3HKBB

Tubulin: rb3 stathmin-like domain complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 132
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkbB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkbB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkbB01
5JQGA 4X1IA 3JAKA 4YJ3B 4X1KA 5LA6B 5IJ9B 2RHOA 3RYIB 4KWEA 3WGLA 3HKBA 3JARA 4TV9A 5LXTB 2XKBA 3ZIDA 5GONB 1OFUA 1JFFB 3N2GA 4O4IA 4X1YA 1SA0B 4TV8B 4YJ2A 3HKCB 5CA1A 1TVKA 5EZYB 4M8IA 3JALA 2RHJA 5EYPA 4DRXB 5ITZB 4F6RB 1W5FA 4LNUB 2Q1YA 3RB8A 3JASB 4X1KB 5LA6A 1RLUA 4O2AA 3UT5B 5CB4A 3VPAA 4B46A 4B45A 3WGJA 2Q1XA 5JVDB 4EB6A 5LYJA 5IYZB 1TUBA 5FNVA 2XKAA 4YJ3A 5LP6A 4I4TA 5J2TB 5JH7A 1RQ2A 3ZBQA 3HKDB 1W5BA 3RYIA 4F6RA 5EIBC 3HKBB 4FFBB 1JFFA 5C8YB 1W59A 4I55A 4ZHQA 1FSZA 1W5EA 1SA0A 4TV8A 5IJ0A 1RQ7A 4TUYB 4IIJB 1W581 5JVDA 2VAMA 1TVKB 4O4LA 3M8KA 3RYFA 5EYPB 5ITZA 2VAPA 3RYCB 3JAWB 4I50A 5EIBD 4O2BA 4I4TB 5J2TA 4O2AB 1Z5VA 4ZOLA 4X1IB 5BMVB 5KMGB 5M7EA 2R6R1 4O4JB 2VAWA 3JATA 2BTOA 3E22A 3N2GB 4ZI7A 5IYZA 2VXYA 3VOBA 4HNAB 5LP6B 4O4LB 5JQGB 1W5AA 5CA0A 3ZBPA 5MN4A 3R4VA 3JAKB 4O4HB 3N2KA 5MN6A 4O4JA 5J2UA 4EI8A 4X20A 1FFXA 4O4IB 4X1YB 4O2BB 3HKCA 3RYHB 5KX5B 4U3JB 5LOVB 3M89A 5IJ9A 5CA0B 4LNUA 5LP6C 3WGKA 3JASA 3N2KB 3WGNA 3E22B 5C8YA 4I55B 4ZHQB 4HNAA 5IJ0B 2GVIA 5FNVB 5MN5A 3V3TA 3HKEB 5JH7B 2R751 3RYFB 4WBNA 2BTQB 4DXDA 1TUBB 4E6EA 4FFBA 4O4HA 3CB2A 4U3JA 5LOVA 4ZOLB 5BMVA 3HKDA 4EI9A 5J2UB 5JCOA 4TUYA 1FFXB 3JARB 4TV9B 5LXTA 5LYJB 3C8LA 5JCOC 4IHJB 2RHLA 3JAWA 4I50B 4IIJA 3RYHA 5KX5A 4EI7A 2RHHA 5CA1B 5EZYA 2BTQA 3RYCA 4DRXA 3VO9A 5KMGA 3JATB 5GONA 3VO8A 3UT5A 5CB4B 3WGMA 3HKEA 4YJ2B 3VOAA 4X20B 4EB6B 4WBNB 4U39A 4IHJA 3JALB 4XCQA 4ZI7B 1Z5WA
chains in the Genus database with same CATH superfamily
3LBYA 3AI3A 3X2EA 2V97A 1PNMA 4JFAA 5BR1A 1JLLA 4ND4A 3K72B 1DO2A 4O4HF 4C6RA 3LNTA 1UXHA 4EARA 1Z82A 4BT3A 5FPOA 3O4IA 3GZNB 5FPRA 1T8WA 2XUOA 2XA2A 5I7SA 3T2MA 4OIMA 1ORQC 2I2BA 2B6NA 1H8EA 3AIOA 4MMZB 4XUEA 1SHUX 3ODGA 3WNQA 3AHHA 2Q29A 5CMUA 5EBWC 4R1PA 4ZO9A 2F9FA 2GZLA 3R7NA 4I99A 4ZYWA 1JQ5A 3I5DA 3GK3A 3MPUA 4MR8A 1NL3A 4Q7MB 2AJLI 2J46A 1W3EX 2FLKA 4MI9A 3CMMA 2VRCA 4CM1A 1F6BA 2DFKB 3RBZA 4PSVA 2RCVA 4K9SA 3NM6B 4L22A 4UOQA 1TIKA 5ESDA 4ZAYA 3TNDA 3BMXA 3EUFA 4P38A 1M5IA 3OFVA 4YUVA 3RUDA 3B6MA 2RONA 3K12A 3D1VA 1Z0ZA 2JGMA 4UVIA 5FBWB 5DV9A 9LDBA 3TGLA 5K8IA 3PGVA 4QASA 3BA6A 2ISCA 4M9RA 4TKVB 1DU4A 3E5HA 4JSYA 4QBGB 3RF6A 4I55A 2RHBA 3IB3A 3Q7QA 4BY9D 4K88A 4K6OA 1P49A 3C8UA 2YI9A 5H9CA 2E18A 1KVUA 1S6YA 3QITA 5BV2P 1XQ6A 3H9VA 4JAUA 2N9UA 4QC2A 3SIXA 3OT5A 4NZNA 1TU0A 3RS2A 1A96A 3E35A 3WYEA 2UZ3A 1MGPA 1T8PA 5FPHA 2X9LA 1KMMA 3BHJA 3R8FA 3T99A 5LD2B 3R3UA 4P1ZA 1II8A 4OQNA 1QG0A 4QAJA 4CR7A 5I7UA 4ZVNA 3O8NA 5KKCA 2MTBA 1YAJA 2YHUA 3G0OA 4XWAA 4BFUA 1ZIYA 1BE1A 2GK3A 5BXZA 2H2GA 1K5QA 1OGIA 2VHJA 1DZIA 2WSIA 2F4VB 2Y1OA 3FE2A 3H3XA 5T57A 4E1BA 1XOUA 3OT1A 3R3SA 1UK9A 1DAHA 2PHNA 2AG8A 1ZOIA 2QXUA 3C3JA 1P6XA 3KOUA 2QSYA 4NU8X 4U9IS 5DTRA 5E6UA 4C04A 4RBNA 3GLIB 4MS1B 1BO6A 1GNVA 4JI8O 2BJHA 1RPRA 2OV3A 4FYXA 2CXSA 3W5HA 5K0TA 2A06H 3KUCA 1XPUA 4TVBA 4PS0A 5I7AA 2AMLA 4ESEA 1GSHA 1KL7A 1K5HA 5KNDA 4V24A 1VSBA 2LJ2A 4U7JA 4M98A 4WK0B 2Y0IA 3U31A 1JEJA 4HWSA 5ILOA 1P4GA 1KRXA 5FFFA 4NZPA 2PSSA 2VO1A 3E8HA 1U7ZA 2HEIA 4DV6O 4A2QA 3LFHA 3U11A 2C1EA 2UUCO 4G24A 1R0LA 3ISVA 4UBKA 2RI6A 3K0FA 1SURA 1H2YA 1UBRS 1GLGA 1L5QA 1NQUA 2Y99A 3UUWA 1VIBA 4EGQA 1UDBA 1Q7YH 1IHYA 4E03A 5HS4A 3EPJA 3FDIA 4J16C 5E3HA 2FSUA 4ZK7A 2Q6KA 3D36C 3ZHUA 2Z1UA 3HBFA 1LDGA 4CT5A 5JMWA 1VJGA 4WLEA 4C3OB 4RQAA 2X42A 1EVZA 3JAWA 2CDNA 3EXHC 5AOAA 3WXMA 3C3XA 3MCZA 4RDXA 5KNDH 3CEJA 3FZYA 3TQOA 4CW7A 3Q7EA 4R84A 4E1AA 4CH3A 2EZUA 2JLCA 1Z16A 1VC2A 4IDHA 4WZBA 1KH2A 1NAHA 4Q3BA 4U7PB 4YIKA 4B7CA 1FAFA 1CQIB 1P2VA 4HZIA 4RZXA 5AHKA 3NO4A 4ALJA 1FU8A 2I7DA 3NEPX 4RK1A 4I0XB 2ICAA 4KBYA 1H48A 3SWWA 4LFCO 2C82A 4G8CA 1JQEA 5BN4A 4J7ZA 3W2GA 2AI3A 2QE7G 1X1QA 3T4DA 4X1IA 1Y7PA 2EQAA 2KM1A 2NO0A 1USGA 2VSQA 3CNNA 4O2RA 4PPGA 4ZD6A 3UCXA 5KQRA 3U7JA 2IOYA 4RYLA 3QVVA 1N2OA 1XLVA 6Q21A 1JKJB 1WIWA 4IDQA 3PB3A 1QQCA 5B1DA 4A91A 3MMNA 1WPBA 2ZBPA 4RFSB 4EY8A 4AG6A 4HCJA 4TXMA 1KAOA 5EZYB 3AX6A 3LCCA 2ZS8A 3PGXA 4G84A 4OAOA 1O6CA 3A4LA 1RLOA 4FMCF 3ROQA 4HQ6A 1MR3F 3HYCA 4WJKB 3CYOA 1M2EA 4D9GA 4EAQA 2L82A 1LV7A 1PLKA 4GKVA 2H7CA 1YS6A 4R6XA 3GNQA 4DK0A 1TTHA 2NSLA 3HO8A 1SG0A 3H5IA 2JARA 2XRFA 3A1VA 1G4UR 1VLQA 4AJOA 4UD6A 2WFLB 4J0IA 1L5HA 3ZI4A 4BNIA 4D80A 4EJ0A 3UYLA 5KQLA 4XTRA 2Z5FA 5EGSA 1NJ6A 2QRUA 1LI4A 2V3CC 3A31A 4HVAA 1VMKA 3MAJA 1FK8A 1QF9A 2IYEA 1KOJA 2RHCA 1OI4A 3NHMA 1TVKB 1TM1E 3N6RA 4PPFA 4H0FA 3VR5H 5H81A 1BN7A 3KWFA 2FZWA 2CVZA 2IUTA 3AQ4A 4QOGA 1E1KA 1BCSA 3JQFC 5CJJA 1JHVA 4FFNA 5HXZA 3V55A 1MGOA 1HNXB 2HVYD 1QB7A 3PA8A 2Q5OA 1KC1A 1WO8A 3SQMA 3SZGA 2AVDA 3T80A 3SCZA 1GP2A 3FF1A 4F56A 2Y92A 7ABPA 5I7EA 4KUEA 1Q81H 2AZXA 1GCUA 3HL4A 3VH4A 13PKA 3DTVB 4IQ0A 2VP5A 3F6PA 3G6WA 2DGDA 3F0GA 2PH3A 3IPAA 1QYXA 2YQZA 4GP6A 1K73W 2VP2A 