3HKBB

Tubulin: rb3 stathmin-like domain complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 132
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkbB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkbB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkbB01
4O2AB 5JVDB 5ITZA 4XCQA 5KMGA 3WGLA 4B45A 3HKDB 4ZOLA 3HKCA 4TUYB 5EZYB 4I55A 5C8YA 4O4JA 1RQ2A 2Q1XA 3JARB 4O4IA 1RQ7A 5IJ0B 1W5AA 4KWEA 5CB4A 2RHJA 3VOAA 3JASB 3RYFB 1SA0A 5LOVB 5BMVA 3JAKA 1JFFB 4X1KA 3CB2A 3JAWB 4U3JB 3ZIDA 5KX5B 1FSZA 4EI8A 5J2TB 3R4VA 5EIBD 3C8LA 4YJ3B 3N2KB 4O2AA 2BTQB 5JVDA 2R6R1 5LP6C 3HKDA 4TUYA 5GONA 4O4HB 4ZI7B 5CA1B 5JCOC 4X1YA 5IJ0A 1OFUA 3JASA 4F6RB 5FNVB 4DXDA 3RYFA 3RB8A 4X20A 3E22A 4LNUB 3UT5A 4E6EA 4U3JA 5KX5A 3ZBPA 1RLUA 3WGMA 4HNAA 5MN6A 5J2TA 5M7EA 4X1IA 4YJ3A 3M8KA 4DRXB 3N2KA 4IHJB 5MN4A 2BTQA 5JH7A 4O2BA 5JQGB 4TV8B 1W5FA 3RYCA 2VAWA 3ZBQA 3JATA 4O4HA 3JALB 4ZI7A 5CA1A 4TV9A 5IYZB 2RHLA 4B46A 5EYPB 4WBNB 2R751 4LNUA 5EZYA 1TVKB 4I4TB 3JARA 5LA6B 4ZHQB 5CA0B 2Q1YA 2BTOA 4FFBB 3RYIB 5LOVA 4DRXA 2GVIA 4YJ2B 1JFFA 3JAWA 3RYHB 1FFXB 5JQGA 3HKCB 3HKEB 2XKBA 1W5BA 4O4JB 5LP6B 3VO9A 4O4IB 1TUBB 5IYZA 2XKAA 5EYPA 5LXTB 3WGJA 3JAKB 5IJ9B 1TVKA 3N2GB 4I4TA 3M89A 5J2UB 5LYJB 5LA6A 3HKBB 1Z5WA 3RYIA 4F6RA 4O4LB 5FNVA 4EI7A 4IIJB 4EB6B 2VAMA 4YJ2A 3RYHA 2RHHA 1FFXA 5GONB 3VPAA 3HKEA 1W59A 2VAPA 5LP6A 4I50B 4U39A 4X1YB 3VOBA 1TUBA 3V3TA 1W5EA 1Z5VA 5ITZB 5JCOA 4IHJA 4EI9A 5KMGB 4X20B 5LXTA 4TV8A 3E22B 4ZOLB 3UT5B 1W581 4I55B 5C8YB 5IJ9A 3N2GA 5EIBC 3JALA 4HNAB 5LYJA 5J2UA 5CB4B 3HKBA 5MN5A 4X1IB 4WBNA 1SA0B 4O4LA 4IIJA 4EB6A 5BMVB 3VO8A 3WGKA 4X1KB 5JH7B 4O2BB 2VXYA 3RYCB 4M8IA 3JATB 2RHOA 5CA0A 4ZHQA 4FFBA 4TV9B 4I50A 3WGNA
chains in the Genus database with same CATH superfamily
3UAZA 2WB4A 3L18A 2VYQA 4FMBB 2HCRA 2HBYA 1HQCA 2IXFA 2WR8A 2IZOA 4LCUC 3K8YA 1AUVA 2POCA 1MN6A 4LVUA 2N05A 4MKFA 5DNWA 4U4AA 2X22A 3KTOA 3RAGA 2JF0A 2GRJA 4RTNA 4ZYWA 1XHZA 3C85A 5C53B 3GGDA 5CVUA 3TO5A 3LPDA 3DFZA 2WTBA 4COKA 2PVSA 3JWJA 4P9PA 4NDNE 4J7KA 2EHJA 2CW5A 3RSCA 4G5SA 1QG4A 2ILTA 1KP3A 3TE7A 3VQTA 4W5NA 4LHSA 3WZLA 4NKGB 4WKNA 1OHHD 5EN4A 2VF2A 5HCUA 1SA0B 4WH0A 2UXBB 2V7PA 2OORC 4MSWC 4J9UE 5K4AA 1Q16A 1OTHA 2BJWA 2QWNB 4KE9A 5SY9A 4WD3A 4ITUA 3DMTC 5I7FA 3A6DA 4DAOA 1G0OA 5J5VA 1GA1A 3RVQA 4L8LA 1PNOA 3QUTA 3MIZA 5FBQB 2Q3LA 5I7UA 3K1TA 1ORDA 3AVPA 1P31A 1Q2XA 3ZGNA 1KZ1A 4MUNA 2OPHA 1PNLA 1JEYB 1P29A 5K8UA 1FTSA 5ITWA 1GO2A 4ZTZB 4ZEOA 1UZUA 3PVSA 4YJ2B 1O0CA 4UUQA 1HR0O 1FQOA 4MRMB 1NJ1A 3IAFA 1T1JA 3DZFA 1WP7A 2ZI4A 4CI9A 3E23A 4QELA 1CZNA 1MJGM 2HA0A 1II9A 2SCUB 2CJWA 4NWOB 2IEYA 4X93A 3LPLA 3AF2A 1Z15A 3T5BA 1Z2AA 2P6MA 5GOZA 4KI0A 1WCYA 4KR3A 2GSDA 1U5AA 1XTRA 3PC8C 4V2IA 4M9CA 4M21A 3NKLA 4JY7A 3G5MA 4R3UC 4ZOLA 1QE5A 3H1TA 3M49A 3NHUA 1H2MA 5EE5B 4KYIB 3IX7A 1Y8QB 3TI9A 1PGOA 3W04A 1IEWA 4K6MA 2Z5GA 2OHIA 5GGYA 1F3LA 4TLMB 5K3OA 4FB4A 1FFWA 1NYLA 4FR2A 3KQPA 3Q0IA 1GLNA 3BH0A 5DLDA 1IOVA 1TT5B 4QARA 1C2TA 3TD6A 1AP6A 5K2MA 2VJNA 3D4OA 3H1EA 1RM4A 4NK4A 4X60A 3TXQA 3WGIA 1DX9A 1IB0A 4JVNA 2BZ1A 3QE0A 3AT1A 1BYUA 3WA7A 3NFRA 1DX4A 2IY8A 4BMSA 1IIBA 5IZ4A 1PWHA 2IQIA 4N21A 3CO0S 4FWTA 1THZA 1M8KA 2WA1A 1KGSA 4EFLA 5IYBO 2YY5A 4QSMA 3KKNA 2Z8ZA 4TMVA 4LJ9A 1EIWA 3ZTYA 3DTUB 5GGXA 1HEUA 3DAGA 3VNRA 2H1SA 1CRZA 3IOMA 4LPSA 3DHNA 2EARA 4MTCA 5CB4A 2IELA 3JZAA 1EQUA 1GIAA 3B7WA 5IEBA 4BP3A 4OI0A 2Q4OA 4HADA 4QPJC 1U99A 3CJQA 4MKZA 2JAPA 3B1VA 5KNDA 2AZMA 2C3MA 3X1ZA 1SCQA 2SBTA 3AUSA 4Q7LA 4RHXA 1EZVH 4JITA 3UMJA 2BFDA 5C1OA 2PXXA 3AEKA 1VCMA 4AI6A 4X66B 2P6UA 1UJCA 4RVNA 2RG1A 2EILC 2XCQA 2XE8A 3H86A 3HY6A 3AK3A 5F5XA 5LQDA 2KSQA 4D26A 1FFTB 2AEEA 1FLVA 3NHAA 1EFPA 3PCXA 4DLSA 4JHLA 1MHPA 3TB6A 1FSSA 4ND8B 1IWPB 1NMQA 3EULA 4CS3A 2CWWA 4CQMA 4MYUA 1PUIA 3FCYA 5F2VO 2Q4RA 4LRWA 3E3MA 3QPWA 2AHRA 3I9JA 4TYWA 2A30A 3NTVA 1FKAO 4PHCA 1SXJC 1K7EB 3D8SA 3IT1A 4HS9A 2OK8A 1G8GA 2ATIA 4BV8A 5DW0A 4XWWA 4KGXA 4LQLA 1GYRA 2FEAA 1D2EA 4B2YA 1Y4ZA 4KFCA 4LF6O 1FDTA 1E6UA 1S02A 3Q4HA 10MHA 1PFWA 1VL6A 1DMSA 3TFOA 4QQFA 1G1AA 2XMQA 3DTVB 1ACJA 3OPQA 2DQSA 4Q16A 4YV1A 5HILA 4C06A 3QUBA 3IODA 1PUXA 2BSAA 5F9FA 4K8RB 1T1EA 5IUKC 3KOUA 3CEMA 3FFBA 3DXRA 3GA7A 4BBJA 4ZRNA 3DPIA 5D1NA 4DSAA 4FZ5A 2A92A 4HLQB 3OGCC 4ZKDA 1LB1B 3I9OA 4GYYA 4PPYA 3IP9A 5KNCD 3QU5A 4I9HA 1YZQA 1K8QA 3OU7A 4RZIA 4UM5A 3SMVA 4YWJA 2FGJA 5BSVA 2JGRA 2Y92A 3T34A 2HPZA 5AVJA 1A9ZA 5JNRA 3TNYA 1GUDA 1EUDB 1W5AA 1R0YA 1UM8A 5JATA 1DRVA 3THSA 1VIYA 4BZZA 3VVBA 4ROTA 1PTJA 3U44A 2ZYVX 2DWDC 3FCSB 1EG2A 5CD9A 3MFYA 1PK7A 4D9EA 1CLIA 3AFOA 5EXXA 4AK9A 3IYLW 4LHVA 4HNSA 2ZXEA 2BV3A 1B15A 2VP5A 2Z2KA 4MKRA 3AGPA 4W5OA 2UDPA 3LUFA 2WUDA 3ZHQA 1JQAA 5FLXN 1EJ6A 4N3NA 3AVQA 2QENA 5FQOA 4E07A 1EQ2A 2Y1DA 1TEHA 5CCXA 2A9HA 1K68A 4AURA 5EYPA 2FWMX 4OJTA 2PRZA 4R5HA 3KDPA 4JI3B 2NVBA 4XRRA 3ZU6A 4BRZA 2I9PA 1E61A 2NXWA 3F1KA 1E32A 3Q6IA 3OTQA 1MV5A 3FTNA 5CG2A 3C6MA 3WG9A 2HB6A 3E15A 1SQXH 3FPBA 4YUXA 2LGJA 2FETA 2ISSD 1QHHA 1VRCA 1JRLA 3K5PA 4O8ZA 2FWNA 5I5EA 