3HKBB

Tubulin: rb3 stathmin-like domain complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Variations in the colchicine-binding domain provide insight into the structural switch of tubulin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 132
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3hkbB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3hkbB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3hkbB01
1W5BA 5FNVA 3VO9A 5BMVA 5KX5B 2RHHA 1RLUA 3RYFB 5KMGA 3RYIB 1W5AA 4IHJB 4ZOLB 4DXDA 4WBNB 4O4JA 3N2KA 2R751 3JATA 4LNUB 3RYHB 4O4HB 5EIBC 2RHLA 5IYZB 4B45A 4O2AB 5JVDB 1RQ2A 4U3JB 1FFXB 3R4VA 5ITZA 3JAWA 4O2BA 4B46A 3RYCA 2VAWA 5LA6A 4O4IB 2XKAA 1SA0A 3JAKA 2Q1YA 5CB4B 4TV8B 4X1IB 4ZHQB 3JASB 3C8LA 4X20A 5FNVB 4EI8A 3WGLA 4O4LA 5JH7A 5EZYA 5KMGB 4EI7A 4EB6A 5IJ0A 2VXYA 3RB8A 1RQ7A 4O4JB 2RHOA 3N2KB 3JATB 1W5EA 4KWEA 4TV9A 4M8IA 5LYJA 3UT5A 5LOVA 4YJ2A 1Z5VA 3VPAA 5LXTA 4TUYA 2BTOA 5J2UA 1W5FA 1JFFA 3HKBA 5EIBD 5LP6A 3JARA 3M89A 5ITZB 4X1KA 1FSZA 3JAWB 4HNAA 4O2BB 4X1YA 4DRXA 3RYCB 5JCOA 4U39A 5LA6B 5MN5A 1SA0B 3JAKB 3VOAA 5IJ9A 5M7EA 5JCOC 4X20B 5J2TA 5CA1A 3VOBA 4YJ3A 3M8KA 4O4LB 5JH7B 4I55A 5EZYB 5BMVB 2R6R1 4EB6B 5IJ0B 2BTQA 2RHJA 3JALA 5LYJB 3WGJA 5GONA 3HKCA 1TVKA 4EI9A 3HKEA 3ZBPA 3HKDA 3V3TA 4TV9B 4IIJA 1Z5WA 3E22A 4FFBA 4I50A 4YJ2B 5EYPA 3UT5B 5LOVB 5LXTB 3N2GA 4TUYB 2VAPA 5CA0A 5J2UB 3ZBQA 4I4TA 1W59A 1TUBA 1JFFB 3HKBB 1OFUA 3JARB 4X1KB 4HNAB 4X1YB 4DRXB 5C8YA 4F6RA 3CB2A 5LP6C 5IJ9B 3ZIDA 4ZI7A 3WGMA 5JQGA 5J2TB 5CA1B 4YJ3B 2Q1XA 3WGKA 4I55B 5KX5A 3RYFA 2BTQB 3JALB 5GONB 3HKCB 1TVKB 3RYIA 4IHJA 3HKEB 3HKDB 4ZOLA 4XCQA 2XKBA 4WBNA 4IIJB 5MN6A 3E22B 4FFBB 4I50B 4LNUA 5EYPB 3RYHA 4O4HA 3N2GB 3WGNA 5CA0B 5IYZA 4I4TB 1W581 4O2AA 1TUBB 3VO8A 5JVDA 4U3JA 1FFXA 5LP6B 5MN4A 5C8YB 4F6RB 2VAMA 4O4IA 2GVIA 4ZI7B 5CB4A 4TV8A 4X1IA 5JQGB 4ZHQA 3JASA 4E6EA
chains in the Genus database with same CATH superfamily
1K7SN 3VYTC 4WCEV 3T5DA 4EABA 1NIPA 1RSOA 3EQ8A 3WKAA 2I8LA 2D1RA 4HH0A 2GN0A 1E79A 4BBZA 4A2WA 4BMYA 3VPAA 4WJLA 3DBHB 1P4JA 3TPZA 3EGDA 4I99A 3QEBZ 3K70C 2JH8A 2A94A 4M21A 5AW8A 2GVDC 2A8YA 3OU2A 1ZJ5A 3GH3A 2OAQ1 2RGGA 4EG5A 4WFFA 3ZU2A 1UANA 1PVDA 2OA0A 3O38A 1B0UA 4LSMA 1X86B 4XGNA 2PKXA 2A1TR 5FTJA 1XK6A 4C0BA 2REBA 3CMAV 3I9OA 5CK4A 4N8SA 4OX9B 4M87A 5HX7A 3PICA 3ICWA 2NZ2A 2OK8A 3G59A 3NUZA 2BR3A 2A9HA 5DXJA 4PAOA 1ZVQA 3KSUA 5ECDA 5FOQA 2PLRA 2Q6TA 2H0QA 3WL8A 5JS7A 1ACLA 3E48A 1D2HA 4MROA 4IILA 3N0RA 3IE2A 3H5OA 1AO0A 3ZQ6A 4ZRDA 5AVXA 3ELYA 3FVTA 5BORA 1SVIA 3CX3A 2BR4A 3CNBA 3IQDB 3UKOA 2P8SA 2H54A 1Q92A 2LCIA 3O8QB 1NASA 1A5AB 4I81A 4UNIA 2GPTA 3O75A 4ZIRB 3GEPA 2ZTVA 3OZAA 1O95D 3BGSA 1MX5A 2IIPA 4O33A 1KU9A 1UDCA 4P53A 3JQEA 1S7CA 5IDWA 4L95C 1CN7A 3N28A 1ONPA 1SU6A 4OJKA 1XCGB 3ESBA 3WWPA 1V26A 1ICIA 4JOCA 2R2GA 3IEMA 3NR7A 1XHXA 4NPAA 4PQYA 2QN2A 2ZXUA 1Q90D 5AVOA 1EDDA 1VE7A 3U26A 5BOSA 3Q7TA 1HRDA 4N7JA 1MXFA 3F97A 3GPDG 4AKGA 2AUNA 5ENZA 4Q3KA 3W3AA 3T9FA 1CJBA 4NOLA 5BN1A 5HFJA 2PZSA 1ISJA 4QEKA 3VGPA 4YAGA 4OOFA 1I2DA 5DGDA 5FPSA 3OWXA 2E48A 4CQMA 4DWVA 1I1OA 4C4YA 4E5YA 3FGZA 1LBHA 2ZYVX 4Q4AA 5BN3B 4QPPA 1I7FA 2CXOA 2QIOA 1T5LA 2ZITA 1WHTA 4BN5A 1W36B 5KA6A 4KIUA 1KH3A 1UBUS 1Y80A 5KDLA 2A7XA 4FYHA 3G6WA 1QHGA 2AWOA 5CEFA 3QY9A 1YZUA 2Z2XA 2W48A 3A9WA 3LUBA 4ZVSA 4G25A 5J5CA 2NUBA 4DW1A 1YRWA 2ADFA 1RYEA 1V16B 3TW8A 3V46A 5JISA 1D3AA 4ZVPA 1DRKA 4ENUA 4IG4A 4X1IA 3R3SA 1RPJA 2Q49A 4I7EA 1BIFA 5B1YA 4M60A 2WFZA 2PXHA 4YMWA 3B9QA 4M86A 5AK3A 3GLIA 2XCIA 3HACA 2PI4A 1FXVA 4LF4B 4URHA 3OM3B 4BNMA 4ZVRA 4V2IA 2DFDA 3KKKA 2ILVA 2XVYA 2B4KA 1Y4SA 2AL7A 2ID9A 2VUSA 1Q1EA 4AO8A 3ADBA 3KEMA 3KT6A 1G6HA 3WRVA 4MIEA 2ORWA 1Z22A 3WGJA 4Q3EA 3ROTA 4PHZA 5CVJA 3Q8MA 2ZFUA 3VTAA 3ZWDA 2FFHA 1ECCA 4QT4A 3ROZA 4DLPA 1DPGA 2AEEA 1M1UA 4R8SA 5LP1A 2YXNA 2YJ6A 3G7NA 1YNOA 4M9ZA 1RYZA 4ZBMA 5KI6A 5JANA 3O9OA 1RWKA 5DCWA 1E0DA 3ZWYA 2FE1A 2XAGA 4JXKA 3LYLA 3SPHA 4NBWA 4XARA 5FCDA 3LGAA 1P1JA 5JC8A 3UAOA 4ZYYA 3AW8A 1HE4A 3ZJZA 3DAYA 5LQJA 5LZ9A 3F9RA 1NR7A 2OHFA 1ZPDA 3ZD9A 2F7SA 4OXYA 4Q9DA 1W25A 4ZCRA 1IBRA 2DERA 4NARA 3QX3A 3P9QA 3PQ7A 5FUBA 2VH1A 3ISVA 1SXHA 3JD1A 5GADl 5HKBA 3ZY2A 4HWOA 1E9VA 1G1XB 4LMAA 4PG4A 2AE1A 4E5VA 5FBLB 4NI5A 2WWYA 3AI7A 1Y9JA 4ZARA 1SBZA 4CW7A 4CG2A 2VSYA 3TRHA 1TMKA 2PSEA 3DT6A 5EJ6A 3KQPA 4YTEA 5LCXA 1EXWA 5EJ9A 2W6QA 1SXJE 2GBPA 1PM9A 5CTJA 3O84A 4KLCA 3FPAA 3L6DA 4PO3X 3LHKA 1V7ZA 2FEOA 4EY4A 3D64A 1X39A 4FEAA 1SUBA 3WMFA 4ND3A 1O4WA 1MN6A 2VNAA 2ZM5A 5L45A 3GRAA 3EXFA 1EUDB 5AD1A 1WXGA 3OOHA 3IUQA 1F51A 5AKXA 1W5BA 1XDUA 4U6SA 3HUEA 2GAIA 4DXDA 4M53A 1I7NA 2GZRA 3TXSA 3NHBA 3AM1A 1WKCA 1UOQA 4BNLA 1K2WA 3BHIA 4R1LA 3U7GA 3C8LA 4Z5XA 1VJDA 3ENWA 2RC6A 5I7RA 1KS9A 3DC5A 3H3JA 4NE7A 2X8JA 2V1UA 4R6XA 2O3TA 4AZTA 3SSAA 2BD0A 1OAKA 1JDTA 4DV3B 1A77A 4FBGA 4WEQA 3H2YA 1M2OB 2WT8A 1ZEMA 5EQFA 1TCBA 3U5ZB 3GNQA 2DQ4A 3QF7A 1NOJA 1UAYA 4D9CA 5DW3A 4L6CA 5I6DA 3R3XA 4HB3A 1XZLA 4J94A 4BVAA 1TW3A 2CXSA 2AYXA 5CYOA 1UFVA 2QROA 3L0IB 2VO1A 2LIVA 5L3CA 3A1NA 