYUA 3K2QA 3BPSA 5I5EA 1N0HA 3RFFA 2ZYTX 2FR0A 4RFVA 3VSDA 1O5IA 4C0BA 1P39A 2EIMC 3I6YA 1Z8HA 1RXVA 3EUAA 2NTNA 2OV4A 4ERXA 5CA3A 4GDMA 3U2QA 1I0LA 4PSAA 2K1SA 3H1GA 2A0FA 2QZ4A 1XU7A 2VP0A 3B1VA 1QHYA 3K9AA 2D62A 1OQAA 5B5SA 1PJTA 1FRFS 4G01B 4GX0A 3VO2A 3E05A 4LXYA 1VIDA 4CLHA 3X1YA 2Q7XA 1NLYA 4DZTA 1AKMA 4Z4CA 4OP2A 5A3VA 5GJCA 2E4XA 1HZJA 1I2BA 2QN9A 2P9JA 4ZTUB 4EG6A 3A27A 2VT2A 2IHNA 4PAMA 2BFCB 4C89A 3IE2A 3OM9A 1TJ5A 4DJ5X 4BFYA 2MSDB 5BQXA 3QVLA 2RHLA 1P2UA 2ISCA 1ANKA 1V1JA 1KERA 4RTQA 2I78A 2P4EA 2C3PA 1G21E 3EG9B 3TQSA 3PVCA 1JZQA 1R5BA 2X14A 4FGSA 4G24A 1YZNA 2LZ0A 3TSYA 4XVQA 1MB2A 1QRUA 2PT9A 4M54A 4G4JA 1FTWA 3P9QA 4GZ3A 5LBTA 2O3QA 1X7PA 1UFOA 3JTEA 1PGNA 1TQHA 2OGTA 1JHRA 5JROA 4RSHA 4TQDA 1H1TA 3HDQA 1RKXA 3L01A 1NKSA 2YYZA 2FUEA 1FNNA 4ZYYA 3KZCA 3T54A 3QTCA 4CIWA 4IUCS 4BMOB 3A04A 3CCEF 3TKYA 1G7TA 3V46A 4FM9A 2QUAA 3A1VA 1GKKA 1AA6A 1OAAA 3QLUA 1N78A 1LWOA 3SC3A 1PJSA 1YDGA 2IEBA 2LW7A 3WNBA 3KHKA 5DHFA 4KJZA 5G1PA 2A67A 2VDQB 3EVKA 1YC5A 2BR4A 4A5OA 2CAZC 1MOPA 3GD7A 3SYAA 2E3CA 4HZGA 5TVGA 2VSQA 1XCLA 1G0NA 2J6HA 4HB4A 1I8TA 1FDIA 1ZK3A 5WRFA 3VJLA 2V7QA 3K1YA 4YRFA 4J9ZB 1P3Y1 3HLKA 3WYBA 5K3DA 2ODBA 1GU7A 4COKA 3DKVA 2ZG6A 4MQEA 2Q3LA 3I7TA 1H94A 4XUGB 4IICA 4WN3A 1NWCA 3K70C 4Y6PA 3CONA 2OM6A 2BKEA 2B8JA 4WY8A 3IELA 4LK2A 4ZQCB 3FOBA 1T9CA 4JJ4A 3KB2A 5LNK1 2FDCA 4ZJZA 1IEXA 1CXZA 4L50A 1O94A 2LQTA 1BHO1 1E2BA 4AZ3B 2XMRA 4YRSA 4DV6B 1KMMA 1Q7RA 3FJ1A 3G82C 5KO2A 2R1UA 3B3FA 2JAQA 3BGDA 3F6MA 4RFSB 4AQ7A 4EPXA 2QGNA 2DPYA 4EABA 3BL6A 2DTDA 4L07A 1FAFA 3LHIA 5AVYA 2AT1A 5AJXA 1WHSB 2I33A 4CRWB 3LUJA 3KQYA 1K98A 3BCUA 2Z04A 3E5NA 4I7EA 1A0OA 4CLOA 2OCAA 3LLMA 4WLNA 2H1OA 5UKDA 4HUTA 4KUHA 2RAFA 2ALEA 3AKEA 3LOPA 1NVXQ 4JUBA 1KRHA 1R7RA 4IF4A 3ZY3A 4B2YA 2QY9A 2BJWA 1G7RA 2EJ7A 2V3CC 2AJCA 1XEXA 2IC5A 2HU2A 1N4CA 3NAQA 1C41A 2WUEA 1I3MA 2REQA 5EXTA 3LWQC 2CMHA 3F49S 3GJSA 2K7FA 2BZGA 1Y4ZA 2DHDA 3L6CA 1XMJA 3NH6A 3UWDA 1EH5A 3G0DA 5K8VA 1CVRA 5B1OA 2JZOA 1ODLA 2FN9A 4FPPA 5A5FA 3G6EF 2PUGA 2NNLD 2B34A 2ZTLA 4ZWNA 5AXAA 4RPGA 3WV4A 1M2WA 1YQ9A 5K7SA 3O31A 3FYHA 3EXIB 2R7NA 4EQZA 1LCIA 1IOWA 2IAFA 2PX3A 3DEJA 3GJ3A 3MAAC 3I55V 4DQDA 5LQJA 1KJ8A 1Z5ZA 1VBNA 4GL4A 1AURA 2DWUA 2CLOB 2IYFA 3TBFA 4OLAA 3KDPA 1OFTA 1LDEA 3ZKWB 2ZM6B 3X1KA 1KMCA 4HQNA 3UK1A 4YMTA 1C7QA 2ZR3A 1HEIA 3UKJA 1CUHA 3RAGA 1EWRA 4N8EA 1EX7A 4LF8B 2DPMA 4HH4A 4GKJO 1D2MA 1H2AS 1N92A 3NTQA 3WLPA 1YJNF 4ENVA 1F0KA 4M55A 2G04A 5A5DA 1IC6A 4JAAA 5K3FA 1IPHA 4LY9A 5DNYB 5BYBA 1KC1A 1SU6A 3Q85A 2DP4E 1VQ8V 5D5HA 1PT6A 1DXOA 1BOFA 5EYPB 2POCA 4D3SA 3AHCA 4MICA 4LOHA 4R0MA 4NTXA 2XLCA 3AIMA 1QU7A 4M1WA 1NTMH 1RJDA 4KBYA 3CLRC 1EPUA 1O97C 1YV9A 3DONA 2D1FA 4UU0A 3DDOA 3S8MA 6GPBA 3DXXA 3UM9A 3KEQA 5TS3A 4ER0A 1NH2B 1AJQA 2BOCC 4U2CA 3FPIA 3W7BA 1WLSA 4FBMA 5IYZF 3WK9A 1NXXA 3LECA 4PM4A 2VAPA 2P2LA 1CZHA 2QTRA 1Z4NA 2ZSKA 2NZUG 2E7ZA 1OJHA 2W7TA 2HA5A 1YASA 2NYAA 4MI1A 5A4MS 2ZJZA 3S4YA 4IMPA 4E32A 4YMSA 2C8VA 3ABLB 2Y48A 2XRZA 2ISSD 4JYMA 1AKNA 3PGA1 3OPMA 4IX1A 1UP4A 3B1JA 4DA9A 2JNBA 3PEEA 2A58A 1YUMA 2OTLV 4EYGA 4ZVNA 4IRXA 4HSGA 1LV7A 3OIFA 2H00A 1XIVA 2P0AA 5F2OA 3B6EA 4K6OA 2JFWA 3NHSA 1J97A 2NYUA 3ZE0B 1CEQA 3OE5A 1TO1E 1X2EA 3GR6A 1GZ5A 4EG8A 2CJXA 4DAOA 3V3TA 4FLFA 1BXKA 4LZAA 4CHGA 2J33A 3ZXYA 4UVGA 9ATCA 2HBYA 1JIKA 4Z99A 2HEGA 4YRCA 5LXTF 3UUFA 2B8TA 3C6ZA 1S0UA 4BP8A 2A9HA 2O9JA 1XHZA 5HTKA 5ESXA 1COMA 2OP1A 4F12A 3AESB 4Q18A 3WLRA 5H4GA 