2RC5A 1PEYA 2Q9LA 5J47A 4QPZA 1F5NA 2C0PA 5IBCA 4E3ZA 3UMMA 2L6LA 4D74A 4C87A 4IDEA 3NWJA 5EXPA 2AC4A 4EQ6A 3OZGA 4F8EA 5JMWA 5DNYB 3GLUA 3ZHXA 3Q8LA 2JEUA 2YOFA 4Q3BA 4KK4A 4LWQA 2B8TA 3M82A 1EK1A 3FB6C 1M2VB 2Z6QA 2WOJA 1WWKA 4TMXA 1U3WA 3M34A 2HJDA 1DIAA 5BT8A 4GEKA 4MPDA 2ZXFA 1ZA1A 2O2ZA 4IYJA 4Q47A 4OXYA 1WDWB 2V7EA 3GGSA 3CZQA 1JEYA 1TJ4A 4UAJA 3BIXA 2ZIVB 1K97A 3L0OA 2FXIA 3M9WA 1T3TA 2N48A 2ZANA 3BT7A 1N9KA 1RAEA 3C9SA 4OXNA 5AJHA 3I05A 2DH5A 3I9MA 5IJ0B 2FJ0A 2IP1A 1EM6A 1KDYA 3CRRA 3FTDA 3ESBA 3P9NA 3FLEA 1EFDN 2J9YB 2Q6VA 5KDDA 4URFA 5KYXB 1CJVC 2XH8A 2SCUA 4D4IA 3KETA 1QIKA 3VZBA 3NBQA 4IKEA 5I3CA 4B4OA 2R4QA 1G9SA 4DV7B 5E6SB 2GNPA 2NXNA 1P74A 4FLYA 1I4OA 1V16A 3I9FA 1CF9A 4JROA 1LBEA 2P2NA 1VQ5F 2P79A 1P60A 1M8JA 1Y8QA 1IXMA 3CKLA 1M33A 3QW2A 3L8GA 3ZU4A 4DUGD 5KYGA 1MJNA 2M7WA 5ITVA 1DG3A 1PJ4A 3B40A 1OLXB 1VBFA 3TD5A 3WP0A 3S6JA 4M87A 1DXHA 4QM7A 2XVXA 4JJEA 2P9ZA 4UVDA 1CQIB 1P2GA 1F14A 2ZSBA 5F4BA 3GFQA 4DMCA 1KO1A 4X6LA 1JFVA 5LL6Y 1JT9A 4J0GA 2R3SA 5GVSA 4FC7A 1GM9A 3SJZA 3VR3A 4MGKR 4Y1FA 3W4IA 3N9IA 3I6IA 4ZTBA 3FIUA 5FFNA 5AVUA 3DMRA 4ZQBA 5JCOC 2FY8A 3PUKA 4Y6SA 1W2BU 2Q3DA 1Z7BA 2G7ZA 3UO2A 3B6IA 3BM5A 3ZP4A 2IRWA 5F7XA 4TMWA 4FLFA 2Z5LA 3AKCA 3AFNA 2IYOA 2VKQA 1AI4A 2VZ8A 1XTUA 3QUQA 3SD7A 3MHHC 2ZM6B 1G9TA 3MHSC 2XAGA 3T95A 3ZJYA 3WKEA 2FF5A 2VYCA 4TTSA 1GCOA 1K33A 4CQNA 3OCUA 2YXHA 2QKSA 5LNK6 4DA4A 1U5CA 4BVJA 4TV9B 4S2EA 1T9CA 2QGNA 4O33A 2P62A 3NHWA 3T12A 1PD3A 4E2FA 4J0QA 4ND8A 1YZVA 1VIDA 1KYTA 5CBGA 3RSFA 3R0VA 5HMMA 5HTKA 2DM6A 1RLOA 3OECA 3TMAA 1DDGA 2H4FA 2VRBA 2Y66A 3UBMA 4I1IA 3ZXYA 1VQ1A 4I99A 3UMGA 2ES4A 5DK4A 4PO1A 1YJXA 2PYDA 3HCAA 2EIXA 1Z8NA 1HDIA 5CDSA 4B5CA 3NWPA 5G4UC 3GIDA 1P17A 4BFCA 2AFIB 2ZRDA 5IN5A 3ROQA 3TZQA 5TVKA 5BVGA 5L3EA 3DTVA 1PM9A 3WHKA 1H1TA 3FPKA 3ZIUA 1S72F 4MRAA 4I4LA 2FFHA 4WY8A 4R2MA 2NZ8A 2Y69B 4HUTA 2X7HA 2AD1A 5IP5A 1SCBA 4JEIA 5A4IS 3JQPA 4U6QA 5IM4F 2QTPA 1KI8A 4KIGA 3FHTA 3LNNA 1F2VA 2R6R1 1MEJA 1E1RA 2A4MA 4EL5A 1QPBA 4J76A 5L6MB 4G9EA 1L6RA 5L3CA 5AHKA 3FKQA 3HVJA 2WJ3A 3PK0A 3DT8A 4BKUA 3VR6A 2OCLA 4PLVA 1XE3A 3NKFA 1JJVA 4FU0A 3DGFC 2H51A 1QXSA 3DAHA 4JV5B 4ZZ1A 2A5YB 1XV5A 1MZPA 5H68A 2HDHA 3NBYC 2HNBA 3DW3X 4IVPA 1P1KA 2G82A 4WDQA 3GF4A 4DQKA 4DNOA 2ZIOA 1ZUQA 4GM0A 1Y4SA 4X8LA 2HA5A 2MINA 2ZBUA 3EORA 3HHPA 1DGQA 4R0MA 1N78A 2ZRQA 5C34B 2D2IA 1AQUA 1YUNA 3E3AA 4AAYA 3R3ZA 2JBAB 1I2AA 2OFFA 3U80A 3Q15C 4ZVLA 2B35A 1GZ4A 2I6GA 2HJ9A 3B5JA 3KFXA 4L8JA 3CLVA 3CLKA 3R24A 4DXHA 4YJ3B 2JFZA 4EFBA 2QJTA 4QRDA 3F6SA 1FXWF 4FHDA 2FOXA 5CPBA 3OZIA 1GCUA 1DEHA 1XI2A 3SMQA 4FJ2A 4YI5A 3CMEF 1TGOA 1BGVA 1QGYA 2C97A 3PCTA 3WLIA 3ROGA 4UC0A 3LKDA 2PH7A 3A1DA 2O0MA 5EQJB 2C5EA 1RQGA 3TG8A 1Z4KA 2ZG6A 3F7VC 1LZKA 4QEDA 2KG7B 1HDJA 3P2JA 1JPJA 2JFBA 2IYFA 4OHRA 3PZBA 4UBNA 1PW7A 2YNMD 3KR2A 1MB0A 5JEDA 3HADA 4DYDA 3JQFC 2Z3WA 4Q1EA 3SC3A 4BAYA 5CA3A 2RHDA 3UT6A 2OCDA 4RY2A 1M2VA 1NDUA 2HF2A 2A0UA 2I3DA 5EZQA 3N59A 1T3ZA 1QHEA 2NN3C 4KAAA 4P2BA 4IUCS 3SDBA 5KWEA 4NNPA 1QB8A 1XZNA 3U9SA 1JLSA 1MRNA 3S03A 1F23A 4FYMA 3D4LA 3ITKA 3ZYCA 2P8JA 3TJMA 5I4KA 2FZ5A 2H6EA 3EVAA 4FINA 4KB5A 1THTA 3ZBTA 3CJHB 1D2NA 3ORRA 5B6PA 1PJ8A 1T6BY 5IHPA 3EAFA 2AXQA 3DMDA 4E33A 1PF7E 2IIBA 1OZHA 5KYXA 2XD4A 1UBFA 2QTFA 1CQPA 4I6JA 5HZHA 1EFAA 3EPLA 1U2DC 3U3ZA 3NRCA 4LWSB 3NHFA 3MD0A 2WHQA 3CN9A 4DR5B 1QPZA 1LQTA 4HXFB 3K0BA 3QSGA 3B85A 4XQCA 1JEQA 1V47A 2BF4A 3BDAA 4I7EA 2Q4EA 4OQMA 1RZRA 4FW8A 1RQ7A 3RARA 4YP5A 2P0AA 4OUDB 5F23A 1OCZB 3GFBA 3P0FA 4KXUA 2V6FA 2E0IA 4P4GA 4RNDB 2YI9A 1OLXA 4PELA 2JI7A 3GLFA 3OEEG 5KPJA 4P5DA 1GGFA 1Y7PA 2BGJA 3R2JA 4RMJA 1OBFO 2XV1A 1OI7A 4OBEA 3CS5A 5GV7A 2MSNA 1QORA 4FCVA 4XWOA 1J7KA 3EVFA 1ZQ1A 2XEDA 2Z9DA 2QA4V 4RU1A 2I6XA 1GTVA 4H15A 2GCEA 2RK4A 3RRJA 2FZEA 1WP8A 4MH0R 1PCXA 2IYWA 3PGA1 2X4DA 4RY8A 3W6PA 4EY5A 4L3VA 3PXCX 1W2GA 1VB5A 5IABA 1WHTB 3ZHZA 1F4PA 4C05A 5E6UA 1EN6A 3MJTA 4K9MA 5C5CA 1XZIA 4HLDA 3KWJA 1V48A 4WZBE 3ENNA 1IQPA 3OZVA 2UYYA 1ZGBA 3LDTA 4YACA 3I5XA 2K9PA 1AGRA 4F46A 2R8XA 3NO4A 1DWUA 1ZNXA 2BHNA 4YRTA 1FNSA 3EJWA 1GU1A 4TV9A 1ECLA 3IHLA 1NRXA 3VIUA 2WAOA 1R6NA 1UH5A 3LUAA 1D2GA 3KIPA 1MG5A 1M8PA 2X8AA 4JA2A 3ETLA 2E4XA 2YS8A 4G84A 4QPDA 3T4XA 1JPVA 3R3VA 4HLCA 4R7ZA 1KFJB 3QVJA 2GYWA 1Z0JA 5DYYA 2ZVQX 4G4VA 1KKLA 1NVFA 1K5SA 4FX2A 3M1XA 3ANTA 3F6PA 3HBAA 3A2KA 1LU9A 4K35A 4WLFA 3SBDA 1ISIA 1JG3A 1GPYA 3NOQA 3EFEA 1M6WA 1MPTA 1R8QA 1N3LA 2H06A 1R15A 5HHTA 1NTOA 1PK9A 1MNQA 2G07A 3KRTA 3U11A 3ZDDA 1KPIA 5TS2A 4IKPA 3H2HA 2CBZA 3Q7SA 5FPPA 3WIVA 1UJNA 1XIVA 2X0IA 1M2JA 4Q0MA 2AOXA 2BRUA 3PPXA 4WZAE 1A8PA 5TMDA 1VQOV 3ABQB 4UEJA 4INAA 2R7MA 3NDBB 3THWB 5EIXA 4CCSA 4BUCA 4R7TA 1Z5GA 2H8CA 4DCSA 3F6RA 3WHIA 1ES9A 2W4IA 2Q7XA 1Y6GA 1MP0A 5CEEA 1VFPA 4QUHA 4Z7OB 1OREA 2HHHB 2DFVA 1JSXA 3JWGA 3DUFB 3BGOS 4C4RA 4UHHA 4IRUB 3S7ZA 3FWPA 4I5FA 1CR1A 4RVDA 4BLPA 3REQA 5HZKA 3H9CA 1KZGB 4F4JA 4HNHA 2VUUA 5AVQA 3ABTA 4IOMA 4RFSB 4C4AA 1D07A 1M1XB 2FFRA 4NZMA 2DSNA 3HCRA 2WP8J 4YAJA 1SAYA 1RKBA 1DRUA 2BE3A 