2AMTA

Structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with a cdp derived fluorescent inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Fluorescent Inhibitors for IspF, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2amtA00
1JN1A 1GX1A 1W57A 3IEQA 3P10A 1JY8A 1T0AA 3K14A 1IV4A 3JVHA 1U3LA 3K2XA 1YQNA 1VH8A 2AMTA 3EORA 3ESJA 3F0EA 1VHAA 3F6MA 4C8EA 1U40A 5B8FA 2UZHA 1W55A 3F0DA 1H48A 1IV1A 2PMPA 3GHZA 3P0ZA 1U3PA 3FPIA 4C8IA 1IV3A 1KNKA 3Q8HA 1H47A 3ELCA 3F0FA 3IKEA 1IV2A 3IEWA 3B6NA 3QHDA 1KNJA 3KE1A 3RE3A 4C81A 3IKFA 3T80A 2GZLA 3F0GA 3FBAA 4C8GA 4C82A 1U43A 3ERNA 3MBMA
chains in the Genus database with same CATH superfamily
4NQ3A 3ZO8A 3E22A 5KMGA 1VQ9F 3CCQF 1Q82H 1FNJA 2AMTA 3S03A 3AGKA 1YJ9F 2VXYA 5LYJA 4O2AB 3V3TA 4DRXA 1U40A 2UYNB 3RA6A 2UYKA 1K8AH 2RHLA 1K73H 5EIBC 3PAFA 4O4JB 3LWRC 5BMVA 5HP7A 2DT4A 3CC2F 5HWEA 1Z5WA 5EIBD 3JAKA 3TD4A 3WJRA 3T80A 3KIZA 1GO1A 4BT3A 2MQEA 3WPWA 1W57A 2F9ZC 3VYSC 2ZVYA 3HAXD 1W42A 3K14A 4U39A 1SDSA 2BTUA 4C4WC 2RB9A 3F6MA 4BT7A 4X1KA 2Q1YA 3LDTA 3LWOC 4FFBA 1VQVA 2KTUA 2RHJA 3GHZA 4IHJB 3J81M 3C9UA 3M84A 5HY4A 3CCJF 5FNVA 3WGMA 5MN6A 2HRUA 3RE3A 1W3EX 2VAWA 4E6EA 3S06A 2GVIA 2LCAA 2LBXA 4EB6B 2OTJF 3P10A 5IYZB 3I7TA 3TD5A 2CZWA 4ZOLB 4I4TB 3CMEF 1UI9A 5CB4B 3JAWB 3HWUA 2R6R1 2Q1XA 1H48A 2HS0A 3GTZA 3SIUA 3S0WA 5J2UA 3KHNA 3WGLA 3HKEA 5HP8A 2EWCA 3WGNA 3CCMF 3JATA 2AIZP 5JVDB 3I55F 2OTMA 5C8YA 2KTVA 2PHNA 1VQPF 5J2TA 4TV9A 4B45A 4RHAA 2CW4A 3MQWA 1XRGA 4B5CA 5KX5A 1JD1A 4I50A 5GANK 2K1SA 2HS3A 3JARA 4G4VA 3JVHA 1YQNA 4O4LA 4EI8A 3KJJA 1RLUA 2OZBA 2HRYA 4KWEA 1UFYA 4I55A 5JCOA 1KQSF 3JASB 3LMEA 1VK3A 5ITZA 2VAPA 3F0FA 4LNUB 4B62A 3I56F 3KE1A 1X52A 4IIJA 4M8IA 1TVKB 5IJ0B 1DBFA 2HQSC 2ALEA 3M4SA 3LWPC 5EZYA 3N2KB 5IJ9B 2G9IA 1JFFB 4TV8A 1QVGF 1W5EA 4ERHA 1VHAA 3N4ZA 1YJNF 4X1IA 1YI2F 2BTOA 5LA6A 4ZHWA 4TZZA 5EYPB 3K0TA 5GONA 4O4HA 3FPIA 1YITF 1Q86H 1IV3A 1W40A 3L7QA 3NK7A 1QVFF 5MN4A 3C8LA 3QHDA 1PF5A 3HKDB 2LBTA 3IKFA 2VGNA 3E20B 5JH7A 3CC7F 2NMUA 1ODEA 4R40B 1T0AA 2Z1TA 2GLZA 4U3JB 3TD3A 1SA0A 5DCVA 4TUYA 3I3FA 1RQ7A 4PWTA 