4H6WA 3W1WA 2H4ZA 1AQYA 2VIIA 4KEAA 3JAMM 3T2MA 2ORVA 2J4FA 1W88A 5JYCA 1OFHA 4WBNB 2R48A 1GO3F 2J6BA 1XUQA 2L82A 2EILB 1BVHA 3TGUH 4RD4A 2GZSA 2Q5EA 1OLUA 3BMQB 5LHHA 3R20A 4GR9A 2CK3A 2QKAA 3URKA 5CD1A 3PLAC 4QX6A 1J07A 4IRXA 1EFLA 1RQPA 1IAVA 3ZIAA 1LLFA 1V71A 2FOXA 1JQ5A 3S27A 3B82A 3WHKA 2BTUA 5CXSA 1G1MA 3BX1A 1KYZA 3BRQA 3I2YX 7GPBA 3IBTA 3H17A 3QPWA 4YCJA 3ZWPA 3FYUB 5D5HA 3TXYA 6ABPA 3ZWKA 3EEBA 3DVLA 1B73A 4BEJA 5HKOA 3CR3C 3GZJA 1Z83A 1QG6A 4X62O 3AFOA 4E3WA 2H3OA 1E63A 3D7MA 3M6IA 3RS4A 3IVRA 2JVDA 4EKNB 1E9BA 5F52A 3PCXA 2BI4A 4WK0B 2OV1A 1C50A 5AVVA 2AC4A 2J5KA 1P77A 2W6JD 5LMCA 4XPIB 5AK0A 1MD9A 4WA8A 4QBHA 3EGVA 1IHYA 2B2NA 2EG5A 3C48A 3C3KA 1HMPA 2MW2B 4P80A 1NI3A 3D54A 4C2TA 3GLGA 4JVNA 3LYUA 1ZY2A 4CT5A 5HZKA 4YI3A 1PZEA 3IR6A 4F2DA 1KGSA 2F4VO 4QE9A 1L7NA 3HN2A 4BQPA 3BDVA 3ZX6A 3PNMA 2B83A 3U3ZA 4FS3A 3LDDA 1ZHFA 2HHHB 1IJFA 4MVJA 5BVGB 2FUG6 1GN8A 4MUYA 3TG8A 1SXGA 3ONFA 1PNTA 1IATA 1DF4A 2HXGA 2ADMA 2PKWA 2OCHA 4B6OA 3FTFA 2VNSA 5EP4A 4Q6BA 3G2JA 1QP8A 5KIAA 1C3LA 3M9XA 1T9KA 1V1RA 2PY5A 1RRMA 4JU8A 3KD2A 4EW2A 2OBMA 2C83A 1KORA 2H92A 3DQQA 1UM9A 2JARA 1YI8A 2WLLB 5TGTA 1FBTA 3ESCA 5HXUA 2YXDA 4B5KA 1L7OA 2FKNA 4F4CA 3EQ6A 2P3LA 3IUJA 1C1XA 3CN9A 3G2KA 3F1LA 1MVLA 1SIBE 3FOZA 2WIGA 4B3MO 2FB5A 1SBCA 4LOIA 4FC7A 3KLNA 5IK2D 1CUVA 3FPKA 5ADVA 1AGXA 4I9GA 5E7IA 1GA1A 2N42A 5KNBD 1ONSA 4EVQA 1B7GO 5JALA 1UP6A 3TNDA 1RI4A 2C59A 1Z18A 3FX2A 4E12A 1Q6YA 3SFVA 3G4SV 3SMQA 1YQUA 3IJPA 1MEJA 3L41A 4ED9A 3FX7A 3U5TA 5FUQA 2BJWA 4CH4A 3V8NA 1TLTA 3PPVA 2VQFO 3FAZA 4IXTA 4PZUA 4HVAA 2IJGX 4MB0A 1OTXA 2H1OA 5MN6A 1PRYA 1EDEA 5ALGA 4QDJA 2JGUA 5H82A 3HB5X 2PKQP 1S2IA 2PUAA 2CMKA 3CCUV 1FQKA 4AW9A 3AV3A 4RPJA 2OZLA 2QT1A 2DJVA 1L8OA 1YB7A 2HV8A 3R9XB 4HH1A 4A82A 1B6TA 2A4KA 5ESXA 2YASA 1CR1A 3W90A 5DGXA 3E3MA 1I3KA 1YRAA 3RHTA 2G71A 3PPYA 2HYIC 4ERNA 2PZAA 1MIHA 1YJNF 5CBKA 1VQPV 4QUKA 2ONJA 3GJZA 2ZRMA 4CU5A 1NW5A 5FYDA 5EIOA 4KI7A 3ELDA 1YHQV 3U3MA 3P9PA 4D9KA 4R2KA 2V7TA 2E21A 4PWYA 2ZUFA 1E3SA 4LRSB 4XM2A 1H94A 1IBMB 4J7UA 4LOLA 3T4UA 5C1DA 1Q16A 4US0R 3B5IA 3G4SF 1XL0A 4LWSA 1D6JA 3O5AA 2GBOA 121PA 2I4LA 1C30A 4Q18A 2O2IA 1XNRB 1YHNA 2IZZA 1VBMA 2X0EA 4BWGA 1BU5A 1RWNA 2IJHA 3LA8A 1GM5A 2QEXF 4HI0E 1HNXO 1YMUA 4DV5O 1HORA 4MVXA 4G63A 3A0HZ 1SVLA 2X14A 2PUTA 3M8AA 2CLCX 2EP5A 1QB8A 5CYFA 4PHCA 1KKLA 2WG0A 2PPLA 1P80A 4KAXA 2IHNA 2WAXA 5L6LB 4HAMA 4PAMA 3A31A 3GJ5A 3PD7A 4NAVA 4QO7A 1KZ9A 4UMVA 1Q12A 4M98A 4EKEA 5TNXA 3RAPR 3FUCA 4G2NA 1TKCA 1KQGA 2JFPA 3CZAA 2H1LA 2WD8A 3I0MA 1N6PA 5JRZA 3IAS6 2B3TA 3WLOA 4K1LA 4J1TC 3FLAA 4TV9B 3HB3B 1JALA 5EYPA 2JVIA 2H11A 4GI1A 1Z35A 1XTTA 2VPYA 3IV6A 4KLZA 1R64A 3TDKA 2E6UX 1NNLA 1CVIA 4FYKA 4YREA 3C70A 4CM4B 1UF9A 1MSDA 1Y6FA 4CR6A 3OQIB 3VSBA 3Q8KA 3JWPA 2QNIA 4Q7EA 1JXQA 3LP8A 5A04A 1PFWA 4OU5A 1QVFU 4WV3A 1SQVH 2FR0A 2JS7A 1H6CA 2ZVYA 2V0CA 5JEEA 3ZR4B 1KNKA 5FPKA 1SKBA 1UBNA 4LCBA 4XUCA 5KNDH 1R0BA 4BFYA 4ISCA 1Q22A 4JV5B 4ZAYA 3SC6A 1E7YA 4GVXA 1WSDA 2LXNA 3KSZO 4KR6A 1EFTA 4R8KA 3CLTD 2IVFA 1T3ZA 1XXLA 3RTGA 2JIZA 5TMBA 4G9GA 3SM3A 1T0UA 4A2CA 1DUVG 3TOVA 1NF3A 4PWTA 4F9TA 1GAXA 5HPYB 1K6JA 1R8SA 3BSSA 4GXQA 4PIVA 2PZGA 1YKSA 2Q4RA 3ZK7A 4TUYF 1G291 4TT3D 4G4ZA 4MRVA 3HI4A 5KHOC 5HJ5A 3O47A 4JBIA 1V8FA 2FMTA 4UTPA 1YT5A 4H0LB 3BIOA 1K68A 4DMMA 1W7AA 1OXVA 1PD3A 1HKHA 1A95A 4L07A 1TM3E 1Z5NA 1XAHA 1LXCA 2B69A 1TXGA 3C1AA 3K9LA 3LUPA 3ZK9A 4IMJB 1BXZA 1S8FA 1AGYA 3EFOB 2OM6A 3LMKA 3IGAC 3T4ZA 4H6XA 3E58A 5KTTA 3B8MA 2ZZKA 1GZDA 1JWBB 3OD4A 2XGSA 3CQ9A 3MOIA 4J1TA 3WGOA 4FNMA 3NBMA 3PRJA 4TXLA 4YB8A 5P8WA 1JFFB 3KXDA 3DLIA 1H2NA 1RM1B 4LF7B 4GSLA 1V11A 3LPDA 3MELA 2UVPB 4XB1A 2WUEA 4NBNA 2YCBA 4AN1A 5KPDA 1TB4A 2IE8A 1ZZGA 4Q82A 4X8OA 2D1TA 2XQFA 1EINA 2BFBB 3UJDA 5E0KB 4I36A 3TR6A 1WUKS 3I34X 2EEZA 1E58A 5CG1A 2XJ9A 3PUVA 1GNPA 1OZGA 3IERA 1MO3A 3PYLA 5DNAA 5J5AA 1GTL1 3MCVA 3U3RA 1YZQA 4NJMA 3IEVA 4I7ZB 5F9HA 2QUKA 2C4TA 4JSYA 4GX0A 1XA0A 5BYBA 3RF6A 2HQOA 3ABTA 4FWTA 1V8ZA 5DV9A 3ABRB 5JY6A 1GQQA 3VOBA 2XYPA 1TEZA 2ATKC 2ZUWA 3UUFA 3NHKA 3H0CA 3EMDA 2JLSA 2VBIA 5FI1B 4IFTA 2UXXA 1E4EA 4GGPA 1R7RA 4E3ZA 1N57A 5EKTA 1UEIA 3E9RA 2R9AA 2A9VA 1TUBB 1G7RA 2BI7A 1OBVA 5ERXA 4XR9A 1UEXC 1ZNZA 5HJ7A 3RWBA 3ZU5A 2JS5A 1AQ6A 2FZVA 5CIYA 1DELA 1XZAA 4GEGA 3TZBA 3DNMA 4FTWA 1PQ4A 1HFEL 4CBVA 1P0QA 3AM5A 1TCCA 4TLEA 1ADYA 4N48A 4EZEA 4BNNA 3PEFA 2G4CA 5G4UC 2ABWA 2HTEA 3LT5A 3SR4A 2RKOA 4ZRMA 4EX6A 1ESMA 3LJKA 4DR2B 1N6HA 1DINA 2P7IA 3ZJ4A 2P2GA 3AJEA 4X93A 5IDVA 2BYTA 2JLUA 1YDEA 5AVZA 1UBFA 2GCOB 2P40A 2GN1A 4BVFA 1XLVA 5ED4A 3N3BC 1HT1E 2BDEA 2OXRA 4EKYA 1QRSA 1VHTA 4JTDB 3F7VC 2P9BA 2ISCA 3PWZA 4ZYUA 3BYZA 4DRYA 1NV8A 1BW9B 1NNSA 1P7PA 4P58A 1LQ2A 2CDRA 2CHEA 3W0LB 2BGKA 4JVOA 2OKGA 2B7LA 3KCXA 3BZWA 1QUFA 3JYHA 3I9MA 1XTSA 1XFDA 1ESCA 1BQ3A 4NB5A 4LCEA 2HR3A 3BD7A 4M1EA 5IKMA 621PA 4JSTA 4AFNA 3RFRA 3AJDA 3I9JA 4P92A 2HWXA 2TSYB 4RK7A 4M0MA 4ZHSA 3BJIC 4YXWG 3V1MA 3COWA 3D3QA 3A37A 3UPDA 2CBXA 4ND1A 5CX4A 1ZUWA 5BQPA 1X7WB 1GTZA 1SQ5A 1JIUA 1UT5A 4H1VA 3B8EA 2ZRJA 