4PO3X 4YUYA 4X95A 3DH0A 2XB9A 2B7LA 4C7XA 1Q1BA 1Y9JA 3BKWA 1ZD2P 1I10A 3C6YA 3DDWA 1K9MW 3CH5A 3TCUA 5C8YB 3LC1O 4K05A 1HG1A 4R1SA 1PFYA 5G1NA 5AMXA 3NTOA 4Q7QA 1T29A 4DNOA 5BVHA 1XAJA 2BD0A 2NU9A 5J1SB 3KJZA 1LSJA 5JUWA 2GJKA 3IB3A 1H2BA 4FHEA 3KZVA 5KTMA 4B75A 1N6KA 4QUJA 3VYWA 5LQCA 2ATXA 3BFKA 2R8PA 2NU8A 1H1LB 1OLUB 4NDNE 5T57A 4U9HS 2MINB 4LRSB 3KTAA 1JG6A 1LR1A 3DVAB 4UASA 5EIAA 2M32A 2YVQA 1M1ZA 4DKXA 4LF4B 1ZLYA 1X1TA 3FKQA 1O9HA 5KNDD 3A1FA 3ZU3A 3D6TB 4OKSA 2ZS8A 1IPFA 4FGZA 3CUEF 2D2XA 2GPWA 3W04A 1I2MA 2CNWD 3HDYA 4MTXA 3G9TA 4IDQA 2G7ZA 2R25B 3UAWA 3ENZA 4HT3B 5H1YA 1A95A 4EX6A 1D09A 4XGQA 4G5YA 1SPBS 1GDHA 1GTJ1 3JCUZ 2PGDA 1T3SA 3I5AA 1PNTA 5JAIA 3ABTA 5D3MB 4HY3A 3REFA 4KRFA 1V11A 3NAZA 4MJLA 2R2AA 3AEUB 3U3ZA 2BE7A 3IR9A 4N23A 3TAHA 4HLNA 2G5TA 3C7KA 2OL4A 1IMJA 1NSYA 5DTRA 1F7VA 4UV8A 3GWZA 1E2PA 5HZHA 1SNYA 1KR5A 3R4CA 1RM1B 3OTOO 3AFMA 2KI5A 3ZV4A 5A7FA 3EH1A 5IKMA 5LQRA 3LUCA 4DLPA 1Q92A 3IE0A 1XNHA 5HFAA 4BNDB 4NBRA 3A70A 4R7TA 3QGMA 4XWGA 1V3VA 4QPZA 5SZIA 1YMQA 3WL5A 5A9SB 1ZVKA 3U48A 1YR7A 5ELXA 5BXZA 4JP2A 1KE1A 3M82A 3R7DA 3TPFA 2IYVA 2V7BA 1O96A 1JEYB 1ZVJA 1PYGA 5EXXA 2PRIA 5FORA 1W4RA 1BA3A 3HBNA 4R69A 3TR0A 5TT0A 4DWVA 2UXNA 4Q3AA 1P61B 3ZJYA 3V4OA 1X0XA 3ZG6A 2Q9LA 3ANTA 2QLLA 1ZVQA 5HWEA 2YVLA 4IO1A 4AMBA 1KH2A 3VKFA 4RUFA 1YO6A 3IC5A 3EGCA 4ZT7A 5E7MA 4CT4B 4RDXA 4XJVA 2DOSA 1XCOA 2NMVA 1ZNYA 5EG5A 3LUAA 2WLLB 4GUDA 1BAPA 2VRWA 1N3YA 2P3SA 4WINA 1I2DA 1Z4IA 5AI4A 4M9CA 4PA9A 4MKHA 4U7FA 2ORVA 1L7NA 4F91B 3TIFA 2AX4A 3CZ9A 3LTEA 1T5HX 3IAS1 4RLSA 1IOZA 1E1KA 2CTRA 4EZIA 3M7MX 5MHTA 4U6QA 2H4FA 4IIYA 4M98A 5JS6A 3D1JA 1E61A 1U2TA 3LFTA 3GDFA 4QEKA 5I7EA 8AT1A 3LCCA 1NTKH 5AFSA 3FD8A 4I4NA 3QW2A 2OV1A 4FK8A 4PGMA 3TOZA 4NB5A 1HKUA 1AS2A 1ORDA 4LIPD 3DNMA 3ZMVA 4HEJA 2FQWA 1X7XA 4MS1A 3ZS8A 4K81B 2OC9A 4C4SA 2B5WA 4PG5A 3KNZA 1AB5A 4RD6A 2YI8A 2XAAA 4DJEC 3NHAA 4RHAA 2OXCA 2CMKA 1N6HA 2ZVQX 1A97A 1UBFA 1E9AA 3UHPA 1YFZA 4K3AA 5FWXA 3Q8KA 3RWMB 4EGAA 1ZHHA 2CFOA 3A2FA 4NCHA 4GQBA 1XXLA 2NUTB 3JVUA 2ACWA 2O1EA 2VUUA 3E9RA 4FN4A 1WQ4A 3LUPA 3D6VA 4PVDA 3N0RA 1P2FA 1ZK2A 3L1JA 2YRXA 1RMYA 1P3DA 4PU0A 1EHCA 4ALMA 4NZZA 3AYXB 3E4CA 1J0XO 3DHYA 3RREA 1YK0A 4WXPA 1QZTA 4KIJA 1XVUA 5A2GA 3KU4A 3H6KA 1H4VB 1J8VA 2CV2A 4G0QA 2ZB2A 1GTL1 2XOKD 2XMZA 3GP3A 4NH0A 3FB6C 1VRWA 2WWRA 1PQYA 1JGTA 3K0AA 2IEIA 1K7EB 3UJ3X 4EYKA 3FTDA 4J2HA 1SESA 4BT4A 5G4LA 3ASVA 1WZCA 4H7KA 2HRRA 3VOTA 2DLDA 5FJJA 1E0SA 4G4XA 2QNRA 2MSKA 3GIDA 5DHRA 4URZR 3GFBA 3DB2A 1IG3A 3T0IA 1R0ZA 2IUYA 4Y1GA 4N0DA 4QQKA 2HMSA 5K01A 2IOFA 2Z3VA 3S02A 3ICEA 2W8BA 1JKFA 1HEYA 2CF6A 3IC7A 1V39A 4I5FA 1EINA 3AL0C 1B7GO 5FV4A 3CCQF 3Q6MA 2ILTA 4K9DA 2XMCA 4MVUA 1RE0A 4MVJG 2PKCA 4UM5A 3MYRA 3WFJA 4WW0A 1MIOB 2P2DA 3K04A 4RZQA 4GKBA 5JXIA 4QX6A 2GPJA 4CG2A 4FS8A 5DGTA 3PNMA 2EX1A 1VQMF 2Z56A 3II6X 2FN7A 4TMXA 1AGYA 1SULA 4RO0A 2FWNA 4ZT4A 4NZMA 5AKIA 1MDBA 2OCCB 1Q50A 2CLMB 1FMTA 3APQA 3GT0A 2D13A 3GZ4A 5FUYA 1R6TA 3V6LA 4Q3DA 5K09A 3HY4A 5HRAA 3IAHA 3OOJA 3KRTA 2C8JA 4HAVA 4GDFA 2R751 3ID6C 3NUZA 3WGMA 1CQIB 2ATIA 2Q1XA 1KGSA 2HPHA 1JSCA 2AJLI 4CR8A 2ZYVX 1FK8A 3AGPA 3QE4A 2BI8A 4JAUA 1QQ7A 2IP4A 3H13A 4JYCA 4C04A 1YZ3A 1H5UA 3ZJTA 5L7YA 4NFYA 3KUUA 2FWIA 2SHKA 3FAKA 2V65A 4EJSA 1KK2A 2HR3A 5IT5A 2W6JG 3RIYA 2YJZA 4R9SA 1A9ZA 5JJKA 5AOVA 3UANA 2CFIA 4MVRA 2GASA 5CT6A 4U3JA 1IBSA 2P3OA 5LPNA 1NLZA 2O6HA 5KTTA 3ZP4A 3A26A 4OFXA 6ABPA 1XTBA 2YHIA 3MTEA 