4J1SA 4QGFA 5JLJA 1LW7A 2XQVA 5HRAA 3DONA 4LV6A 1WPRA 2VZEA 4N40A 5EIBD 2F62A 1YDMA 5JXHA 3R4CA 3WADA 4TTAA 1A4UA 2PGJA 2O5EA 4GBJA 2MU1A 4LXGA 3QIAA 4Z1MA 3DXZA 1YJ9F 1ABEA 1MO5A 1UFKA 4G3XA 3CVXA 1KI6A 5LDGA 2A94A 3NIBA 3CGWA 4LUCA 1KYQA 2F9ZC 1FXKB 4ZAZA 2C31A 2NIPA 4EY8A 4D8TA 1N34O 5CLQA 1AGXA 1O54A 4DV0B 1IZ9A 4U39A 3GNSA 4R0NA 3JQDA 4EO4A 4L4RA 1EFCA 3ZWOA 4A5OA 3QQPA 3EEYA 4C30A 3K9QO 2RHCA 3LG2A 1U0GA 2OBMA 5AKYA 2KG7A 3S44A 1H42A 1QLWA 5JXJA 4DCPA 1H8ED 4QDOA 2FPIB 3OMWA 4RZUA 3WLMA 2JPDA 2HLDA 3FHLA 5DMXA 4N8EA 1F3OA 4BNZA 2BE9A 3PNQA 2CXOA 2AVDA 4JOSA 2JA1A 3KB1A 3K53A 5BT9A 5FR2A 2ZQMA 4CIWA 1YOVA 2WSSD 1CG6A 3GWGA 1UK7A 1WMDA 3AUYA 4G0XA 3MGKA 4UE3S 1YZKA 5EP1A 3D01A 1PKXA 2OKCA 1XTSA 1BHJA 2PZBA 3NAQA 2ZS9A 3DWIA 4A2QA 1L3IA 2YWCA 3I6QA 2J7KA 4KMOA 3QRWA 4IJWA 1AX9A 2UYJA 3ABLB 3APQA 2PBRA 1YI2F 3O4HA 3S1LA 5ICCA 2AVNA 3CW8X 2W6JA 3WGGA 4IOLA 4H77A 4REMA 4IHAA 2HBZA 1K73W 3SX4A 2HGSA 1E5QA 3WFIA 4CR6A 5KYNA 2CXSA 2QPOA 2PX2A 1EUCB 1KSHA 5HKKA 1IOWA 2WYWA 4MAFA 3UJNA 3K08A 1K4YA 1KQSU 3OEYA 1Q21A 1LI7A 3PX3A 3K2EA 1OWMA 1GL9B 4PTYA 3UO3A 3DW1X 4XWKA 2YBDA 3EEOA 4OQQA 1RWWA 3PI7A 1ZJ5A 2ONCA 4HP8A 5EAZA 5KVCA 1JAYA 4W6ZA 1MAUA 3V4VB 5J58A 3OQVA 2HBRA 2XRFA 1Y8CA 1ZVVA 2PZLA 3ZE1B 1BAPA 5TPZA 2GDSA 2W11A 4RF5A 1F2UB 2JHGA 5TC4A 1ZH2A 2FCRA 2A0KA 3M6XA 4G0OA 5BQXA 5F3DA 2FR1A 2ORED 5KREA 3NHPA 3GVIA 1I2BA 1DUVG 1LDYA 1KO4A 1MDFA 7ADHA 3A2FA 2FF7A 1ZOOA 2YY7A 4EJ2A 2OFOA 1J1UA 1M6YA 5KWIA 2MR5A 1KI7A 1C0IA 4EJ0A 4QLOA 5K3DA 1G1XB 2LQTA 1I4LD 2VQ3A 1GNVA 5I9TA 4Q05A 1UBCA 4BQEA 2FEWB 3F7MA 4OHOA 1OSNA 1X77A 1I6KA 5E3JA 4R2LA 3TCXB 3MWLA 3K06A 1WHTA 2BBWA 2WEKA 4WFBV 2FXVA 2OBBA 3RF7A 1HM5A 5DM0A 3LJKA 1XMQO 1KKCA 4FT2A 4JBXA 3N0VA 3LYHA 1GQ2A 3ZMSA 1MMMA 1N2OA 5KJFA 1KMIY 4V0SA 4XFKA 1YMVA 4CEHB 3EXG1 4RIGA 4JJKA 1AB3A 4GG1A 2QLJA 3ZK8A 4AJ4A 3N2GA 2X4IA 1ZUNB 3WYCA 1N6RA 3BIFA 4XVUA 2QUIA 4J4HA 4NARA 1KE2A 1CUUA 3N6VA 3GJRA 3P0JA 4DEVA 1VMAA 1Q8IA 3B1FA 3L8ZA 3DBHB 1WHSA 1QF6A 2Z98A 3FI9A 5KDOA 5B1HA 1VB3A 2H2AA 4YA6A 1I9GA 3BWBA 2UYKA 5AIBA 3FOWA 4WTOA 3MS4A 1Y9AA 3ZLBA 3N5KA 1ODFA 2P2GA 2QQ0A 2VHZA 2Q4TA 3IJEB 1KIAA 1E6WA 2Q46A 4IL5A 1GEGA 2X1MA 1ZGGA 3VC3A 2QI9F 1WEKA 2PRKA 2CCJA 3GDHA 4DV5B 2EBFX 3GUUA 2BKVA 3E84A 2NNLD 2HYDA 3RPEA 1SESA 5LNK1 4GPIB 1E6MA 3THWA 2RB4A 9LDBA 1F9EA 4Q37A 1JQ0A 1BXGB 1S2IA 3IXLA 5ESDA 1XUQA 5HJ5A 1HA3A 3P94A 4B6RA 5H8WA 2YCLA 3BY6A 4NK5A 1QV6A 3BCSA 5F51A 3QKIA 3DUFA 4LOJA 3W8EA 4RWEA 3IBSA 4H16A 1EYZA 5EMKA 3LQ2A 2B8WA 2PV7A 2I91A 3H13A 4IHKA 3W2EA 3QWBA 1V3UA 1O58A 4MW3A 4RFSA 1VG8A 3P9XA 2NO4A 4XXHA 3LHIA 4KVFA 2G71A 1YJ5A 4EKNB 1GGKA 2EIJB 5EMHA 1N8SA 1I8TA 3GMDA 2RGDA 1ONBA 3KUDA 4Y8VA 1PTJC 2SKCA 4LFBO 1XVAA 1XNQB 3OQMA 5I48A 2F1OA 3U7QB 1EEHA 4NY1A 5J2UB 2ET6A 2ZZNA 3FHOA 1QCEA 1BU5A 1GN6A 4RANA 4JYZA 1ZMRA 4XSHA 3ESYA 4US2R 1USVA 2XWBF 1S6YA 2K87A 2ECFA 4PLFA 1OI3A 4TL9A 4RS4A 1XXHA 3ZN0A 3KJXA 3WGLA 3A1CA 1UP6A 2FGYA 1Y7IA 4XDYA 5CT6A 4IRXA 1FXKA 4AU1A 2EKBA 1KK3A 1G4AE 1HDXA 3IUYA 2E76B 1T1RA 5HNKA 4KV7A 1XQ6A 3IRUA 2GTPA 2BWJA 5DYNA 1IDSA 3LBHA 2A0FA 3IEVA 4P34A 4KO3S 3F4KA 3BL5A 5ARCA 4BNDB 1C81A 1LVUA 4OPHA 3AM1A 5F7ZA 1OA1A 4DLPA 3G13A 4F3CA 5JRDS 4GL4A 1K4DC 4BPRA 2FPIA 3H05A 2GD2A 2BZGA 1HNWO 3B13B 3FPIA 4ZZ0A 4OTZA 2XNDG 2KPOA 5GONB 4IKOA 4OYLA 1DVRA 2PMFA 4U2KA 1NKDA 4ITRC 2JEOA 1XLVA 1QQCA 2C4KA 1AILA 5KYVA 4EB6A 5ALOA 2R7AA 1I94B 3TDKA 1WCIB 4M60A 3L6UA 3N0WA 1NQWA 2D1SA 4C8GA 4F84A 1L4KA 2V45A 3P2YA 2QBYA 1NXTA 2YYEA 2YWBA 5J4YA 4G4WA 1JBKA 1CQZA 1UXOA 4CT4B 3U40A 2CXHA 2AK3A 4Q1BA 2CTQA 4U7WA 1V7PC 4ZT7A 1NN5A 2HUPA 3L82B 2CYAA 1NZJA 3EWIA 3SHFA 3CJRA 1QIGA 4HSGA 1VIMA 4QYIB 1QVGU 1R6VA 1RHJA 4LJRA 1NOJA 2QQGA 2QSJA 3SDZA 1J20A 1XALA 2AIFA 1SQ0A 4YPVA 4Y7CA 2ZVJA 4IUYA 3T15A 5KQGA 4BNIA 4JUFA 1DTWA 5CM2Z 1EVEA 2UYPA 1Q82W 2ODAA 2JHFA 1MABG 4EAAA 1DBRA 1EUYA 1D2DA 3LUPA 4TQGA 2POQX 1S2LA 4HGYA 2WLNA 1OB2A 4YCDA 4IMRA 1XZFA 3K72B 1KDVA 4WFHA 1TRHA 1A9OA 4DDHA 4ZYLA 2HZBA 1G7RA 4FWIB 2L19A 2UZ3A 3K79A 3K6SB 4INJA 1JIQA 3KJKA 4C5CA 4TKVA 4URXR 5KX5A 2D2EA 5FOWA 5C52B 4GKJO 5AK4A 4YO7A 3OZBA 2PUJA 4XUGB 3EDQA 3RGWS 4TYYA 5BWNA 3DQPA 3PQFA 5EWRA 2PMKA 1UBNA 4OYYA 4XVHA 4LHEA 3GQBB 3HXKA 3LBIA 2VTEA 1RP3B 4B9AA 3C5HA 6CHYA 5CTAA 1UZMA 3VISA 4B81A 1J70A 4IGEA 4XQEA 1GVNB 1LDEA 3QKSB 2A3QA 2IW5A 1WKCA 1BRMA 1D4OA 1LV8A 3FYCA 2HWXA 1QGOA 3TGWA 4IZIA 3P71T 4RACA 3EJ6A 2Q49A 5EXEA 1T34A 5KYUA 4ZU6X 5ENVA 4G36A 3T3GA 5HX7A 4CEHA 1H7MA 1CE8B 4LYHA 4H18A 1DKOA 2QRVA 4GLOA 2GHTA 5LB2A 2SHKA 5FNZA 2ZRPA 3EF1A 1QJ4A 2PWAA 2DHCA 2B1IA 4LYYA 1C1DA 3FCCA 4M9QA 3HYLA 3QSYA 3HU3A 1H4QA 1UBGA 2E7ZA 4UPEA 4AO7A 1E96A 2H48A 1FMFA 3DBHA 4B3MB 2GVIA 4PGHA 3HJBA 2V7UA 6AT1A 1OU4A 2R1VB 3KEFA 4RD3A 1XMVA 2WW8A 4QJ3A 3QXSA 4K3AA 1FDVA 4UEOA 3UVEA 5JYDA 2PRYA 4WUVA 4D41A 4RJLA 4HX9A 1YO6A 3TE6A 3AR4A 3EPHA 3L7IA 3WLQA 3KOOA 5ALDA 3VZDA 2E49A 1Q0LA 1HE2A 3PG5A 4FDTA 4KMRA 4D44A 5K7SA 2KSDA 1ODIA 3FE2A 4DOMA 4X8MA 4JP5A 3AHGA 4IEEA 5HJ7A 5FF9A 4QJBA 1D2CA 