1OX6A 3R7LA 5EXSA 4KWHA 2F3PA 3W5SA 4DSUA 4ZAGA 4HX2A 2IHZA 4EKGA 1MB3A 3FSRA 3ND5A 3ZHCA 3S2IA 2B20A 1M75A 4MSWC 3D0QA 2QM8A 4YJFA 1CDOA 2XUHA 2GEBA 3O85A 3AHGA 3AINA 3E5MA 5A1JA 2PMWB 4IX1A 1YR6A 3ZS8C 1MMFB 1HK7A 5DBFA 1X70A 3P2IA 2XT9A 4NY1A 1OYWA 3I9LA 4H7KA 4QQ8A 5I7WA 4JJ8A 1XCBA 5JJKA 1W4LA 4UXJA 5HKKD 1H0KA 2WFLB 2HJFC 1EN5A 3DLHA 3JS5A 2GASA 2HFKA 3DMDA 3GXBA 4AM8A 4YR7A 2AOUB 2F3TA 2A35A 1Q7BA 3GCDA 4JI7O 4RTJA 4EY7A 4NU8X 4IS2A 1Z38A 1MCZA 4YRKA 4DE5A 1LRKA 3G2MA 3S8EA 2Z09A 4ISBA 2G70A 4N12A 4BVLA 1QU9A 3QY0A 4L8WB 4LRYA 1XLWA 4UDOA 1V6AA 1O1YA 4XQCA 3CF2A 3M1IA 2ZYSA 3MCZA 3PBKA 1A2QA 3C3AA 2JS3A 3AMVA 3ZE7A 5IXJA 1VB3A 2HIHA 4EF6A 5I9MA 2GA9A 1JDNA 4GL2A 3T9CA 2YIMA 3FBTA 3W1VA 4JLJA 3E6AA 3LY7A 3SQMA 2RBEA 3VQTA 5LZ2A 1B8NA 1G98A 3QEAZ 5E4TA 4PQGA 3VOSA 3BABA 4KQGA 1DIOB 4D96A 1RQ2A 1KO8A 2L69A 1U3WA 3H87A 1M7HA 4GWKA 1G9XA 3SICE 1I0LA 3SYMA 1KEVA 3GA7A 4LF6O 2AG1A 3IAUA 1CRPA 3BH0A 4I1VA 3RS7A 1R10A 4NFSA 2Z4SA 4L15A 3P2MA 1XXHA 1CEQA 4EVIA 3LBYA 2AG0A 4NAHA 5KCZA 4JZKA 4IINA 2HP8A 4OMCA 3OT1A 4O6VA 1OWPA 1RI1A 1U0LA 3IDOA 4YMIA 1EFRD 2P9HA 1HWYA 3PWTA 2VDOB 2JBHA 3DTVB 1RBMA 3DP9A 3OIVA 2OYRA 1FU8A 2CTWA 1XZMA 4KGZA 3SJCC 1PT7A 3VA7A 5IKXA 3TL6A 2I55A 3ZS8A 3I01A 5CPBA 3M1YA 2GTIA 3C39A 5ALRA 3E9ZA 3HJTA 1F60A 2ZIUB 1GN4A 2F66C 3B2EA 2Q8PA 2EP7A 3K8YA 2X1MA 5B1DA 1E1DA 2OVFA 3V4SA 3UTDA 1JR3E 1OH6A 4J4TA 2QE7A 3ZDFA 2PTHA 1R8YA 5G0UA 2R6JA 1IFXA 3CCVV 4YHBA 2HA3A 4MJLA 1I7SB 4PBSA 5AKZA 2PMBA 4A6XA 4XBFA 5E6RA 3U7RA 3T9AA 2HT1A 3UMRA 3TI7A 3KZNA 3PC7A 2WNHA 1U9YA 1XCMA 3DE6X 1IQPA 5EWJA 4JUBA 5K05A 1DB3A 4P32A 3RNLA 5BR4A 4Q1BA 2GXUA 2EVWX 3OUZA 3RVPA 3QO8A 4LPKA 2ZBFA 2P06A 1N1GA 1X59A 4XVRA 1JP7A 5JQGB 3A2NA 3PEYA 1WMDA 1JIJA 4M4SA 1XCPA 4O4HF 3CE2A 5D6OA 1L4HA 1TYAE 4XJSA 3VNAA 1US8B 1KYOF 5SYAA 3M5WA 4BVBA 3H1FA 4J0DA 3HAXD 4BIOA 2E4WA 2Y67A 1MB2A 4V0KA 5LQDA 4AD8A 1GZHB 1WW8A 3QGMA 4B3SO 2ZZNA 3TD5A 4LC9A 4P0QB 1LC0A 4X63A 4CF5A 2SNIE 1R9JA 3K4PA 2E5LO 2JZOA 3OOSA 5LQSA 3PLNA 5LDDC 1G5PA 1BMTA 2KX7A 4DPMA 2YJNA 2EGHA 3G67A 2GKSA 5K3FA 1NPTO 3K3WA 4V2UA 3LQRA 2BOBC 4G3XA 3LUTB 5EZSA 3DLPX 1N33O 3NBKA 4EB0A 5A4FS 5C7OO 2ILMA 3SJCA 4GKKB 4EGJA 5AUPB 2I6QA 5EQDA 1G2OA 1YS1X 2DPLA 2R85A 1ZXXA 1VYTA 1PZNA 1AXGA 4LKOA 3TQCA 3VHXA 1NXVA 1PGPA 2MU1A 3EF3A 5M5BA 4QTYA 1UBKS 2WIDA 1EM6A 4GEKA 1RHUA 5GWXA 5BV2P 3LVRE 2YZNA 4X20A 2OFOA 3MHHC 3UF0A 1QHHA 4ZQBA 5H1YA 2BJVA 3KTAA 1XMPA 1QJCA 4QE3A 3DFIA 1GTMA 3ZGNA 1AI7A 4Y9SA 2Z6VA 2P3OA 3D4NA 2QLFA 2JEXA 1RQXA 1ZRSA 3MGCA 4YGXB 5LA6F 3CJTA 2IHJA 2BE3A 4RHCA 3OPYB 1Y8ZA 4LJ9A 4EYSA 3MS2A 3V4LA 3LO5A 1TZCA 3M4YA 1I0IA 2OXEA 1MIOB 4WFHA 3JZDA 2WPDG 2OHGA 3CLRC 4WW0A 3LUHA 1E62A 5LQUA 3W2EA 4MRNA 3BEHA 1Q1GA 4OK6A 5ALXA 3OAAG 5F2OA 4MHTA 1E1KA 5DECA 5I7HA 5AJTA 1LF5A 2WOJA 3CEHA 1O6FA 3L1VA 3M4NA 4GBGA 4URYR 5DYTA 4KOEC 3BICA 2PH7A 4Z3KA 1DUSA 1S5HC 1QTIA 1TEHA 2R96A 4COKA 1IWPB 2P41A 4B6SA 1KIFA 3CBQA 4WKBA 1BX1A 3VAZA 3HCPA 3S1SA 4OG2A 4NJEA 3VTIC 2HUNA 4A0QA 2CZGA 2O0JA 2YY5A 3F8WA 2EX3A 3TVTA 5CA0A 3HA7A 3JQ9C 1S01A 1C7IA 1IN5A 4R7TA 3UGKA 3ETEA 2I7XA 3WWYA 4A16A 3OLZA 1X7XB 3OEWA 3BTVA 2X5NA 3WIEA 3DYVA 1SF9A 3ELCA 1F2UB 1C0PA 2N75A 1FCJA 1GTG1 2GPWA 3UBTA 2XEDA 3OCVA 1HDCA 1X3LA 1J90A 4GKAA 2ORED 4O3FA 3WB1A 4EDHA 4IGAA 3X44A 1P31A 3JVUA 3IQXA 3ICPA 3L0CA 5ESWA 3A0BZ 3KYIB 2AJ8A 1GNLA 1N2CA 1WOMA 5C8YF 3OX4A 3A14A 1OZFA 1U0FA 1W0CA 1A1SA 1X1QA 1N0UA 4LP8A 2WSSA 3UMJA 2NN4A 4RJKA 1JX6A 1QFJA 5GJBA 1RHMA 1SHKA 2UUBO 4LBEC 3HJGA 5H7XA 1U1EA 1IMOA 4L3OA 1SDSA 4BFWA 1ODTC 3F6CA 1H6DA 1DXYA 3WQHA 1AP5A 4FK8A 4BECA 3G13A 5KYTA 3PNOA 1FYDA 2M1XA 2RI1A 5EIEA 5IZ4A 4DMFA 2IUYA 4CLHA 3EIHA 4BAUA 3ERCA 5DN6A 4PC7A 1F48A 1B23P 1AGNA 3ZV5A 3BS4A 4F3RA 2DB3A 1FRVA 3G0GA 5JS6A 4G5FA 2EBWA 1Q57A 3WK6A 3RH0A 3TLXA 3N2LA 4IXNA 1YVRA 5AHRA 1L5ZA 1NNEA 2RHWA 4RKEA 3SPIA 4PNZA 5AM5A 4QSHA 4LTDA 4F84A 3DBHA 3MRXA 3TK1A 4TV8B 1I7LA 1W36C 3EW7A 3ZXSA 3PFIA 3RVQA 3HTXA 2NVBA 4AKEA 1XPRA 5HIKA 1NFQA 5ELLA 2O0HA 2KGWA 2QTRA 3FOEC 2BIFA 4LJ8A 2CF5A 2RCVA 1T3HA 1EVEA 1O6ZA 2QVLA 4U5QA 1H2XA 3K6SB 3DE0X 5BR1A 4PLPA 2PX2A 3GAFA 3LDUA 3HGQA 3TVDA 3JQ9A 2HQ1A 3C1OA 2F9FA 2GKGA 3QOWA 4DL9A 5FORA 2W58A 4BB5A 4RANA 3TETA 2FQQA 1ZL2A 3CWQA 2E82A 5DRTA 3X1MA 3EDCA 4M1MA 1V3QE 5HYVA 4IIJB 1V8DA 3AUUA 4O8ZA 4QYXA 5FQOA 5BN5B 4OQNA 3AILA 1U3DA 5EB1B 2XGMA 4RVDA 5B8FA 4M6WB 1Q81H 3W04A 3FOFC 1G8HA 4LZWA 2PZLA 3FSGD 3O8QA 3S5JA 3M2PA 3LQQA 1V55B 4QM6A 5E7JA 4I9FA 8GPBA 1VRCA 2I4OA 2WV9A 3PP8A 1OSNA 2P1DA 3AG3B 4FFOA 3UO2A 3VX4A 4B6FA 2WSBA 1VRVA 2H2IA 3OUSA 2UXNA 3QPBA 5FPHA 2FU5C 2NYRA 1V7PC 2OCDA 5K9ZA 1VQMF 1DRUA 5K3CA 1X19A 1J0DA 3V42A 1JGTA 2LIPA 2DJIA 4EH1A 2XODA 4Y18A 4K0KB 2JF0A 5AOCA 2RJZA 3RC8A 3A0RB 3T52A 2VPXA 1ZK1A 5KAPA 4I1OA 3U44B 4Z51A 1RQRA 1JFVA 2X86A 5IT5A 3RA5A 4BGEA 1GV0A 4GW3A 3UPTA 1CNFA 2A5FA 1CRLA 4CDGA 1Q2UA 2ZJFA 5KNBH 5FTMA 3L7YA 3LECA 4DEXA 1SCDA 1Q0LA 2RAVA 1CY1A 2QJFA 3HJAA 5BN3A 3T7KA 1ZMTA 3CWBH 1GA6A 4DCPA 4PJ0Z 1SVSA 3BMOB 4E94A 4GP7A 4JITA 4C4AA 4MLCA 