1JQBA 4QQKA 3HY3A 3TEMA 5IM4F 2ACWA 4KE8A 4CLDA 2NTJA 3DFMA 4ADSG 1N2CE 3I6YA 4ZVTA 4H7EA 1PP9H 4BE9A 1B04A 3B8HA 3PEWA 1VDMA 4PA7A 3B89A 3BL6A 4MUJA 2BDTA 5JMOA 3IGAC 4QODA 1B42A 4R4JA 1YI2V 2EZPA 1NJIW 1DQRA 2AR9A 4HB2A 1BE0A 4NEGA 1XDCA 1GZ6A 1SQ5A 1TYEB 2NAPA 3AYXB 3MUEA 1RQXA 2MSNA 3OE7D 4KW7A 5EQJB 4YCLA 5F9FA 1S9HA 3VQXA 2QLJA 3OF2A 3DGEC 4UMEA 3D8NA 5FL7D 4ZTZB 4TZ6A 1GMGA 1K86A 4PO3X 2FP4A 5TQ0B 3SEZA 1CBUA 1O9GA 3WLQA 3KC2A 2ORYA 4BWGA 4FEGA 3R0IA 4BFLA 2C9DA 1DFHA 1DFIA 3UPTA 2HK8A 2C4VA 1DAGA 4DR6B 1U7TA 4MV7A 5AHWA 3RVKA 4RD1A 2H18A 5CVCA 2HHHB 1BHBA 3UMCA 3L74H 1GGHA 3A36A 5EJIA 3D3WA 2ZSAA 2CV2A 3WG9A 2XUAA 3IAS6 1ULAA 3NWBA 1W36B 4FR5A 4CNBA 3EEOA 3ZX4A 5TR9A 1T4CA 4CKEA 4KPYA 1Z68A 2NV2B 4U2GA 1QV7A 4JLVA 3Q11A 2QX8A 3WGOA 1OYWA 1PFYA 2H4ZA 2WLIB 2OC9A 2UVPA 3KOWA 3P94A 4PY2A 3KTAA 3GA5A 3HDJA 3M6FA 3ASOC 3CG4A 5JJKA 1M57C 3A4YA 1OI2A 1SUSA 4WECA 1NI8A 2KQUA 5AICA 2G0TA 5AIAA 1A9XA 4GGOA 2BTEA 1QH8A 4XCQA 4R40B 3PFHA 3CLTC 2WLSA 2GN2A 3PX2A 4KGXA 5EZYF 5K3SA 3IMFA 1RYDA 3BYZA 3ZK8A 4C0AC 3E83A 2HLDG 2W4QA 2HJWA 3GJ6A 2ZR3A 5IAGA 4U2DA 4HDQB 1SQVH 5BNFA 1Y7LA 4OH1A 4IUYA 4JI6O 4PXSA 4TTRA 1XTVA 2PYJA 1FS6A 4L0MA 4XEHA 3EX7C 1QIGA 2DHQA 2VUTA 4PI2A 2DPHA 4PNHA 1QDUA 2Y4TA 2O8VA 2NTEA 2QPAA 2VCEA 3DEFA 4P81A 1YRHA 1N3YA 3PKIA 1YRQA 3B8NA 3MUNA 3H1BA 3LHFA 3O47A 3I4LA 1V11A 4KL8S 2B20A 1IRXA 1UBLS 4LFAO 3I0MA 1CY4A 3ICCA 1SZDA 3R5TA 1ONOA 2ZOVA 1SETA 3A27A 4U4AA 3OGCC 1XJQA 5BY1A 1ZAUA 3IPRA 3IO3A 1TUBA 3ZS8C 1K8QA 4HJXA 4HSGA 4XPZA 1LBQA 3ZYCA 1TPYA 4QM7A 3T06B 1COWA 4B4OA 2A78A 3X1XA 4EKNB 2PCLA 5A0VA 3TL2A 2CCJA 5EC2C 3UXEA 2OHHA 4ATNA 4BVFA 3EF1A 1LBHA 1UPAA 4FKBA 3G4SV 2JIZD 1ODTC 2Q3EA 2X8LA 3H5NA 4BUZA 4QYSA 4Y0VA 2FEPA 3HCDA 2UZ4A 4B40A 2Z6VA 5LZ7A 4EG1A 3OBYA 1U0GA 3CVUA 3D7LA 4N4AA 4A27A 5F4BA 3KWMA 1BW9A 4WN9A 3ON5A 2EW1A 4EBFA 4NSNA 3BMQA 1FLAA 1M1NA 3N2NA 5KTSA 4MW3A 4Z99A 3LE8A 1V1MA 4H77A 2WJIA 3FFTA 1SVWA 1MO4A 4FLUA 5EUMA 1K63A 3OZEA 1ORVA 5F78A 2ZJOA 3DVLA 3B6NA 3R1IA 6ADHA 2AFHB 2XT9A 4DUGA 1BMTA 2CSUA 1KWKA 3I2IA 1PJRA 1NLZA 5FX2A 2X4DA 2JAXA 2P68A 3COSA 1Q92A 2PD3A 4IXDA 3DH0A 1SXJD 1VFNA 2YWEA 3EXEA 2QZ4A 4KQEA 4NE9A 4Q4JB 4UBLA 2L19A 3AKZA 4LP8A 2E21A 4G07A 1P77A 1QK3A 3OPXA 3NONA 1U94A 1DJOA 1NQWA 1IX9A 1K6MA 1PJAA 2OAP1 3IQWA 2VJMB 2PNJA 3O3MB 4MP8A 4RLFA 3LWVC 4DV7O 1PV1A 1VHDA 2V1UA 2GGSA 3Q3JB 3QXJA 1VP7A 4QPPA 5ALKA 2H51A 5CLJA 2ZDIA 1JZQA 2VF4X 1ULBA 1V54B 3GGJA 5K20A 2HH9A 4UPVA 1NKTA 1YZBA 1U4OA 4FK8A 3QTCA 2VEDA 1NKSA 3UG7A 3HYRA 3ZE6A 1ZCJA 3BCCH 1TQ6A 1MVOA 1VL1A 2AF3C 4RHTA 4UPDA 5CT5A 4EUFA 2V7GA 2WWYA 4YECA 3H2SA 4KN5A 4RW0A 1A9PA 1JRLA 3IUMA 3RFVA 3ABMC 4X65O 1KI1A 1P0QA 3JRXA 4AO8A 4BVHA 4MQLA 1FIUA 1WCXA 3EG9A 5TLSA 1SUCA 1VRWA 3PKJA 3RYHA 1A4XA 4TRNA 5DM4A 4DWOA 3ZEIA 3IE1A 3L4JA 2JAWA 1GPKA 2F1KA 2V59A 4NC9A 4Q66C 2W70A 4BN5A 1EESA 3IB6A 1ISIA 1TMGE 4YBZA 1Y67A 1ICEA 2EG9A 1OTXA 4DCGA 4H1WA 4NFHA 5REQA 3I9OA 4X93A 4FJCC 2C2YA 2YW2A 2Z2IA 4HN2A 1KYIA 3RK0A 5FTNA 3UATA 4BMSA 2YWCA 1W0KD 2QMHA 2O2HA 3WJPA 4E88A 1XNQB 3L73H 4IW3B 4JJGA 4JCOA 2JLBA 2NM0A 2OHVA 2XOKA 3PYLA 1O5TA 4IBOA 1PIWA 4I8DA 4KN8A 5DHSA 4WA7A 3S29A 4HDSA 1M0SA 2BM8A 3KO8A 4XR4A 1Z6AA 4CT4B 3DHNA 1NLFA 3H65A 1O8CA 2ZRLA 5D84A 4QQRA 3M5PA 2P7HA 4OXKA 2W6ZA 1NIPA 2CEAA 5HYVA 1DWOA 4MUYA 4KXRA 3VU3A 1TJYA 1TW2A 2R8XA 3I28A 1M34A 3J7TA 1YL6A 1CCWA 4IRXA 4QU9A 2Q69A 2ZUFA 3IVRA 2Z2ZA 3GHZA 2ZSKA 3GJ3A 3E81A 1UBSB 4HDMA 4MINA 4YAWA 2VQ6A 2ZBGA 3QLTA 4FBMA 3SR4A 5BSHA 3ZWWA 4WGFA 3VSDA 4TXJA 3FD5A 1Q16A 2IS6A 4OLJA 4ILEA 3HKDB 1XEQA 4NKGB 2RSLA 3LT2A 4GPEA 4ZZIA 5AOVA 4LF4O 3ZKWB 2WUGA 5ICMA 3KTDA 1A9TA 3QU5A 5IC5A 1AUPA 2IW3A 3C7TA 2R79A 1ZKMA 2QSAA 3B3QA 1UADA 4IAOA 3TLBA 1V7PC 3ZWXA 4RIEA 1FNMA 2A5GA 1MB0A 3ZZTA 1TA0A 4N48A 5A9GA 1GWNA 1OPXA 4L3OA 4X60A 3DD1A 1Z4NA 1SQXH 1JAYA 2HEGA 3Q41A 2Z09A 1W0KA 1NQVA 2XMZA 4LXTA 4YC7A 3PD1A 4YLYA 3RN4A 1PFQA 2E4ZA 4QHSA 5BQXA 4BN0A 4P36A 4DCTA 3CYQA 1A9YA 2J5XA 2Z8ZA 3F6BX 2AUNA 3LA8A 3QEBZ 4Q6GA 3QVUA 2JI8A 3NBUA 4ZYTA 2ZRBA 1DAFA 5LA6F 3FR7A 2GN9A 4LJLA 4I1OA 4CM9D 3ZWKA 2A7WA 3L7KA 4URUR 2JRCA 1J21A 1QCCA 4PQFA 1RKQA 1ILWA 2PCJA 3R77A 3GVXA 2P67A 1H47A 1PX0A 3UUEA 5I7OA 1JMKC 4DR6O 5EUCA 5K3DA 1U2TA 4HLCA 3VHRA 3WMXA 1WX1A 3JCMM 3K0BA 4NU6A 1XB2A 1LPMA 1J5XA 5AO9A 1OBFO 3GLHB 3KLBA 2JLVA 2VHQA 4PF1A 4KYVA 1Y6JA 1NM5C 4OB8A 5D51S 4FLTA 3E22B 1QHYA 3AJAA 3WIVA 5AVWA 4BV8A 2GBIA 3H1FA 2BMWA 3D6JA 5IHXA 1EN5A 1YHZA 3GRPA 3CPWU 1O87A 1VL5A 3Q0IA 4RK4A 3FMGA 5EWMA 1SBCA 4E09A 3ORRA 1Y33E 4Q20A 3K9CA 3OMXA 4H18A 4KMRA 2YXHA 3MLEA 4W9NC 5AI9A 4HS4A 2B1JA 1G6Q1 1U9ZA 1AKRA 3ACDA 1VQ5F 1NZJA 3C6XA 4RZQA 3W34A 4BEWA 3FZEA 4IYIA 1IBLO 5J2UB 2RKOA 3RSHA 3EEQA 1L0NH 3O2QB 2WIGA 5C18A 1U3UA 4J6FA 4QEKA 2Q1SA 4RVUA 2JW5A 4YV2A 5DMHA 5IWAO 3BCSA 4K6HA 2HJDA 4ENTA 4D0NA 3LUKA 2Y6UA 3AV0B 7ADHA 3D8UA 5CNMA 1JV2B 1TD1A 1ZLYA 1NNUA 5I47A 2E6UX 4X1OA 4MLCA 4HV4A 5KNBH 3WGYA 1ODJA 4BLPA 1BEZA 1FYEA 1FD9A 2OCGA 4QNNA 1NYTA 5ALOA 2FTKA 2Q6LA 1JJOA 3FXAA 