4TUYA 1JALA 2B0JA 4OXXA 4F72A 4DIEA 1KQOA 1SD2A 1BXGA 3K0SA 1X1AA 1X1RA 1BOOA 4RQAA 5FV4A 5I7HA 2NT3A 4ZU1X 5LZ2A 3EVEA 3F3SA 2WA4A 3EDCA 4DARA 3RI3A 5AM3A 5TX7A 3C8DA 4LE2A 1KVUA 2XWSA 3BDIA 3C48A 4YDRA 1R10A 2DTEA 1AUXA 4DYHA 5I45A 4R8CA 4O2AF 3AERA 5LQCA 5B1AC 3V7QA 1BH2A 4M0MA 1IHYA 5J2TF 2A84A 1XT6A 3VNQA 5AHRA 1T0PA 5HEKA 4EVIA 4GYWA 5LLDA 3EGXA 2LNDA 4ZO4A 3RRFA 4PLZA 1KJIA 2I7CA 2PRIA 2O8EB 4F91B 2CE2X 4EEQA 4NCIA 2OZEA 3IP1A 4EW6A 1OFTA 1MJGA 1G17A 2IA5A 1V39A 4HOYA 3TETA 3ITDA 4FIPC 4CG1A 5GP1A 1PR1A 4ENUA 4GGOA 2YDEA 4PC2A 3HXQA 4A5UB 4PAOA 1O4WA 3A7EA 5EFZA 3BZUA 3ED1A 2OQRA 1TVKB 3G0GA 1KQNA 4CS2A 4DCMA 1R3IC 1EBBA 5HFNA 4FDLA 1FS4A 5ADVA 1W5BA 3FB7C 1OLSA 1DO8A 2GV9A 1UZLA 4KXVA 4L28A 4GSKA 4M0PA 3T3PB 2JFYA 3I5AA 4M1WA 2GAIA 1X7WB 3DEIA 3OY7A 4BMDA 2CWJA 4JYAB 3HG7A 2V7VA 2QUZA 1E4YA 5ER9A 4B73A 4BNDA 1Z35A 5LMCA 3NYWA 1M5TA 2JAXA 3GFSA 1T6XA 1CBUA 2XDAA 3Q3IA 4BX2A 2FSHA 4OBXA 2IX9A 5CCEA 4MVQA 1K0UA 5CBHA 2L18A 3UOAB 1NUUA 1L5KA 4LN1A 5GONA 4EENA 3LLMA 2O2XA 4G0MA 4PGMA 1UKVY 3VKUA 1NRWA 2FSPA 4IDFA 3H11B 4R05A 1WCIA 5LSAA 1J5EB 1Q15A 2A7QA 3CCQV 1F17A 2G5PA 3HE3A 2WSLA 3E9YA 1TF5A 1JN0A 3TPFA 4V0NA 2HSEA 2IYNA 1RLGA 1VL8A 4IWXA 3HVUA 3OPYI 1D03A 5IN4A 4BGVA 1BMFD 4PJ0Z 3F6EX 1M2EA 4UHCA 1P81A 2DFNA 5EB0A 4JI0O 5J3JA 1JZTA 5AW0A 2ZSHA 4XQ0A 5ERXA 1KGDA 3I6ZA 3HBNA 1LEHA 1U31A 3HCCA 4OL0A 3P32A 3B38A 3NATA 3KKOA 4C6TA 2BMFA 3S99A 1N5LA 2QTHA 2W58A 3I9NA 2CFRA 2HO4A 3V1UA 5BQ5A 4BRWA 2IV2X 2ZWAA 3T4DA 3CF0A 4TVKA 1R37A 4N8DA 5JEEA 3TQSA 4MGIR 4DQ0A 1D7AA 2G6TA 2VHQA 3KBOA 1RRCA 1YRAA 3BICA 2Q7GA 1JQEA 4MHOA 4MW7A 4CI0B 1MC4A 1AMNA 4UBLA 3TPZA 2EW1A 3F5SA 3RNLA 2BHRA 1PJ3A 4HQ6A 4BLTA 2P3OA 4JC0A 3TSCA 3HPLC 4MEJA 1H1LB 5FWYA 1M54A 1EI9A 1YJ8A 4D3XA 2HREA 5DO9A 1XAIA 3DWFA 1M34E 2HK8A 5GZ3A 4TTRA 3ZV6A 1L3BA 3AFIA 4S1VA 3UH1A 3RAEC 1ZSNA 4A26A 1CDEA 3LBYA 5EE1A 1D6JA 1NASA 4YQZA 4FP9A 4B5LA 1VPWA 3MXTA 1XQ8A 5CM9C 3TEJA 3KQVA 3MT0A 4HYYA 4ZQGA 4X1KA 3DZ8A 2YSUB 3MB5A 3R5JA 2IQQA 3L0IB 4HUJA 1VKOA 3D2LA 4BNWA 1R1MA 2EWWA 3A1EA 4BVFA 1TQ2A 4RTRA 1LKZA 4IEIA 4MV0A 1ZSYA 1Q1ZA 1QIDA 1M0EA 4L8VA 4JGSA 1XWWA 4UEQA 1U3VA 3WK8A 1SXGA 4Q7QA 2CNDA 2QZZA 1AKEA 2GA9A 3K2XA 4OEHA 1RIIA 1EBOA 4OHKA 1GPNA 1F38A 1AKTA 3WMRA 4LW8A 4RE5A 5CDYA 4F5EA 2R84A 3PT9A 2Q5QA 1AGNA 4YQFA 4JK3A 1VRVA 1OB5A 4AP9A 3AG3B 4OQEA 1VH8A 1MMFB 1RXVA 5JJLA 3I23A 3OCYA 1WTCA 1PP4A 5IUNC 4Z6KA 5BUQA 3WQBA 3EVDA 5CLHA 2WD9A 5HKBA 1A4RA 3AR8A 5CDHA 5G3ZA 1PW5A 5FI0B 2Z57A 3G2HA 1V11A 2VQ6A 3D4BA 2R1VA 4UCTA 1HSOA 4U7DA 1XDZA 3AEUB 3TQHA 3SQMA 3TLEA 4NTYA 4URVR 1D6MA 3L7MA 3MB8A 3TSWA 4GX5A 2HA3A 3OPXA 3H42B 1KNQA 4QODA 1C4WA 3P3NA 1E9DA 5CH3A 1T8TA 4IHJB 4YMTA 3VYTB 4WFIA 3B3FA 1L8XA 1GN2A 3OQBA 3RRXA 1KXJA 2Q3JA 1R8XA 3QFHA 5AICA 2BRUC 4JI6O 4TWJA 3D3IA 1OXVA 3VR2A 2FW6A 4HRAA 2PT5A 1YTLA 1XL0A 1JDUA 1BFDA 1VCIA 3V8VA 2OZKA 3QFSA 4MLZA 2PQ6A 3IVCA 3HVRA 1CERA 3MBOA 1V6AA 5FTKA 2A35A 1YB6A 5AI0A 3RIHA 4PIPA 8ATCA 2Y69C 5A5EA 3LWQC 3BZWA 1O6BA 2R11A 1ZJZA 3BJIC 3GCGA 4MR8B 1DBIA 1X25A 4MQEB 2E5LO 2X41A 5FBRB 4JBNA 2P40A 1Y9EA 1EP3B 2YZGA 4X88A 4HZUB 3UCFA 3W8FA 1XZBA 4Z9XA 4DGSA 5ALUA 3A27A 1SOVA 1PVDA 3TJRA 1FS5A 2AXPA 4P54A 4MOWA 1LSSA 2JGJA 2B69A 1QQ7A 2NZJA 1I01A 5I9MA 1PEDA 4NYJR 1QYIA 1KO8A 3ILSA 4LRYA 1VJTA 4ND5A 1DADA 1N7IA 2GXSA 3M7IA 5BRJA 2G1AA 2YWHA 4RIIA 2FCAA 3CXRA 2J4FA 3NVDA 3G1TA 3C4QA 4OSPA 1C3LA 4L73A 1I3CA 2Q3BA 5FXMA 3MA0A 1YF3A 2DLDA 3VR4D 4R1LA 3F2IA 4MYSA 2O1SA 1GGMA 2WQ6A 4GHWA 5E9JA 1KZ9A 2XQJA 1E59A 4TS9A 4CMCA 4DW8A 5BSHA 4P22A 1VQ6F 3R0QA 2AH5A 2J5RA 3LLUA 1SA0A 3U7FB 4S1OA 5GM1A 1XG5A 1X7WA 4CDRA 1QBZA 3TIGA 3HUUA 2IS1A 2WYVA 4EVRA 2JB9A 5IE9A 1O95D 2BOCC 1GJRA 4KQIA 3RD5A 4G0WA 5AP9A 4RQUA 5KHGA 4RAIA 4LVCA 4B7KA 4KXWA 1UPAA 2Z1UA 2IPLA 1HDEA 1GZDA 3P2EA 1Q0TA 1Q74A 4DR4B 4DA9A 4DMMA 1HX7A 3ETHA 3THXB 3QMWA 2GBCA 2YHBA 4HB2A 4NPAA 2OZPA 3HLYA 4IZ6A 3PFHA 2JGMA 1XTZA 2HMAA 4YJ2A 4OI2A 4W5RA 1ORIA 4MRMA 1Z0KA 1MG0A 3C3WA 5DHPA 3H11A 3Q7TA 3SFTA 3BXFA 1TJYA 4M8IA 2UXNA 3IVRA 1SVIA 4IR7A 1SURA 4FJCC 4Y9DA 1QVFU 4NZOA 3DAPA 4R2WA 4BQNA 4KQKA 3AV0B 3ZWCA 4O4HB 1D1PA 3BCHA 4OMDA 3VSDA 1YHNA 2IH3C 1JE0A 5I4IA 2BD0A 5HM6A 2VA9A 5TEVA 1T0AA 2YQZA 4CDGA 1NN1A 3AXSA 3DYVA 3BL8A 4RYLA 3AY7A 1ISJA 2FTKA 3V2UA 3E81A 1N32O 2IYXA 2C04A 2R6HA 3LKVA 3AVUA 2EP5A 3D7KA 1TT5A 3DEAA 1TJPB 4DQUA 3Q3JB 4D6TH 4FFPA 5JPCA 1XU7A 4D9NA 3H5IA 4BZWA 2J48A 1V8OA 3H1JH 3ZMUA 1A97A 4DCJA 1XA0A 4M0EA 2VHTA 2I2XB 3ZX5A 1YKFA 3OP4A 2H07A 1KOLA 4B4KA 4F93B 5BPHA 5A6SB 3JYCA 1E3IA 2H7VA 4W1RA 3U26A 5IDVA 1KIMA 2IS2A 3DMHA 1Y9ZA 4I14A 5L6LB 3RF6A 2K7ZA 1L6IA 5TNXA 3L1HA 5IAEA 2V9ZA 1ZI6A 2V5UA 3E2MA 3FWNA 4LCKA 2F3PA 4JGBA 1JLHA 1BMTA 1B8PA 3IEQA 2CVFA 1PT9A 5LP1A 4KQFA 1UF9A 2A4KA 4ETIA 4O4IF 3CKMA 1BJKA 3NI2A 3ZGXA 3HI4A 1KMCA 3IDQA 2VGNA 4X00A 5EINA 2YV4A 3CUYA 4TT8A 4YIPA 3IQDB 2I1WA 1FQWA 1RTKA 3L7JA 1DB3A 3OT4A 4OJMX 2YQ5A 4Q00A 5B53A 5DK6A 3BE4A 2NYUA 2WHYA 3KPUA 4QBKA 1Z2CA 3OJLA 3C6QA 3DL0A 1YBFA 1TC1A 4QJFB 3LPMA 