1JLKA 3OMLA 9LDTA 3E1YA 1OLXB 1F0YA 4YRQA 1R0KA 3IMCA 4LZWA 3RSFA 1JJIA 2EW8A 3TQOA 2EJBA 1TPZA 4TLCA 4MW6A 3KFVA 2J31A 4RFLA 3KKEA 2ABWA 1VM6A 2Q99A 3K9LA 2WLTA 3MIIA 1O4VA 3PYMA 3M81A 3GL9A 3HTNA 3FB1A 4CF7A 4UQOA 4KZPA 5JXWA 1KI4A 3QTYA 1KY2A 1LRKA 3PU6A 2AMVA 5K0GA 4IWNA 1KZHA 1E89A 1R10A 2II6A 3HZHA 5GANK 2PXAA 2YDXA 1E8DA 3AEIA 3OFNA 3GG2A 4EELA 5KX5A 2R8ZA 3LO5A 3CSDA 3OEED 1IIBA 2VWJA 1Q7YW 3HL0A 3EIOA 5IKXA 1YUBA 2P3LA 5IM5A 3DMPA 3HB5X 1W40A 4JBHA 4RBNA 1R74A 3IXLA 3UV7A 1VQ5V 2ZBFA 4A2QA 2ZROA 1XA4A 1DAGA 3D3WA 4HF7A 1PE0A 3LGSA 4XJTA 2JDIA 1QHIA 1M72A 4BOYA 1QGDA 2ACKA 3ANYB 4MA4A 1JLMA 5DEIA 4TKUB 4AUEA 3ZHYA 5K0CA 4GHWA 1KI7A 2D5LA 4XGIA 1F3OA 4UUAA 3OGIB 4Q16A 2C0CA 3PFKA 3JQGA 1ZAYA 1TLTA 3O9OA 1EQAA 2DFLA 4RVFA 2Q28A 2RMKB 4A0QA 4YREA 1F8YA 2VHVA 3N87A 3KPJA 1TW3A 1U2QA 2B3TA 2PMPA 4BAGA 4NFLA 2PRZA 4RANA 2H1SA 4K9KA 3E9DA 1P9RA 3U13A 1BHJA 1F4NA 2XUIA 4L75A 4EDFA 2H9YA 5AVMA 3VHXB 1UFQA 2FEKA 1OJLA 4FMDB 4J0GA 1VA5A 3DC6A 3Q7TA 2XAGA 2P9ZA 5JSKA 3N5CA 4HPWA 4DV2B 2YRFA 3HI4A 4AYXA 1VLZA 1TO2E 1GSOA 3LK6A 1G60A 1IV4A 1V26A 4E2FA 4HH1A 1QIEA 3S5JA 3TRFA 3L8DA 4HFJA 2P67A 1CRLA 1RQXA 4Z1MA 1INLA 5KUTA 2COKA 1GCGA 3EEIA 1W35A 2ZXFA 5DXJA 8MHTA 4MW8A 3H3FA 4ZHSA 4KI0A 3OECA 1AXEA 4UTOA 1WNSA 4JJFA 1U5BA 4RLHA 2NMUA 4C76A 1M7BA 2H5JA 3KXDA 5IBRA 4LBYA 2WPDG 2BMJA 2QYHA 1NVGA 4RCZA 1K97A 4CC5A 5JQGA 3PE3A 5KTOA 3CH7A 3JRWA 3NU1A 1OSNA 1F06A 4PV7A 4AI8A 1TMYA 4A2WA 1PJLA 2A9QA 4BY9D 4AQDA 1UCFA 4OATA 1SERA 5MGBA 4R9NA 3ADDA 2Z6UA 4BNKA 4M83A 1U5CA 4U7JA 1I3OA 5LDDC 3NWOA 2FG6C 3DV0A 4X3CA 1UDRA 4KX5A 4ZODA 4JGGA 2FPPA 1ZUIA 4U7NA 2ZANA 3EOAI 10MHA 3WKEA 4BTEA 2F23A 4L27A 1OTHA 2G9NA 3PHCA 1W36C 2ZYAA 4HX9A 4K9SA 4O4HF 3JQ6A 4X6YA 1BHAA 1GK9A 3NP7A 1ODEA 3QUAA 2IGBA 2I9PA 1N0UA 1VQ9F 3IXQA 4DARA 2UV8A 1GJRA 5T8KA 3V6MA 1HX7A 3A37A 2C7OA 1AJNA 3K2EA 3QH4A 2MCFA 5AVVA 4NEQA 3ZMZA 1PTKA 5F64A 5LGNA 3M9XA 2HF2A 1EUZA 3CLUC 1WMBA 4RAIA 2O5CA 3NIDB 3ASYA 1CZKA 3S1LA 3OVMA 1JI0A 2FUKA 5FOUA 2H7XA 1BRTA 1QTQA 1P0CA 2Q21A 5JS7A 1THGA 3STHA 3DPUA 3DKIA 3N2NA 1S1MA 3ZD6A 2ESRA 5SYMA 1NXWA 5D2CA 4FW8A 3W6PA 4E5UA 3JSXA 3NAGA 4UB6Z 1DO0A 2KPOA 4WIAA 1G20A 4MR8A 4YLYA 4B6GA 4GRDA 2C54A 2EOAA 3HSSA 2BFDB 1S77D 3J80A 1I80A 1RM0A 2Q2QA 4XCQA 1VKRA 4O5AA 4ND2A 1GPUA 4PZCA 3MT9A 4Y0VA 1T0KB 5LB2A 2XAJA 3RVKA 5D5PA 3VNVA 3ABUA 1IEWA 3L7NA 3EHDA 3TBHA 2P11A 2BONA 2XWPA 3M6VA 2WIFA 5FJIA 3OAAG 4JWKA 3IO3A 4CTNA 4NPCA 4EFDA 4FUTA 4KKVA 4OHPA 1HLFA 2R11A 1P4RA 2FX5A 3UATA 1IURA 5TISZ 4DSOA 3B3AA 4O6VA 5B7PA 1W2HA 4X3PA 2ZYWX 1P74A 2J5RA 4KWCA 3R09A 5G0TA 2V6MA 4KR7A 3F71A 1OYOA 2B94A 3SPGA 1GRQA 2JFVA 5AKHA 1VPVA 4QXQA 4JC5A 3V7WA 2PWYA 1YNOA 5L3BA 1O6BA 3JD3A 1U2ZA 2PUHA 3U1TA 1TIBA 1TYCA 2RE8A 3OQPA 5FR1A 1NRIA 4BRUA 1IXKA 4BQOA 2JLVA 4TMKA 4BFZA 4QE9A 2BGNA 2PI4A 4YAWA 3QU9A 1ZC3A 1ZM7A 1LBTA 2P2CA 4EBBA 1J90A 3CVYA 3LWNA 1L8AA 1WP8A 2J0EA 3VC2A 2FFHA 1SFRA 4F92B 1CQXA 1UJ6A 4EG0A 2JLXA 5BV8A 4YUAA 4DILA 2AOUA 2WM2A 3QFRA 3QNWA 4LQ4A 2O0LA 4Z3OA 2P6JA 2GHTA 4TMTA 2QF7A 3IUYA 4TV8A 3LDDA 2BO1A 4AZ0A 3B1ZA 3EC7A 4Q34A 5LLTA 1YS7A 3PVSA 3SY8A 3AVVA 4YJDA 1MV8A 4IFBA 2N74A 2H4JA 4WESA 1M2FA 4RTJA 3FM9A 1MPTA 1GT6A 1QHNA 1OWLA 3H18A 5CW1A 4LBZA 4DDTA 4IAOA 5A04A 3WICA 1PP9H 2KG4A 5EKDA 2IZ7A 2OGUA 4BUCA 4OLHA 5HGJA 1R73A 4MOWA 3A36A 4F9TA 2WJAA 4ZOLA 3MMNA 1GGHA 4QLBA 4ZU6X 4NENB 3SN6A 3VI6A 1OAKA 1XTPA 2PGJA 1B6GA 3FOWA 3FOZA 1IPEA 1H1DA 5JDCA 