2Q3LA 4LJYA 5IAOA 3H84A 3VGJA 1PR2A 3K4HA 4BQNA 2W2NA 2YXLA 2HSGA 1N0NA 3A9WA 4D9HA 5I48A 2EERA 5LU9A 3PQ4A 5JQGA 5IAKA 3JAKA 4JHXA 3TF5A 1R5JA 2ZR7A 3C97A 1KK1A 3NIBA 3TYXA 4D9KA 4G88A 3A05A 4WEQA 2WSMA 3RJMA 4YMHA 4LYEA 4AURA 3LG2A 4F4UA 1EK1A 3FD6A 1F1JA 3ACCA 1RU3A 1TVKA 2K9PA 3JY6A 1X1EA 1Z3CA 2FPLA 1Z4MA 3CMEF 3NW9A 4Y7DA 1RE1A 2O05A 2OGWA 3GLQA 1EVLA 2R1ZA 4B6OA 1UJWB 1K6EA 2R1UA 4Z7OB 1JQLB 2NR5A 4JB2A 4ZI3A 5CA0F 3DL2A 2WWVD 3B40A 3M1YA 5HCIA 2VNKA 2XUJA 3FOWA 4GL2A 1DG3A 3P71T 1PWXA 4LFBB 3I5UA 3IBCA 3BABA 3IVGA 4ZCIA 1EX6A 2CYAA 3EG9B 4I3GA 1EVYA 5JT1A 2DUUA 1RXSA 2QGZA 3EF3A 3SPXA 3ZE0B 1ZMXA 1QYWA 1I5EA 1SRYA 2VUUA 3BJRA 2FOLA 1R9JA 4GKBA 4KACA 3A4TA 2PHZA 4M0EA 1PZXA 3RHSA 3TDMA 4DG8A 2VRBA 4F04A 2W6NA 1Q0TA 2HMTA 2Q4OA 3GBVA 1NVEA 4IOKA 4L16A 4UXIA 1I8TA 1E2PA 1ZUNB 4UCSA 3EUWA 4KAXA 1EDEA 2A5LA 3OLCX 2DERA 1U0OC 2P5TB 1WY5A 221PA 1JEDA 5E6SB 4DLWA 1JFVA 3TZHA 1GITA 3DDOA 5A06A 2GBCA 3L43A 4MQ4A 2CZCA 5HS6A 4AM8A 1Z25A 2HDHA 1KYYA 5C9ZA 1N25A 4LI3X 4TL9A 2C2ZA 2NLJC 2DBVO 3VR1A 3KB1A 1NQXA 3DPIA 4HDSB 4HR7A 4D3SA 3CD6V 1FC0A 1BGYH 3RIHA 1FF9A 3A6EA 2OD9A 2CJFA 4ES6A 5BSEA 1XZPA 1RHKA 2O1XA 2PSHA 3ADPA 3TE6A 4CLEA 5H9WA 1EAMA 1FP4B 4M86A 4BFSA 4AF6A 5DGCA 1VDZA 3FETA 4BTLA 3JRNA 1AZSC 4IEIA 3SQXA 3EGEA 3AYZB 4M9XA 1WCYA 3EHEA 5KWJA 1OLUA 2BW0A 1FP2A 3GCXA 3OJFA 4FOLA 4IMRA 5AKYA 5EC1C 5CURA 5BW8A 5FR1A 3U09A 4MVJP 4ZCMA 3FTEA 3A0RB 3KKNA 2X58A 4N3CA 3SYPA 4NK5A 4IT5A 3LO8A 5EJEA 2XWQA 1TF2A 2ZR9A 4JOCA 5J4VA 2QM8A 1RMQA 2B25A 2CUKA 2POQX 3E84A 1DBSA 1U7DA 2VPXA 3L4EA 3LPDA 1NI3A 3NOVA 3VYUB 3U80A 1HYHA 3MTIA 2O6HA 3C5WP 3HLKA 3M3HA 1J9GA 4IKEA 1K7EB 3KEGA 3KQMA 1HURA 4ZI5A 3ZJ5A 5LOVF 5LIRA 3LUHA 3O85A 4LXIA 4G8BA 3AM4A 5AKLA 3CRMA 1QG6A 3VX4A 2QWNB 4AJ4A 3VHQA 5B3LA 2BH9A 4TS4A 4C1NA 1A32A 1XV5A 3D64A 4CM5A 3E0XA 2RH5A 1RP3B 2CEKA 4PBRA 3I53A 3M5WA 1ECGA 1NATA 3SS7X 4UCXA 5H68A 4WW0A 1SCUA 2WNSA 1W52X 3N28A 4JAVC 2G1AA 1Y6QA 4UAJA 1FMFA 1XKXA 3BOSA 3TM4A 1CYEA 3C5HA 4OK3A 4KVAA 4P83A 1ZI9A 3KB2A 5DHRA 3S2UA 3RC2A 5HJ5A 4BO7A 5A5VA 2FPPA 4DV0O 3DP9A 2VNHA 1ADYA 2JI9A 3ZWYA 2JIQA 4E7PA 2AT1A 5B5EZ 1T13A 1YE5A 4LF6B 4XDKA 1Q2UA 5IJWA 5C52B 2BFBA 3IKEA 1SOUA 1F6DA 2NU9A 3AF3A 1US6A 3NGXA 4PZZA 4FFKA 4C4WC 1CZKA 4WOJA 4Y7CA 3EJWA 4D8UA 2D4AA 4Q4DA 2C58A 2E4VA 3KLNA 3DFIA 3G2IA 4G9GA 1TZCA 1U81A 3VR4A 1XDSA 3VGPA 3A6DA 5JCPA 2GK6A 3RVRA 5D5QA 1XRMA 1H2NA 1LU9A 3KXPA 3OCZA 3COJA 4ZV4A 4ZVQA 2XSZD 3FCEA 2IYZA 4H33A 1NT4A 3D8HA 1FUKA 2C1ZA 3DC2A 2LWIA 2I78A 3V00A 2EWMA 4WNIA 4EG5A 4U5QA 1WPXA 1SBQA 5BNZA 3WJRA 2XPCA 3QBTA 1ZOLA 1RAHA 1BS2A 3NTQA 3LUTB 2ZAOA 4I14A 4A8JB 4BBAA 5A7FA 1RJGA 1VQ7F 4OFZA 4WWHA 3OPVA 2XAGA 2V6MA 3QHAA 1PG0A 2QUZA 2Y1WA 2ZWIA 3DZHA 3ES9A 5E2IA 4K8XA 1F0KA 4QOFA 2J6HA 1BCCH 3IE2A 1XI1A 2NU8B 3RAPR 1CUWA 1QFMA 1GTRA 1RFYA 1LBSA 3AEUB 5F2EA 2HJ9A 1EKXA 5IMSA 1WNFA 3CCSV 1G8PA 4JC5A 1MAWA 5HWSA 4BNLA 1R3JC 1TKBA 3RFFA 4Y8VA 2UXDO 1XD9A 3JD3A 2GDZA 2OV8A 4MQUA 1JDSA 1EN6A 5K0FA 2VHYA 1KI3A 5CT6A 4MMYB 2ZVZA 3KXLA 3NHAA 4Y30A 2A88A 4P7BA 1UBJS 4K86A 2OO5A 3R5KA 1OFHA 5M29A 2I8LA 4RHAA 2C2MA 4EYQA 4FMDF 2DFTA 4KLRA 2WIBA 1W48A 5K3OA 1MV5A 2CTWA 2PX8A 3QU2A 3CWCA 1ADFA 3AUFA 2FUEA 3WRYC 2HCFA 1K4CC 4LSWA 3I58A 5MN4A 4GW3A 4NQZA 4PAOA 1H2KA 3VR4D 4JX9A 4R81A 4B82A 4C7XA 2XVYA 4QUHA 5JAOA 2GD6A 3DTTA 3NYRA 4ALIA 1A5AB 2XSZA 2IU3A 4REQA 2QM4A 4WIAA 3UCSC 3I55F 1JAXA 1KETA 1KEPA 1OZGA 3EVZA 2XD9A 3OAAD 4K6GA 4TMYA 4U2CA 4O0LA 4ZRDA 3PC3A 5F9MA 2CD9A 1E2FA 3ML0A 2W8BC 1EP1B 1LK5A 1GA4A 2OHOA 2Z1DA 1AUOA 2ZAIA 3AFIA 5DULA 3U9SA 4OCZA 3IXMA 1AHIA 3OMLA 1STOA 3QEMA 1F8XA 2OZLA 3I30X 4Y1FA 4Z86A 1BCRA 3K3WA 2XUFA 2AG1A 2DBYA 2RI1A 1II0A 1PL4A 2A6PA 3MYYA 2BTQB 3BK7A 1ZRHA 2DFDA 3OWHA 4M8LA 2GN0A 4RNDB 3WWCA 5IANA 4GI7A 3BAFA 4K9KA 4D5GA 8OHMA 4P5PA 2JFXA 3H5AA 2BGGA 1KOLA 1S72V 3ZJYA 1KHHA 2RFLA 2HMUA 3CZQA 1Z39A 1I14A 1Y9ZA 1VL8A 3L8HA 3MJFA 3OPQA 3PVSA 4G0QA 3NWPA 1YJNF 4OFXA 4OHMA 4QYIB 3L49A 5JQWA 4MV0A 4PX5A 3GAZA 4CHTA 5DP2A 1C7JA 2PMWB 4FILA 5E1AC 3Q1LA 4FJ0A 4J07A 4M49A 3KHSA 3CH4B 4EY4A 2I3DA 4U7OA 2R1VB 1LUWA 2W83A 3A1DA 4JYAB 3ICXA 4GLOA 2H0QA 2AMVA 1Z13A 1SR8A 1N0VC 1IN8A 1DAOA 3A1WA 3STVA 3JQEA 1JHRA 3D9QX 3NBMA 3UOWA 3V7EA 3F7OA 3KZMA 4C0WA 4RTQA 3L46A 2YBDA 1AXGA 1NP7A 2G0AA 4Q39A 5E3IA 3RKUA 3PX7A 1K8XB 1DEOA 1EG2A 5T4EA 2O8CA 1HY3A 1VQPV 1EFKA 1T91A 1G1MA 2KLHA 3PJDA 3WZMA 3NBFA 5BWLA 3D6TB 2VT6A 1OAKA 4HZ3A 1G2IA 3UQZA 3DBLA 4R31A 4CTMA 4YYZA 3SIPA 3I1JA 1MA0A 3OZRA 4ER3A 4R1UA 1PNRA 2BCCH 3K7EA 3KDSE 4Q03A 5D87A 2BKAA 3QEOA 1IV2A 4EG6A 4N5HX 1OGJA 1PL0A 3ZLVA 4FIZA 4KQXA 1DUVG 3CA8A 5EPUA 3RVBA 2NUAA 4I3HA 5JCJD 4CH5A 3P9SA 1HDGO 1NTMH 1V1RA 2WJJA 3R09A 4JD5A 2EAUA 4QDUA 4EGFA 1FNCA 3DM5A 5IYCO 3CWQA 4QGSA 1FDOA 4DDUA 2IX9A 4M21A 4FD3A 4OX9O 3I42A 1WV1A 3BMCB 5H6QA 1L4FA 4JEHA 4G25A 4GYWA 4OF4A 1AJQA 2GEDA 4TKUA 4WFAV 2FMHA 3OEHD 3C45A 5B6IA 3K9NA 4LVCA 4JBWA 2VLIA 3NV7A 5BORA 3MJHA 4C4YA 4P4NA 4LKOA 4MCJA 4I50A 5DXJA 5GQSA 1EB9A 4C7UA 2CK3A 2JGIA 2UXCO 