3UK6A 4Z2YA 2I4LA 4MULA 4R81A 1MC8A 3CCMF 2JLZA 3N5CA 4P1ZA 4GGMX 4OQDA 4DV1O 1HQYE 3BHMA 3NGLA 1OCCC 5CDFE 1FQJA 2NU6B 3O8LA 4L0DA 4EX7A 1MC5A 4RTQA 3EIEA 4HDSB 1G21B 5HBRA 4XRGA 3FN4A 3LLVA 1FSPA 3Q2IA 3PJRA 2DYKA 2D5IA 4Q4DA 1T15A 4FKBA 2IU6A 3I58A 1GD1O 3JQAD 3L41A 3AEUA 3DKKA 3AR9A 3PLAE 4HDRB 1PNKA 4GC5A 1T5EA 4C21A 4KWIA 1FZQA 2QN8A 1KNKA 2E4AA 2AUMA 3GCZA 4NJEB 1ZN9A 1QR2A 3FCEA 1TCCA 4IHJA 4KSBA 5KS2A 1NX6A 5BRNA 1F0PA 1YXBA 4FLMA 3CRNA 3H01A 1NBMA 2QXUA 2W6CX 5D2CA 2VWGA 2IPNA 2WU1A 3BFKA 2HCTA 1NC1A 1HZZA 3Q40A 1I0LA 2BTQB 1OR8A 2FEKA 5DGXA 5IC4A 2ASVA 1EUDA 1WDMA 2XAQA 3IAM6 1VLZA 2G9UA 4OHCA 3F74A 5K5EA 3OWHA 3RVRA 2I78A 4NQ3A 2WJ6A 3RC8A 1SRRA 1JBQA 3ENWA 4DWOA 1JPXA 1EB8A 1J7HA 4BJ6A 1ZUD1 2V7TA 3SQDA 3OAAA 1OOEA 2J9ZB 4OY3A 5KTSA 1NT2B 3R09A 2QTOA 3WMXA 3A32A 3MWEB 3QI2A 3WRYA 2C4HA 3HSYA 4C4PA 2BZ0A 3F7NA 2W6QA 4K81B 1M7GA 1RM1C 4JT2A 3R0JA 1AR4A 3DEKA 3A3YA 2NR5A 3K1JA 5G41A 3TCKA 1VZ2A 4TL8A 3C15C 2NAPA 3A4VA 4OXIA 3P20A 5FPRA 2WWWA 5FYQA 2OAQ1 1POWA 5HCIA 3GWZA 3DO8A 4HBZA 2XODA 2CHGA 3ZRVA 3CVYA 3DFUA 3RTAA 2Z43A 2JFFA 1FYJA 3IIKA 3KE1A 5EMNA 1Z2NX 3IKTA 2HQ1A 2RAPA 2OV4A 5DBIA 1SN7A 3KKYA 2J8ZA 3I0ZA 2Z2XA 2ZWPA 4EM6A 1JH8A 5BR7A 5DM1A 4M89A 3T1NA 4I55F 1FXKC 4DBVO 2WNHA 3EUAA 4PZLA 3LF1A 1T5SA 3K0KA 2ODQA 3QXJA 3ILXA 4E5YA 5BYKA 1CJTC 2Q5IA 2ZTUA 2AYYA 4YB8A 3SU8A 1F0YA 2VUSA 1IBMB 4AP5A 4HNGA 3G0CA 1VGQA 5TQ0B 2RCVA 4MICA 3RRBA 4R5MA 2BTEA 1U97A 4CDNA 3AEYA 5E38A 3THXA 1NH2B 3LVBA 5KUMA 3WNCA 3ZZUA 2A0LA 3I9V1 1CY0A 2VNAA 1FUEA 4OL9A 3FX7A 3R3XA 2DXIA 2XMBA 3PGLA 5IJ0A 4FYIA 1MZFA 4LNUB 1NUSA 3CUEF 1GO1A 1YS2X 3M3PA 1UBRS 3OQPA 1DV1A 3JZMA 1JJ2F 1UJMA 3LWDA 1MNAA 3L92A 4FE3A 5KO2A 4DKXA 2ZCJA 4LFAB 1Z39A 3OM0A 5E6SA 3KXIA 1HBJA 3K59A 2Y77A 2EXXA 4NMHA 4RGBA 3DT6A 2XQKA 3RREA 4M9UA 2DGDA 4ON9A 1XDGA 3P9QA 2QLFA 5HFLA 5LMNB 3L8FA 2EFJA 1R5BA 5HFAA 3ABLC 1XEWY 4ZV9A 3CO5A 1Q86W 5CJ2A 5JWHA 5JJ5A 4ERXA 4GS5A 2QRKA 5FA5A 1KEKA 2XJ4A 3BXPA 1J0EA 2QROA 4X65O 5KKNB 3TLAA 2G6BA 4IG4A 2GJAA 3FYUB 2J7PD 4B75A 5AUPB 3PF8A 2H6LA 4CGZA 1P8AA 5JQGF 4WNAB 4W7IA 1GUAA 3VV2A 3LCJA 1CQIA 1DC4A 3UWSA 3CCEF 1J49A 1KAMA 4ENPA 4EYEA 3OJFA 2XJ9A 2A2ZA 3U09A 4L0QA 4CL3A 4YCNA 1UBTS 3EY4A 3I28A 4I1OA 4EMSA 3BYQA 2ZIXB 1Q7YW 1AT1A 1X8LA 4M0DA 3OM1A 3L7DA 1KAOA 1ZKMA 4MUAA 5A6SA 3ODGA 2QTGA 3FKSA 1DE0A 2JAWA 4RD1A 1RWPA 3X0DA 4FW9A 3GJ7A 2VDKB 3TLJA 4XDZA 2QUJA 2NV6A 5TR9A 1NY6A 4CV1A 3BTOA 1EBFA 5KU7A 1OBVA 3VPAA 2H3EA 5E6RB 4B7XA 4MV1A 1R6DA 1QZZA 2HJGA 3QVOA 2WTNA 3DSRA 4TTTS 2R00A 1QGED 3J7AC 1XEQA 4W4KA 1CUFA 2ECOA 1OXTA 1B3QA 4YRAA 1XKLA 1Q6YA 2XHZA 4GP7A 2LIVA 4C43A 1LI4A 4RZSA 1Q81H 2EAUA 2WY2D 1KJ8A 2ZNIA 4R2HA 3AESB 1WXFA 2BMJA 1RLUA 1E3EA 2NLJC 4NMWA 2FMUA 3DBRB 2JEYA 5BV8A 2CZQA 4MVJG 2FKNA 2MIIA 1MO6A 4MPPA 2BGUA 5DT9A 3MCTA 1W19A 2JGKA 2HFJA 4EFDA 2WF8A 3OT5A 4RABA 4OXKA 5JWPA 1W9HA 4MPRA 2BAGA 2DPGA 4X0EA 3ESAA 2J3EA 3R76A 2NU6A 1USIA 3D9QX 3DR5A 1K8YB 1YCDA 1G21A 1E5VA 1XEAA 3PC7A 3E9RA 4MUJA 2VHEA 2WSIA 1WBJB 5G4KB 3FCAA 1SG0A 2F8SA 3P2OA 1GKFA 2AFIA 4RDXA 2CGNA 3DE7X 5HF8A 2YWEA 1JVNA 2JLRA 3ZEAA 3BXHA 3ROFA 1YT5A 3HRHA 2O4CA 4C9BA 4JXZA 1SUDA 4OQ4A 4WDRA 4HDRA 2GKSA 1K0FA 2B34A 3U4DA 2BT4A 1O1YA 2VNJA 4RJKA 2JIZG 5C1BA 4UVAA 1S0UA 4R9UC 3GA0A 1Y3HA 3NVAA 3O8BA 2WU4A 3KOMA 3RTDA 1GKUB 2CL0X 3LK6A 1BEEA 4EG8A 1N4DA 3FNRA 3OI7A 4S3MA 1IN7A 1OFUX 1AF4A 5FHQA 1BZKA 1W1UA 1HK7A 3PHCA 2Q8QA 1XJWA 4RHEA 2V74B 4O4JB 2Q1WA 2ZPTX 2R9IA 1TOAA 4RSGA 4MKXA 2RK3A 3MG9A 4Y2HA 2IEIA 4QJIA 4LZWA 4AJ1A 2D1QA 3GEPA 4CE6A 1W1IA 1YQ9A 4XA8A 1KZ7B 1Q0ZA 1NV8A 1V3TA 4MO2A 1HNXB 1E2IA 1T5HX 1RVV1 1DAMA 3KZXA 1B2RA 4AWBA 1FD9A 2QL5A 4TRRA 4YP0A 2FPOA 4OVKA 1MIHA 2WB2A 1NT2A 3C4VA 2ZRLA 2JBAA 2FW7A 3H0EA 3MWEA 2R8RA 5P8WA 2DVMA 3JPYA 3L01A 2P4SA 3HY4A 4MCAA 1R9JA 1QGDA 2Q21A 4YJ3A 4B2PA 4IFBA 2RONA 4L02A 2HBQA 1LUWA 2JFXA 2YWFA 4LTMA 1LJ8A 4PPQA 2ZR8A 2H7YA 3DQZA 4HBGA 5B1OA 1XVUA 5NULA 2VPZA 2ZQ5A 1EGHA 2YICA 1DT3A 3WGUA 2HX0A 3AHHA 2BGIA 1DHTA 2ZT7A 4ZI3A 2LV8A 1C4KA 2YVUA 3WISA 1NI3A 3P0ZA 4WSOA 3LWNA 2HLPA 3BIOA 2QWRB 4MR7B 5J1TB 2HC9A 4KFSA 4LJKA 4URWR 1O9BA 2V9PA 4HDAA 2XGSA 1W4AA 4HQ0A 3AO0B 1XK6A 4JXJA 2Q0QA 3ROEA 4I4TF 4DR3O 4MVYA 4J43A 2Y67A 1WU7A 5FNVB 1SZJG 3FJ1A 3SP1A 1E0KA 2FFJA 1L5VA 7YASA 1Y3AA 3IEMA 1DJOA 1R2QA 3LDUA 1U5BB 4J7UA 1GCGA 1JS1X 2A8YA 3TG2A 2QEXV 1JH9A 2WYUA 1NBOA 3GDFA 3ICQB 1FRFS 1MVLA 4DSOA 3QX3A 1LD3A 1V55B 2Q8VA 3CJHA 1ZPDA 1LTKA 5K1PA 2J31A 1WMFA 3LCUA 5J63A 4LBZA 2GHYA 4RYDA 1VMGA 2JAOA 1GTMA 5KVSA 2GBIA 2CKMA 4EKYA 4ZV4A 4JF3A 4ZT6A 1MPXA 3GV0A 2HMUA 1XQXA 3AILA 4MVWA 1J0CA 4R84A 2H4JA 3Q3EA 5BNIA 1VIVA 4FTWA 3PLNA 4LWSA 2XMRA 3WSTA 1ZMOA 3RSOA 2MJLA 3AINA 5THQA 2OT5A 3LXXA 5LD2B 1W52X 3NC4A 4CM9A 3NT4A 2GZ2A 2ZKIA 1POXA 4LJ6A 1EP1B 1R3JC 1JJFA 1AZLA 4S0ZA 1U96A 1RFLA 1YHZA 3L1JA 2OFWA 5H83A 2JRLA 4P7FA 4HFJA 3CYPB 1Y74B 1Z88A 3EIOA 1GTZA 4N82A 2ZJ4A 2H85A 1G4HA 4OUDA 2AK2A 3NDPA 2D4AA 2XKJE 3CPHA 3KB8A 1TYDE 2B1QA 1MR3F 3R5TA 4AUNA 3FYUA 2VJBA 3SHWA 2I29A 1O94A 