2BGWA 4GFDA 1JU4A 1X80B 4ZQIA 3C6MA 5ARDA 3SKXA 4DR5O 1W1UA 5LGUA 2CMHA 2I91A 4UCXA 1GV1A 1W47A 2J41A 4WOPA 1V16A 4E33A 3CCRV 3WLNA 4P22A 2YV2A 5C35A 1CR2A 3TSOA 2DBVO 1KJNA 1ORQC 3ZE2B 3T7JA 3CKKA 4L0DA 4CF4A 1V8BA 1E0SA 1J0AA 5A3VA 1NW9B 3DP7A 3QVSA 4Q1AA 3T1HB 2JFXA 1UR5A 2UZAA 5JW6A 2QKCA 1YBHA 2IJIA 5F3WB 3WYAA 2G7ZA 3J7AR 4W8HA 5DOZA 3D3JA 5C1OA 3RAFC 3EA0A 2HA6A 4RA9B 1VQ4V 2ORYA 4KITB 1LJ8A 1SQBH 1V35A 4FMCB 3CNLA 5AIAA 1J2EA 4LYYA 4DJJA 5IT9N 1EEXB 5EY5B 2ZB4A 3A70A 3GZNB 2I33A 4DARA 1IXZA 2CNLA 3DBRB 3QVJA 3VYSB 5IF3A 1IMJA 2BUAA 3KHNA 4TYMA 1K9MW 4X6LA 3WA6A 4MTLA 4NTWA 3V48A 1MC4A 3HR4A 4RFLA 4M9RA 1BXKA 4BOYA 6AT1A 4EKDA 1GTRA 4BVGA 4P4NA 2ZDIC 3I37X 5LMNB 1KOFA 3N07A 3P10A 2X6RA 1J99A 2AIZP 2H2DA 3E86A 4JGIA 2XYRA 5DMXA 1EA7A 3QUSA 3SZLA 5B1NA 1CEEA 5C5CA 5A7FA 3W5CA 4N6OA 2V54A 5L3EA 1QNLA 4F3KA 4LV6A 3BREA 5GONB 4LGVA 1Q11A 3L75H 4FEYA 1GAJA 2OFFA 4ZPXA 5JXHA 5HRUA 2NZWA 1IOVA 2YHIB 3CVXA 1HRKA 5EERA 3TI9A 2P2ZA 3GUYA 1OZ0A 1VQ4F 3FDXA 4X85A 2EILC 4J03A 1SCKA 5A2GA 1Z2NX 2W8BB 2QX8A 4U7WA 5G4KB 3RK4A 4B3IA 2GTHA 1P2SA 1H1DA 2O8CB 4GLJA 4NYJQ 5EMMA 3W2IA 3A6PC 4K9PA 4NCXA 4UAJA 3G3EA 5B4VA 4X3PA 2YC0A 1WG8A 2IE0A 3R0VA 4OKIA 1X1SA 4TSFA 1I5XA 1THMA 3G2NA 4NU5A 2ZK7A 4BKPA 1Y42X 3OFNA 1ABEA 2QSYA 1FKAO 1PZFA 1ORWA 1Z2PX 1MG0A 4Q1EA 3QXSA 3FYUC 1T8UA 4GBMA 4FKMA 1TQ2A 3MHTA 1EUDA 2XWQA 4B3CA 4XD7D 2A0FA 1EXNA 4BMNA 1MAUA 4ZMRA 3ZE6A 4NPCA 3TCKA 2V1DA 1AUPA 3HXLA 3G6BA 2QGNA 1VJTA 1T91A 1QH8B 1HTWA 4WIAA 3RBZA 2VFAA 1R0KA 1ZWZA 1KETA 1T5EA 4Y9TA 4WKPA 1KMHB 1RD4A 5F51A 2H4XA 2PUFA 2FUEA 1NUQA 4JLPA 5AXDA 1K3UB 4URXR 4U8GA 3MZ0A 1DC5A 1M2OA 2JFYA 3RFVA 4LKRA 4KDRA 2YS7A 2DEUA 2ZDIA 4HLQB 2WU8A 5B58C 2V5VA 1KJIA 4MGYR 3TTUA 5BMVF 1P4AA 1AP6A 4ESOA 4KVZA 2FFRA 3ZHZA 2COKA 2I3DA 1A9RA 4XVQA 4YAFA 3L92A 2EW1A 4UCUA 3DYBA 2BEUB 2EQBA 2BKEA 1VKOA 1CRZA 4TKVB 4HWSA 3CMAF 4ZT5A 3FYEB 4GRDA 4X71A 2CLLB 4LQLA 1RI5A 1PIWA 4EW1A 4ZTZB 5THKA 2O0MA 1IXYA 3F3YA 4KE9A 1U3VA 1BRMA 2E85A 4K6GA 3EWAA 3BRWD 1UJMA 3L6UA 4WBNA 2ZB2A 3SZ3A 4DLVA 3JVVA 3I6YA 3E1GA 3H5IA 4PC3A 4FB4A 2H4FA 5FAKA 4U7GA 1II9A 3EGXB 4W5JA 4L3WA 5F3RA 2JI9A 3BMQA 2JDID 4PZZA 4D0RA 4LXQA 3BE4A 3CBGA 2VCYA 4IIXA 1UPTA 4GD3Q 2G80A 5FIUA 5FNZA 3MT8A 1KI9A 1ZMRA 4YONB 9MHTA 4RD1A 3NTXA 1PUIA 1HT0A 1TZ2A 2AFHB 3N0WA 4OGLA 5CU7A 1G19A 1M0SA 2NUTB 4Q3NA 1ULSA 1U8UA 3T5BA 1LPAB 3H2BA 4YDQA 5IWAB 3TW4A 2QUIA 1MORA 3UHFA 1VMGA 2XRZA 3FYUA 3OX2A 3V1YA 4QUGA 3UA3A 4CE6A 2ZIXA 3U4DA 1DSSG 5CNIA 2QTAA 2QN6A 1WB9A 4L27A 1S3IA 4HB2A 1J7JA 5JMTA 1Z62A 1P72A 3E4DA 4P36A 1Z25A 2DPMA 2QAIA 1RT9A 5DU2A 4ER0A 2DULA 4YRAA 5B1BB 3K0TA 4E6EA 1X9GA 2V4UA 1C3VA 3OI7A 4XPIA 1VKNA 5B1OA 1ZJJA 3SJBC 1VMAA 3ZGYA 2EJVA 3L0PA 1Q1QA 2H5IA 3GLTA 1PVVA 5T57A 2BHTA 3B89A 4P54A 1KFBB 1K8ZB 1EUZA 2WLSA 1BVYF 4QGBA 1S2GA 3AUTA 2WLIB 3JQ8B 3RFXA 2NLJC 2IK8A 3TOXA 4BNYA 3SR0A 5BVGA 4TVKA 2WT4A 3ZCRA 1VB5A 4H37A 5T4BA 4HNGA 1VM6A 3CY6A 2FH5B 4KIJA 1N8RH 2TMKA 3I39X 2HO5A 3CE6A 3CF0A 5CLIA 2VRNA 3RROA 3HJCA 1ZSNA 1DBSA 2YZ2A 3TBKA 4XSVA 1ZH6A 1SVNA 4WKCA 1U7DA 3ECAA 3VR0A 2WLLA 2UZIR 3TLCA 3EDRA 4GF5A 4CQLB 1KYYA 2CWDA 4YEDA 3ZG6A 4C07A 3EYAA 3P9IA 1MHPA 3U4MA 3WBBA 1HOXA 3OD1A 5J4HA 1KI3A 3UFXB 1Y3AA 4UTOA 4MWCA 2YOGA 2QRHA 4MQ4A 4L22A 3AOEC 1A1VA 4GKJO 1TA9A 1WB8A 1Z15A 4EB6B 1S76D 4UAVA 4BX2A 4U9HS 1EJ2A 2JGIA 2O8DB 4F9EA 4KUMA 4HNTA 3UJCA 1OH8A 5IJ9B 3THYB 3O4FA 5F4BA 3QIVA 3ZNOA 4EUEA 4GI2A 1Y7LA 3LS2A 4X8LA 3R9XA 2H8GA 2WWGA 2JAUA 1UFIA 2WQ6A 4FE7A 4BMXA 2AD5A 2V6JA 5B1IA 1FLVA 4K87A 5BSEA 5HIJA 5LB4A 5JSHA 5K8JB 5D01A 4LMPA 3EZ9A 4JI4O 1EJ0A 3MTAA 3SJBA 3OT5A 1ZLZA 1EM1A 1I51A 4RVNA 3U1VA 1WXFA 4ZVOA 2RONA 1DVRA 4LDJA 4Z4QA 2NNUA 4INPA 1NYRA 1KBOA 3OHPA 4Q66C 2A9PA 3G5AA 1J5EO 4YCDA 2MYUA 1ZAKA 3FYTA 2PLFA 3F0DA 3UXEA 1CQZA 1P44A 4CJXA 2RHGB 2H8CA 1N0JA 4F9FA 1V1MB 5H4GA 1SUEA 4Q9IA 3REOA 1GFZA 4N5NA 3GTZA 1Y81A 4QDKA 1T8WA 2WF5A 3MQ4A 3GIDA 3KS9A 2OYQA 4EHDA 5CCXA 1MTOA 3H0KA 4LYEA 4NU0A 4ZGGA 4HEA6 2BFCB 2CKDA 4UEJA 1YCDA 4DVJA 1SESA 4PLWA 4QJ4A 3O95A 4X66O 4BT5A 5IYCO 2QWNB 4LK3A 2XIQA 3RFFA 1YE5A 5LUBA 3QPUA 1JDSA 1MZEA 2CL0X 1SK8A 4R9VA 3LDHA 1ZN8A 1XPUA 3FFBA 1UINA 3SQLA 4RJTA 4E2LA 3TBHA 7MDHA 3NP7A 3PNPA 3NX4A 4TSKA 2MYNA 5HY1A 5KTRA 4G5RA 2AOTB 2Q7XA 5FV7A 2K9PA 3P2OA 4TV9A 2OGZA 3AOEA 5JNUA 1HA3A 1Z36A 3GJ3A 3NIWA 1N3YA 1AKNA 1RM1C 2PFGA 5CXUA 1CJMA 3G8CA 5G1PA 4MVCA 4CM4A 1NVWQ 3UYKA 4RQFA 3OQIA 4OK5A 1QFXA 2ID4A 4DMRA 2LBWA 3VBBA 3GA0A 3UJ3X 2VHEA 2LWIA 1XTPA 4A5SA 4D3FA 1JIQA 1USKA 2Q1WA 3MOGA 3P2EA 3L71H 8ABPA 1FRQA 3RASA 4B2PA 2QTBA 5H5JA 4D4HA 3L18A 4MWOA 3H2SA 2C84A 1IOLA 4BGVA 1CY4A 1D03A 3W4IA 2V7BA 2KSDA 1FTYA 1YFJA 4L0MA 3K53A 1EMDA 3ZD6A 3KOMA 2W6ID 3K0HA 1KVQA 2R70A 1EESA 1V4NA 1ZHHA 1PV1A 4B4OA 4PLFA 2OCPA 1X7HA 4L5BA 3N2IA 3ZN2A 1C7QA 221PA 2R62A 3MBIA 3UFBA 4PRKA 2VRCD 4V1CB 4H0NA 1XROA 2R1TB 1JWAB 1P17A 2O1XA 2ZXWB 1JZSA 1HR0B 3F7TA 1W34A 4TZ0A 1ZCJA 3NHYA 1N4CA 4TKLA 4PNPA 4DPLA 4FFLA 2G9NA 3D3KA 4P7FA 2BGUA 1FQOA 1QB7A 3EFOA 2FP3A 5DHSA 1A8PA 3PHLA 