1ZJ4A 2QD3A 3EK2A 2R6R1 2DOKA 1KPHA 4WY5A 4ARUA 3AFGA 4D98A 1UPFA 4FCWA 1JTFA 2CVHA 1XPRA 2DUWA 3AHFA 1RWXA 1NGSA 3E22A 4JJAA 5ALZA 4DNFA 3AVWA 2FN7A 1GOTA 3A7EA 3DNPA 4WK4B 2PYLA 4YCJA 5DI3A 1EQAA 2XMPA 3D7KA 3ESAA 3TQFA 3W5SA 2OA0A 1JLHA 4TMVA 4WFJA 2IUFA 4ZCQA 4P31A 1T2AA 2X3UA 1XNJA 2CNBA 1ZH8A 2QD5A 3JQCA 2WTMA 2YWJA 3GX1A 3F49S 2H1SA 5AKZA 3FHOA 3SYRA 4EGSA 2BY4A 2HJFC 3L0DA 4FW9A 4CCWA 4YAGA 4QG3A 3IAM1 2VWQA 3OJWA 4B1FA 1IN1A 3LY8A 3GMTA 3RJZA 4AS3A 3BMNA 2VQEB 3CUVA 1CTQA 4LDAA 1V25A 4NPAA 4RELA 1HOXA 2ZPAA 3DKVA 1H66A 3SJBA 1R66A 1B93A 1LRKA 2I8AA 2ZTMA 4Q02A 1NVPB 3EXHB 4XKJA 1OF1A 4R69A 1V37A 4WZ6A 1WUTA 3MMPA 4D41A 1PPJH 1HOTA 1UZLA 3NTOA 4HNSA 4LRXA 4Q05A 5JCJA 4CV2A 1YIAA 5DHTA 3F98A 4OHZA 4EA8A 1LF5A 1QXSA 4MVUA 1BQZA 3FMVA 4B8ZA 3AOGA 4EHIA 1L1FA 1L8LA 1WLSA 3GLKA 3HPQA 4KGVA 3O73A 4JXXA 4LZOA 3KIZA 3T3PB 4GKJB 1BDJA 1C0IA 1ORHA 2I7VA 2J6CA 1GNLA 2HA5A 2WF5A 3LDAA 2ZRMA 3OCXA 2B4RO 2X9QA 4HFMA 4UUOA 2FMTA 5HP8A 3SS9X 4LJKA 1G6UA 1AH2A 5LWQA 2AR0A 2V98A 4BCBA 5MGBA 2CK3D 1R3LC 4TQAA 2DBZA 4LY3A 1OOEA 4FLEA 2N75A 4L1KA 1U3PA 2RHHA 1KFKB 4PA4A 1DADA 3IUBA 4KQ6A 1T6NA 2C5FA 2NQTA 4O2AF 2GN4A 4LNHA 2EG5A 4FFWA 4G97A 3HCFA 1ZKDA 4BB0A 4PX9A 1J9EA 1UXIA 3AEQB 1XHXA 3IULA 4JBLA 1S0VA 4LGYA 5TDHA 4EH1A 4U39A 3KL2A 2WG2A 3QPCA 5JXHA 2E55A 2QI9C 3ENKA 3LFUA 3ZV5A 3N4ZA 3M1XA 1TLFA 4EEKA 3M4SA 4X1KA 1M5TA 1F8UA 1KZ4A 2OCXA 2J9YB 4KEAA 1GPH1 3IRVA 3I55V 4OQ4A 4ZDWA 4E2YA 1DEKA 5M34A 1DIOB 1E7QA 5DN6G 3F71A 3FROA 3L6CA 4G5YA 3WJ2A 6AT1A 1HL7A 2NLOA 1ST2A 1TZJA 1E9VA 2HJVA 3HB9A 2RHJA 2FB9A 2ONKA 1TT7A 4KLAA 1W42A 1ORIA 2ZQMA 1GPMA 3AEIA 4LNUB 1KYZA 4D46A 3UGJA 1URFA 1C7EA 1LJ8A 1X8XA 1GHTA 4IG9A 1B6GA 1AA9A 1E1LA 3EEBA 4C14A 1QLEC 2FSIA 4OGFA 5EI5A 3KZOA 3WC4A 1D9ZA 1TRHA 2C9BA 4EB6A 2IP1A 3KCXA 1PL7A 2NVUA 2Q4RA 4G5XA 4PSAA 4TROA 3GT4A 1S72F 1EA7A 4E51A 3VQWA 1AUVA 5FLYA 1M7HA 1MX9A 5IDYA 3ELUA 1PF5A 4K8ZA 4HXEB 4JELA 5TIIA 1YJNV 3BA8A 4GXTA 1W0JD 4V3CA 1UFQA 1L4GA 4K0KB 1M56C 1LLDA 2AEJA 5FQOA 3UMSA 2QX9A 4I08A 4QA9A 1GN9A 2RB4A 2RGNA 5DBGA 2J0UB 2JC3A 3QVMA 3G0GA 1SIOA 1GQQA 1E18A 4BWFB 4MRNA 2GZ2A 1XBTA 4GDFA 4AXBA 4XFDA 4QM6A 1ABEA 5A0TA 5HTKA 1YDWA 2AYXA 4LY6A 2HQ1A 2C96A 3HCBA 5JQGF 1ZJWA 4MT8A 4O2BA 3DUFB 5CPBA 1TYZA 3RHZA 3EODA 3RU7A 4H7HA 4QAQA 3CZAA 3FWYA 3PFWO 1HFJA 4UKDA 1Q0SA 2ZJFA 1G8KA 1TRKA 2BGKA 3J80M 1T3TA 2PX5A 3AGQA 5FUWA 3CEAA 4U0JA 1M72A 1KK2A 1LZKA 2DB3A 3LWDA 2WB4A 4FUQA 3UWMA 5YASA 1SESA 5KYYA 2CUNA 1JJVA 4L5BA 1C8BA 1UM9B 1F0YA 1HA3A 1GZVA 1YJXA 4ZWNA 2JI6A 4C6TA 4IINA 1EMDA 1R1DA 4RETA 1F4LA 2CC2A 3WRYA 4RXMA 4FGWA 4M1OA 5LXTF 4AJLA 1RKVA 2C7QA 2Q6OA 1YZYA 2IF2A 3KVYA 3RBVA 4MVJA 1WZUA 1IXBA 1PW5A 3A6PC 1Y8QA 5IMBA 5I5EA 1KBZA 3OA2A 1G60A 4JLBA 1XZLA 3FAVA 5DF1A 1DJLA 2GDSA 1WCV1 2BP7A 4V1CB 5AXDA 5L3FA 2PIAA 4RANA 4TQDA 4Q18A 2SKDA 2DH5A 1JP7A 1KIAA 2C29D 3IEMA 4BO2A 4JLUA 5EPEA 3KU4A 3N2KB 3K14A 4RYDA 3W8DA 3FPIA 3VTFA 1KI7A 1Z6XA 2G9VA 5HBRA 5KTOA 3HYLA 4ZZ2A 1P81A 2PV7A 3V2UA 4W7IA 1DF5A 1MB4A 2WJZB 1SKAA 2IZ6A 1TUBB 1DL5A 1TZ2A 3WYBA 1E6KA 1JFLA 2QMYA 1URPA 5DIZA 4PSKA 2HP8A 1PGJA 5DEDA 1X7WA 4LC0A 3FY4A 4Q3LA 4JN6B 1FRQA 2B92A 1M3SA 1OXTA 3BHPA 4D8WA 2TYSB 4AJHA 1CJTC 1BRMA 3F5DA 2X1MA 2G6BA 3HBLA 3O9VA 3OQVA 1BGVA 4FOPA 4J0KA 1Z29A 4PLYA 3SYMA 4DNXA 2F3TA 3X0DA 1HE2A 1C9NA 3ETQA 1XAHA 2AEEA 2VJKA 1N6NA 3GJXC 4NESA 4WZAE 3TFQA 2AIZP 5LMCA 2J3DA 4R9VA 1WXEA 3BIOA 3NHFA 3DTUB 3PIDA 2WYWA 3A9SA 2W6CX 3TRJA 1ELOA 1SG9A 3VC3A 1XNHA 1RAIA 3PIRA 1JDBB 3AEYA 3VVLA 3R66A 2EEPA 1RHUA 2HIHA 1GSIA 4JT8A 3DE1X 4N3GA 4LF6O 2GEFA 2MINB 2QJFA 1TKCA 4LWSB 1J8DA 2J9GA 3HADA 3MIZA 3OOHA 3O26A 4GH5A 3UB3A 4BRSA 1EK0A 1U96A 3ZHRA 2DCUA 1CY0A 2Y69C 1P80A 2PT6A 2XY4A 3UAXA 4B4VA 3VFDA 4MVJD 1P74A 4H4EA 3SBDA 3L7IA 3S1AA 5CB4F 3TMYA 1E62A 4WZBE 4XJXA 1ESDA 1Y3IA 4KOAA 4RGBA 3TW6A 4YV1A 4JUIA 2LDBA 4BAYA 3Q6IA 5K2OA 2GLZA 3OEED 5AVSA 2GUZB 1QH1B 2IOQA 3HJRA 3Q8KA 2A30A 4BU1A 1HH4A 4YRNA 1Y5LA 3GUZA 3GBSA 2J0VA 1A9ZA 1V9LA 2WVHA 4F7DA 4TWIA 4IRMA 4CODB 2FW0A 3AUUA 4EYGA 2V6FA 5E1MA 4NX2A 3WL4A 1I94O 5AM4A 4A0HA 4B3TB 1QGED 3DTNA 3L7JA 4DMMA 1GX1A 2X0NA 1NG9A 3C6MA 4CMIB 4YX9A 3M4ZA 1XVIA 4OBWA 1PQ4A 4E0BA 4EECA 4N5MA 4DCNA 3HKBB 4MKIA 1TK3A 5FOQA 1Y5NA 1Q6IA 1OV4A 2OBFA 2JIRA 5DASA 5IC6A 4EJFA 2AW5A 5KNBA 2M6SA 1JUDA 5K6AA 1IPAA 4CI0B 3URKA 3HBJA 3EJ6A 4G4ZA 4GKKB 3UMBA 3H6GA 2BBOA 1CQJB 1GUDA 3TLAA 1JJAA 2EX1A 3FCOA 4CG0A 4C2TA 2DC1A 4K6MA 3DYBA 4P7JA 3FUTA 3FLMA 1SBHA 1J8MF 1E7SA 1BX3A 3CHYA 4XCXA 1ZIOA 4IJQA 5DH9A 1ZXLA 3JWPA 3MRVA 3PFCA 1C8KA 2NXNA 2RGWA 3H9QA 4UVBA 2H85A 3Q72A 5ILQA 3VX3A 4AX8A 5JBNA 1MH1A 2IXTA 5M04A 2ZYUX 4PGFA 4JB8A 1I9CA 1CQJA 1FDUA 2C5SA 1ZTEA 1IBCA 2KJQA 4D96A 3N0WA 3KBBA 3PR3A 3UJPA 5HUQA 3GFBA 4DDTA 5KSOA 5SV2A 4FEEA 2VDNB 1NU8A 4N65A 2DMXA 4F2WA 4YQYA 3BX1A 3MVEA 1ZH6A 3OHMA 4PANA 5CT4A 3M6WA 1PJBA 1P7PA 2MMGA 2QG6A 4RY8A 4BX0A 3UMMA 1GNQA 1N7IA 1NF8A 3L8ZA 1LPPA 4UM8B 4YP9A 3TTUA 1VG1A 1KYTA 1R6KA 2PGAA 3ONWA 4GPZA 4D4LA 5CH3A 3RFCA 5LWHA 2IDJA 