3SLGA 3ZKAA 1FU4A 3KE8A 3X2QB 2YV5A 1SZQA 4PLHA 3I2HA 4AKEA 3MTDA 4BB0A 5B1SA 4KR2A 3H1EA 2A0KA 3RTCA 1VYHA 5F5XA 4QASA 1QO9A 3OFSA 1K6EA 3NBUA 2VT3A 2WTXA 3H75A 1UC4B 2ZJBA 4QBTA 1C30B 1XLWA 1FVFA 2BGKA 3AFIA 3HWX1 1UM8A 4MS3B 1IY0A 2UYOA 1UEXC 1KNKA 1U8YA 4QU5A 3LLUA 5KCMA 3B2QA 4OMFG 4RHTA 5EJGA 1XDWA 2VQEO 1LPMA 1KR2A 2IH5A 1W5BA 4P82A 3D0RA 1M1YA 2G40A 2AG0A 2FZLA 3ELBA 1R6KA 3KALA 4QPDA 2OSVA 2Y71A 2OAGA 1VLMA 5JC8A 2X8WA 5SY6A 1K0UA 1AB6A 4J1SA 1EBFA 1QAHA 2PS1A 3OT4A 4MKIA 2QT0A 2AFHA 3TDMA 2YS8A 4DLVA 3TX2A 3HI6A 4GYWA 1NW7A 2JI8A 2VWKA 1CK2A 1O7JA 4X54A 3STXA 4CGZA 4K9QA 2DPXA 2F43A 3EEQA 5EE5B 4WJLA 1KAGA 2XZPA 4RMHA 4BJ3A 1U04A 2CHEA 3VH2A 2YR0A 4W7SA 2H8EA 1M8PA 1TE2A 3DT9A 3IR6A 1MZFA 3IVXA 3AVUA 3I72A 3D7NA 1PNRA 3AUAA 3IIKA 4ZPXA 4TLDA 2G4VA 1E7MA 2ZOSA 1NYQA 1SRQA 3SP1A 4YMGA 1X7ZA 3A11A 1NLFA 4L73A 1BA2A 1CR0A 2IH3C 4P9PA 2REOA 1TT5A 1XQ8A 1WDMA 3ZMSA 3ZXUB 3OQNA 1NMSA 1RW4A 2C1XA 5EWJB 1PR3A 1IUNA 3N07A 1XTKA 4BU0A 3OU6A 4AZWA 4YRGA 2YW9A 5B2ZA 4X6LA 1X7GA 4NSNA 4QA9A 3GUCA 4ADSG 1L7DA 4H37A 3MQFA 1GFWA 2QROA 5MF6A 2Q45A 3WPXA 1R0WA 3RC8A 1J9GA 1L5YA 1PFUA 3WQQA 1LBSA 4EA6A 3L49A 5HEKA 3UT5A 1S89A 1WOMA 3K05A 3IULA 1H7MA 1DBIA 2XZOA 1TT7A 3CU5A 4IWXA 3FLBA 3CC8A 4INPA 3NWPA 3U4HA 1US8B 3ZBHA 4JJEA 1BDMA 4P4UA 3K0FB 3A14A 2I6TA 3QVNA 5G0UA 1QVZA 4L9SA 3BIJA 4R4JA 2I5PO 3DW3X 2IZ6A 1IBKB 3UN1A 3QXCA 4AMYA 4WZBA 2XAUA 3JQ7A 2JANA 3C3JA 3RJMA 3ZWQA 3RTGA 3DZKA 4GD3Q 4MR9A 1S9DA 2VCEA 5HKKD 4NWOB 4OH7A 1NG9A 1T3HA 4GMDA 1ZMXA 1BS9A 3SWWA 1JAIA 2IOYA 1V2HE 4QOFA 3CH6A 4LE1A 4BQIA 4YCCA 2VPWA 2IUTA 1AZTA 3NGLA 1B00A 3KHUA 5JV5A 1GN3A 2QAGC 3NJ8A 4JR2A 3V4ZA 2XJ9A 2GUZB 2IYLD 4O4IB 5IK2D 2I2BA 2ZVDA 4HVLA 2QHXA 4R05A 1GUBA 1QGAA 5TVKA 1UBUS 5CK4A 2J1LA 1UKCA 3CNEA 4JPRA 4QFMA 1TAQA 3O4GA 1Y3DE 5CXXA 4RHEA 4KQJA 5KNDA 3TPCA 2PXCA 1UANA 3VR2D 2JI4A 1H8HG 3UCSC 2BEVA 4BX2A 4LWSB 1GITA 4QU9A 4LDAA 3KSDO 2CNWA 3WGHA 1E3TA 3TOSA 4G4VA 1ADCA 1R4MA 3KQVA 4FHGA 4JA2A 2PSEA 4BLVA 2Z5FA 4Z0PA 1ULZA 4L22A 4DLKA 1QAOA 4PBTA 1SCAA 2V6GA 2ZAIA 2PMFA 4DCNA 1FFXB 2HZ7A 4RQAA 4MNTA 1SIWA 1QCZA 5G02A 1TC1A 1JX6A 4BXOB 1G2OA 4O25A 1D7AA 4ZVQA 3TVYA 1QVWA 1U8AA 4P30A 3WLFA 4GXTA 1SVSA 5K8TA 3MINA 4TLLB 4G5FA 3AG7A 1NI5A 4HAOA 2OTJF 3GVPA 3W5JA 1DAKA 1X2BA 2C99A 4EW6A 3ND7A 2WWHA 1OFGA 1VCOA 1NPTO 4J6FA 3HDTA 4M37A 2CJPA 3WIVA 4PTLA 1L5SA 3S0JA 1KVUA 4PDVA 3CZAA 3TD5A 4EKDA 4JT4A 3KXIA 5CH3A 3IALA 4GZRB 3CC2F 3M9LA 5ALGA 3QENA 4KO3S 3CD6V 4MUAA 3FNRA 5K8JB 4ZJYA 1LB1B 4FZJA 4DA6A 3GLHB 2BE9A 2X5KO 1GNRA 4XB2A 1DAPA 4J0CA 1PW7A 5B4VA 3ESCA 2V3WA 2QQFA 1LVGA 2O7VA 2H1IA 2WJGA 1XN1A 3IH5A 3FZGA 4U7TB 1YTFB 4FNOA 2P79A 1R8QA 1W25A 1MC5A 2PV7A 1ONNA 2AI1A 1W41A 4ZDKA 4WPGA 2ADFA 1JHDA 4UMFA 4WY2A 1W9MA 5CDHA 1CEZA 1GMGA 4ZZIA 3IRUA 3P9IA 1CJBA 1KDOA 2OHJA 2Y05A 3WY9A 3U7FB 3RAPR 3S28A 1L5OA 3L7JA 3UWPA 5AI5A 1L1QA 4JIGA 3U9SA 3OEWA 2WTMA 4RL6A 4OJNA 4QOIA 4NK4A 1EWVA 4CF6A 3ZQ6A 3WX0A 4P0PB 3KCXA 3OZBA 4LMAA 4W99A 1Y5MA 1NVAA 1Q1GA 4UNNA 2PO5A 2DW4A 3LKVA 5A4IS 1YC2A 4C05A 1VOTA 2NTJA 3GRYA 1REQB 1UFRA 4RS3A 4HYTA 2GFHA 3GVHA 1XP8A 5HM6A 2OZBA 2CD7A 1EIZA 1F12A 4MKRA 3OC6A 1GXSB 3ZW9A 1Q86H 2YNMC 5J5CA 1MW9X 3KOXA 1LTHR 3QBTA 4M86A 2XYGA 3CWZA 1QG0A 4MQBA 2EQAA 4ZI5A 2DN9A 3GRKA 1J00A 4XFJA 1FLAA 2E82A 3FKSD 2RONA 4MO9A 4UHCA 1R4NA 5FBHA 2VNKA 3KSUA 3EFHA 1PT8A 1E0JA 2PVPA 4AY6A 1ZJWA 1RYFA 2R87A 1TYDE 2W9XA 1ULSA 5DU2A 1EWKA 3CLHA 2H52A 3N28A 3F5FA 