1Z8DA 1C3EA 1TUEB 4R0VA 2CTPA 1A97A 3H16A 5HP4A 1EK0A 3SE0A 4ALNA 3PQCA 3OCXA 3EX7C 3AESB 3LC7O 2EV9A 5C7IO 2DWCA 3KD3A 1OAAA 2BTOA 5IJWA 4YGYA 1JFFA 3N3AC 2UVPA 1VIVA 3V4OA 1XZJA 1HFJA 3A32A 1SB8A 3C8MA 5J47A 1G3UA 1YHYA 3VPHA 3MJHA 4PRZA 2HK7A 1BROA 4L0CA 1GO2A 4TXJA 4NNOA 5BSRA 3FCYA 4OI2A 3J81k 3V7FA 2BFBA 4ITVA 3LBHA 2Q1XA 2BZ1A 2PX0A 1OYYA 3H97A 3AK4A 3BILA 5JHGB 2ATXA 2Q21A 6NULA 5IVPA 1JHZA 1C4OA 2ZI7A 2YXEA 1HYQA 4KH0A 1KEKA 3VSCA 5CDUA 2AG6A 5DIZA 2UYKA 3M6XA 4X0EA 2VH2A 2CVFA 5HKLA 4RF2A 5C8DA 4NXMB 3OC6A 1C80A 1Q8RA 3SSMA 1R8JA 3JQGB 2XUFA 4KQFA 1QVVA 2YS8A 2Y05A 3FF4A 4KKVA 1D9ZA 2C9CA 1LBQA 2L17A 1L2TA 4HMOA 2J3DA 3BCUA 3LU1A 4KN8A 3FETA 3R7WB 3HO1A 4KIFA 1E2EA 2WYIA 1MAAA 4PRYA 2JAOA 3U13A 5DYNA 4JTCB 2CSUA 4NECA 2EZOA 2X15A 5TE9A 1TUBA 4WFJA 1KUQA 2DR3A 1YDXA 4IDAA 2V7EA 2PUSA 3FTNA 3CCUF 3FYSA 2CB0A 2H65A 1TZJA 4QPDA 5CBGA 3Q11A 5A9GA 3I3OA 4ZGWA 3LV8A 3VC1A 2R5FA 2C3UA 4D99A 3SDBA 2PT9A 5AK6A 5KX5B 1Z8NA 4HVLA 9GPBA 5DEDA 7AT1A 1VQPF 3V2IA 4L1KA 5KWJA 1YHQF 1UBRS 2FUG1 3DEZA 2GCOA 2RHOA 4Z9BA 3WWCA 2Q5QA 4LXHA 3T80A 1TKBA 1SA0B 2ZNIA 1BW9A 5I7OA 1SCIA 2SECE 1PPJH 3EVTA 2QSZA 3HEAA 1FZTA 2XUPA 1KZHA 1ZI8A 3O4VA 2ZZMA 4Z7QB 1NS1A 5JJIA 4WN9B 5DHPA 1PD1A 3EHBB 1JHUA 4QULA 4LQCA 5H3CA 2X1VA 3AM4A 5DM6V 3HFSA 3H86A 3N86A 1X0VA 4G97A 5T6BA 1HLFA 3DA8A 4DNQA 3BSYA 3NFYA 1TPYA 1TLLA 4ARBA 1CUBA 2CXQA 2BFWA 2EJ7A 2XB4A 4JYMA 2K2QB 5I7SA 2H2AA 3V8VA 3H13A 3GU3A 1ZD1A 1X7WA 3F6MA 3WYGA 3JZMA 1SJ9A 3H8VA 2J1LA 4X3CA 1CY2A 3JR3A 5ELXA 4JA0A 1V6CA 3G6EV 2QG9A 3D6VA 4YDSA 1KK1A 2JJ2A 2QUZA 5A9SB 4J1NA 4DSNA 1GNQA 1GOTA 4IGEA 3FVRA 4LXGA 3UAXA 2WU4A 1D7OA 4JC8A 3OEEG 4E03A 5FOVA 1SCJA 2C7BA 3K0AB 1IG0A 1HDXA 2I22A 4ID9A 5BNWA 2GZHA 2I7DA 2YWDA 2YN0A 2FCAA 3H5VA 3QPVA 1IZ0A 4OSEA 3CGGA 4DABA 3DEAA 1DKQA 4Y30A 2B6NA 3C8DA 4ZEVA 1RYNA 1EB9A 3SE7A 2Q1SA 3EZ7A 3ENVA 1QIMA 1E2HA 2WYVA 3K2EA 4J75A 4Q05A 4LSWA 1LLQA 1F4LA 1GEEA 4PYJA 3IFXA 2R9IA 3SZOA 2BZ0A 1K5PA 3AUYA 1Z47A 1RP1A 3LDAA 4KRXA 1H7MA 4J76A 4GX5A 3KJHA 2NT3A 2NTVA 3L7JA 1J70A 2AOUA 4CLRB 5MF6A 2YWXA 3NTQA 4U6NA 3I64A 5FPPA 3D0KA 1U5CA 3VJKA 3S0HA 2J4CA 4P38A 3KQWA 3MT7A 4INAA 4HNSA 3JVDA 5T4HA 3KYDB 3F4KA 1BHJA 4KPYA 2O5VA 5FBZA 4LXXA 4B47A 1PFQA 3O3NB 2NSJA 1CDDA 2XUQA 1VCIA 1E6EA 1ZM7A 1U6KA 5DNVA 1XA3A 3VPGA 2V4DA 1VK3A 1UXHA 2WWRA 1LQUA 4KUEA 4NEHB 3WG7B 5DI9A 4ZAWA 3HYCA 3PQDA 3O2QB 4JLWA 1RJDA 5LKAA 2HSZA 3QQ5A 4CKEB 4PZLA 1PR0A 1DEAA 1RAGA 1V95A 2WEKA 2ZJAA 3Q5DA 4DW0A 2UXDO 1HMYA 3OQ6A 3RLFA 4PBRA 4DGSA 1JUDA 5L95A 3IAS1 4O0MA 1VQKV 1E8DA 1U9CA 2VTBB 4U7NA 5DTRA 4EMBA 5DX0A 4JFAA 3HXOA 1I8TA 4BEBA 1DAHA 4KIGA 3VR3A 4I9HA 5AHKA 3GFQA 4Z0TA 4DA8A 3L0YA 3PITA 4O4IF 2CNNA 4XIGS 4RVHA 5AG2A 3U56A 1VPEA 1GRNA 4G81A 1H9BA 4E4EA 3CMMA 3GHHA 2YV3A 1YZFA 4JEHA 1YRBA 3DTVA 2V8BA 1KQPA 4JNCA 1IY0A 3TD6A 5C5IA 2YXBA 4I3HA 3AWDA 1G5IA 4MUGA 1NZ6A 4MARA 1COWG 1AKVA 1GCAA 1BZYA 4PG6A 821PA 2H4JA 2QWRB 1I1NA 2YCLA 4DBLC 2QP3A 3U7IA 1GNTA 4BP9A 1ZIXA 2GAFA 2OMEA 4IJQA 2GDZA 4X9XA 4GMGA 3V2UA 3QUTA 5B4UA 4D4GA 2YI8A 4ASUA 4UFNA 2SCUB 2MT9A 3GLRA 1XN1A 2RGBA 1O6CA 3OM8A 2JGEA 2FSUA 3PR3A 2OB1A 5DIFA 1AF7A 5B3LA 3KSDO 3MPUA 4RTPA 2ZAYA 4PV1B 4F0JA 3FMOB 1W0KG 5K1PA 4IL6Z 5I9TA 1ZXLA 4CG3A 1LKZA 1L5RA 2IUTA 5H4HA 3WLHA 2HYDA 1UDRA 1D2RA 3ZI4A 3VH1A 1NLYA 3AI1A 1SUFA 1QPBA 8LDHA 1DTOA 3QUQA 2DZDA 4P7JA 1N2HA 3QWHA 5JQGA 1VZ3A 1V2GA 1P61B 4JUCA 1VSQA 3PE6A 5K7SA 5ALNA 2ZD9A 3RS0A 1TRKA 1US8A 3MWEB 3EPKA 2ZE5A 2X5OA 4ZI7B 1U2ZA 2A58A 5I9LA 3RUPA 1XC7A 1VL1A 1J9ZA 2R6GA 4I6EA 2WIKA 4BX3A 5KYNA 2R2AA 1A2KC 4HAYA 2IY9A 4HX9A 2PSJA 3E8MA 3PS9A 3VXKA 1XTQA 3M99B 4ETNA 3H7AA 4CIXA 1X92A 2Y0DA 2FSIA 4E5UA 1XBIA 4BNTA 1FLNA 5CB4F 3V6LA 3DO6A 5DVZA 5FBRB 3IA2A 5BW6B 1ZJZA 1XTUA 4BJHB 1RVDA 4UCTA 2IZ6A 4DDUA 2WJGA 1HEYA 1QANA 1DC3A 1MA3A 3MLBA 4Q4LA 1H5UA 1ANKA 4B87A 3CNEA 3IE0A 5BMOA 5JNVA 1I3OA 4MDHA 2QSAA 2FK8A 1GR0A 4L5JA 3ETGA 4IRMA 2Q68A 5D3KA 3GFRA 4MKRA 4BWAA 3GJQA 1TC2A 3E05A 3KL2A 4NABA 5ALJA 3W7UA 4CT0A 3R77A 5ICCA 1A8IA 1D2EA 5IJXA 2F17A 3EARA 4BX0A 5E7QA 1IM5A 1U7ZA 1U81A 1IZ3A 3TXQA 4OBWA 1Z4MA 1Z73A 1EJBA 5JVDF 4TTVA 1OBCA 3NGXA 3OPYA 3Q8WA 3OMNB 4D9HA 1E94E 2DUUA 3DEIA 1IZ7A 2QN8A 1XU4A 2O14A 2XPCA 4URUR 1MIOA 1P60A 4MPTA 1YBVA 3MA0A 2F93B 3W9UA 2RGYA 1EGVB 5DLPA 2PLNA 4G88A 2XNDD 2JJ1D 3OMLA 3WGNA 1WMAA 4R1SA 1W0JG 1W87A 2YN2A 1B93A 4WXPA 2C96A 2EJRA 1FFWA 4C0QC 3WNZA 1OXXK 1KHTA 1U9JA 4UUQA 4V3CA 5AXCA 5AVRA 1SC9A 3HL4A 3ABZA 2HVKC 4J11A 1GZ5A 1A71A 1YFLA 2BM0A 1WXHA 4B75A 3FWNA 1CE8B 1O54A 2WILA 4UQLA 5CLJA 2VF7A 3RSFA 2I1QA 1SC1A 3UKDA 1BCCH 3PNLA 1X7XA 3CVOA 3V7NA 1JS1X 3KBBA 3RSLA 1VF6C 3GRZA 2OIEA 4IJKA 1O5OA 3KZOA 3RTBA 1F2UA 2ONZA 3HVKA 4LOJA 3OT7A 4D9EA 3LI2A 1NC3A 4JXJA 2P9QA 5DXFA 5BUZA 2XUMA 3AX6A 2IBZH 1YQWA 3E7FA 3Q6NA 1F0YA 2AMLA 4YWJA 2IZ7A 1YXBA 4DDWA 3JVHA 3IKLA 1ORTA 4WY2A 1QVWA 4CKXA 2X5KO 1V55C 3CP1A 3C16C 4P9PA 4K9LA 1X7ZB 4JR1A 2ZTSA 2OGUA 1O97D 1DIGA 3RYHB 4WKGA 2DE0X 5L8VA 1EGQA 3N2EA 3AG3C 3TQHA 3ZGZA 2XKAA 3L8FA 4MAMA 3TRDA 3NIDB 1I4TD 