3LQQA 3ST7A 1N2IA 4L2IA 4EGCB 3LCUA 3PWTA 3GWGA 1EM8A 3LRPA 1A5BB 1I2MA 2KG4A 2GKOA 4GF5A 1F20A 2PLRA 2Q2QA 4JLAA 3SYLA 4PO8A 3LDEA 4GQBA 3EA5A 2NMUA 3H8JA 3P9XA 4FHCA 1OAOA 1CXZB 1OV9A 3WISA 1KQ3A 2GUZA 3TGUH 1QH1A 1FDRA 4AQDA 4DC1A 4I9UA 2VF8A 5HXAA 4LF5O 3ABKB 1L7QA 4QLOA 1POWA 4L2IB 1LLUA 1Z4OA 3PF9A 2Z0AA 4WCEV 5HHTA 2QSJA 3CCSF 3NDIA 3JARB 4I0WB 4LHYA 3O74A 4RHEA 2QTBA 3BF7A 3BPSA 3I6MA 4Z6KA 5LCXA 1O0SA 2P35A 4MGEA 5U1PA 1XMOO 2QGNA 4XRRA 3R24A 4RMHA 2DWCA 4FZ0A 1M6HA 2GJ9A 1LNQA 2F93B 1AUXA 2VBIA 2Z0MA 3BCUA 1LQTA 2VPZA 4LBEC 3KJHA 3MC1A 4N12A 4QPZA 5BWNA 3CC4F 4O4JF 3JATB 2KG7B 3O83A 3WR5A 4JGBA 4K0RA 5B1EA 1NC3A 3TGWA 4RF5A 5CDSA 4X20B 5HE8A 2D8AA 5G4VC 4RGVA 1HPLA 1GR0A 1RWNA 1X1BA 2FGKA 2NZ8A 2O2DA 4X8OA 8ABPA 4DCJA 1Q6YA 4M76B 2V5VA 3JQPA 4LKRA 4JIMA 1W85A 5EWJA 2VUHB 2AOTA 4NOMA 5KJEA 2FWPA 4HMQA 4F5ZA 5LUBA 2IKSA 4C08A 2A9VA 4X61A 2BLLA 3ETGA 4DMUB 4YRKA 4ITVA 4UVGA 3NANA 2AFHA 1J1ZA 1Y1QA 2PU5A 3TDKA 4Z7QB 1J39A 3LZCA 3CC7V 3B7GA 3CUYA 4DV1B 1H8HG 2I4OA 4ND7A 4R1LA 2DETA 1XHEA 4QYWA 5T8KA 5CBPB 3GDOA 1THGA 2P06A 1WOYA 4PFQA 1OXKB 2QR3A 4PRYA 1X7XA 1XZDA 2YCLA 1E4YA 5KJCA 3F6SA 4TN1A 4UTVA 1ISMA 2GWRA 5H6RA 1Q82H 1OMOA 3CCBA 4Y2VA 2IGBA 5DTEA 5TQ2B 5HKKD 3V5NA 1G9SA 1QUFA 2GNAA 4UUPA 1J8QA 3O75A 1WDWB 2WM8A 2OTMA 3N7TA 4N82A 4ARZA 1Q12A 4J1NA 1OD6A 3E8SA 3GEHA 2QD2A 4M6WB 2ZUTA 1C3JA 3HDVA 1M76A 3KL4A 3GWZA 5DIFA 3S1SA 3Q1KA 3MAAC 1OWOA 2E4UA 1VKOA 1SCDA 1AKVA 1OASA 2HNAA 1RPTA 3FLEA 4PD4F 2WLHA 4JI5O 1AC5A 1BQ4A 3ID6C 1DRUA 3AVQA 3IEUA 4JQYA 5H3HA 3WICA 1YULA 1TFUA 5K03A 3C43A 1Z73A 2PLFA 4ZVUA 4TZZA 1LWOA 2QDKA 4W7HA 4WKBA 5TJHA 1Z37A 2ZOSA 5IUNC 3ESXA 2PD4A 3DLCA 3AVVA 3T1YO 2NPFA 3V33A 2JJ1G 4ZI7A 4LYAA 1ZMRA 2VDJA 4MCIA 2KE5A 1E1CB 3P9PA 3FM9A 3UMFA 4DJTA 1UIMA 2RN9A 1R9NA 2JHGA 1CE8B 2XDQB 3EGIA 5JAIA 4MYCA 2CE4A 4OM8A 3KKLA 1I3OA 3GGDA 1VHAA 2VR1A 4G0OA 2JI4A 4UDYX 2A4KA 3B2EE 2QUHA 3NBYC 4URVR 2DECA 4UU7A 1Z0AA 1LW6E 4JTDB 3E05A 5DTMA 2XOXA 3QUWA 2NZYA 3QKSA 2CTPA 4FYKA 1N6IA 3DL4A 1DIGA 4KODA 5KINB 3HJFA 2Y4NA 2CBGA 1PGPA 3FKSD 3VDMA 4ZVOA 5LDGA 1KH3A 3EAFA 4MGYR 1H9AA 3CLHA 3DC5A 4F1JA 5CA0B 2Z2JA 1IG0A 1IMOA 2FWMX 1D6NA 4ZC1A 5G3ZA 4R8KA 3OLZA 5D3KA 2TMYA 3JZMA 4LJ4A 1GEEA 4J9YB 1JD1A 1AKQA 4ISBA 3VU1A 4BLQA 3OPMA 4BJHB 1GUAA 3KIPA 4D02A 1CY2A 2GDJA 2GF0A 2JF0A 2KYRA 5HBGA 4CKEB 5KTNA 4DUYO 2J0QA 4N23A 1EEHA 1RFLA 1SUWA 1B1AA 3CV3A 4RTMA 4GLLA 5HP4A 4FU0A 2FUNB 1DKQA 3C9TA 2Z4RA 1NPDA 1OIWA 4M9SA 1ZSYA 3RWRD 3TXQA 1DG1G 2ZJ1A 1B76A 1P1RA 3VPHA 1YBMA 2WV7A 4ZEOA 3T38A 2XUPA 2VTEA 2EJTA 5KX5A 2IU6A 4Y9DA 1JYFA 3MJSA 2RKWA 5IH3A 5FF9A 2EKDA 1UWVA 1XLTA 1T9CA 2BFDA 1JG4A 3ILYA 3G79A 4W82A 1EFRD 4C20A 1J7JA 1HE1C 3AG1B 2V0GA 3BS4A 2J6IA 5SYAA 1U2SA 3OVMA 3U7IA 1WXQA 2MYTA 2YC4C 5B2FA 4G5HA 2H6LA 2C8KA 2QX7A 3PPVA 1NXXA 1YK1A 3KYIB 5DE3A 3WLJA 4WBNB 2FHPA 4TZKA 4ALLA 4A26A 3E6AA 4N6OA 4KP4A 1V11B 1F5NA 3F4LA 2BT4A 3I09A 3JQAD 2Q5HA 3TFWA 1E0JA 3GLRA 5CEEA 2W0XA 1U99A 5KCMA 2EBHX 3APOA 3E86A 4R0NA 1VE7A 3E53A 5BPFA 4QDZA 2E82A 4JOQA 3WTCA 1N8RW 4KU4A 5JJEB 1BROA 1O54A 1DG9A 5FFMA 5DTQA 5BRNA 4Y0NA 4M7OA 3UCFA 4QBIA 1BWRA 4BR6A 1Y4MA 1FE8A 3FJOA 4X65B 2ORWA 3EE6A 3ZY5A 4O08A 3KJFA 5E95A 2ORED 1P4RA 4C4TA 1JHUA 2XXBA 3BXPA 4AQYO 1JB9A 1ENZA 3ZCTA 5E4JA 5HVNA 3MHTA 3E3LA 4EPRA 4DRZA 1SUEA 2CHSA 3R7AA 4PEVA 4KQKA 3OE1A 1QKIA 4H13B 4TGLA 3ZPXA 4CIVA 1XEWX 1I4WA 1I3LA 2B7BA 3C9UA 3B9PA 3ENNA 3HWX1 3PHIA 2HG5C 3TNJA 3FMFA 1M34E 3UGQA 1Z74A 3JCUZ 3DV0B 3P5SA 3GFQA 5DHAA 1ATZA 3IYLW 3W9YA 3CRQA 1KP3A 1U1CA 5B1BB 3A7DA 4G5OA 4LGVA 4RD3A 1N7HA 5CHEA 2GUGA 4BTVA 3SIVA 1CUAA 1ISJA 2HA4A 1WNTA 2G1JA 3BH0A 4X44A 1Z3IX 4D44A 5I9IA 1Z5VA 1IN6A 2P9QA 3I3OA 3T5TA 3ZDFA 5IW8A 3BSWA 3ZTWA 1YJ9V 1RM3A 1U2DA 3LC0A 3HXLA 2P30A 1V5IA 4F84A 4FFMA 3QG5A 2VXYA 2XWPA 3BTUA 3GV0A 1Q15A 1Z9BA 3N0XA 3OLWA 4ZI7F 3WPXA 2AQKA 1CEQA 3HJAA 4G1MB 1E3SA 4MB2A 5BSTA 1Y3DE 2REBA 3QVKA 3D54A 4WFEA 1W5AA 1KHTA 2P4QA 2YRWA 3DA8A 4L7QA 3TUJC 4BO9A 4DC9A 1H93A 2WY2D 3D0KA 3ZIAD 3HJGA 4P86A 4IEEA 3BDAA 3I9MA 2OUKA 1DX4A 2IW1A 3SOPA 3K0KA 1YBHA 1M93A 2NXEA 5HZHA 3RFTA 1BZYA 1TA4A 4I66A 4NABA 4E6PA 1X38A 4RA6A 4F4IA 1UFYA 1KMIZ 1QU2A 1ISHA 1UBKS 2QR2A 3MQ4A 1UK6A 4C0JA 2QTCA 2YYSA 2HF9A 3EYAA 4FC7A 5E8JA 1QLEB 3A11A 1N8SA 2AN9A 2OT5A 2EWWA 2P40A 3D4PA 2A4MA 2JIDA 3W2FA 3WYDA 1R3UA 3TWOA 2Y76A 4N3NA 4AUNA 4IIFA 2HR1A 1SVLA 1GTG1 3EDQA 3CCQV 1W87A 2V3WA 4YIHA 2PWBA 2C0PA 1DIBA 2VYNA 4DN6A 1Z6YA 1AGYA 3CYFA 5GTDA 1JLRA 4CMBA 1A9OA 4D9IA 4OU5A 4F2GA 3ASOB 1FFGA 1I2AA 1D4ZA 1WUIS 2NVWA 3E27A 3PLNA 4KJXA 2ODBA 4OSEA 3VYRB 3H1TA 4LFAB 3AC0A 4LZWA 4KXLA 1Q0PA 3R0JA 4DCUA 4ZK2A 2RE8A 2G88A 2JGDB 1GFWA 4MB0A 2N05A 4TL6A 3ROKA 3L0CA 4GZ3A 4K6FA 3FRJA 4NBSA 2IYTA 1N9GB 3G8AA 3O8OA 2X4GA 4KXQA 2QEXV 1JL3A 4NV0A 3WNDA 4DIUA 2Q0QA 4JLPA 5A9SB 5L3BA 5KYWB 4LYJA 5ALWA 2WYVA 1PSZA 1VIMA 2IHZA 4CIAA 3WB0A 1D8TA 1HE5A 1AIPA 2BLNA 1LJUA 1X77A 3GLSA 3MXTA 4RZ3A 3ASZA 3QXHA 1ZZGA 4MGHA 3J81N 4P7FA 3CVYA 3QKRA 2JIPA 1MQ9A 2XAUA 4WDRA 2XTNA 