3HTXA 2P69A 4YIOA 3TZLA 5BMVF 2VBGA 1I80A 1USUA 2XXAB 4UFZA 1P80A 1X7DA 4EG0A 3NALA 4E2WA 4MB0A 1BHAA 2ZUCA 3VPXA 2JDIG 3ZIAD 1KECA 3CU5A 1HMYA 2PLAA 2ZIXA 1M3SA 3AG4B 4PSCA 2I67A 3KEGA 1RHRA 2ZRHA 4Q3EA 4IXWA 3MMPA 2BTUA 4H0FA 3CCSV 3I2FA 3T3EA 5JSQA 2X15A 2NZYA 1MX5A 1QM5A 3DF9A 2AJDA 1QIEA 4GXQA 3V6MA 4YUZA 2PIDA 1OYYA 4W5HA 3GRZA 3S2ZA 1DO2A 4PLTA 2EBWA 4RVFA 3EF0A 1FJGO 2IY9A 3C5CA 2SICE 4FNGA 4GMHA 1HNZB 3B2EA 5FWDA 4UPVA 3TIVA 3OFVA 2G9NA 4UVCA 1H9CA 3ER6A 4JTCB 1KRHA 2BGWA 3LT2A 5ALMA 2FR0A 3NDRA 2Z1DA 3FFWA 2ATVA 4EVSA 3GLGE 1QVZA 4MJ3A 2CT8A 2BR5A 2LR0A 5KCMA 2OO7A 4BLRA 4L9AA 4CRWB 2YR0A 3EGIA 4ZCMA 3CNBA 1QONA 2VDMB 3BHJA 4JN6B 3FYTA 3CCJV 3DBRA 5JNLA 4HS4A 3N28A 1XRLA 2HLNA 2GNOA 1N5JA 3P26A 2OZBA 2X0LA 3HCWA 3G2PA 1HKUA 3ZGOA 2OLJA 2H52A 1JKIA 2XT9A 1NPYA 2RMKB 1ZGHA 3BJMA 3ABUA 1LBHA 5FBVB 4ZMBA 1Y82A 4AQ7A 4GZ6A 5K99A 3F2VA 2JK0A 4IIHA 1TLFA 4TWZA 4HDCA 2BH2A 4D2IA 2ONZA 2C54A 1RJWA 5DRYA 2WFMA 4R1PA 3KPYA 3QPVA 4ZOAA 4MV3A 3K14A 5ALTA 1UDRA 3W7AA 4CKEB 3HB4X 4LCJA 3LGXA 4I8XA 3DF7A 2ZPAA 1X0VA 1KEZA 2GCIA 3IKJA 5B58C 3K9LA 4B1FA 3CF4A 3RFTA 3ANLA 1OQAA 5B12A 3EE6A 3LWOC 1GX1A 4O4JA 1E2NA 3KSBC 3FB8C 2HU8A 4U2BA 2P68A 5J43A 4AKHA 1PZNA 3D54D 3CG0A 3ZNOA 2B83A 1GDDA 1KTVA 1CEZA 2C96A 1JDTA 9ABPA 2E85A 4CMBA 5AI4A 1NVKA 1DNPA 1G63A 1OA0A 3T8YA 4MVOA 1UMKA 1VQNV 1KHHA 2GGSA 3G9TA 1Q44A 4K26A 3CD6F 5JASA 4PC3A 5TGDA 1EWRA 2Y4NA 1YJWV 1Y4MA 3SQLA 1QCDA 5FR1A 2XUAA 1TE2A 2LZ0A 4MVJI 3K4HA 2C4VA 2G5TA 3PNBA 2X3FA 4MRSA 1R0RE 2ZU0C 1Z7WA 4PHZA 1XCLA 4YRPA 1O77A 4I3FA 1RU3A 3CC8A 2B61A 1ENVA 2YMMA 4R40B 3NTQA 3EIWA 4E70A 4YUWA 4GBMA 4DMUB 3ND9A 3OQ6A 1QVVA 3QE4A 1DG1G 1AOXA 1RS0A 1D8AA 5H59A 1YMQA 3IAM1 3GFGA 1YTFD 3LUGA 3X1YA 1F8UA 1VJGA 2PO7A 5IASA 2HS0A 3KT6A 8LDHA 1Y33E 2I4IA 5AHWA 3J81N 3T7EA 1UODA 4Z1VA 1XCOA 3QOYA 4K46A 2AIRA 3CMCO 3IP7A 1UXIA 1JEOA 3CN7A 5EJ4A 4H1HA 4MUKA 1KYYA 1I3LA 3NASA 1TUBB 1ID1A 3ZH9B 1GKYA 3ZZTA 4ADSG 5LBIA 2WRZA 5FNVA 3AHEA 4HSEA 4E09A 1W5EA 2HLHA 4S1NA 2BGNA 4UTVA 16PKA 4IFEA 1QR8A 1U5BA 1DRJA 2Y1KA 4IY1A 2HIHA 4PNPA 3EWNA 3VPSA 1TUEB 1NL3A 1YXMA 3PAFA 2ECKA 5AM1A 4AUKA 1JHUA 3AI7A 3KTDA 3A4TA 4E12A 1G7TA 4EQZA 4HXGA 1HY3A 2JHAA 4BQPA 4JBIA 2OV3A 4C08A 2AHOA 4DZRA 5GWXA 1EUCA 4GP9A 1JTEA 2O3QA 4CH5A 3M3HA 2PX4A 3FCXA 2QAJA 3AYZB 4QVGA 2WF7A 1S5LZ 4IIEA 4X95A 1E0JA 5LXTB 4F3NA 1Y74A 1LC0A 3GBVA 1D04A 4MDHA 3K8OE 1SPBS 3R0XA 4PZAA 2EV9A 4HQNA 4JJ6A 2O07A 1JEEA 4D5GA 2XWQA 5C3UA 2KQXA 3KELA 5CXSA 1NC3A 3F6MA 4OH7A 5MN5A 2QVGA 2XDWA 1OUMA 4XVQA 4BDSA 1F2UA 4JX9A 3NFYA 2FZLA 4Y9RA 3Q11A 2F3QA 2XXAA 3TW6A 4MRVA 1RI1A 3MWGA 1NQUA 4EWLA 4A82A 4R8VA 4L87A 4F5ZA 4K9OA 1Z18A 2I6SA 4KQGA 4J29A 3NTOA 1U8UA 3OKPA 1R9MA 4KUGA 2JH9A 3SC4A 1PU2A 4G2NA 3M4NA 4TT3G 5T7BA 4NU8X 4PYQA 3AP1A 4KACA 3WMEA 4IH4A 2YW2A 4ZV7A 2Y4TA 3LQ1A 4OU4A 1U94A 5LJLA 1QPGA 2P2ZA 4C3VA 4RF4A 1EUZA 3MVEA 5EVCA 5GPBA 1FFYA 3T1CA 2NSHA 5A0VA 4Y7DA 3N05A 2ZUWA 5ABPA 2CF6A 2I6RA 3RH0A 3EXFB 4QVIA 3HCPA 3QI7A 4FFMA 2H1OA 4NG4A 5TQJA 1KFCB 1LF0A 5LQKA 4DIBA 1K7DA 3AV3A 4MS3B 3TLYA 4AJJA 1ZUNA 4L51A 1NW3A 2AI3A 2IP2A 3SKYA 4HGOA 4L50A 4GI1A 1FDWA 4FMCF 4PFKA 5D8DA 4O59O 2R6CA 2QX7A 4QFDA 1BRTA 3K16A 1AQIA 2JJ1A 2WAAA 1YJQA 3IPCA 2QQFA 3ABSB 4YR7A 3B1YA 2N42A 3N0XA 2C5SA 2VHWA 3O3MB 5JY1A 4YJGB 3HK2A 4BO3A 2DH6A 4D9HA 3DV9A 3RAPR 4BFVA 4NTXA 1NWCA 1XQVA 3CZ9A 4J03A 5E8JA 2BEUB 4RF3A 1JL3A 3EIQA 5EEHA 2JJ2A 2RMKA 1PWXA 2PSEA 3ZZ0A 2ZVZA 1R4MB 4Y2YA 1Y6XA 1ESZA 1W59A 4BAZA 4O29A 4QDJA 3TNDA 4KIJA 5JAMA 5CCBA 1V71A 4YV0A 2FEMA 4IV8A 2JS7A 1KY2A 1UFOA 5AJZA 7MDHA 2ZYWX 2QVXX 2VQEO 2CFSA 1CKEA 3DMPA 1KERA 2B2NA 1PFVA 5C1IA 3W6ZA 1I7NA 1YCHA 3BMOB 3R9XB 4YV7A 3R3SA 3BFXA 5T3YA 2JFHA 2AHYA 3VYTC 2UZAA 1E7MA 4TS4A 4II7A 3IC9A 1DAIA 3W5HA 4Q7JB 4FR0A 2TMYA 5A4DA 4FONA 1WA8B 1EAMA 4LJ7A 1L5FA 1ZHHA 2VRCD 1GM7A 1IE3A 5HE9A 1SKAA 1IBSA 4XEUA 1HZZC 4DREA 3KR9A 4LXXA 3U2QA 2O20A 2WWIA 3LNMB 2VGMA 1W94A 3T61A 3PE6A 1X14A 3PL5A 2RJZA 1WU8A 2ZSEA 3D59A 3EZ2A 3OQHA 4B76A 1I3MA 1OF1A 3THOA 1GT6A 5CNIA 3U7QA 5J2UA 4FLWA 3S7TA 2UVDA 1Z07A 3VU3A 4M0FA 4XASA 4KQHA 3U3JA 3T5GA 1JJBA 4F2GA 4XDHA 3I9V6 4BVTA 5A7GA 1BS1A 1TO6A 3M6IA 3CLTC 3DVQX 4XYLA 4TSFD 2GN4A 1NR5A 2WTMA 3WRYC 3D6UA 1M2FA 2ZBEA 4WZBB 2AN9A 3U6BA 4JI4O 4XE5A 1TYAE 5FJJA 3FF1A 3V7UA 1G6OA 2CHVA 4DJTA 4TQDA 4G88A 3TSOA 3IMPA 4RHTA 3TZKA 2CNBA 1R3DA 1FXUA 4UVEA 4GM1A 1ECCA 4R1QA 4YCLA 4CWAA 2WJZB 3L0DA 3ZQUA 2GVZC 2W83A 3PN1A 2DQZA 2F6RA 1J09A 4TWAA 1SQBH 1Y37A 3CZMA 4R69A 2NPIA 2ZKLA 5I6DA 5LBUA 1YKSA 3B3JA 3IB6A 4Y2PA 2BCEA 4I66A 1MG1A 2ID7A 2QE7D 4ALMA 3GLHB 2QIOA 1CY4A 4NV1A 1HLPA 2WM3A 1Y89A 5DASA 3H97A 2GPYA 5LVAA 1YH3A 2Y6VA 1K6MA 3R7WB 2G28A 1RJFA 4KR9A 4J1QA 1QB7A 1OILA 4R8RA 3W5JA 3IDSA 3KJNA 1GRNA 2VF7A 1JQ3A 5JO0A 1NX9A 4B6OA 1MJFA 3UHJA 1Q0PA 4D45A 5JSHA 2D3TA 1C9YA 2O0JA 5EJGA 4WZAB 2HU5A 3BA9A 1KP2A 3Q85A 2B8EA 1IWBB 4JLAA 1T2EA 4WBNF 2JVKA 4LY9A 3JQ9A 4L15A 5CFPA 1EXMA 1TW3A 1E1QD 3K2BA 2XXJA 2W0SA 3HKCB 5HZGA 4CS4A 3BEHA 2ZYDA 1T2VA 4QYIA 3IGFA 