1UAYA 1NN3A 4C6RA 1N77A 4AQYO 2VAWA 3C9UA 3ORYA 1FFHA 5IF9A 2Y99A 3J80N 2HMTA 2XOKA 1XZJA 1H3NA 4OMUA 1KS9A 2HCBA 2RK4A 1O6CA 5H7XA 3TQCA 3ABMC 4QFCA 4LNAA 1VQ4V 3OJCA 4EJFA 1BRMA 3N2LA 2W6QA 3KUCA 5HFLA 2C2BA 1UJCA 3MA0A 2YJTD 1KKCA 2PH7A 4U02A 5DGXA 1NY6A 4TSFG 2XA2A 4PZYA 3S5UA 3EMBA 5JSFA 4KQ6A 2R1VB 5CB4B 5JNVA 5DYTA 4BO4A 4N12A 1YR6A 2QMQA 4NYMQ 5H59A 1CETA 3E2PA 1TUGA 3AOEC 1KHTA 5I6DA 4WE3A 2XE6A 5LHIA 3K2XA 1TUEA 2F3PA 1RHQA 4D82A 3O8QA 1HQDA 1G41A 3G5MA 2PFKA 4WK0B 2QTWB 4HTAA 1NRWA 2O8CA 3K32A 2WUGA 2D0OB 2ZT8A 3FYSA 3WVNA 2OFOA 2PNJA 1FP6A 3QHPA 4GUAA 4QBIA 5AK6A 1V1RA 2W90A 1TC2A 4W5WA 3W6NA 2CHUA 3FZYA 3FMPB 2FX3A 3UO8B 1C1DA 1C8BA 1A4XA 2P9QA 1JTEA 1A5SB 3PRHA 4D0SA 2FR1A 5LZ5A 5G0WA 2ZI4A 4XYEA 1FP4B 4DA0A 1VGVA 4EPWA 1EZJA 1C3EA 1XAGA 2NUAA 5ALKA 3RLIA 2OAQ1 2JGNA 2I8AA 4X64O 1DP4A 2H29A 5MDHA 3ENWA 2WDZA 3CYQA 1VE1A 4YUXA 1T4CB 1YHQV 2GN9A 3IRVA 2P9GA 5EGSA 3D2LA 1NPDA 2HPZA 4PPYA 1OLSA 2VGNA 4IYHA 3QI2A 4HP8A 2JIDA 3E1GA 5IAKA 1RI2A 5CB0A 4HFNA 1NP7A 4RHCA 2HMYB 2SKDA 4RD2A 1ZMOA 5EL0A 3SQDA 4N8DA 1C2TA 4Q3OA 3WOHA 3IQXA 2I0FA 1GU0A 3UH1A 3OZEA 2P2NA 3K6SA 1XHOA 1AOXA 2L69A 3ZVMA 2UXXA 1NMUB 3JZMA 3A6DA 3EUWA 2JJMA 3IP7A 1ZJ5A 2EIXA 4KQCA 3ORFA 1YBAA 3PZRA 4R2XA 4RTNA 1THTA 5DB4A 3ZZTA 3IHLA 3SPJA 5F7JA 3DZIA 1N5MA 3E89A 3R77A 4BZQA 4FKBA 2PYIA 5GWXA 4KQHA 2WJHA 1LX7A 5J59A 1L4KA 3CNHA 5TT1A 4TKVB 4MV9A 1CE8B 3M6WA 1ODFA 3TG8A 3F0EA 4LFCB 4TV9F 2FQYA 3LPDA 3GA0A 3GLFA 3FE2A 3EARA 3R20A 3UJ9A 3VVBA 3CGWA 1Y76A 2OVBA 3OEEA 5AQEA 4I9FA 5TGZA 3OIGA 4C3OB 3AR8A 2NZWA 1DRKA 5E38A 5F3RA 1MMFB 3NLLA 1APBA 3WGYA 4UTVA 4EHAA 4DLRA 1J1ZA 1YRHA 3IFSA 4S2EA 1B73A 3IAXA 2MWMA 1UWCA 3SIRA 3HO6A 1HE4A 1W57A 1OHHG 4DYVA 2CCJA 3CCMF 1VLJA 3CW8X 3I6ZA 1XMOB 2SNIE 4B4WA 1XAHA 1ZHFA 4ZT6A 5AVOA 4UCVA 3KSAC 3OPNA 3BXZA 5HVNA 2QORA 4RWUA 3MS4A 1T0UA 5HBGA 1U4SA 2CVZA 4OYLA 1BU5A 1GKYA 1QFSA 2H1VA 4WXMA 5J4YA 4W1PA 3U56A 1IVYA 1K6MA 2P9TA 1O0BA 5LC1A 4BGEA 3JR3A 4GBGA 4HXEB 1G6Q1 4DB2A 4EI8A 2QRNA 5THXA 4RF2A 3QE0A 2F9FA 5KOJB 1PZNA 2XA9A 1I08A 3T9DA 1UM9A 1XPUA 2HDOA 4ZQIA 4ARUA 1RC1A 5JQWA 4BBJA 3OKCA 4PA3A 1T91A 3UTCA 3SZLA 5IMBA 1RWXA 5HKAA 2YI9A 1QHFA 3C24A 3VIUA 2NQTA 4ZA2A 1FS6A 3NNDA 2Y69B 4JXKA 3CJHA 3TAUA 3AEKA 4OXRA 4P54A 1QCYA 2NV2B 1KU0A 3A9UA 2H9IA 1NQ5A 1WAMA 4NZPA 2JJ8A 4M9SA 2XTMA 4LRUA 3BDIA 4IFIA 2LRHA 4ZHYB 3VU0A 5GP1A 4F11A 4WA7A 1KO1A 4GLXA 4G1VA 4MP8A 2PL5A 4F4HA 1NIPA 5LGTA 1K7CA 2XDQA 3EEBA 4ARVA 2FG5A 5JSUA 2Z1FA 4ZI7A 3NW9A 1Q90D 3KJIA 1WPGA 3PTLA 1Y6GA 3VGPA 3SZOA 2EXXA 4GS5A 1AG9A 3P0RA 3DMYA 3NTXA 4RK1A 2DG2A 2V6IA 3OLXA 5F1OA 2O8BB 4GOLD 1SMKA 2DT8A 2WNSA 3ZOKA 4K03A 4NJEB 3HDVA 6LDHA 1CKEA 2J7PD 1N2ZA 3Q3GE 1PX0A 1F6DA 1L5HB 1RWVA 2CLDX 1FXHA 4GOJA 1UBNA 5BW6B 5KHJA 1ZOIA 1T5DX 4KGZA 5H8WA 1B2LA 2P2ZA 3TJMA 3USZA 4NOLA 3I04A 5C53B 621PA 2ZR8A 2PI5A 4ZIRA 1N32B 4AJNA 3KCNA 3AUYA 4MO2A 3IOBA 3KXPA 1GTMA 3P9PA 4JYAO 4IOKA 3H99A 2O8NA 1DBSA 1V5EA 4AUKA 5CGZA 1BL8A 3D4LA 3C39A 4MV3A 1WCIA 4Z7QB 2JGAA 5BNTA 2XB6A 1UDAA 3TVTA 3OKPA 3B7GA 1M9NA 1XTSA 2FSUA 3ZLJA 1PJ8A 1VQPV 1H2ZA 3RUAA 3DXFA 3EZXA 4RORA 1DC8A 1IHUA 4TQUS 1TZBA 3H17A 3MJEA 3QW4B 4HWGA 2WIDA 2FPOA 2HX0A 1I51A 4CMCA 1TKRA 3Q41A 3B09A 1Y1QA 1B6SA 4PELA 4RVNA 2B33A 4HDMA 1VHLA 3T3PB 1SVMA 3R6LA 3E5HA 1HRKA 1YSCA 2OHIA 5BY1A 2ZYHA 1KNXA 3P5SA 5JNTA 2CEKA 5AJHA 2WA1A 4AXXA 1PR1A 3GLKA 5KYYB 5DWVA 3ABIA 4PYOA 2DB3A 4J91A 1KY4A 1OH8A 4IIXA 4TS4A 4GL2A 