4YJ3B 5LOVA 3RYIA 4WBNB 1Z5VA 1IV1A 3E1YA 4X1YB 1RLGA 1VQNF 3P0ZA 3HJWC 2CHSA 2BO1A 3RYCB 5GIOC 1KNKA 5FJ4C 4ZI7B 1YHQF 2HVYD 2Z1UA 3VYTC 4X3LA 5EO3A 5CA0A 4F6RA 2ZOVA 1R1MA 2HP0A 2RHOA 4BVRA 4C8EA 3MDOA 1U43A 2QA4F 1OFUA 1TUBA 1VQ8F 1FFXA 3UT5A 4XCQA 1JJ2F 3WGJA 1XV2A 2R751 3E22B 5KMGB 3HKBA 1NMUB 5CA1A 1KC8H 3CCLF 2I6RA 4RQOA 5AVMA 5LYJB 1FNKA 3QTYA 2N48A 4DRXB 4C81A 1KD1H 3MCQA 3LWQC 3JCMM 1YIJF 1X7OA 1YGYA 5BMVB 3S02A 1VQ7F 3IMPA 4G4XA 4ZHQA 3JAKB 1U3LA 3K2XA 1VH8A 2RHHA 5G4UC 5A2QM 2B33A 3P4EA 2ZAUA 3FFMA 4X20A 1XBIA 2OTLF 4BT2A 3ZP4A 1U3PA 3N2GA 1GZ0A 1W59A 3WXMB 1IV2A 1RQ2A 4BVSA 4X1KB 1M90H 4FFBB 2QTPA 4LCKA 5LP6A 3CCRF 1NQ3A 5FNVB 4NUTA 3JAMM 3G6EF 1H7MA 5LXTA 4BT5A 3CPWF 5GIPC 5JQGA 4HNAA 2V9YA 1W5BA 3RYFA 3VO8A 3F0DA 4O2BA 3CXCF 1Q7YH 2JNBA 3CMAF 1SZQA 5EAZA 3OONA 3HKCA 5GINC 1VQOF 2IAFA 5IJ9A 4B46A 3N4YA 2H6LA 3ZP7A 5G4VC 3DC2A 2HP3A 5J2UB 3RYHA 2FGYA 5JCOC 3HKEB 2YYEA 5EB1B 3JATB 3G71F 3EORA 3VIUA 5J2TB 3BYQA 4O4IA 4YJ2A 1K9MH 4G4ZA 5KX5B 2ZODA 4I50B 1M1KH 4ZHVA 2Z01A 3JARB 4O4LB 1W41A 3J7AR 1W2BF 1KNJA 3VMFB 2IG8A 4I55B 3JALB 4O2AA 3OBYA 2W8BC 4ZK7A 5ITZB 5GAPK 4BVTA 3SIVA 3R0PA 2UYNA 1YJWF 4X1YA 3D01A 3QUWA 1W5AA 1Q8RA 2VGMA 4O4JA 1CLIA 3D54A 5MN5A 1VQMF 3VOBA 5EZYB 3VYUC 4EI9A 4TV8B 4C8IA 3NVKE 4X1IB 1J7HA 3ZOPA 3M1XA 1PXWA 3FBAA 3CCUF 3ON1A 5GONB 3V7QA 4C8GA 4O4HB 3WJQA 2CVLA 1CK2A 3WJPA 1VQ5F 2UYPA 3S0YA 3NVIB 2ZF8A 4IHJA 2ZVZA 3FD6A 3NK6A 5JH7B 3CCSF 2P6YA 3VOAA 1QD9A 3VI6A 1W581 5B8FA 2UZHA 3CYPB 2KG4A 3CYQA 3OW2F 4EB6A 1SA0B 3VCZA 3RA5A 5HY2A 4TUYB 5IYZA 1VQKF 5LOVB 3RYIB 3J80M 3C9SA 5HXZA 4ZOLA 4I4TA 5CB4A 1VQ4F 5EWRA 2GZLA 3JAWA 3CCEF 4C82A 3VTIC 1FSZA 2Z1FA 3LYBA 5CA0B 4F6RB 1N8RH 2HP0B 3ESJA 2LBWA 2AIFA 1CN7A 3U0OA 2VAMA 1GO0A 1TUBB 5JVDA 1FFXB 4X3MA 3UT5B 3CG6A 2H8CA 2DYYA 1NJIH 3GYQA 3K12A 3Q8HA 3ELCA 3B6NA 3NMUC 1X7PA 5IT9M 3HKBB 3MBMA 5CA1B 1GX1A 2I6DA 1JY8A 3JASA 4DXDA 2Z1EA 2CWJA 2BTQB 5EB0A 2HS4A 3WGKA 5HY1A 2OHWA 4LNUA 3HTNA 1W55A 5LP6C 1TVKA 4ZHQB 3IR9A 5HXUA 5IJ0A 1X25A 3FD5A 3D00A 4G4WA 3V7EA 3N2KA 3IEWA 1JFFA 2YXZA 4X20B 4BW0B 1COMA 3F0GA 4NWOB 