3WGLA 1NLUA 1XTPA 1JIUA 2Y0EA 4GOXA 3R8XA 4FNGA 3LYUA 3I5YA 3E89A 4G2TA 4Z2WA 3P45A 3NPMA 2Y6VA 4CKWB 3BZWA 2JASA 2DYRC 3D7SA 1VLJA 1MTOA 2WWGA 5DX0A 3IODA 1J56A 3FMOB 1P5HA 3QKTA 3V1MA 4GMGA 1WPGA 1F14A 3CCMF 1TQHA 3HEMA 1AD2A 2OLEA 2QPLA 3F3YA 3KM0A 3PITA 5EKUA 1WOMA 5C8ZA 5BNWA 3CNQS 3AB7A 5HFAA 1JJ7A 4WA8A 3V4OA 3BKXA 1U9JA 1RWWA 3UPUA 4B46A 2Y4UA 4PI0A 3NWJA 3UWOA 1PV0A 4FP9A 3K1YA 3IUSA 1LK0A 5JXWA 1JILA 2Y1KA 4JT4A 1XWWA 2FVXA 1JWBB 1XD2A 2W6ID 3OQIB 5DCUA 4YUYA 1LXCA 3JQBA 4DTCA 3DLBA 4DIBA 3CCCA 1ETUA 1H22A 1GKLA 3DHYA 5FXMA 3WA6A 1KY3A 3C2QA 1MXHA 2QJRA 4PHTA 1Q1EA 2Y93A 2YXDA 1GQFA 2YZMA 1Z7EA 3WWZA 4V2UA 3TCUA 2ZVYA 2J85A 2B4TO 3LLUA 3FWKA 4QT0A 1CY7A 4Q1FA 4FGJA 2DHCA 5E7MA 2XYPA 3RVOA 2JIOA 5JLAA 3PGA1 5BZBA 3DAOA 1J42A 3NWOA 3AVPA 4C06A 2HF8A 4NR0A 1OLXA 3DMNA 5KUMA 3U4AA 5IASA 2MHCA 1HQYE 3P2IA 3R3ZA 2VAWA 4LIPD 3CCJF 4QPCA 4QRHA 1IRIA 4X97A 4AG3A 2BOBC 1SB9A 2W6JA 3HB4X 4GZMA 3ZVLA 2W90A 4RU1A 5AJYA 4LZLA 1DC3A 2JJ2D 5ITWA 1WNSA 4PXYA 4F5DA 3A2KA 3RYTC 2G09A 2ZKLA 3STZC 1OXXK 1PSWA 1W85B 2EYUA 5EWJB 1YDMA 1MO6A 4URYR 4XWTA 4D56A 2E5FA 1MDFA 2EKLA 1SC9A 1J07A 4G28B 2QL7A 3R5XA 1JXOA 2GHIA 4BKUA 3FW1A 1X7YB 1N1EA 5HY4A 2VBGA 2XKKA 3DMDA 2BC9A 3ND7A 4OSPA 4AJKA 3ISTA 2OP0A 3QE3A 1BMFD 2OT3B 5H7XA 1MZPA 2CLIB 3TB6A 3W04A 5HQTA 4JUBA 3MGCA 1IWPB 2ZG6A 1M67A 4XIGS 5LOVB 4ED9A 5HTOA 2OG1A 5DCYA 4BO6A 3JASA 1JEQB 1EZJA 1SK8A 4N0DA 2Y0BA 4I9GA 4FYMA 4JZKA 3LHSA 5TXGA 3V46A 3KT0A 1KMHA 4BYMA 2IU4A 4L5IA 2ADPA 1G5RA 4V1CI 3GQVA 2JJ1A 1XHLA 2QIPA 4CLRB 1AQIA 1S3GA 3OUSA 4QE3A 5HGJA 5TT0A 4F86A 4Z54A 2IS2A 2HY7A 4NWIA 4HH4A 4ZT2A 2IV2X 3RTGA 4P4GA 4DT1B 1UBGA 4MI6A 1ZD1A 2NUTB 1EG7A 3HUTA 5F5NA 4J1TC 3RT9A 4U5XA 4RH0A 2PGLA 5JCOC 3L1VA 3II6X 1N2JA 1PJ3A 1YRLA 3DPSA 4F8JA 3CONA 3WIUA 1QZTA 3EPLA 2DY0A 4PX2A 1WDTA 1GYQA 3A0HZ 3EGXB 4OA8A 4RJIA 2VNIA 1U3LA 4TMTA 3K9SA 4DR5B 1HM5A 2JJ2A 3ZGNA 1X3LA 2IH1C 1CHDA 1Q7YW 2VDLB 1Z4KA 2YZNA 2GA9A 1GT91 3AF4A 3F78A 3FHLA 4ZQGA 4GC9A 4E5DA 4XWOA 3R76A 1E79D 2G04A 4W1RA 2XNJA 3KQOA 5DHFA 3UICA 1SC1A 4DXHA 1QHTA 3MSXA 4JWTA 5T3UA 1LBEA 3OIFA 3CC7F 3FKSG 3HG7A 4G63A 4OLAA 3LOPA 1P5FA 4WNCA 4X85A 2G63A 3KP1A 4CTJA 1P19A 2JAUA 4J2TA 5EN4A 1WDMA 2RCNA 5BWBA 3PGJA 4YMIA 3CS3A 4L4ZA 5EB0A 4M8IA 4CZ2A 2F43A 4JASB 3OZ7A 4HLNA 1V54C 1YCFA 1Y42X 5ITZB 1U7HA 4JJ8A 5BQ3A 3S5UA 5C32A 4LPKA 3DTYA 121PA 2QRHA 4HRYA 3PHJA 1YQNA 2E5WA 4H3KB 4MWSA 3HB1A 4GPIB 3VPAA 1XR3A 1NVDA 4Z49A 2WTNA 4BT6A 1MAAA 2N42A 3FWNA 5DLQC 3CKLA 3LXUX 5TY0A 1OVMA 4BQSA 2FMXA 5M2QA 3IUPA 1Z83A 3QENA 3T52A 1SD2A 3ZRWB 1LUAA 1X4TA 1UP7A 1Y34E 4GC5A 4HBGA 3JQ9A 1JA1A 4WCFB 4XGIA 3U39A 4J9ZB 4E5MA 5JCXA 2CB0A 1GL3A 2UUCB 1SCIA 3U9TA 1VLHA 5K0EA 1KIFA 1PQPA 5A4AA 2ZYRA 1B3QA 4YMUA 4JY7A 3V4LA 3TBHA 4HMOA 2FEKA 4H17A 4RMNA 4G0YA 2HA6A 6LDHA 3PL5A 1P8JA 2BR4A 3KKQA 3NTXA 3UJAA 3KQLA 1G4AE 1LA2A 1UXJA 2PUVA 4FJ2A 4PLTA 3WYAA 2UYHA 1NXQA 4EHDA 2IODA 1T24A 5HGXA 5LMZA 1NSYA 1MRZA 2WMNB 3IAHA 2DX7A 3KUDA 3OHSX 4G0MA 4NAUA 2J0SA 3PRHA 3OFJA 3GOHA 1WB4A 5CVUA 2I03A 3IEKA 4IF6A 4K26A 4N5DA 4DMRA 4QPKA 1TGOA 4OPAA 1G8GA 1EFUA 1WRBA 2F4VO 1CEXA 1N5RA 1Y7IA 5E6SA 3RGBA 1T2UA 4ZVLA 1YMUA 2IPNA 3WMRA 3M2TA 1PQUA 3OKCA 3P9NA 5L53A 1DKLA 1H8ED 1OILA 2FRDC 4FDTA 4J43A 6YASA 2ZSIA 1WWKA 5ERGB 3I0ZA 1QRSA 1A98A 1XTJA 1RACA 4F0JA 2QI2A 2DWPA 2A0UA 2C2GA 3VH2A 4CUZA 3BJMA 5AK3A 2V7QA 4DA6A 4U7FA 4HQNA 2EP5A 1F6WA 5HFNA 1BU5A 4MUBA 2XIJA 3ZU2A 2OWOA 1EVEA 3L92A 5K05A 4ZCPA 4AXXA 1Z63A 4FLWA 2A9RA 2B8JA 3A70A 3LVFO 4BVGA 1D1TA 2HWXA 3HO6A 3MMXA 4GYYA 4LSZA 4Q7KA 4J11A 2CUZA 2I2AA 3FPLA 1P1HA 3AEUA 1J7KA 3LBFA 3ZLTA 1GIAA 1VMGA 1RXUA 1MO3A 1R16A 2EOAA 3KAJA 4YEDA 5ENVA 2B0CA 1WB6A 3UAGA 3QYJA 4WBNA 2XB6A 2Z04A 3BSSA 3OO1A 2P7TC 1DB3A 1TL7C 3Q3CA 2DQ3A 1QMPA 3BIJA 3HS3A 3OSUA 4QPJA 2FSVC 1OTYA 4PO1A 4URFA 1HW7A 3AHCA 5C8XA 1VARA 1M1YB 4MMXB 1FRFS 2AEMA 1ESZA 3DEIA 3E8XA 3PQ6A 4TYPA 4CLXA 5AVRA 2JH3A 2HK6A 1IJFA 5EMMA 2C98A 2C2HA 4I4TF 3UEOA 4AWBA 1T0PA 3B2NA 4KO3S 2RAFA 3EMKA 2CVLA 4FN4A 5KMGA 3RC9A 3OMNB 1Y1TA 4RKEA 1EIWA 2E3CA 2IZ7A 3SKXA 5D85A 4J80A 1CUIA 1YZKA 2HO5A 3TS1A 3SJAC 4H08A 2ZWOA 1D0SA 4P54A 5CLLA 2XADA 2PMFA 2ZROA 4E3WA 2YC2C 4E12A 5LNK6 1J5EB 3Q7PA 1QG2A 1YZQA 1UJ5A 1GPWB 2AXPA 3QMVA 4P6VF 3UA3A 1KU6A 2BGNA 2P8SA 3CZMA 5CR9A 3VRHA 1RCUA 3QO5A 1EINA 2G4VA 1J8VA 1SKUA 4FM0A 5EVCA 4FC6A 3QX8A 4P98A 5JIBA 1KJ9A 4MXDA 1TUEB 2C5LA 3DF9A 3QWIA 4WKPA 2WSBA 1YU6A 4BRUA 1YIDA 4KPUB 1G64A 4D81A 4EG3A 4MW9A 3U19A 1AR1B 1T9GR 2FWRA 1A8IA 4QFCA 1EWVA 1TJPB 2P6UA 1IOWA 1P91A 1WMAA 1ECCA 2WU1A 2B33A 3GCDA 3P96A 2O7SA 2ITCC 5L3DA 4NENB 1P9NA 3I0NA 3O8LA 4ZBMA 1BVRA 1P1JA 2AMTA 2AGAA 1EHYA 2GEJA 2IXAA 3R0PA 3MRSA 4JJ7A 4RTKA 2B9EA 2HZBA 2SHKA 2WJWA 3PQDA 3CEIA 4XDJA 2AC7A 4PLVA 4UBJA 3D01A 4C2AA 2PS3A 4KQGA 1RHRA 3L18A 5TB5A 5A4FS 2IYVA 3AJ9A 2D3WA 4CH4A 3DBRB 1Z5ZA 1JNXX 1S3SA 3I9LA 2A1TR 3Q8XB 3PLAE 2O8FB 3E7DA 3ANSA 1K06A 3KRTA 4YK7A 3ESYA 3NHKA 3AVOA 1R37A 3JQQA 4HI0E 1H6CA 3IC9A 1NW8A 2XV1A 4RTNA 2WB2A 3CX5F 1SZCA 2B21A 