1BS2A 3LGAA 2XQGA 4Z8XA 2PPLA 1VIYA 3PKIA 2AJDA 4XRRA 2ZBQA 3BMNB 1RHMA 1ONPA 1P9WA 2AG5A 2HR1A 3MW8A 3STWA 2W4IA 2AIZP 5SZJA 3QPVA 4OGLA 1MRZA 3AG2C 5I3ZA 1E1NA 2AN4A 1RAAA 1QF9A 4OB8A 2E0IA 1QDLB 1WXDA 4BWGA 4YMLA 1UDWA 3RVBA 4PWTA 1ZJYA 1RYDA 3WR5A 3L7CA 2RDCA 4ZVLA 1KMHA 3HB9A 5DHSA 5TR9A 4LGMA 1ICEA 2F1MA 3CS5A 3RKRA 4DCMA 5HS6A 4PCVA 2GN0A 4L0MA 3OTWA 1G4AE 1H8EG 2W2LD 4XE5A 2JAXA 3GF4A 4UD6A 1PLJA 5EBWC 4TT3D 2HNKA 1DC5A 4BC0A 2YTZA 3BBPA 3H2HA 1I30A 2ZBGA 3ACDA 3DO6A 6Q21A 2DETA 3NT4A 3DM5A 1M6EX 1JWBB 2W43A 5DBGA 1TIPA 1E1QD 1K8ZB 3ON5A 3DEZA 2XYRA 5FYQA 2PKEA 3CXHF 3L9XA 1JFSA 3VC1A 4DZRA 1U0HC 1FLVA 5CEEA 2YWJA 1H2YA 3QVMA 3JU3A 4XIJA 3TK1A 4N48A 1H2GA 1VGRA 4ZXPA 2EINB 3K1ZA 4LYHA 1Q3KA 2AEEA 3HKEB 3OMNB 3AUJB 3PGJA 1QHHA 1SHZA 1EEXB 1P0MA 2YJ5A 4IH9A 2OB2A 1GZ7A 2RHMA 2I9KA 3EWNA 1QE3A 3QM1A 3I28A 1LVHA 3GP5A 4UEJA 3CV3A 5DXAA 5EE9A 2CZWA 2AN5A 1H69A 3GUZA 1TTQB 4YXFA 4BPRA 3BC1A 3AWDA 3FHLA 2RC5A 4WASA 4F8JA 2H1RA 1OD6A 1Z39A 4D9EA 1HLGA 2V7XA 5EC2C 1OXXK 2G17A 3ZE8A 3DAFA 3I5DA 1XYVA 1KZYC 4REQB 5A3JA 2O6LA 1ZIXA 2HYDA 2KSQA 2I7VA 4CIVA 2WSSG 2QTVA 5JW6A 4DR1O 1BJKA 2AE2A 1QR2A 5TPWB 5IBPA 4B6FA 3ESBA 2QD3A 2PDAA 1NMYA 3UTDA 2ZWMA 3K15A 3FZEA 3RFVA 1LGYA 4GW3A 5FEUA 1ZK1A 5A6VA 2Y0DA 4NTYA 1M90H 1ZR2A 2ZSDA 2C2MA 3HNOA 4ZHQA 2FMHA 1DCFA 5EE3A 5GIOC 5CVTA 3CKYA 4GLLA 5C4MA 3AEQA 2FMLA 5L8VA 4LFBO 4OXXA 3K1JA 4MVJP 4FHFA 3T4UA 1PBTA 5B64A 3BREA 3A6PC 4Q7JB 3H5OA 4EFEA 1H0RA 1M34A 4HX2A 1J42A 2CLKB 2ONYA 3T4DA 3OUSA 5FFFA 3BEDA 3C9SA 4LPKA 3BPZA 2V9ZA 1K7FB 3I09A 2XUKA 1JDJA 3G4SF 3AKYA 2X9VA 1BGYH 1PN3A 4YX9A 3BIOA 2EILC 1XZMA 1VYTA 1JDBC 1USVA 1M73E 1UJ5A 2GDZA 3SZ3A 3V42A 4E4RA 4A1FA 3AY3A 4ZZ2A 4KQ1A 1WR8A 4KR9A 4AO8A 1J39A 1NM5C 3ZE7A 3CUWA 2HUNA 2IS6A 1U63A 2Q1WA 1NW9B 4PSCA 3T4XA 1Z83A 4MDHA 4GYJA 4UHKA 4MW2A 4QJ3A 3EXHA 4ZEMA 3NH9A 1V95A 2NSJA 1RXEA 3GEIA 4DO2A 1KFKB 4XX0B 3U4AA 2CDNA 2FV8A 1ITZA 3WYDA 3G67A 2HD4A 3H4IA 2OCYC 1Y5NA 3K1AB 3ZNQA 1PT5A 4MA5A 1QVFU 1QOZA 4RF5A 3ZVNA 4OMCA 3F74A 2PN1A 4K9MA 3WMEA 1KJYA 2NV6A 4AKHA 4C88A 1ZGAA 4KQFA 4IIJB 2A4MA 1V7ZA 4BWAA 2HJHA 2H31A 3GUYA 5F5LA 1KMNA 2PX4A 1EFKA 1YR9A 1TMKA 1SOAA 2BM8A 4WNAB 3PENA 1M1NB 1W3EX 3DHVA 3I9NA 3JWIA 3VZSA 5K45A 1G8SA 1FY2A 4LEIA 5CDGA 2BMEA 4Y7CA 4KAFA 3TW0A 1IM8A 5AI0A 2AMLA 4PXYA 4CJXA 2P4HX 4NVPA 3PNPA 1WJZA 3DMHA 1BHQ1 3WFVA 1QFJA 4F3NA 1GPYA 3RYCB 1NJ2A 2HOQA 1PHPA 5JTTA 2OE2A 3RQSA 3QBJA 4J2TA 2JGMA 2A86A 3PWTA 4MXDA 1D4OA 3WADA 4PQGA 3IPXA 5C31A 3BA9A 1DEHA 2OGZA 3A1CA 4Q3KA 1VK3A 1LBHA 2PF4E 4MI9A 4PZAA 5HKKA 5C51B 4B43A 4C43A 3IPYA 1GHTA 3E8SA 3KJQA 1JEDA 5I8PA 1UXHA 5BMOA 4ZARA 1KQSF 5IK2A 1W5FA 1Z88A 3F5MA 1EGMB 2WQ7A 2E49A 4XLLA 4JVSB 1V9PA 4V0RA 3UJPA 2UUBB 1E20A 1RSZA 3COJA 3D0QA 1ZGGA 3F5WC 1OX4B 4NXMB 3N4YA 4UCQA 3VR2A 2IYRA 3I3SR 3DMTA 2F1JA 4M0PA 3GVMA 5BSVA 2ZGVA 2WF6A 5BOSB 5TJHA 1D9XA 3N7UA 3AUXA 2O2ZA 4ETNA 4HH3C 3GH1A 3W6UA 4ZGGA 2B4RO 3T9EA 3T1OA 2YYEA 2GLXA 4ESEA 1F20A 1ND6A 3T2MA 1N8RW 3H9JA 4E5YA 1WPBA 4HRYA 3N76A 4ARIA 4KPUA 5CW2A 1IXZA 4R16A 5I8WA 4S05A 1FSFA 3KQTA 2ZBDA 4D80A 4FM0A 3D01A 3G88A 5AP9A 5IDJA 4L08A 2J4DA 3ZY2A 1AN0A 4C2AA 3GZTB 5ADUS 3UXMA 2FSPA 3PDCA 2WZBA 4B82A 1CUEA 2E2WA 1DOZA 3RQIA 3C9RA 1B14A 4YC7A 4IF6A 2O2HA 5AUNB 1WKVA 1WZ2A 3M4NA 5FWYB 4BEJA 3Q7PA 2Q4RA 2QOEA 4GF5A 4HI0E 2FUG1 4AIIA 3D3EA 4EATA 1TUBB 1MFZA 1D0VA 2X2EA 5DLQC 2H2FA 2GRAA 3DZBA 2IHBA 5L3QB 3S8YA 4WOBA 4H6XA 1M8JA 3RROA 