3CD6F 1IPAA 3CB2A 1JN1A 4EI7A 4G4YA 3N2GB 4BVQA 5EYPA 1IV4A 1W5FA 5C8YB 5LP6B 2QEXF 3HKDA 4TV9B 3JALA 2WALA 3G4SF 2L26A 3C9TA 5LXTB 1Q81H 1E7KA 1ONIA 5JQGB 1H47A 4HNAB 4U3JA 3V4DA 3MCAB 1QU9A 3RYFB 2KGWA 3DDNA 4O2BB 1QAHA 4YJ3A 3CC4F 3ERNA 3LWVC 2FC3A 1T0KB 4BT4A 3IEQA 4WBNA 3HKCB 3S0HA 4BY9D 3O85A 2IQQA 5HY0A 1S72F 4BT6A 3PLAC 3WPXA 3CCVF 3RYCA 2HX0A 1VQ6F 1DT9A 3F0EA 2UYJA 4IIJB 2CHTA 4ZI7A 4G88A 3RYHB 3OBWA 2PMPA 4ZHYB 3LFOA 1VQLF 1ZWZA 2QI2A 1XHOA 5FLXM 3KJKA 2H8EA 3IKEA 3CPQA 1OAPA 3C9RA 4O4IB 4YJ2B 5LA6B 2CSLA 1RA4A
chains in the Genus database with same CATH topology
1JN1A 1GX1A 1W57A 3IEQA 3P10A 1JY8A 1T0AA 3K14A 1IV4A 3JVHA 1U3LA 3K2XA 1YQNA 1VH8A 2AMTA 3EORA 3ESJA 3F0EA 1VHAA 3F6MA 4C8EA 1U40A 5B8FA 2UZHA 1W55A 3F0DA 1H48A 1IV1A 2PMPA 3GHZA 3P0ZA 1U3PA 3FPIA 4C8IA 1IV3A 1KNKA 3Q8HA 1H47A 3ELCA 3F0FA 3IKEA 1IV2A 3IEWA 3B6NA 3QHDA 1KNJA 3KE1A 3RE3A 4C81A 3IKFA 3T80A 2GZLA 3F0GA 3FBAA 4C8GA 4C82A 1U43A 3ERNA 3MBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN1 A;  1GX1 A;  1W57 A;  3IEQ A;  3P10 A;  1JY8 A;  1T0A A;  3K14 A;  1IV4 A;  3JVH A;  1U3L A;  3K2X A;  1YQN A;  1VH8 A;  2AMT A;  3EOR A;  3ESJ A;  3F0E A;  1VHA A;  3F6M A;  4C8E A;  1U40 A;  5B8F A;  2UZH A;  1W55 A;  3F0D A;  1H48 A;  1IV1 A;  2PMP A;  3GHZ A;  3P0Z A;  1U3P A;  3FPI A;  4C8I A;  1IV3 A;  1KNK A;  3Q8H A;  1H47 A;  3ELC A;  3F0F A;  3IKE A;  1IV2 A;  3IEW A;  3B6N A;  3QHD A;  1KNJ A;  3KE1 A;  3RE3 A;  4C81 A;  3IKF A;  3T80 A;  2GZL A;  3F0G A;  3FBA A;  4C8G A;  4C82 A;  1U43 A;  3ERN A;  3MBM A; 
#chains in the Genus database with same CATH topology
 4NQ3 A;  3ZO8 A;  3E22 A;  5KMG A;  1VQ9 F;  3CCQ F;  1Q82 H;  1FNJ A;  2AMT A;  3S03 A;  3AGK A;  1YJ9 F;  2VXY A;  5LYJ A;  4O2A B;  3V3T A;  4DRX A;  1U40 A;  2UYN B;  3RA6 A;  2UYK A;  1K8A H;  2RHL A;  1K73 H;  5EIB C;  3PAF A;  4O4J B;  3LWR C;  5BMV A;  5HP7 A;  2DT4 A;  3CC2 F;  5HWE A;  1Z5W A;  5EIB D;  3JAK A;  3TD4 A;  3WJR A;  3T80 A;  3KIZ A;  1GO1 A;  4BT3 A;  2MQE A;  3WPW A;  1W57 A;  2F9Z C;  3VYS C;  2ZVY A;  3HAX D;  1W42 