1SQSA 4KKVA 3D4NA 4UQOA 3RC1A 1SJ9A 3WLLA 2FSFA 3A37A 3I04M 4KODA 5ARBA 2V3VA 4FOTA 3V6LA 2XW6A 3OE7D 4MIKA 4Z53A 1YU9A 4M9XA 2KX7A 5JZSA 3G9UA 1RLTA 2DWPA 1QHTA 1CTQA 4DANA 4QD3A 4F9EA 1NATA 1HTWA 4F5YA 3DD5A 4BGIA 3ROMA 4S04A 3C3EA 3K6SA 4C2UA 4ZVTA 3STXA 1GU7A 5J5AA 3NP9A 1PG0A 4PHFA 4B82A 2GPJA 3FAVB 3KEOA 2XYVA 4UMDA 3L05A 3M6MD 1CP3A 1L7AA 3W7XA 2MWMA 2EW8A 3UG6A 3FTEA 3GCXA 2PT6A 3NCTA 3GQBA 4F8JA 1QRDA 1X70A 3DVRX 3VR5H 4LY3A 4HV4A 1BE1A 1NVUQ 2UXCB 3RVPA 2I3AA 1IXRC 3QKSA 3B1JA 2VYNA 3IQGX 4G1MB 3OKCA 1AJPA 1CEEA 4JI1O 3I6MA 5CU7A 4P0PB 3B3QA 1YDEA 3GPBA 2ZOSA 2R00C 3EXFA 2I80A 4B80A 4Q01A 4W99A 1CE8A 1HRDA 4QNRA 5BW8A 2EBOA 4L3WA 3CMAV 4PYOA 4FHCA 2W6MA 1BHSA 3O4JA 1ONPA 4QBFA 3IPRA 3DG9A 1Y98A 3QVUA 1CN7A 4ZVOA 3E9NA 4Y0VA 3WDLA 3N6XA 1BQZA 2JGNA 4X63A 1VHWA 4B83A 4UV9A 4DQVA 5IULC 1X7YB 5JNWA 3WA6A 1KH1A 2C57A 2CV2A 3ADOA 1WSWA 5BO5A 2ONKA 3KHNA 5TLSA 4D7TA 3MTEA 1PZHA 5JVDB 1MQAA 3NZEA 3OLCX 5EZYB 2BEUA 2ZODA 4W6QA 1P0FA 5EC8A 1E7QA 2VPIA 3RVKA 2QVCA 2JLUA 4OYHA 1R4MA 5C4GB 1LS6A 3QKUA 4TS1A 1X6VA 1UC5B 4M8SA 1A3CA 4J9VA 2CUKA 1UEXC 2IH1C 3NRJA 5BW6B 1ZESA 1JJAA 3CLSC 1ZW1A 2NO5A 5CLIA 4NV3A 1CNFA 2ZVPX 1Q12A 2W48A 4C4WC 1BVRA 3AG6A 5DM70 5J59A 1RCFA 4AG5A 4GUDA 2RGYA 4MTXA 1NI5A 1ZUHA 1PLLA 2HW8A 1ZR2A 5B8FA 1WA8A 4OFWA 3H5OA 5I7SA 3ZJZA 3L8DA 3FPHA 1AI6A 2GKGA 4M54A 4BV2A 5TV2A 1WLSA 1PDOA 2E82A 1MC1A 1W87A 1ND5A 3R6DA 1MFZA 4EA7A 2BFPA 4PF1A 3LTNC 2P9EA 1YC5A 3BXXA 1WXDA 2NO6A 3LY7A 3GBSA 3K0AB 4ZREA 3SZMA 3K58A 3L49A 3L07A 2O8EA 3EY9A 4U8GA 3SYLA 1ZS9A 2X4GA 1NN3A 2Z4SA 1I3OA 3GJZA 5EMLA 1M90H 2IUYA 4GMFA 1WPXA 3H0KA 3QOWA 1VQMF 5KNLA 2P2YA 2F93B 2VT6A 5TT1A 3VQVA 2G1PA 4IDDA 2GBLA 4MCHA 4PQFA 3ROKA 1P2TA 1SCAA 3GAZA 3ZGYA 4AJEA 1TVKA 1UADA 4R0VA 1ZNWA 4WZBA 3KB2A 2ACWA 2JAUA 2W6IG 5AW6A 1Z7EA 3I1YA 2EZPA 3GVCA 4H59A 3GW8A 2PR2A 4EPWA 4KXNA 5IDXA 3BSWA 1DP4A 1P7GA 1DINA 2PQMA 1SQGA 4UOZA 3ITNA 1W6UA 3RSSA 4KP4A 3CRCA 2J9FB 4ZAYA 1H8HD 3IUNA 1XPRA 5L7YA 4YXWA 3ZR4B 1K1EA 2LCIA 4JB0A 1DAKA 4FI3F 1PJAA 2CLKB 4P38A 3LKBA 3W5SA 2QN9A 2QUHA 1L4YA 3DLTA 5DBGA 3GLHA 2CNKA 2HP3A 2CK3G 3E5HA 4MW4A 1TJ3A 4QZVA 1XTTA 5H6QA 3U49A 3ER8A 1JECA 4QOSA 3R7WA 5F3RA 4OV6B 1T35A 3GJQA 2G9QA 1XHEA 3H2JA 4FZ0A 1DFHA 1GR0A 4ZVKA 3M2PA 3OQIB 1M83A 1DZIA 3PQDA 1KQGA 3EODA 3ZQ6A 5KTPA 4MTGA 2W2XA 4ZVQA 4IIGA 2IOYA 4LYDA 4DR2O 4BIOA 1OX4B 4Q1VA 1ZRHA 3KUCA 1XMOB 3KKZA 1M8FA 4EGJA 4L8YA 1FFAA 2PZFA 2O7NA 5HRUA 2OZLB 1ND6A 4MQ6A 3U5ZB 2CEAA 3AR3A 3ICXA 2VP2A 1NJ5A 3T1TA 1FMCA 1OYOA 2VJPA 3HKCA 4KXRA 2OCCB 1UBEA 3AR7A 2VDNB 3ZP7A 1RAAA 2GEKA 2HIMA 5D85A 2ZBVA 1N8KA 5KSPA 3UMVA 2QMOA 4JC8A 4DY4A 3QP9A 2QA5A 2WIKA 4MUXA 1UOOA 3KLBA 3H19A 1H5UA 4H3HB 3SQOA 2CXUA 4OJYA 2OXEA 5KCZA 1G38A 3A2LA 3E8BA 5KJEA 4B0PA 1K8AW 1Q0RA 2RHGB 2ZTMA 3JXEA 4YJFB 2AFHE 5JDIA 1ZKDA 1YF2A 5IS2A 5JD4A 1NW5A 2REQB 1DQRA 4FLZA 2MMCA 4EELA 4DEXA 1OCZC 2ZYTX 2GAJA 1H1LA 5M3BA 5AOBA 2XZLA 3FYUC 3ZX6A 3ZG6A 1VFNA 3T35A 2GF9A 4C88A 1O94C 4PX3A 3FOAA 1P1JA 1GRJA 1BZYA 3FAVA 2OCAA 5KUTA 2NVOA 3VQXA 1QH9A 4GX1A 2O0HA 1TTPB 3FFQA 4F71A 4CIDA 4ND3A 3ZHCA 5K09A 1FFEA 2F55A 2OXFA 3L1KA 2RHTA 3KVVA 3NXSA 2E74B 4TMKA 4ZIRB 1ZO8A 4RMGA 4FYPA 4JVSB 2G7MC 3O95A 4HF7A 2E89A 4PONA 1J9EA 5CIWA 4CG2A 4LEIA 4J3JA 1BVYF 2HX1A 1U9YA 4LZOA 3IB3A 4BQRA 3RT9A 1N5RA 2XKBA 2X4LA 2AW5A 2OHXA 2G08A 3P2IA 3HN2A 1W29A 4UVIA 2LTAA 2X6QA 3P4XA 2FYTA 3WLEA 3D6HA 2FMIA 3MLAA 4Q7EA 1CR6A 4NDZA 3SN6A 3NEYA 5DF1A 3S0JA 4MVJH 3K5HA 4AMGA 4XYMA 4BNHA 1O7JA 2LRHA 5A0FA 5IH7A 2NM0A 2HRDA 3ABMB 4D3ZA 1ZXLA 3JWHA 2ZTVA 4QUDA 3CRZA 3W3AA 3KQSA 3OSUA 2EG5A 1L7EA 3IRVA 4DM3A 4V24A 1AHHA 3L8YA 4NNOA 4EEZA 3OY2A 3QELB 4OKSA 5I9IA 2OD7A 1I7SB 1X7YA 4HDOB 3IBYA 2GZAA 4HQOA 3IIEA 4RCZA 2AJLI 4XB1A 2YVLA 1VI2A 1M6NA 5L3VA 3E9MA 4UBIA 5EZYA 2CDNA 4OXQA 1RE1A 3AU9A 3X44A 1M67A 5F2KA 1KHTA 1SIUA 3R3WA 1H23A 3HAXD 3RQSA 2HF8A 3TZCA 1KJWA 3LH5A 4D57A 3K5LA 3L77A 4R50A 3NJRA 2WYIA 4Y2XA 4OP3A 4ZOBA 3UWDA 3VQWA 1JHXA 2FW0A 5DHRA 1IPEA 3E8XA 3C16C 3VHLB 3CMMA 4RFVA 3MC1A 3IUMA 3O03A 3L7YA 4ZZ2A 1ISPA 3LRXA 3AEQB 2H8EA 2L0XA 3VZQA 2ZB8A 5LOVF 4ZALA 4LMAA 1VM6A 5LQUA 1ZP6A 2A1TR 4LSWA 3CYFA 1XB2A 1NFRA 2IZ0A 2O2GA 3FBWA 4BKQA 1PF5A 1NQAO 1WMAA 4JMPA 1JT2A 1OV6A 3L9WA 4MR8A 2I99A 1KQ3A 3LC0A 4MQEA 4E11A 4R8LA 3PNLA 1Z4NA 5ALRA 1U7XA 3Q9SA 3R7SA 1QYVA 4JB3A 2PGGA 4HZUA 4AJLA 4D8VA 1J24A 3UMCA 4MWSA 2EW2A 1MTZA 1E64A 3I2HA 4WNIA 3ISTA 1YJBA 2F3TA 2DOKA 4LMRA 3M1IA 4C04A 1FP7A 3GLVA 1SKUA 3HY3A 3FTPA 2VAPA 3AF6A 1C7JA 1DDIA 4YCCA 1WB8A 4PX5A 1DCMA 2F3SA 3O4VA 4WESB 1OGYA 2GI4A 3HJHA 4ARAA 4INOA 2GK6A 3GYQA 4ASUD 3JQEA 1J6UA 1RHUA 2FDRA 4EPRA 1MO2A 5L3SB 3RSZA 4R6XA 4M3NA 4K0RA 4DLKA 1KDPA 3CCRF 3STLC 1E2UA 5JYBA 2XAJA 2E3CA 5UKDA 4JR0A 1R27A 1NVGA 4FZVA 3A0HZ 1LRKA 4M7WA 5FTNA 2NTYC 4ZJUA 4XI9A 4L8FA 3PX7A 1U3GA 4NE2A 4L0MA 4EPYA 3HTNA 2P1RA 3LS2A 2BM0A 5K51A 3AG5A 1KFBB 1UC9A 3I56F 5EJEA 2JVDA 1KJNA 3RO7A 3CWCA 1H0KA 1QIMA 4YRDA 1W0JA 4UU0A 4NZZA 5LZ8A 3S81A 4B35A 1UBOS 4DSUA 4EHKA 1YITV 2J3IA 