8GPBA 4HWSA 3TZHA 4LF6O 3IBCA 5IXSA 3W7UA 2WM3A 4LCKA 3GJZA 5LD2C 4JMLA 3FNFA 3LT0A 4G9GA 5IHPA 4AZVA 3R3YA 1TVKB 5GJBA 1B04A 2X7XA 4YY3B 4A8HA 1NR1A 2M1ZA 4M0UA 3BABA 1IQRA 4FYYA 2VZLA 4LSZA 2PFGA 2HZBA 1T6NA 1YL6A 2C83A 2HQOA 1M6HA 3G0IA 4YUVA 5C9ZA 1YU6A 4B3TO 5JRDS 5CBPB 1DLBA 3KPUA 1N5OX 3ZQKA 3P19A 2QVLA 1EFVA 3QOFA 4QJ4A 4YAIA 1QX3A 1WNTA 4FHDA 2Z95A 3GGGA 1QYDA 1L7AA 2HRYA 1DFIA 1VKOA 3ZWDA 4FC6A 3HG7A 3PHIA 1M6VB 3OICA 1PJZA 3I2IA 2DFTA 4C1BA 3GJQA 5ITZB 2XXAB 4YT4A 1HM5A 4N6OA 1M1KW 2NZJA 2DQZA 2AC7A 4MPPA 5I3CA 1N2OA 1I6LA 5DF1A 1NBME 1GTZA 2XWBF 4R8SA 2WJIA 2EL7A 3LY8A 4LOLA 4K28A 1JIQA 1UPBA 2WAMA 1RLOA 1PLKA 4BLUA 3ST7A 1JBEA 2Z98A 5AVRA 3IHTA 1DB3A 3QLTA 3HJFA 1D1TA 2AZTA 1FU7A 4TRMA 4QYIA 5EVCA 4EUKA 1VI2A 3DVSX 1XOUA 3NX4A 1HNWO 4YIHA 2AI2A 1P49A 3FKSA 3ETLA 2J9XB 2A2ZA 2OZVA 4JTDB 1HSZA 2CUNA 2W5UA 1WP9A 3RUPA 3P2OA 4HQFA 5KNBD 1X1CA 2PEZA 1P4HA 3UNXA 1EP9A 4AAYA 2VH1A 2AH5A 5JS2A 1ZLXA 3NKVA 4NZOA 5DWQA 1LPPA 4MYTA 2AIRA 3D36C 3I2JA 3H9BA 4PQYA 1V41E 4POOA 4GSYA 2WYOA 1XZDA 5F1YA 2GGSA 1XHEA 1Y4AE 4RY2A 3HXMA 4QGGA 3L0PA 1L4FA 1JQDA 5BN5A 1TEHA 1W47A 2C4VA 3WDSA 4LQLA 2D7JA 1YITV 4RABA 1L4BA 1O9BA 4RSMA 3L6UA 2HLNA 5AKZA 4YMWA 3ESXA 1ESEA 3TLYA 3EQ2A 4DV5B 1F2DA 3U7IA 4DBLC 1SQGA 2RGNA 1ZQ9A 2Q2OA 3KE1A 4FFRA 1VL0A 4PONA 4IQ4A 3FUXA 1EUDB 2G4CA 4BR6A 1W88B 4GM0A 4QXMA 5H68A 2Z2JA 3JQBA 3PA8A 4D43A 5G3ZA 1II8B 1GZ0A 5J4HA 1F2UB 1CRPA 4RM2A 5LMNO 4OGQB 3OE4A 2BE3A 2B5VA 5KYUB 2C3UA 5CRIA 4V0MA 4UARA 4QU8A 4H0NA 3WGGA 1E9EA 1Q17A 4LG1A 1ML3A 1GV1A 1T9GS 3PITA 4R8CA 3EORA 3SC2B 1P4JA 3DW1X 4U8HA 4BCCA 1HE2A 4Y1RB 2QT9A 3RS0A 4WKNA 3H05A 3W2GA 1GZSA 3UXEA 1ENZA 5DNAA 4IV5A 1A04A 3UAXA 5GOZA 4R1MA 4BFCA 5A2QA 3BZWA 3MWEB 3SVTA 4Q82A 3ZJ4A 2FMUA 4KDRA 2IYWA 1IHXA 2IOHA 4WLFA 5NULA 2EWCA 3A06A 2PH1A 3CISA 2CV0A 2VNAA 4DNFA 4K1LA 1GEGA 2DQSA 4KIWA 1Z7WA 4QULA 3VYRB 1DT9A 4KQGA 1W94A 3UAZA 4BTVA 2NU7A 4UNSA 1W19A 1IJFA 1ISGA 3D3JA 2QWRB 5AW8A 4K6FA 1B15A 5AKJA 4H4CA 5FD8A 4X3MA 3C98A 3INNA 2GCGA 2GZ3A 4M0CA 1P4AA 3TCNA 1CRQA 2AFIA 3AR5A 5K0JA 2CHSA 4B7CA 3JYHA 2VHXA 4KGVA 2B8WA 3MSXA 2AKEA 1JAHA 5B1IA 4O29A 1XZEA 5EKTA 3I76A 1XR3A 3EHBB 5GADl 4HN9A 3DCJA 3W90A 5L3ZA 4I4TB 1MJ5A 1N3IA 2ALJA 1PFVA 1AQYA 1AQIA 4UOQA 1JH9A 3IEQA 4JJZA 2BCGY 4C2UA 3B6ZA 2XI4A 3WYEA 3SJAA 2RH4A 5G4UC 4MKZA 2ZSUA 3MXTA 2NUPA 2BH2A 4XPZA 3HZZA 4F56A 2YMQA 2F1KA 2ZR9A 2R4QA 4FYWA 3U5ZB 4EW1A 1DUSA 5LYJB 3FPKA 3VX4A 2FSVA 1GN8A 8ABPA 3O95A 5HMLA 2N42A 5J43A 2YIAA 3U31A 5BWCA 4JL8A 3A7DA 4J90A 5B7GA 1HYHA 1ZJJA 5FBZA 4P3KA 4ZCIA 4EQ6A 4YIKA 3OEHD 3H2JA 5CFLA 4L8GA 4WK2B 3S0HA 4ACAA 3OE7G 3G2OA 2HF7A 3HR0A 4LGVA 1Z2AA 2BF7A 2OBLA 4LHXA 1SR8A 2MYPA 4G0OA 5CA1B 3DAYA 1WDWB 2AD5A 1KAHA 1UZMA 2I2WA 5A0TA 7AT1A 3GOQA 3L7KA 3CRZA 3MBOA 4W7IA 5NLLA 5KDOA 2CTWA 3JPYA 2AMYA 1SOWA 3DJYA 4UVDA 2WV9A 3KETA 4I0XB 4MITA 2EQ5A 3GEEA 2QWPB 1EJ2A 4QU0A 3PNKA 4BVBA 3LIIA 1XZQA 4RJLA 1X74A 2VP5A 4PFKA 2BSQA 1WY5A 2O5VA 5ICFA 5GVSA 5I7UA 3JSLA 3B36A 2N75A 3DC7A 4P92A 3V97A 4M9XA 1GG9A 2G07A 4KHPO 5B30A 2CXTA 5TV2A 3KPWA 3B38A 5E9QA 3HRIA 4TVSA 3AR7A 3PWZA 3F2IA 1FXVA 3UJCA 2FPMA 3BWEA 4AECA 1XXHB 3ZE1B 1NXVA 3ROKA 5BUZA 5KS2A 4Q4JB 1T0JB 3A28A 2BJVA 4LKOA 2R8EA 1JFTA 1PNMA 3W3AH 3PAFA 1DHRA 4KVFA 4JLJA 2Q0QA 4BNTA 1YDHA 5IS2A 4DV1B 4US2R 3E86A 1Z6QA 1FMLA 2BYTA 3ESYA 1CNFA 4JGSA 1RAGA 2VDLB 3JQ9A 1MJHA 2A84A 3ER9A 1VSVA 1PGQA 3N8GA 3FLAA 3D8SA 5JRZA 5COBA 4QXAA 3A31A 4OK5A 