A;  3K14 A;  4U39 A;  1SDS A;  2BTU A;  4C4W C;  2RB9 A;  3F6M A;  4BT7 A;  4X1K A;  2Q1Y A;  3LDT A;  3LWO C;  4FFB A;  1VQV A;  2KTU A;  2RHJ A;  3GHZ A;  4IHJ B;  3J81 M;  3C9U A;  3M84 A;  5HY4 A;  3CCJ F;  5FNV A;  3WGM A;  5MN6 A;  2HRU A;  3RE3 A;  1W3E X;  2VAW A;  4E6E A;  3S06 A;  2GVI A;  2LCA A;  2LBX A;  4EB6 B;  2OTJ F;  3P10 A;  5IYZ B;  3I7T A;  3TD5 A;  2CZW A;  4ZOL B;  4I4T B;  3CME F;  1UI9 A;  5CB4 B;  3JAW B;  3HWU A;  2R6R 1;  2Q1X A;  1H48 A;  2HS0 A;  3GTZ A;  3SIU A;  3S0W A;  5J2U A;  3KHN A;  3WGL A;  3HKE A;  5HP8 A;  2EWC A;  3WGN A;  3CCM F;  3JAT A;  2AIZ P;  5JVD B;  3I55 F;  2OTM A;  5C8Y A;  2KTV A;  2PHN A;  1VQP F;  5J2T A;  4TV9 A;  4B45 A;  4RHA A;  2CW4 A;  3MQW A;  1XRG A;  4B5C A;  5KX5 A;  1JD1 A;  4I50 A;  5GAN K;  2K1S A;  2HS3 A;  3JAR A;  4G4V A;  3JVH A;  1YQN A;  4O4L A;  4EI8 A;  3KJJ A;  1RLU A;  2OZB A;  2HRY A;  4KWE A;  1UFY A;  4I55 A;  5JCO A;  1KQS F;  3JAS B;  3LME A;  1VK3 A;  5ITZ A;  2VAP A;  3F0F A;  4LNU B;  4B62 A;  3I56 F;  3KE1 A;  1X52 A;  4IIJ A;  4M8I A;  1TVK B;  5IJ0 B;  1DBF A;  2HQS C;  2ALE A;  3M4S A;  3LWP C;  5EZY A;  3N2K B;  5IJ9 B;  2G9I A;  1JFF B;  4TV8 A;  1QVG F;  1W5E A;  4ERH A;  1VHA A;  3N4Z A;  1YJN F;  4X1I A;  1YI2 F;  2BTO A;  5LA6 A;  4ZHW A;  4TZZ A;  5EYP B;  3K0T A;  5GON A;  4O4H A;  3FPI A;  1YIT F;  1Q86 H;  1IV3 A;  1W40 A;  3L7Q A;  3NK7 A;  1QVF F;  5MN4 A;  3C8L A;  3QHD A;  1PF5 A;  3HKD B;  2LBT A;  3IKF A;  2VGN A;  3E20 B;  5JH7 A;  3CC7 F;  2NMU A;  1ODE A;  4R40 B;  1T0A A;  2Z1T A;  2GLZ A;  4U3J B;  3TD3 A;  1SA0 A;  5DCV A;  4TUY A;  3I3F A;  1RQ7 A;  4PWT A;  4YJ3 B;  5LOV A;  3RYI A;  4WBN B;  1Z5V A;  1IV1 A;  3E1Y A;  4X1Y B;  1RLG A;  1VQN F;  3P0Z A;  3HJW C;  2CHS A;  2BO1 A;  3RYC B;  5GIO C;  1KNK A;  5FJ4 C;  4ZI7 B;  1YHQ F;  2HVY D;  2Z1U A;  3VYT C;  4X3L A;  5EO3 A;  5CA0 A;  4F6R A;  2ZOV A;  1R1M A;  2HP0 A;  2RHO A;  4BVR A;  4C8E A;  3MDO A;  1U43 A;  2QA4 F;  1OFU A;  1TUB A;  1VQ8 F;  1FFX A;  3UT5 A;  4XCQ A;  1JJ2 F;  3WGJ A;  1XV2 A;  2R75 1;  3E22 