2ZUBA 3R0XA 4XZ3A 4K6CA 1W19A 2V54A 3W2EA 1XNRO 4MVRA 3NXKA 3QVGB 1NXVA 3AFNA 4LF8B 2P6YA 3G02A 5ARCA 1GSAA 3D3NA 3OY7A 5LC1A 3VJLA 3PHCA 2BFDB 3SHWA 1O77A 2FSGA 1QU9A 4G01B 4ZVPA 4N47A 1CK2A 1H2BA 3HJNA 4C7VA 1ZVKA 3F8SA 3T12A 4TUYF 3MRTA 5DWVA 2GFHA 2QAIA 4TMZA 1QGOA 4N49A 1X7OA 3ZGZA 3A1UA 3QKRB 5EP1A 5AP9A 5C51B 1OROA 2YC0A 1RHMA 5I6DA 4ZANA 5BMVF 3BE6A 1NQ5A 1RAGA 3N4YA 2X2EA 2O2CA 1RZVA 4Q4HB 2G82A 4QYTA 2ZS7A 4M99A 3UK7A 1J2JA 1RBZA 2WJGA 2Z56A 3FLBA 2WJ6A 3AEQA 4PFSA 5EZSA 3VI6A 1L1RA 4GEKA 3B1KA 4WLOA 1XEFA 4Z0NA 5EJ8A 2PUGA 4AN4A 1C0EA 1RC8A 1T1SA 2BFFB 4C4SA 2HV8A 2C3YA 4HDNA 1TPZA 4UCFA 1O94D 4ILKA 2HPZA 4KQHA 2N1BA 2YN0A 1O1YA 1D1SA 1I5XA 2VS1A 5F1KA 1PGNA 1AGXA 2GZ3A 1XCJA 5CX1A 1AVMA 1PNLA 4YP1A 4RWUA 4IFTA 3IEXA 1ZESA 3ZCRA 3GC6A 3PEVA 1QP0A 4Z9FA 1T2DA 3CG0A 5JZ9A 4BX3A 1NNEA 4BHTA 5FWXB 2AG0A 5L3VA 2C7PA 2ZQYA 1W0KG 4TYMA 3SGIA 2IBSA 3R9XA 2XW6A 1JG1A 1ZK0A 2I67A 3GFVA 4KWIA 4UNNA 2Y0CA 2A0YA 2B9VA 2CJWB 4PSUA 3QELA 4ZARA 5HE9A 3UFXB 4BP3A 3BEHA 2VC2B 4IKOA 1Z2OX 1JR3E 1C5KA 1QP8A 2W98A 3EVNA 2VZ8A 3DL7A 2P2DA 2WHEA 4BATA 1FSPA 2CYCA 1E5XA 1D1PA 5J9FA 5D5PA 1RXWA 4IYHA 1YJ9F 3NNNA 4MKXA 3STWA 4RJTA 1EH5A 4EHJA 2PZBA 2YHBA 2GESA 3DM9B 1TMKA 1XZQA 4BX2A 4HNVA 1MN6A 1W2BF 3O4RA 5ECGC 5FJIA 4HNQA 1HTBA 2FVYA 1V9CA 1XDBA 1FDSA 2XUGA 3AWIA 4WCDA 2G25A 4Z4HA 5KCZA 1QMGA 1R00A 4U6QA 3AK1A 4PYJA 5CLFA 1Q43A 2PF4E 2CVPA 1VRVA 1OT5A 4Z4FA 1X86B 3NNSA 1VXRA 2AMYA 3SPIA 2C7OA 4OHUA 4IXMA 4S04A 2GFIA 4F4HA 2VRNA 3NNDA 2YV1A 1E5QA 5JISA 2LGQA 1VMDA 3G0CA 5AW9A 3ROPA 3A8TA 3C3KA 3HVUA 1W2BU 4AI6A 3G5MA 1MEJA 1NBMA 4N0QA 4CQNA 2YZ2A 3TUZC 1FLDA 2YJGA 5DN6A 1A95A 1L4MA 1TW3A 4OHKA 1RQLA 2I6FA 1ONSA 1OA1A 4ENQA 7REQA 3O2JA 1USVA 2CBZA 4CEHB 3BFJA 4PG8A 2WYUA 2CXXA 5A4JA 5LR6A 1JWAB 1EFVB 4I1VA 2R65A 1DV2A 3FI9A 5G40A 3A1FA 2E85A 3BL5A 4FWBA 5JC8A 3WGIA 1E6LA 2BRUA 1USWA 3B78A 1QQTA 3JYCA 3R44A 1LX6A 3QKIA 3RS7A 4YT2A 5KQMA 2W0SA 3STUA 5H2FZ 2CVOA 3EDYA 1B3BA 3TZEA 4AMGA 2VSOA 3PNVA 3E48A 4P93A 4EHHA 3T9FA 2O7VA 1LK7A 1YE3A 4KDFA 1L4BA 1S4MA 5JSZB 1HT2E 3I1YA 4X7PA 4NWOB 3FDJA 1HMYA 3FCUB 5AVUA 1Y66A 3UPDA 4ZOLA 1X52A 2XMBA 3BAAA 2WDZA 4PN3A 5KQGA 3PCRB 5MF6A 1PHPA 2ZYTX 3PBKA 3UJ6A 4CM8B 2AV6A 3BGDA 4B3IA 3EULA 3ZH2A 3WVNA 3DEKA 3ZHCA 2N74A 2YBEA 1M5UA 5EC8A 3KV1A 4BOYA 3ZCCA 2C7GA 2WJHA 3CE6A 4ZVSA 1KKMA 2ZB3A 3H2GA 1YFJA 3KHNA 1DEXA 1ZUIA 1MOSA 3M6XA 2ZT8A 4FE7A 4RVNA 2JGLA 5GP1A 3SN6A 1MOZA 3UGKA 5CXQA 3KNZA 4YH1A 4BX8A 2Y48A 2R25B 4LXGA 5C5IA 3OM8A 2I1QA 1KA9H 3L1UA 1D4OA 3OM1A 4L9SA 3HB0A 3YASA 4W4TA 3ZS9A 1MVNA 2D74A 3S2FA 1RT9A 3VOSA 2PO5A 4DPLA 5DN6D 2QWRB 4N6NA 1T36B 3PHHA 3OJLA 3PQCA 2QD1A 4RPHA 4DS3A 5KX5B 3LS2A 4UDXX 4IEFB 1DIHA 1ZAKA 3ULKA 3ZHVA 1KYWA 1RA4A 4PNPA 4M8SA 5F2OA 5AVOA 4MW0A 4HDRA 2VS0A 1Q77A 3ILXA 3D6VA 4N03A 4PIVA 1U11A 1ZM2A 1GTOA 2HREA 4MP3A 4X3MA 2AC2A 3H6KA 1IC6A 1C2YA 2ZUWA 4X00A 1EXWA 4PQRA 4GOLD 3F5SA 4XXHA 1TAGA 4DA0A 3WBKA 2GTSA 5HXUA 3NOOA 3HZZA 4NMXB 4TLLB 1GTVA 2XAQA 3VUEA 1CR2A 3PGLA 3PLAC 3HJTA 5LP1A 3U60B 3FGNA 4GLXA 4UCQA 3W3AD 3A25A 4KR2A 4AG5A 3JSNA 1QHHA 2XUIA 5BV8A 1QR8A 5H5NA 3ZN1A 1A4RA 2G0NA 1JIJA 1P8AA 4C0QC 3IQGX 1M33A 3EWNA 2IT1A 2PEZA 4JPRA 3MYRA 4BIMA 1T34A 4W5OA 3ONEA 2QRLA 4Y2UA 5JAUA 1RE0A 4QULA 2VQFB 2ZRCA 3HU5A 3QOXA 1YIOA 2ZI5A 1NMZA 2AYZA 2PYIA 5K8TA 4XUCA 3I04A 1QV9A 1MFPA 4WPGA 1Y98A 5CB4B 2MU1A 2QUJA 2OFXA 5ICGA 5A3VA 3I2GA 5FT9A 1NVKA 1ZICA 4UHHA 3QBEA 3TNLA 1PT8A 4PXAA 2NXCA 1L7RA 3AK2A 3C3SA 1E1CA 2AK3A 4UDOA 5SZHB 4R50A 2WAYA 3NKVA 4X95A 2QEQA 3INRA 2IM9A 4K9LA 4OY3A 1IV1A 3O94A 1ZA2A 3O5AA 4DWVA 1Y8ZA 7MHTA 3E8BA 3SPHA 2R00C 3KXDA 3NEYA 1BG6A 1NJ5A 1Y3HA 1K08A 3QVJA 2DR2A 3NG1A 5EIOA 3HI6A 2BUBA 3DDZX 4JI2O 2Q5IA 2I4LA 1P3Y1 1EJ2A 1E7YA 3TQCA 3B7WA 1QTRA 3JPYA 3LP8A 5JXGA 4F6EA 2LCQA 2Q7HA 4OFWA 3AOEC 1CVRA 3FBWA 4TV8F 3ZQKA 3W5BA 1NT2A 2AUTA 1GSOA 3EIWA 4ZCSA 1AO0A 1FFAA 2Z2YA 4OKSA 4HHEA 1CJMA 1KAHA 4CF7A 1QCYA 2GASA 4CMCA 3H4MA 4G86A 3UG6A 3LUAA 3S3WA 2NAFA 4N7MA 2OBXA 4QUKA 1FFWA 5CCDA 1HWYA 5SY6A 4DLAA 4EWLA 5AVTA 1W59A 1H8HD 4QQ8A 1XYGA 4MPDA 2BUAA 4LAFA 4EKEA 1JHDA 4IIJB 2VXOA 3FOCA 3ONNA 2PKQO 4OMUA 4PLPA 4TSFD 2Y2VA 3RS3A 3TXXA 4RVFA 2W8BB 1MLDA 3RYCB 3SDZA 5ICCA 3TW8B 5KU7A 1Q11A 4IIBA 4MUMA 5B30A 4Z2YA 2ZJZA 2A9HA 3NRCA 5KJFA 5JRZA 3AU8A 1SQ6A 1X39A 1CDZA 2P2LA 3CF2A 4Y6SA 2XECA 2XQKA 1ENVA 2F59A 5D1NA 5J5AA 1HNNA 2IHUA 2QR5A 4NVRA 4KKVA 4ZDIA 3B5IA 2FZVA 3HB5X 1Z6PA 5F2KA 2Y2UA 5IYZF 3I2YX 3K71B 5IVKA 5A4DA 3B5EA 3B77A 3LDGA 4MGZR 3LWRC 1JS1X 1MJGA 1SUIA 1Q1AA 3KSRA 2UYGA 4YRAA 2CE7A 2B61A 4R5MA 3DLPX 4DV4B 4YIOA 2E74B 2PUWA 3DZKA 1AB6A 4MTCA 3PWSA 4DEXA 3FX7A 1D5CA 5I45A 1NUQA 2CXTA 2UXNA 2XODA 5BVHA 4X66B 1BHQ1 2HP0B 3ZHSA 2LGWA 1A69A 3BFVA 2XYGA 3BMQB 4YO8A 1BKSB 3ZRSA 3HB7A 1QLJA 2A8YA 3LF2A 1NY5A 3MQWA 2WU4A 3BK1A 3VR6D 3LHDA 3VC1A 4FFOA 4ZXFA 4BNKA 4GVXA 2QAJA 2O3SA 4TOIA 1ENPA 2I3AA 3OU6A 1NVMB 2VH5R 4A6XA 4N8DA 4ABTA 2PZEA 3EEIA 1P5RA 4YCAA 1J95A 2YTZA 1O7JA 2R9RB 3CY6A 1UUFA 2VYFA 3IVXA 3PJFA 3PRJA 