3T1TA 3MFYA 1WZ2A 2RGWA 4AC9A 3FIJA 4TXHA 4FOOA 3J80M 1N75A 3A05A 4EPWA 3RV4A 4OSPA 1UUFA 2P2NA 2FMLA 2VLBA 4OP3A 4A8TA 5CVCA 3CX4A 3ESQA 1ULHA 4LI3X 4OHOA 3SOZA 1N1MA 4Y7DA 4D9NA 2I76A 4IDFA 2Q4TA 3ELBA 2IYYA 3RV3A 4NCBA 3KSAC 4EJ2A 4OREX 4MMZB 3DFMA 2FZCA 3ND8A 3RJ5A 2Q6AA 3RRZA 4P8RA 1IXBA 521PA 2Z8ZA 1P6UA 3D4PA 5EGSA 1YONA 3QVNA 4L0QA 5TF4A 3VDMA 4TV8A 1ULAA 2MDTA 1E96A 2GDJA 1T4BA 1MENA 2RHHA 1R5NA 4YK7A 2ZVPX 4KDFA 4X45A 3I2JA 3UMFA 3WNCA 3Q7IA 2ZREA 3AR9A 1R37A 2OUIA 3RSCA 4MYSA 4JD5A 4GI7A 1Z4NA 3NJRA 2Y1OA 3O92A 2IQQA 4BXOB 4ZZ0A 2VRZA 3K6SA 2VTVA 3FIUA 3CCVF 2H6EA 4GLOA 4W5NA 1NC1A 1EX7A 2IIVA 2FMIA 5BR8B 4MMXB 1WCV1 2BTEA 3ROGA 3QE3A 3IURA 1R0YA 2JFOA 3ZDAA 1FXWA 1VF6A 4RPIA 2AQ8A 1SR8A 3K7EA 4XWTA 4IFEA 1QONA 1QLNA 1O77A 5E2AA 5CW1A 4IIJA 1XRLA 5M7EA 2WNSA 1M0WA 5BP7A 4N3GA 2RC5A 5BN5A 3AL0C 4JL5A 1JI3A 3DZDA 3VDXA 4ZZ1A 3C3XA 1GUZA 4NONA 3T7TA 3B48A 4US1R 2XBMA 2Y0EA 1IHUA 4M6WA 4P4SB 3WJQA 1WZNA 4MUHA 3C3JA 1JEYB 1ORIA 1NMSA 5LP6B 1XDDA 2PSSA 2EZPA 2V7UA 4GPD1 5F5LA 1G5QA 3EQ9A 3VYSC 4ARZB 2J87A 3CSDA 3ED5A 4WXRA 1W85B 4DHWA 4DQLA 3H9GA 4UEOA 1QE5A 1AQUA 3AV0B 5AHXA 3CCSV 2A9QA 4HAZA 1FJGO 1RBZA 2DUJA 4TQUS 5JXGA 2E87A 4C3ZA 3OZSA 1PJ4A 3T3HA 2XB2A 2ATCA 5EJAA 3R7BA 2ZJ1A 3VOTA 4UV9A 3A0RA 1FFCA 1DZ3A 4NCNA 1SVUA 3U44A 1IZ9A 4FN4A 2G67A 3GVXA 1CY6A 3E83A 4OXQA 4B48A 4NWIA 5CFPA 3VVLA 4UNNA 1JXMA 1VIAA 4DRXB 1YJQA 3K5WA 2R8XA 2ZQMA 4BO2A 5CURA 2YIBD 3R7NA 3I5MA 1R6TA 1J8FA 4IZIA 2OCIA 4MQUA 3TDNA 2W8BC 5DISB 5ICGA 1Q50A 1R0SA 2E3JA 3BMOA 3MLAA 4EHJA 3UVEA 4GDFA 4I50F 3IPXA 3A58B 2DQSA 1OXBB 1X80A 3D6TB 3KOZA 1ZUHA 5D2CA 4B4VA 3ABKB 1C8LA 2C2OA 2VP6A 4WZBB 5KQPA 1TC1A 4KAJA 4LBYA 1CZKA 3IDZA 1PZGA 4B3JA 1UBJS 3M2TA 2VEOA 2BLLA 2ZI4A 4RAOA 3SU8A 3WDMA 2E89A 1D5WA 1M57B 4RA9A 4KQIA 3V8BA 1ZH4A 4M37A 3IEIA 1MRNA 2PX3A 1FP1D 5JBQA 4G2KA 3NASA 3OJXA 3GZNA 3E0XA 1JT2A 1IPHA 1HZJA 3DBRA 4B6GA 1KY5A 4I55F 4JLAA 1BE3H 1X9IA 3DZKA 1Z5PA 3ADPA 5DWDA 3VQVA 2IX9A 3ADOA 3HXMA 3KJEA 2HO4A 1KU6A 4N0QA 3L40A 2Z56A 2NZVG 2XTZA 4B17A 2FSHA 1IIBA 4YXFA 1LVHA 1GFIA 3AL3A 5K3BA 4Y9RA 1BOOA 2Y76A 4DZRA 4C7VA 2IW1A 4IIGA 3L9XA 1KNQA 4R8RA 3M6MD 2I99A 3PGKA 3KQNA 3OFSA 1ODKA 3CPWF 5GONA 4XVUA 3ZBPA 2LP4Y 4WJZA 2YHIA 1HDZA 1DWQA 4UVHA 4YJHB 3KYCB 4ARCA 2BPOA 2GGSA 1A9OA 4B3DA 2PXCA 2W8BA 4LQ4A 3A9RA 1W2WB 2QEQA 2ZKIA 1YVEI 1BCSB 5G4KA 4RK0A 1O9HA 2FN8A 3LY5A 4DY6A 1YL7A 3A6DA 3IP6A 4ZT3A 1WWKA 3QKUA 2BHNA 2J5BA 2P69A 3HSYA 3RS5A 3DWIA 3DCJA 2J33A 4QLAA 3JQQA 2IEGA 4CXMA 2GHTA 1VHQA 1Q1BA 1RTKA 3OZBA 4J90A 3ES9A 4CIDA 2R86A 5IAKA 4BLVA 1G8JA 3H8JA 3RGWS 1YJWV 4RJIA 1TF2A 1E6KA 4ZMBA 2JCBA 1R00A 2JBWA 4PO8A 1MA1A 1E66A 1ORVA 1PEYA 1ORRA 3MUEA 1J09A 5JJEB 3WAGA 3CZPA 1QH8A 4HMQA 4CKWB 3MCUA 2V7QG 1FNNA 5B1BC 1PNLA 1MU0A 3NV7A 5DGIA 4MA0A 2F48A 1COZA 1KMHA 2IV2X 4DIEA 4ZIRA 3Q3GE 2W2NA 2RCNA 4YRLA 1L1QA 4QOSA 3HO6A 4OGQB 2ACWA 2QAJA 3VDRA 2G9QA 3EHEA 4BLOA 5AK4A 3I83A 2VDLB 4XGKA 3JYPA 2ODBA 5BWLA 4HV4A 2RI0A 5HCIA 1GGVA 1SZPA 2UZ1B 4EB3A 3KE8A 2BEUA 4HQ0A 3TTXA 1HL3A 5KB3A 1B14A 3RIEA 4TKVA 1U7UA 3NRBA 1UH5A 5SYMA 1FNBA 2DHEA 1TZMA 4DLAA 1SVMA 3NT4A 1EWRA 3NVDA 4MIOA 2CLHB 1YJWF 4D2IA 1L4KA 3AUXA 3GPCA 1N2XA 2JA1A 3NAZA 3KKOA 1NAHA 2MJLA 1R4MB 5LOVB 3L5KA 4P33A 1N8KA 1ADJA 5EMKA 3KEGA 3KKLA 4L28A 2M6LA 3OOEA 3K79A 4Q5IA 1Z2EA 3RK0A 1O08A 3EGXA 1G66A 1ZK4A 2QVYX 5HCUA 3VISA 4ZDKA 5EMJA 1KO7A 5J4YA 4MW2A 4POOA 1ONBA 1OH7A 1NONA 1SUCA 4F56A 4RQOA 2X40A 2YC2C 1L8QA 3FYCA 4G8JA 4LGCA 4NVPA 1W5AA 4E08A 2PO7A 3UHJA 1HE5A 2AFHA 2Z0AA 3RFUA 3F0FA 1TQ8A 2P9TA 3FPCA 4MKGA 5T3UA 2ETVA 3R9KA 2FWRA 2PRJA 3ZZNA 1BMDA 3I61A 2NUTA 3D6AA 2DQKA 2C3OA 2VN8A 1FL9A 1FIUA 4BO0A 3I73A 4AS1A 1I9CA 2VKTA 4MP3A 3TPFA 2C2XA 3BAZA 2N3ZA 1XJ0A 3U80A 3QKIA 1QXSA 4GI5A 3U4AA 4TL6A 3MAQA 5L7YA 2FRVA 4B76A 2RGUA 4YMSA 2WSYB 4OHPA 5HQJA 3P0RA 1QCZA 5B2EA 3IUBA 4H1HA 1BRTA 4Q3DA 1JJIA 2BGNA 1M1YE 3FSJX 1PBTA 1ISFA 5CIWA 3WU2Z 1WUIS 1C1HA 2FWBA 4RMIA 2P6UA 2FMKA 3STHA 4JP5A 1WS6A 3D7LA 3OM0A 2QV7A 4QJ3A 3IMKA 1Y4DE 1I2AA 3FB1A 3L7AA 1PQUA 1NH2B 5JO0A 4AY3A 3A1FA 4LDQA 3QI2A 2VF8A 3U49A 2OHWA 3ERNA 3U3KA 3MXTA 1XEFA 4YIOA 1Z6TA 2Z9BA 3WYNA 3RVLA 2QM0A 1JY8A 4CCSA 4DTCA 3PXGA 2WLIA 1LSUA 2JJMA 1L4NA 1VL5A 3CCRF 3RB8A 4R8LA 3PAFA 2JGAA 4Q1DA 2JK1A 2I6TA 4BIIA 5LSAA 5IT9A 3MBMA 3MILA 4X7RA 2C5SA 3IJ4A 5ALEA 1ZOLA 1C0KA 3STWA 4GECA 1UJBA 1A8HA 1JT9A 1U8XX 4G4SP 3L5OA 1M0TA 2I34A 3KUXA 3KWFA 4CQLA 2D2VA 2H31A 2QZ9A 4Q03A 3B36A 2JI7A 5GZ6A 4EG3A 3TSAA 4GAEA 5TC4A 4RLQA 1IEQA 1XQYA 4OM8A 3BEDA 2C4NA 3ON5A 3G2IA 4IDGA 5IEBA 3N2ZB 4M36A 4FYWA 4QM7A 3QE2A 2O1EA 5JAQA 5T6MA 1TJ3A 4D82A 1QAOA 2JFQA 3UFXA 2D59A 1KEZA 3MIIA 3O8CA 1YB1A 3BIJA 3TOCA 1K9VF 4PG5A 3CXRA 2WQZA 4EB6A 3QWBA 3CO5A 1Z0ZA 1N34O 2QJWA 3OBYA 2QRUA 1QIGA 2O8DA 1G3RA 4B3BA 2F67A 4ND5A 3BWCA 4JUDX 1YQDA 2ZGVA 1NN0A 2BKVA 1VC2A 4PQRA 5DK4A 5IJ9A 3THYA 2D1QA 1NW3A 2CXRA 2QRGA 3A1WA 5EZYB 1BAPA 1ZOIA 3ZCQA 1ZCBA 4IFBA 4EHBA 2N46A 3KSRA 4EUSA 3NHPA 1Y63A 3HVIA 3EIQA 4YCSA 3IMPA 4I4NA 1U2QA 1NLUA 1XUOA 2QYOA 