B;  5KMG B;  3HKB A;  1NMU B;  5CA1 A;  1KC8 H;  3CCL F;  2I6R A;  4RQO A;  5AVM A;  5LYJ B;  1FNK A;  3QTY A;  2N48 A;  4DRX B;  4C81 A;  1KD1 H;  3MCQ A;  3LWQ C;  3JCM M;  1YIJ F;  1X7O A;  1YGY A;  5BMV B;  3S02 A;  1VQ7 F;  3IMP A;  4G4X A;  4ZHQ A;  3JAK B;  1U3L A;  3K2X A;  1VH8 A;  2RHH A;  5G4U C;  5A2Q M;  2B33 A;  3P4E A;  2ZAU A;  3FFM A;  4X20 A;  1XBI A;  2OTL F;  4BT2 A;  3ZP4 A;  1U3P A;  3N2G A;  1GZ0 A;  1W59 A;  3WXM B;  1IV2 A;  1RQ2 A;  4BVS A;  4X1K B;  1M90 H;  4FFB B;  2QTP A;  4LCK A;  5LP6 A;  3CCR F;  1NQ3 A;  5FNV B;  4NUT A;  3JAM M;  3G6E F;  1H7M A;  5LXT A;  4BT5 A;  3CPW F;  5GIP C;  5JQG A;  4HNA A;  2V9Y A;  1W5B A;  3RYF A;  3VO8 A;  3F0D A;  4O2B A;  3CXC F;  1Q7Y H;  2JNB A;  3CMA F;  1SZQ A;  5EAZ A;  3OON A;  3HKC A;  5GIN C;  1VQO F;  2IAF A;  5IJ9 A;  4B46 A;  3N4Y A;  2H6L A;  3ZP7 A;  5G4V C;  3DC2 A;  2HP3 A;  5J2U B;  3RYH A;  2FGY A;  5JCO C;  3HKE B;  2YYE A;  5EB1 B;  3JAT B;  3G71 F;  3EOR A;  3VIU A;  5J2T B;  3BYQ A;  4O4I A;  4YJ2 A;  1K9M H;  4G4Z A;  5KX5 B;  2ZOD A;  4I50 B;  1M1K H;  4ZHV A;  2Z01 A;  3JAR B;  4O4L B;  1W41 A;  3J7A R;  1W2B F;  1KNJ A;  3VMF B;  2IG8 A;  4I55 B;  3JAL B;  4O2A A;  3OBY A;  2W8B C;  4ZK7 A;  5ITZ B;  5GAP K;  4BVT A;  3SIV A;  3R0P A;  2UYN A;  1YJW F;  4X1Y A;  3D01 A;  3QUW A;  1W5A A;  1Q8R A;  2VGM A;  4O4J A;  1CLI A;  3D54 A;  5MN5 A;  1VQM F;  3VOB A;  5EZY B;  3VYU C;  4EI9 A;  4TV8 B;  4C8I A;  3NVK E;  4X1I B;  1J7H A;  3ZOP A;  3M1X A;  1PXW A;  3FBA A;  3CCU F;  3ON1 A;  5GON B;  3V7Q A;  4C8G A;  4O4H B;  3WJQ A;  2CVL A;  1CK2 A;  3WJP A;  1VQ5 F;  2UYP A;  3S0Y A;  3NVI B;  2ZF8 A;  4IHJ A;  2ZVZ A;  3FD6 A;  3NK6 A;  5JH7 B;  3CCS F;  2P6Y A;  3VOA A;  1QD9 A;  3VI6 A;  1W58 1;  5B8F A;  2UZH A;  3CYP B;  2KG4 A;  3CYQ A;  3OW2 F;  4EB6 A;  1SA0 B;  3VCZ A;  3RA5 A;  5HY2 A;  4TUY B;  5IYZ A;  1VQK F;  5LOV B;  3RYI B;  3J80 M;  3C9S A;  5HXZ A;  4ZOL A;  4I4T A;  5CB4 A;  1VQ4 F;  5EWR A;  2GZL A;  3JAW A;  3CCE F;  4C82 A;  3VTI C;  1FSZ A;  2Z1F A;  3LYB A;  5CA0 B;  4F6R