4G97A 3C3DA 4TYNA 4KGXA 3CRMA 2LVBA 3A6JA 3B70A 4JHXA 3JAMA 5CVJA 3PCXA 3G9QA 2PYZA 4HSEA 2YYSA 3HCRA 1X8JA 3LQRA 4BE4A 2A06H 1SB8A 2OBXA 2HK9A 3LOQA 3ZX6A 2YJNA 4HHEA 3JW8A 2DYRC 3LNCA 2ZIAA 5E9WA 2J7PA 4R7CA 2AG8A 2RIPA 1I4OA 2XOEA 4B08A 2OPBA 4FOOA 4H7HA 4LJAA 3C4QA 3V32A 3JASA 4YDQA 4S35A 1N8NA 3PC8A 3AI7A 4QL3A 2JS5A 2UZAA 5E4YA 4XSVA 1GL7A 4MQLA 1F4PA 2X0NA 4TTAA 2XRYA 1KIMA 4HNAB 4Y98A 2PD4A 1CVIA 4FLEA 1JSZA 1TU3A 5KOHB 5DISB 3CF2A 2DY0A 2FSIA 3ESZA 2RK3A 3HR7A 1QFZA 4ZANA 3TL3A 4URFA 4A73A 2F7SA 2QUHA 1QD9A 3WK8A 1VL1A 2J3DA 1Y7TA 5C1PA 3JQFC 4YCDA 2HEPA 3G71F 3IAAA 1F6BA 3S81A 2I3DA 3AOGA 1PR4A 4S1OA 3RG2A 1BWRA 4F06A 2XZLA 5ENDA 4KH0A 1FNSA 1KBZA 3LSUA 1WF3A 4JROA 2EBUA 1KIFA 1D2GA 2ARHA 2IXTA 4JMPA 2Z8XA 1G4YB 1NNSA 3MJ4A 2J9GA 4OJQA 3RE1A 4BMYA 2DUUA 5HPYB 3UKOA 3DWEX 4C6TB 1M0SA 1IRXA 2C4KA 1T4DA 4EEXA 4JI3B 1EUCA 4PTYA 2KKWA 1JLSA 3L7OA 3JAKB 4EUNA 1Y6ZA 3R7FA 4BB5A 5FOSA 3SEFA 3WZMA 2I54A 3IAM6 3ZHQA 2ZJ2A 3HCFA 4L4XA 2IPLA 4ND8A 2FEAA 2DBRA 1U98A 1YZQA 1OI2A 1MH9A 4DR5O 2YN0A 4M87A 5CAEB 4OP3A 2O2DA 1MO5A 1H23A 1JHQA 4GT1A 3RUCA 4E14A 3NVMB 5JD4A 3F67A 4Y2TA 5EJ6A 1MX5A 3WNDA 1EVYA 2HS4A 3SIUA 1TKBA 3GEMA 3ICVA 3V2HA 1KPGA 2YJ6A 2QR4A 4JEMA 3X2EA 1FE8A 1Q1QA 3QVJA 1IOLA 3KV1A 4NR0A 4NU6A 2FW0A 1QU9A 4LYEA 3ZEDA 4CL3A 3SZRA 5CA0F 2V1XA 3IV9A 3AG6A 1W1UA 2V6BA 2W2LA 2BDTA 2QJFA 4MKXA 4TT3A 4X1IB 3NETA 1D07A 1ESNA 4UREA 4QVKA 4QNHB 5KVQA 1E1QA 5A02A 1OMOA 2OHVA 4H4DA 3EPKA 3LSQA 3PD1A 2FPGB 4TLMB 3DBRB 5LU8A 2P7TC 4LCBA 2C2OA 1OH7A 1OU0A 3RSSA 2HQSC 5DH9A 4C0QC 2VDWB 2BI4A 4GX1A 2ODNA 3GCZA 4N7JA 1CUZA 4KO2S 5JEDA 1ADJA 4FCCA 4UM9B 3O2SB 3WU2Z 2W2NA 4U5QA 3O2JA 1E0AA 4HFMA 4BJ1A 1N2GA 3BERA 4EYQA 4W5QA 5J9FA 2KG7B 4PSVA 4F2HA 4RUEA 2WP8J 2WKQA 2K4MA 1SS3A 3CRCA 3HHPA 3RJ9A 3O7MA 3NK7A 1AF4A 2C3MA 5EAIA 4FS3A 2AHOA 1OCCC 3E27A 5EZSA 4PZEA 4G56A 1XMVA 3OJEA 3NHPA 5EY5B 1UXKA 2GKSA 4XDHA 2AZ2A 4PXSA 5ALUA 4Z4GA 4CFYA 2YZKA 3L4EA 2H17A 4F4FA 4A0GA 1X80B 1E1LA 2QI9F 1Q1ZA 1TDJA 1XU4A 2AF4C 2VKQA 1HDEA 1AV7A 3PTZA 4YHHO 3OD1A 3QKSA 1ILWA 3IT0A 1NVPB 1TAGA 9MHTA 2ZWPA 4MV1A 3STTA 4B3IA 4UEQA 3RF6A 2F48A 1FJHA 4TXHA 3K96A 5DCWA 2RGYA 5BMVF 1Z2CA 3MERA 2X6RA 2PH5A 3MHPA 4DQXA 2Q5OA 1TM2A 1SXJD 2VUHB 4KLAA 5GM1A 1GKLA 1H6DA 4DMGA 1UBKS 4F2DA 1KQSU 1R3DA 2CUKA 2V9CA 4DSZA 1URFA 1QVFF 4PYJA 3I56V 1VE6A 5L6MB 1L7BA 3UCEA 3SC4A 1DKPA 3U44B 1EG7A 4MMYB 2AYYA 2ZJ3A 3PYLA 1F0PA 2X8JB 2XIJA 1MC8A 1CUFA 4W4LA 3WRVA 3KYDB 2CLHB 1F8UA 1Y5LA 2PS0A 2HQ1A 3VYSB 3U9TA 3X1DA 1V7PC 3P4XA 4OO3A 1T0AA 2Z4TA 3TETA 1X25A 3OC0A 2CL7X 3BB3A 4NL4H 4C0SA 1ESCA 2EX0A 3TKLA 2VPZA 2C82A 721PA 4CTJA 2VH5R 2B4TO 3T1YB 3COYA 2HHHO 2GTSA 4KK3A 2CEAA 4EFLA 4M49A 2IYYA 2GETA 3ANMA 3MWGA 5C1DA 2BKXA 3L79A 2B3DA 1HQCA 2W0MA 1X7WB 1ISJA 4LF7O 4PYKA 2IZ1A 4CCWA 1QYVA 5EP2A 1ZUHA 1M54A 3QEBZ 3EYWA 1J5EB 3T41A 2UU9O 2GPBA 4HLCA 3N2KB 3QO8A 3EQ9A 2HA0A 1PVVA 3P71T 4DV4O 2I6DA 3JZAA 1DLIA 4DUZB 3OCYA 2VJLA 1RI3A 3FI9A 4UHFA 3UGQA 1V43A 3LQFA 1E96A 2G70A 4UOZA 3U3RA 1Y7HA 4Q9HA 5BN3B 2ZFUA 3NGXA 5AM2A 3CVJA 4HNSA 1S2NA 3N2GB 1AHPA 3SEQA 4MS4A 2QRKA 1GILA 3E9QA 4RVDA 5A2QN 5BUCA 4YPVA 4L76A 5EZYF 2GDSA 2H51A 1JR2A 3DD1A 3VU1A 2Q29A 3E8HA 5EIBC 2A3QA 1EK6A 1T2CA 2ZIXA 3GU3A 3O8OA 1FVXA 1GKUB 3JYLA 5JVDA 1PWXA 1A7JA 3SGIA 3O93A 2Q7GA 3P8ZA 2F64A 3CIFA 3OE1A 3SFZA 3AF3A 3ORHA 4A4DA 1GG5A 4JJAA 2PHZA 2ZPUA 4GLOA 1K3TA 2FHSA 4C7UA 5DO9A 2AZ4A 2R79A 4MQFB 2CKMA 1D4FA 1CP9A