1IH8A 3HH8A 2PKRA 3NC1C 3QLVA 3U7QB 4U7TB 3SQOA 4GLBA 4TSFA 4EJ2A 1SBYA 2LNDA 3R3WA 3DD5A 2IEAA 3Q3HA 4OHWA 5DBIA 1ZN9A 3AK4A 4DGQA 1UMCB 5AI5A 5B7PA 4JR0A 3KYDA 5D1HA 3ZHYA 1R4ZA 1UAAA 1BYIA 2HPAA 3IR5A 2UZIR 2X77A 4CHGA 2WAAA 1V6AA 1QU3A 4B71A 1XZGA 1BVUA 2NN3C 3SHQA 4IIDA 2G06A 2YV4A 3JD1A 4R1TA 1ZP6A 1REQA 1I7FA 1FYJA 3GI1A 1QHIA 3FB4A 5L8VA 4CM6A 4M60A 2O5CA 4H7IA 3K6SA 1QNMA 3WKAA 4FUTA 2QN2A 1FRZA 3TX6A 1CJBA 3JTMA 4X64O 4NXNO 1KNJA 1L2TA 4YDRA 3QSYA 3EIQA 1INLA 2GCOB 4Z9BA 4A4DA 2GBLA 1O5IA 4Z2AA 3GGOA 2Z1TA 5IYDO 1ZVQA 5IK2A 1NXTA 1R5OA 2SICE 3JX9A 5A3JA 3ZWNA 2F90A 5TISZ 2XASA 1NF9A 2BHRA 3PUYA 4FYIA 2ZT5A 4R68A 1J2EA 4CE6A 1R74A 2H1RA 4LTMA 2NNUA 3IBSA 3M3PA 1OCCB 5KYYB 5B7QA 4OQDA 3OFKA 4J0JA 2B1GA 1DZ3A 1T4GA 2IXBA 2W2LD 2ZQ5A 5J9PC 1VXOA 3W8NA 1U31A 1ILEA 2ZCJA 2OD2A 5KPJA 2NYAA 2I4MA 2PYZA 3D1LA 2ZYAA 3PWKA 5D86A 5HDBB 3RC7A 5BVHB 4IICA 1SXJB 1H3FA 4D5EA 1O89A 3FWPA 5NLLA 1EXVA 5GINE 1L4NA 4TL7A 4DLTA 3IP7A 3SJZA 5ADVA 1O8BA 2QU8A 2X5JO 1N34O 3EARA 2IWHA 3SMVA 4AP9A 3CC2F 2PH7A 4BAUA 2WSSD 5JADA 1N1DA 4CH6A 4JDPA 4N7RA 2DH6A 3PZRA 2ZJ3A 3CZCA 2C9CA 5KSPA 2FWJA 2NO5A 3VQTA 3D1JA 3IT3A 2NIPA 4X0EA 4AJNA 1SBZA 1SVIA 1E60A 1OA0A 3OT1B 4L6AA 5EQTA 1WTAA 1R7RA 1OV6A 4KNVA 2WQ7A 1T5BA 3ZV4A 2EKQA 1Q90D 4P80A 3VU9B 4KI7A 1SDSA 1C8VB 1GNRA 1NVXQ 2P27A 5IAEA 3NDBB 1QR6A 2I29A 2Y68A 2A1UB 4U7WA 1B74A 4XIYA 1U5CA 1O0BA 3JVEA 3KVVA 1H2HA 2OSVA 2ZF8A 3CUWA 3RAFC 2HBYA 2WG1A 1DCMA 1DP4A 3Q10A 3SQLA 4YRGA 3PQ8A 1M6WA 1SHZA 3GFSA 3I72A 4O8ZA 1F0PA 4ZOBA 1K9VF 1V45E 2IOFA 3U2QA 2QBYB 5CBKA 4IL5A 2FEOA 1XF1A 4BIUA 2BOCC 3EC2A 2NV6A 3MJEA 5DRTA 2J3IA 3ETLA 3EHBB 3B6EA 4KLCA 2RHDA 4HUQB 5DYIA 2IZ1A 3ZE1B 3OJOA 4UFPA 3GLGE 4NJEA 4EQ6B 4BMPB 4GSYA 4DSTA 3O0TA 4KPUA 3Q5GA 2O3RA 1XVLA 1FQKA 2RGNC 2F4NA 3H99A 1UK7A 3N0RA 2Z98A 4KB5A 4QJ3A 2HIAA 3AONB 1ZBQA 1UKAA 4IMIB 4RWZA 3IT0A 4W6ZA 3T4PA 5GTIZ 4RD0A 3WSTA 4G2KA 3I3SR 4HAIA 2W2XA 2JLWA 3R0VA 1UBTS 1T36A 1SC5B 3V32A 4G0WA 1USUA 2OHIA 3AY3A 3LNNA 1U0TA 2P9BA 2GBOA 3OCCA 2NP7A 1YVWA 1SIBE 3LW7A 2XB2A 3OA0A 3RWMB 3EGOA 4XH9B 1AHPA 1YR9A 1GTJ1 1ZN2A 2Z5GA 4JA0A 1L1QA 5KJ6A 2NU8A 3ECCA 3EZNA 2H1OA 1DT3A 2ZYGA 5JY6A 3GG9A 5LU8A 2VZ0A 3H9EO 3PE4A 3SEQA 1LQ2A 3UWDA 4WBNF 4NTWA 1UQUA 9LDTA 3ANMA 2IYFA 1YGPA 3ZD9A 1PVOA 3FD9A 5HFJA 2F9LA 3NTLA 3E2EA 2EF1A 4R7CA 3SXUB 1VI2A 1MFZA 4MQ6A 2R48A 5PGMA 3DV0A 1H5NA 1H1LB 4RJJA 3AHGA 5CITA 3KLMX 2G17A 1UMKA 3G8CA 2B6HA 2B2CA 4DSNA 3ZBTA 2IYXA 1YRYE 4YA6A 1WW2A 4B4UA 2YXEA 1ZYUA 1NDQA 2C3OA 3RVDA 4UXHA 2FF7A 2OCKA 3LHKA 4D6PA 1CZOA 2O9JA 3E4DA 4KMMA 1XSEA 1GM9A 4L8JA 3N2GA 2UU9B 4WCFC 2RARA 4KHPB 1PYOA 1P7WA 1IWOA 1JZSA 1E3WA 2PVPA 3QH4A 4QPDA 2J48A 3GZ4A 4M1KA 3N8NA 4D97A 2RGUA 3FTCA 1KEEB 4PC2A 2XNDG 2Q1XA 2JVJA 1YQTA 1CF9A 4YJFB 2ZJ5A 4GG1A 3FTDA 4DF3A 3CCRV 3FUUA 4BU0A 1JJBA 1YR1A 5FUBA 1QLNA 4Z1VA 4D3YA 2WUWE 3K04A 1A2QA 1HK7A 2NXWA 2PRZA 3CT6A 4KAFA 5TQJA 1AR4A 5EO3A 3RTDA 1G59A 4GIBA 1HT1E 4EHFA 3ZVMA 3M6VA 1RLIA 4IHQA 5FOWA 4DLNA 2RNBA 4XWKA 3SM3A 5IT9N 2HNKA 4J9UE 2ZJYA 4L28A 4DJEC 4NNJA 4EF6A 4IM7A 1T1JA 3W5DA 1N5DA 5J2TF 4MRPA 3VAYA 3B1WA 4ND6A 1ZGCA 1PJ2A 1CEYA 1Z07A 1NOKA 4QDJA 1ZM7A 1L6RA 2JB9A 3KKMA 3SYTA 1OW3B 3O6VA 3K08A 4PCLA 1J23A 2G28A 4TRJA 2NV0A 1GPJA 2H5IA 2WKPA 4GYCB 1KEVA 3M49A 3TCKA 4RTLA 5JYDA 2JFPA 2FNAA 1IURA 3MJTA 1N0UA 3FZGA 1E66A 2CXPA 4RKFA 1P2UA 1ZIXA 2WWTA 3R4CA 4OEHA 4R8LA 3LQFA 2CJPA 4JODA 4KAAA 4B17A 3CHXA 1TX4B 2RMKB 5CGQB 5HF8A 2BM9A 3HJHA 2XB9A 3JAKB 1D2DA 1I0LA 1RTKA 1ZXBA 3HCWA 3M82A 4Q15A 2O06A 3F74A 4NJOA 5F1PA 2AZDA 3ZXSA 3KQNA 2Y77A 1DJMA 2IG8A 2AJTA 3KT3A 1R8QA 4XLLA 5KTKA 1R5BA 1UANA 5JSZA 1EJ6A 4JP8A 1NHGA 1UJBA 4WVLA 3V9PA 1D7AA 2F8TA 1NUHA 4UBOA 1UWLA 1CB7A 1HYQA 5AHRA 3BF8A 2P9JA 4L3VA 3LUJA 1PKEA 1BWPA 3LVQE 2G72A 3WA7A 3ETDA 2PXAA 2Z9CA 2HA2A 3BSFA 3B1XA 1K3UB 1O9HA 1NPTO 3FWHA 3OJ0A 1X3SA 4KE9A 2AOUA 1EIZA 3CG6A 1MX1A 3GWOA 2VK2A 1PX2A 3QHQA 1D2HA 5UKDA 4A6EA 3QYFA 4MQBA 3WK4A 1MHTA 4FFBA 5JJNB 1L5OA 1J22A 2P1DA 3BWBA 4MW7A 3VBEA 2YHIB 1YFKA 3IPCA 4FPPA 1JXAA 3PC6A 4MPRA 5JD3A 1GU0A 4HPWA 5KSYA 2RK4A 5GM2A 5MGNA 2BEVA 3OQ6A 2H54A 1BRTA 3K0AB 4Y1EA 1AP6A 1QHEA 2QN7A 3NT5A 1A8QA 4TKUB 1K89A 1FTSA 4NDNE 1VI6A 4I2VA 4Q3EA 1T8UA 2J9RA 1MSWD 1GTMA 2OR3A 4AECA 2W2KB 3U40A 2QA4V 3LL7A 3G0IA 5AXAA 4C6SA 1NN1A 2P5YA 1M9NA 2YVLA 2WSSG 3IIIA 2Q7OE 2P9GA 5EMKA 1CR4A 1Z7BA 2WG0A 4K6KA 4GMKA 2WOJA 4JVSB 1W88A 2ARHA 4IL6Z 3RSSA 3A0BZ 2IYNA 1EJBA 2G07A 3AKYA 4ASUG 4K5QA 2JK5C 4TLEA 5CAEA 1KXJA 2ECKA 1ZCBA 2HM7A 3FIUA 3IDFA 4L08A 3G8YA 2GFQA 3JVDA 3K8ZA 3OCUA 5J5VA 3RO7A 2ECQA 2B94A 1B43A 1CRWG 1TM3E 4OTZA 4PC7A 3FB1A 1FP7A 2AC4A 3DBRA 3OAAA 2HKOA 1KQSF 5P8WA 2VATA 1NWHA 1OXSC 3TDNA 1YKFA 2V58A 4LMBA 3OEHG 3CJTA 4ZQEA 3WP1B 3T9CA 3N0VA 2XUZA 4B6QA 3OQOA 3M34A 1H5UA 4LJ9A 1FQOA 4DEVA 4A0QA 3K5OA 5K0CA 3H6HA 4HYTA 2Q2VA 3CURA 5EZ6B 2YICA 5KYXA 1QIIA 2ONJA 4R3WA 3V7QA 1A76A 1K4YA 3KOXA 5AIBA 4BASA 2P7IA 2NNLD 5DNWA 3O7WA 2A1TS 1NW9B 2WM9B 3ZD6A 3GRKA 2QAGB 3HXTA 5HWEA 4ZPXA 2ZB4A