4ZCPA 4HZIA 4W7HA 4UCUA 5HMLA 1COWA 4GF5A 3LY8A 1ZLXA 4LF9B 1DAEA 5EFOA 1B6QA 2J9XB 4AZ0B 3O1LA 1EP9A 3A4YA 4WLNA 1S77D 5B1IA 2XDQB 1XNGA 3ID6C 3OQIA 1OFHA 5TGZA 1XR3A 1TKAA 5I8PA 3LDEA 4Z8YA 3C8LA 5LKRA 1IG0A 2YFKA 1CZRA 4TPKA 1DRWA 1OX4A 2P9BA 3PEVA 3BJEA 4XYEA 3EZ9A 3HDVA 2ORVA 1RWXA 2LBWA 4Y0NA 4TV8F 3DE1X 3CXCF 3S2EA 1B3RA 4AULA 4QFCA 1W5FA 4V0QA 3STWA 2OZLA 3K12A 4O4HA 1S7CA 1N3BA 2PZJA 1WPBA 1V55C 2IHYA 3C1TA 4AROA 2JHPA 3LCVB 3T3MB 4MJXA 3WRVA 1ECFA 2L17A 2P1DA 4XLTA 5BP7A 1XMPA 3NUGA 1UBHS 4N5MA 2PK3A 4BATA 5DI3B 2W2VA 1FXVA 5FUVA 2C2HA 1U2ZA 3G6EV 3O7MA 3KYDB 1ZD3A 1XL4A 3SHTA 3VI6A 3C14C 1X9HA 2PUFA 5LD2C 5EIHA 2J5KA 5J23A 1P44A 3KSDO 3FFAA 3KHSA 1GILA 3JCUZ 2PGLA 3BVPA 1G41A 4WE3A 1WXWA 1GSOA 1SEPA 3F5DA 3DDOA 4LZZA 1EDOA 3WWPA 2A59A 2IGBA 1WZUA 2JFOA 1KSFX 4MI3A 2PMBA 5JZMA 1K4KA 2BMAA 2Q5ZA 5GINE 1LUAA 4MP6A 4N54A 1NVPD 4PA6A 3S2YA 5LWQA 1FVOA 1HDYA 4WOPA 3OFNG 3FAZA 2R70A 3BHNA 2YV3A 2PHZA 3G2JA 3QXHA 1WSAA 1EK2A 2AYXA 2H1VA 1L9KA 4PZ9A 1PGNA 1RBYA 3I64A 3HXTA 4ZIRA 1Z45A 3R7DA 1S5JA 2WLSA 5DVZA 4N01A 3H1IH 3MBKA 3TTTA 2OY0A 3RVSA 3B82A 1DIOB 4Y9TA 1TO1E 4D4KA 1WDLA 4PZPA 5CXQA 1QQAA 5AVKA 1CVRA 4AQDA 5KZMB 2WDPA 3CRQA 5AYVA 3TRHA 4LWPA 3HB0A 4WACA 5A3SA 3IVAA 1IN6A 3LZDA 1SD5A 3RS2A 2XASA 3WB0A 3WQRA 4FFRA 2BEVB 3C5WP 3A0RB 3EZXA 3BK7A 2N9UA 4TTQA 2ALEA 3ZJTA 3AOGA 1X9IA 4OA5A 1E2HA 1C5KA 4DR6B 5IBRA 1CR2A 4A92A 2NZXA 2JIBA 2AFRA 4ARIA 4HDSA 2W2QA 4JZGA 3ET5A 3TAHA 1NMEA 1BMQA 3OJEA 5DN6D 1WUIS 3TTYA 4CM5A 3MBIA 4GRIA 1YZGA 1ETHA 4P98A 2YEVB 5TARA 5A03A 2ZSUA 2W2NA 4Y2VA 5JECA 1ZVQA 4J6FA 2JK1A 3NVIB 1H3EA 2VATA 3CX3A 5GIPE 1G8HA 3COSA 1GTG1 1YS6A 1F1JA 1FRQA 3EIUA 3EXEB 3M6FA 4OHYA 1E60A 3HNRA 3AKDA 1E2PA 4ZD6A 4MYHA 3KWLA 4D3FA 2E87A 4NJEA 1WKBA 5IF3A 5ECGC 3DOOA 2CBGA 3IPAA 2P8SA 1A2KC 2V7GA 3F5TA 1WW3A 1PS8A 5DNEA 2PFKA 1JQKA 5AK0A 2QXYA 1HL3A 3VZPA 3AM5A 2IYZA 1N4CA 1LGYA 1Q2UA 3G79A 2GFIA 1K7FB 3L0SA 1MOQA 4JBYA 5LP6F 1J25A 5B1NA 3NRBA 1Z8HA 2B5OA 1TQ6A 2BTQA 4QAQA 3C9RA 3MERA 3SGIA 4G01B 1U7DA 1NNSA 3O8DA 4DTCA 3L4SO 2B1JA 3GLQA 1G8MA 4O2BF 3A7DA 4NZNA 1G60A 4YX9A 3IXMA 1V8FA 1OKKA 5KOHB 4KQXA 1L7MA 2WKRA 3FGPA 3D6TB 1M34B 3PTLA 5LZ5A 4JEUA 2D7CA 2LKDA 2PKWA 4M8KA 2XD9A 2C2BA 2VP4A 1BNCA 3PD1A 3OEHG 1XZKA 1KY4A 3CPQA 2I1QA 5EERA 2EIJC 3PUXA 1JFTA 3AL0C 3NEJA 5CNKA 3JU3A 5LYYA 1FK8A 4WLOA 3KL2A 4Y6QA 2GEDA 2FLVA 1JSRA 3A2MA 2ZUDA 3EG9B 3MF4A 2NSJA 1N36B 3OPVA 1CUWA 5I4BA 4UCSA 2W43A 4WESA 1WEHA 3RUPA 4BEJA 1NU8A 4JT9A 1Z37A 2Q9CA 3ZVMA 3OOJA 3WGHA 2GTIA 2JS5A 1YK1A 4LZJA 4ZO7A 2JJMA 4JH0A 5L3SA 2QN7A 2XOKG 4FJ1A 4IPTA 4K88A 4C5AA 1FFSA 1PL8A 3O2NA 4MJLA 3FNGA 5EGNA 3PNSA 2FV8A 4JJ4A 1N3YA 2J5BA 2FMHA 2J0VA 1F51E 2JIPA 3H84A 3COJA 1N0IA 3H5RA 2HRQA 1GAXA 2PWBA 2AQIA 5TQ0A 3KR1A 3SZRA 2HFEC 4XH9B 1ECGA 4ID9A 1I5YA 4K6OA 3CX5F 4LJSA 4W1QA 3KEQA 2CEKA 2XUDA 3KOYA 1SCKA 3TMKA 3H1GA 4X7BA 5E1OA 1FMTA 3V1NA 3K0DA 1IBLO 2JBHA 2QN6A 4AZ0A 4EB8A 1ZL2A 4KAFA 1Z2GA 2DKFA 3GX1A 4LNUA 4I50F 4CXMA 3QVKA 1ZK3A 3G4SV 3FNEA 2GYVA 4KFMA 4KX5A 2LCQA 1IZYA 3WGJA 3KJEA 2V0NA 1H2KA 5DTRA 1JYSA 2C5AA 2GZRA 3QENA 3PGMA 1ISHA 2QM7A 3M5WA 4WINA 1RPNA 3W5BA 3Q5EA 3E9EA 4QDUA 3M6UA 3QLUA 3JQ9C 4NU5A 1UMDB 2BLLA 1K9MW 2LUOA 4FIDA 1Y1SA 1EG7A 1XCJA 4BMYA 4UU7A 4EY7A 3G0OA 1NTRA 4X64B 1P9LA 4G0YA 2Q3EA 4LAFA 4NYIR 1ZWIC 4MVMA 1EU1A 1EVZA 4BIMA 5DI3A 2I3GA 3AETB 5B6IA 4ZAVA 4HY3A 4BZXA 5BYBA 3KYDA 4X89A 4WNAA 1G7CA 5EQTA 2ZAUA 4E14A 1GAJA 2WPDD 2ZYIA 5KNBH 2Y1GA 3EZLA 1VQLV 4YREA 1ISGA 4RGYA 3GEBA 4K2AA 5DCVA 2LWIA 3GEEA 2E37A 4I2VA 2O19A 3CGGA 3L2OB 4PVDA 3QNMA 3AF3A 2HJVA 1OTXA 1A9SA 5AVVA 1W2WB 4HDKB 1NFQA 5ETJA 2CMKA 1YAHA 5KVAA 4KGVA 2CSUA 4NH0A 2CLMB 4XJVA 2XTAA 1M2KA 3WC4A 2DJVA 4MYDA 2PZMA 2QXTA 2VXYA 1XJCA 2VWQA 5KB3A 4I46A 5E6RA 1M10A 2QJRA 3TZ6A 1WBBA 1YFLA 3NNSA 2A6PA 1OGIA 3D8HA 1PD1A 4R2IA 3U60B 1F8GA 3WG7B 4KQEA 5E95A 2FSUA 2VUIB 2CUNA 3WB1A 1FC0A 3WV5A 1RFGE 2C2YA 5NLLA 4QYSA 1W2HA 1U2QA 2KBEA 1JHAA 3OP1A 1UINA 3B5EA 4BBZA 4MZDA 1UK8A 3RK4A 3AESA 5E4JA 5F9MA 3RU3A 5BQFA 5D7NA 4UOQA 3QXCA 1RHQA 1UJ6A 2BEVA 3G6KA 4J0EA 1Q7BA 3TQRA 1NVVR 2JH3A 1NF8A 3IPYA 5EJ9A 1E3LA 3QBVA 2QVBA 4NIMA 2HCFA 4P5PA 4BW5A 5IWAO 4RFLA 1YRQA 2R2GA 4PXYA 3RVDA 2AJ8A 1C7IA 1KVQA 3KQYA 2DERA 4FMDF 3AF0A 1GQOA 1ZGCA 3P0HA 4PFJA 4L5BA 4HUQB 5G4KA 2WSSA 4FFNA 2YEVA 3PXUA 3S1AB 4J41A 2C3PA 2Y1EA 3RKSA 4NBLA 2PV0A 4HXEB 4XX1A 1DAGA 1NW7A 1UAAA 1LQUA 3TYXA 5DX1A 1PAUA 1S2NA 2WJHA 1ZL0A 1JI0A 8MHTA 4YY3B 5EP3A 4KO1S 3A3PA 4IEFB 4KBFA 3RS9A 1KXZA 4W1SA 4ZN6A 1Q0QA 1KU9A 1UKAA 4P9NA 2RGAA 1WSBA 3KQMA 3TBHA 3ER9A 1QD9A 1X8KA 3LCMA 3FLBA 4JLVA 5EPEA 1FMJA 2GAFA 2WUEA 2A5LA 5JD6A 3RAJA 4X6UA 1FX1A 2OHJA 1OH5A 2J5QA 4YHHB 4GICA 4ALLA 1N33B 1KYIA 4QA9A 1YHQV 4YMIA 5AG2A 2LXNA 3HO6A 1P7VA 4NPHA 2EQAA 2DSTA 4UNIA 5JSKA 1I3NA 2P6RA 4P3KA 2QL7A 1GN3A 4QNMA 5DTMA 2F43B 1CF4A 5FL7G 1GQRA 1G1MA 1P7ZA 5KOHA 3DB2A 5U4XA 3RASA 4X54A 4G5OA 3EUEA 1M34A 4PPFA 4HFNA 1D4ZA 1WY5A 3IT2A 5FX2A 4LQDA 4P3NA 4TQUS 4A36A 2X2FA 4G4GA 5BN3B 4XM1A