B;  1N8R H;  2HP0 B;  3ESJ A;  2LBW A;  2AIF A;  1CN7 A;  3U0O A;  2VAM A;  1GO0 A;  1TUB B;  5JVD A;  1FFX B;  4X3M A;  3UT5 B;  3CG6 A;  2H8C A;  2DYY A;  1NJI H;  3GYQ A;  3K12 A;  3Q8H A;  3ELC A;  3B6N A;  3NMU C;  1X7P A;  5IT9 M;  3HKB B;  3MBM A;  5CA1 B;  1GX1 A;  2I6D A;  1JY8 A;  3JAS A;  4DXD A;  2Z1E A;  2CWJ A;  2BTQ B;  5EB0 A;  2HS4 A;  3WGK A;  5HY1 A;  2OHW A;  4LNU A;  3HTN A;  1W55 A;  5LP6 C;  1TVK A;  4ZHQ B;  3IR9 A;  5HXU A;  5IJ0 A;  1X25 A;  3FD5 A;  3D00 A;  4G4W A;  3V7E A;  3N2K A;  3IEW A;  1JFF A;  2YXZ A;  4X20 B;  4BW0 B;  1COM A;  3F0G A;  4NWO B;  3CD6 F;  1IPA A;  3CB2 A;  1JN1 A;  4EI7 A;  4G4Y A;  3N2G B;  4BVQ A;  5EYP A;  1IV4 A;  1W5F A;  5C8Y B;  5LP6 B;  2QEX F;  3HKD A;  4TV9 B;  3JAL A;  2WAL A;  3G4S F;  2L26 A;  3C9T A;  5LXT B;  1Q81 H;  1E7K A;  1ONI A;  5JQG B;  1H47 A;  4HNA B;  4U3J A;  3V4D A;  3MCA B;  1QU9 A;  3RYF B;  2KGW A;  3DDN A;  4O2B B;  1QAH A;  4YJ3 A;  3CC4 F;  3ERN A;  3LWV C;  2FC3 A;  1T0K B;  4BT4 A;  3IEQ A;  4WBN A;  3HKC B;  3S0H A;  4BY9 D;  3O85 A;  2IQQ A;  5HY0 A;  1S72 F;  4BT6 A;  3PLA C;  3WPX A;  3CCV F;  3RYC A;  2HX0 A;  1VQ6 F;  1DT9 A;  3F0E A;  2UYJ A;  4IIJ B;  2CHT A;  4ZI7 A;  4G88 A;  3RYH B;  3OBW A;  2PMP A;  4ZHY B;  3LFO A;  1VQL F;  1ZWZ A;  2QI2 A;  1XHO A;  5FLX M;  3KJK A;  2H8E A;  3IKE A;  3CPQ A;  1OAP A;  3C9R A;  4O4I B;  4YJ2 B;  5LA6 B;  2CSL A;  1RA4 A; 
#chains in the Genus database with same CATH homology
 1JN1 A;  1GX1 A;  1W57 A;  3IEQ A;  3P10 A;  1JY8 A;  1T0A A;  3K14 A;  1IV4 A;  3JVH A;  1U3L A;  3K2X A;  1YQN A;  1VH8 A;  2AMT A;  3EOR A;  3ESJ A;  3F0E A;  1VHA A;  3F6M A;  4C8E A;  1U40 A;  5B8F A;  2UZH A;  1W55 A;  3F0D A;  1H48 A;  1IV1 A;  2PMP A;  3GHZ A;  3P0Z A;  1U3P A;  3FPI A;  4C8I A;  1IV3 A;  1KNK A;  3Q8H A;  1H47 A;  3ELC A;  3F0F A;  3IKE A;  1IV2 A;  3IEW A;  3B6N A;  3QHD A;  1KNJ A;  3KE1 A;  3RE3 A;  4C81 A;  3IKF A;  3T80 A;  2GZL A;  3F0G A;  3FBA A;  4C8G A;  4C82 A;  1U43 A;  3ERN A;  3MBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...