4QUAA 1HBJA 2WSIA 4DB4A 1GM9A 2VSOA 4L4UA 4L78A 1N4DA 4GCZA 4I1PA 3L8DA 3HHPA 1JAYA 4EPRA 4FSXA 2C57A 5BWOA 3EJWA 1G17A 3HM2A 1X7YB 1NXPA 1NXQA 3BULA 4TRMA 1XG5A 3ZDXB 4HDQB 5HQ3B 1ZIPA 4V39A 4IY1A 2ZRLA 3UCXA 5TX7A 1LLDA 5B36A 1V1MA 1GH6A 3WTCA 1ZMBA 1PD0A 2C2MA 5EFOA 4BNUA 4MUNA 1BJKA 3SHFA 3LBNA 3JAKB 5HQTA 2ZXWC 3E15A 5KKNB 1Z28A 3OLVA 4GX1A 5IJ0B 2BFCA 1XZIA 1N0WA 1VI2A 1RRFA 1ZL8B 2GF9A 3T34A 4B7KA 3SPGA 1BGWA 4O63O 4W9MC 2RD2A 1B8OA 5EHXA 4X6UA 5JZSA 2PQ0A 1OZHA 2V7WA 4G0VA 1SU7A 2CMDA 4EA9A 5ILOA 1OPRA 3NC1C 2ZJ6A 3KVRA 1O4VA 1IV3A 5K1ZA 1JKMA 3ABLB 4GT1A 4QGAA 3U4IA 4AJHA 3OY2A 2AOTA 3RANA 2CFCA 1CDZA 1V5FA 4FHDA 5I3ZA 3C6KA 1KY3A 1V5IA 3DDZX 5EZ6B 2GVNA 4AMVA 2DMRA 2ALEA 1XN4A 3PEUA 3E1SA 5H3HA 3N9IA 3BCRA 3HY6A 3GC6A 3RVNA 2DFNA 2XOKD 4MRSA 4BMPB 1FNMA 5TV2A 4O2LA 3NALA 2IS1A 1EVZA 1QZXA 3LZCA 5L40A 4OTZA 1Q2XA 4Q9LA 5DBIA 4R5HA 1RI3A 4XEUA 3I04M 5BR7A 3RVRA 3QSYA 4I9QA 3HU3A 3HI6A 5DM0A 4XCQA 4JEMA 1U7HA 5BV1A 3PSHA 2GRUA 3AGPA 3P19A 2RCYA 3K31A 3FGPA 4EHFA 2IM9A 4X61A 4RU1A 3P0JA 5H9VA 5BQ3A 1QGOA 2RAFA 4O2AB 1NMUB 2OUKA 2W43A 1L1RA 2OAEA 4B2LA 3UGJA 1GYPA 2UZ4A 4V1CA 1QM5A 4ZZ2A 1EBFA 2QWPB 2R1TA 3AVUA 4W4LA 4N9WA 2WD9A 5E1BA 3WDLA 3SKVA 1RJ9B 5DNDA 4REOA 1W55A 1Y34E 4Q1FA 2PBRA 3M6UA 3BAFA 4R51A 3IVXA 1XOIA 1J39A 3DFUA 2BWJA 3AVYA 3J81N 2W22A 4LVCA 2QTSA 3KIPA 4HWKA 3IR9A 3WK9A 5TJ9A 5A2QN 4RTQA 5JS1A 3EAGA 2AGAA 3WS7A 4JJ6A 4QVKA 4V03A 3ZWVA 4BTEA 2W2QA 3CCFA 1TUEA 3SS9X 5EO3A 4LWPA 2O3RA 4RWEA 1DG3A 3AESA 4DV1O 2C4WA 1KK3A 2Z9CA 1KVSA 4XB6B 4EHHA 1NL3A 4BIMA 2UYCA 3E0QA 2D7CA 5FYQA 5HF8A 1FFBA 2GJAA 3AFNA 4FYIA 2W98A 2IPOA 4BL5A 2FPUA 1MB9A 1AHPA 1JCHA 3ZRXA 3ICEA 2AZ0A 3L93A 1EVYA 4AJEA 3B6NA 1P7ZA 4D8TA 1CR6A 2ZJ0A 1ZNWA 2LKDA 5JD4A 2WKSA 4UHJA 2EIXA 3MWDB 2QSJA 3A25A 1M10A 3WLKX 4MS2A 1JIKA 3WLQA 1LPSA 4IOLA 2V74B 2OG1A 1L5VA 1OYOA 1P6XA 3ANLA 3BE5A 3SNHA 4PN7A 3KE1A 2HHAA 3LOQA 3HSSA 5B55A 4ZEMA 2Q6VA 3OFKA 3OM9A 4CMHA 3KZMA 3EULA 4CM1A 3JQGA 1M8JA 1ZSYA 4A15A 3PDCA 1HNWO 3VMMA 2FSVC 2Q2WA 2POQX 1WNTA 3KXIA 2F8TA 4G56A 2ZIFA 1AJNA 3DHWC 3R7WA 5F1YA 3B2QA 2DW4A 3AP1A 4OPAA 2NPIA 2IV7A 4AZSA 2VWPA 4LWQA 2RAUA 2EX4A 3I8SA 1U1CA 4BYGA 4OAPA 4FYPA 4IDEA 1S02A 2AMVA 1XVIA 1Y7HA 2OP1A 4WACA 4TS1A 2ZBUA 3HQ4O 4E46A 2W2OA 16PKA 1NULA 4OCZA 4Z4IA 1E9EA 2NLOA 4FGUA 3FXAA 1JBKA 5FWYB 2G5GX 5KX5A 4X3OA 2ZU0C 5J63A 3TQSA 4H59A 1A9YA 3UIEA 4HBZA 1NP6A 2OTJV 1W4RA 3IMGA 3B9RA 4KHPB 3RE3A 1OYVA 1BEEA 4DUZB 4S24A 4HSGA 1T3TA 3IIIA 3UCSC 5HIAA 1TX4B 3HDQA 3U17A 2E4VA 1RI2A 2GN6A 2G38A 4H16A 4AAYA 3HLYA 5DBGA 5AOBA 3COZA 4R7GA 5JJJB 4HATA 3H5NA 1SA0A 3J7TA 2KQUA 1K9MH 2CNOA 5JSUA 1MC5A 4IV8A 4J07A 5A06A 2HWWA 1HTTA 3AKYA 4Q93A 1RPOA 3M89A 5FNVF 4Z6KA 3WG7C 2MIIA 4WN9A 5WRFA 3SXUB 4BO9A 3K2QA 1M5RA 2RARA 4LHZA 4LCJA 4MYUA 1M9NA 1OKKA 2Y0PA 2RG1A 1O03A 3AG1B 3CRNA 5J2UB 1A7UA 1SUSA 5CNJA 1KMIY 1SO8A 4MHOA 1IBLB 3S40A 3IMCA 4OK3A 5IBRA 4YP0A 1AU9A 1YV9A 5E4YA 2QMQA 5JV5A 2I62A 1WQ3A 1EK5A 3EJ6A 4Z4HA 5A9SA 3ZXUB 4BLWA 2FSVA 4ZMSA 5JS2A 1D07A 1K7FB 2Z2IA 3PL5A 3ASZA 4QTXA 3CCQV 3K0AA 2V7XA 1QR9A 3HADA 3GQVA 2ZRNA 4F7WA 3W4JA 1YE8A 2UYNB 1IONA 4YCAA 1Y5MA 3PJFA 1YL5A 1Q5PA 2HRZA 3CO0S 5BRNA 4GXRA 1U40A 4RK5A 1PN3A 5E1DA 2D1FA 5CJPA 3HU2A 4MQ5A 3EDMA 4C78A 1LNSA 3KPYA 3FUTA 3LXMA 3H9BA 4C3OB 3CLSC 3GWZA 3VKGA 3ZEDA 4OI0A 1JSLA 1UP7A 1W4CA 5DNEA 2IYVA 1RJFA 4ZVLA 4OQZA 5FXMA 2JIQA 4ALMA 1J9GA 5LKRA 1IV1A 4J3NA 3OWOA 2IYZA 4MO9A 4I66A 2WBLC 1XNHA 3OQPA 5I7FA 4CLRA 1ONOA 1P1FA 2C7QA 4ETMA 2OD9A 4B79A 1D2DA 1C9MA 2PXXA 3EF0A 1RZRA 4AQDA 4AZVA 3K35A 1BA2A 4DZTA 1YQ9A 3F7YC 3NK7A 2A5JA 3PQ5A 3KYDA 3OBIA 3GEEA 1KOJA 4HEA1 4ZOCA 3NQ41 1M67A 3L4SO 1AOXA 3P45A 1K6IA 1W9HA 2R7LA 4RH1A 4XJXA 1KAMA 1OV4A 4YMHA 1OJLA 4R3UC 4DSOA 3T1VA 4X91A 4ZVVA 2FEKA 2WJWA 4TL8A 1TECE 5J1SB 2J7PA 2IG8A 4GP6A 4Y6QA 4L50A 4CKEA 3GP5A 4M99A 2GD6A 3REQB 3R7SA 4ACBA 3B3FA 2VHUA 1NKSA 5LUAA 1ZGCA 4JP8A 2G8NA 2XCOA 5AOAA 3A4IA 1N5DA 4JBNA 1XMOO 1T6ZA 1R73A 3U6KA 1JG7A 1UZLA 4X88A 2IUEA 3DKRA 4KK4A 2VTBA 5KHJA 2N1MA 2D62A 3NG1A 3W6UA 4RESA 5DH9A 4KAAA 1LDYA 4BNHA 3T9BA 1SBYA 5E79Z 2HD4A 2JHPA 4FYXA 1R3LC 2H1HA 1SKAA 1W9MA 1VJGA 3QTYA 4C7KA 3REFA 3RUCA 1FP4B 3KR9A 2WICA 4WNAB 1G6OA 1QP7A 2BL4A 3X1XA 2X8BA 1T6NA 4C4XA 5EE1A 2VRBA 2B5UA 3TUJC 1A4RA 1XKLA 3NPAA 3ILHA 3OIFA 1SU4A 4JYAO 5EJGA 4AKIA 2JI4A 4DA9A 1WSAA 2XMZA 2I2CA 2I4RA 3IIMA 1E2FA 4LMRA 2CSXA 3NRCA 5HCNA 1M2EA 1J22A 1GVNB 2EYUA 1TK3A 4NNJA 1XAIA 2BC9A 3P0HA 3O26A 1GKLA 3MINB 3PNVA 1EXDA 2PHZA 3JVIA 2WYHA 1G8KA 2VDJA 1LUVA 3PDHA 2H2HA 2QJRA 2WF6A 3JU3A 2SCUA 3G23A 1PHRA 2IYNA 4DYHA 5SZIA 4IUDS 4YJ3F 1ECLA 1JWLA 3REGA 1V4BA 2AMYA 3AR5A 4MYHA 1ZN9A 3R5JA 1WY5A 4PFJA 1WBDA 2P62A 1ZS9A 5IM4F 2I7VA 5DEIA 1ZL0A 1N6NA 3VUFA 4O3MA 2BGGA 4HQFA 3HRKA 4DBZA 1QU3A 1MAVA 3WP0A 3QF4B 1VDMA 1ZH8A 1WPRA 5JAIA 2Z04A 4OKSA 4D02A 2HF9A 4RV4A 1LPPA 9ABPA 2IH1C 3DE1X 4YMTA 4KP7A 5B1SA 3PHJA 1CERA 1JV2B 3IOYA 1V96A 3MWEA 4EAQA 1OWOA 2CKMA 2QTMA 3GH1A 2D13A 5FUWA 1DT5A 4RHTA 3CH7A 4ZI7A 1J42A 2J8ZA 5DYGA 3BHNA 4GPEA 3EXIB 1FXKB 3B52X 2OV8A 3I4FA 2VNIA 3BIFA 4MCJA 3V32A 3D6HA 1M74A 4F4LA 2ODMA 1L4LA 4EM6A 4E51A 3CEJA 4I0WB 1NT2B 3FVWA 2WA4A 4ROTA 1KFKB 2QX6A 3SJ7A 1O0CA 3L73H 3KVVA 1CS0B 4A5UB 3Q7QA 4GR4A 1KI8A 4CMIB 3FNFA 3GD7A 1W49A 3AVPA 4Z1MA 3RJ9A 4F91B 1JA1A 1ESEA 4NFLA 4LF8O 2I1WA 2BKAA 4R1PA 4RMGA 5CB8A 2EULA 2HCBA 3BXGA 4HYOA 1A9SA 4LZZA 5LMUB 3KQTA 4Q3OA 3NEPX 1UXOA 1NBMD 1RYMA 2ZTMA 3UMCA 1E20A 3JQAB 4L02A 1Q43A 5T4EA 2WFLA 4Q9NA 1GGEA 3P97A 4MYCA 4G0OA 2H29A 4M0CA 5JAHA 4PSCA 3PUZA 1RMYA 2FPWA 1CC1S 5FUMA 3G7SA 4PVDA 2F6RA 4HZUB 3G6EF 4C01A 3PUWA 3ZMSA 4LA4A 1CZUA 1IN6A 3FUXA 1X77A 4AO7A 4L73A 1TD9A 2ONYA 4MTXA 4UJ5A 2CE2X 4ZXPA 1P2TA 1YMVA 2W42A 1WDLA 2XWBF 4LFCO 4HDCA 3RT3C 1NQ5A 3R5KA 4UVCA 3PQ4A 3QITA 4IZ6A 5HTOA 1W76A 3VZSA 4CM6A 3OM1A 2X9NA 4RVFA 1DXHA 4X8AA 1WV1A 1DBPA 3CR7A 3HO8A 4WK2B 4IXDA 4C08A 1WX1A 2ZUDA 2PGGA 4CLDA 4DNPA 2AI2A 1JF8A 3QNUA 5KOHB 4EJMA 1KO1A 3C3YA 5SZJA 3GEIA 1DX6A 4JT9A 4UTZA 3SX4A 2GD0A 2RSLA 4GWLA 3V8RA 3WJ7A 1TQHA 3S99A 2IEYA 4P3PA 2B30A 2PUEA 4LJAA 4QAJA 5HUHA 5K3DA 3TN7A 2GR9A 5FL7D 1CE8A 4NYMQ 2ZE7A 2BM1A 5B2FA 4GMHA 4KOAA 2PX8A 4UCRA 2I67A 2CBZA 1QHTA 3IMEA 4BNVA 4QBGB 3OP4A 1F20A 4J6FA 1Q21A 1FX0B 3CPQA 4DXAA 5G0TA 2RGAA 3S81A 4EMUA 1AN0A 1CW2B 3D7SA 3I05A 3CM0A 1LRLA 1U6IA 3PHGA 2RG7A 3BZBA 3I30X 3RU7A 1KSGA 3VTZA 2VR1A 1GAEO 2HNKA 4WFGA 2G77B 3LKDA 2PH5A 4YO8A 3RWMB 1UKEA 2IX3A 2PV7A 3HV0A 3CISA 4C7OB 3M33A 5LP6C 3COYA 3BHJA 4R1MA 1DRVA 3O1HB 2VHZA 1X7ZA 3RYHA 1VQKF 1P9OA 1JG4A 1IM8A 1GZ4A 1TIKA 2G3YA 4EGQA 1ZZEA 2ENWA 3L06A 3ZP7A 3PEVA 5JDIC 2Z4RA 3BKXA 3PA6A 3EPHA 2A0YA 3CA8A 3B1YA 3B77A 4DSAA 3OR6C 3R44A 2VAWA 4IEEA 3C5EA 4DUGA 2XADA 5I7AA 3OIGA 1FYJA 4R1OA 5IULC 2R6ZA 2I3BA 3M5PA 3W9BA 1A2OA 1U3FA 4I0XB 3UAYA 4DY4A 4LC1A 5H6RA 5A6SB 5L7TA 2OQ2A 1DTWB 1S2NA 3C4VA 2ZUCA 2ODEA 5E1AC 3NH6A 4YRTA 3E8HA 1OFTA 3LVBA 4JUIA 4UUAA 4F46A 3GJ0A 1LF0A 2FX3A 1M33A 4IFIA 2JLXA 4PEVA 3VZCA 3DVRX 2ZPUA 2I29A 3ZDBA 2WUFA 1XHOA 1QOPB 3KOUA 3U09A 3WKBA 2FETA 4WERA 1GCIA 2B8JA 1XBTA 3UXMA 4ZALA 5GJVC 4WJKB 4IQ4A 3WL3A 4BXOA 2ECOA 4DCVA 3ABKC 1XZFA 5IKOA 4WLVA 2CUGA 5AVKA 2C78A 2FUKA 3K9AA 5EIBC 2RKWA 3OICA 2QN7A 3QWAA 4EW6A 2XXAB 3WK7A 4XRGA 2OV6A 4EI7A 3NETA 4FQ5A 5LC1A 1SQ0A 1JHDA 5C4MA 3NI2A 1DLBA 3EZXA 4RKYA 1M57C 1SXJB 3ICCA 4JOSA 3TEMA 3M8KA 3DDUA 5DASA 1W4ZA 3TYXA 3UHPA 4P4SA 4NFYA 1J0BA 1JEYA 4ENQA 4S12A 3A9UA 1HFWA 4K88A 1WB6A 3GYBA 4ARZA 1R16A 3VQWA 1SC3A 4HG2A 1W85A 4Q6GA 3EFBA 3P9XA 3S3WA 1KBZA 3IPCA 3W8FA 2DH6A 2R8EA 2ECFA 3L05A 3MCQA 3R1IA 2HMYB 2DWQA 3QVKA 3AL2A 2VWGA 3FCCA 5JDIA 1QHSA 2W2KB 3E1KA 5KHKA 4KXYA 3LBAA 2VBCA 4K3VA 2OO3A 3SQNA 4IQFA 3H1JH 4AK9A 1FFXB 5CXXA 2Z01A 2Q1YA 1XU7A 1FVFA 1MGPA 5CLFA 4PO1A 1NYTA 4F06A 1J49A 4L74A 3QKSB 5HDQA 3Q3JB 1W29A 2IDMA 3DMRA 4ZC1A 3TTSA 5CH5A 3WB2A 2ZKLA 1JQKA 4OX9O 2ZANA 4DRXA 1OWLA 3Q10A 1SKUA 4NEQA 1JI0A 3TIVA 4F4DA 1ODEA 4BY9E 4JP2A 1BS9A 3GAAA 1T0AA 5ALIA 4PGHA 3AUJB 2AUTA 1N0HA 2N48A 3HRIA 3K5NA 3IB3A 3IA7A 3E70C 2P35A 4P7BA 3BJZA 2Q7OE 3PHHA 1PF7E 1KI2A 3WNBA 3OPVA 4D4IA 5DFAA 2Q7EA 3A6HA 4HGNA 3OF3A 4IXMA 5H02A 5LXTF 4KQXA 1K88A 2TMGA 2D2XA 3V3KA 4KVGA 5IP5A 3VZDA 1JL3A 4CIWA 1H2SB 3K5MA 2ZVJA 3F90A 2OE2A 1UFYA 5D5PA 1MXHA 4WZBA 2RHDA 2PTMA 2V59A 4ESEA 2WF7A 1YAJA 3GEMA 2X6CA 3BERA 4OI1A 3T7CA 5KS2A 1F17A 1QGZA 2REXB 5ECGC 1YKGA 1JD1A 4AURA 1I7QB 4MRRA 5ICFA 4RS4A 1D09A 1GAWA 4YV1A 3OOJA 4KNWA 3WPWA 4BWFB 3T3IA 1Q44A 3GJRA 3UWOA 4C2BA 5KREA 4N23A 3CMEV 3D5EA 3VTFA 4FI3F 1IZ8A 3ORHA 5CCEA 3D9QX 4FLZA 2IP1A 4JJIA 1A72A 1YS2X 3MK31 3T4PA 1E1RD 3NOQA 3W79A 3A4VA 5EQTA 3KPWA 1YA8A 1B43A 2X0NA 1GFSA 4A26A 3F6PA 3WGMA 4OO3A 2I9PA 3K05A 2J67A 4BRWA 3AVWA 2C8VA 3R0XA 2MSDB 2HMSA 3Q3HA 1NN1A 3L1IA 2VYNA 1X8XA 3I6IA 2PVSA 2Z6UA 2HBRA 4GNKA 1XKQA 3L8HA 2V9CA 4PHGA 2IEDA 1L1FA 1GSHA 1U7TA 3MGGA 2QGFA 2FWNA 3IT3A 5KA5A 1EUYA 5KWIA 1XKXA 5C4IA 4NZNA 4Z54A 5C3MA 2GWRA 1Q3EA 4JJZA 1WXIA 4HDMB 3AFGA 4B6EA 5KYUB 2VDMB 1WIWA 4M89A 2PNJA 2JFHA 4HX5A 4B08A 3RHSA 3G68A 2ZE6A 4LZJA 2WR8A 2YUIA 5CHYA 1HSOA 3F8TA 3GEBA 2A79B 4YJHA 3KYCA 4NRDA 1TM2A 1QO0D 1BCSA 4IAOA 1W2BU 2O3SA 2DH5A 5IARA 1E9FA 1U3CA 4LV8B 2FPRA 1KSJA 4W5HA 4CM9D 3MGKA 4LF4O 1B3QA 2F55A 4RY8A 1LA2A 2PUGA 3FNGA 1REQB 4AUEA 2R00C 4DW8A 4AJOA 3PF9A 4QPZA 1QPGA 4DWOA 2G72A 5J2TF 4RGQA 3GNLA 4D41A 2JLYA 4WMLA 3N74A 2O1WA 2DY1A 4DCOA 4LPSA 2G5PA 1E7QA 4FZ5A 5DM1A 4S1VA 3LC0A 3DTTA 2I2AA 4MV6A 2CJPA 3FUUA 1K92A 5DXAA 2VYCA 5I9NA 4MS1B 4JR0A 4TL7A 3HG7A 2A9FA 4ZO4A 3EVBA 2HQBA 2LNDA 3C4JA 4XAQA 3AJAA 1JA8A 1L5KA 3TL2A 4ZYWA 8OHMA 5K0GA 4HJRA 3IXMA 4C4TA 1CVLA 5FLXM 3UWSA 4MQEB 4DV4B 2FDXA 1ND6A 1YAHA 3EMKA 1RYFA 4AMBA 3O4RA 4CKWA 4YY3B 4OIFA 3EFEA 4JP3A 4FP9A 2B8NA 2CHUA 3FRHA 4BKQA 3IILA 3BQNB 3SHWA 3ZYZA 3P0EA 3DPIA 1ESZA 1WB5A 3ONVA 2PD6A 1WABA 1PF5A 2GN2A 3DYIA 1C9NA 2P4VA 1M6VB 1WETA 4MYTA 4Z9AA 2VCHA 2FGKA 1AB5A 1QIJA 3P0FA 4FDLA 1K5QA 3GLSA 1BMFD 4XWAA 3UMBA 4Y2TA 3X2SA 1HV8A 2V97A 2UZ1A 2C00A 5KPJA 1VGQA 2UXBB 3LWRC 4UOQA 4EYEA 3ZHXA 3UK0A 1PWYE 1R5JA 5F12A 1KS2A 2RN9A 2ZRPA