2AMTA

Structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with a cdp derived fluorescent inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
b'MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
molecule tags Lyase
source organism Escherichia coli
publication title Fluorescent Inhibitors for IspF, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.
pubmed doi rcsb
total genus 43
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2amtA00
3B6NA 4C8IA 3RE3A 1JY8A 1U40A 3IKFA 3JVHA 1H48A 1VH8A 1W55A 3IKEA 3F0FA 3T80A 3KE1A 4C82A 3EORA 1IV1A 3ERNA 3P10A 3F0GA 3GHZA 3ELCA 1GX1A 1H47A 3ESJA 3F0DA 3IEQA 1U3LA 3QHDA 1IV4A 1YQNA 1T0AA 3P0ZA 3Q8HA 4C81A 1KNJA 1U43A 4C8GA 3FBAA 1KNKA 3FPIA 3F0EA 3MBMA 2UZHA 1IV2A 4C8EA 3F6MA 2PMPA 5B8FA 3IEWA 2GZLA 3K14A 3K2XA 1VHAA 1U3PA 1IV3A 2AMTA 1JN1A 1W57A
chains in the Genus database with same CATH superfamily
3RA5A 3B6NA 3CD6F 3CMEF 4ZK7A 3WPXA 4R40B 3LYBA 3C9TA 3V7EA 3V4DA 2UYNB 4DRXB 1S72F 3RYHA 5EB1B 2OHWA 4U39A 1QVFF 5CA0A 3CC2F 3E22B 4BVSA 5EO3A 4BVTA 5MN4A 1VQ5F 2B33A 3NK7A 2LBWA 1VK3A 1W57A 3CCJF 4C8IA 4X1KA 5FLXM 3CCSF 1NMUB 1J7HA 3T80A 2CZWA 1GX1A 1H47A 2Z1FA 1N8RH 1VQ7F 3P4EA 4IIJA 5ITZA 4X1IB 3G4SF 5A2QM 3C9RA 2DYYA 1K9MH 5IJ9B 2UZHA 4RHAA 4C8EA 5LYJB 3S06A 2KTUA 2NMUA 2HQSC 5AVMA 4O4HA 4X20A 5CA1A 2ZVYA 4EI9A 5LYJA 5LA6A 5GANK 2ALEA 5IJ9A 2HP0A 1FNJA 2Z1EA 3E20B 4O2AA 4X1IA 1IV1A 5HY2A 2KG4A 3D00A 3QTYA 1PXWA 1RLUA 4BVQA 5LXTB 5JQGB 3QHDA 4C81A 1X52A 3D01A 3S0WA 4X1KB 3WGLA 5KMGA 3WGNA 4ZHVA 3JAWA 1SZQA 4BW0B 1VHAA 4O4LA 1YGYA 4XCQA 1X25A 2IQQA 3E22A 1ONIA 3JASB 5EYPB 5CA0B 3CC4F 3IKEA 1W55A 3K0TA 5JH7A 5EZYB 5CB4B 3VOAA 4I50B 4ZHWA 2RHOA 2ZOVA 2LCAA 4BT3A 1H7MA 3VYUC 3RYHB 5FJ4C 3Q8HA 4G4YA 1M90H 3LWPC 3SIUA 4ZHYB 3HJWC 1IV2A 3TD4A 1YITF 4KWEA 4ZHQA 3VMFB 4FFBA 4IHJB 3VOBA 2OTJF 1RQ2A 2AIFA 4HNAB 4WBNA 5LOVB 3SIVA 1U40A 3IKFA 3CXCF 1FFXB 4B46A 5BMVB 3CCMF 4BVRA 2F9ZC 4YJ3B 1TUBB 3LWVC 4NWOB 3ZP7A 5J2UB 5HY1A 5JVDB 2I6RA 5LP6C 3WGMA 1KNJA 1U43A 3HAXD 2OZBA 4ZOLB 4O4JB 2H6LA 3ZOPA 1CLIA 2GZLA 4NQ3A 2CW4A 4TV9B 1W5BA 3AGKA 3N4YA 1K8AH 5KX5B 1JY8A 5J2TB 4BT2A 2QA4F 3G71F 3F0FA 1NJIH 3ZP4A 1GO0A 4I4TB 2BTUA 5EAZA 5JVDA 4ERHA 2GVIA 1T0KB 4G88A 2VGNA 2Z1TA 1SA0A 3FD5A 1Q82H 1TVKA 1W59A 1FFXA 2PMPA 4M8IA 3CPWF 1KC8H 1X7OA 4TV8B 4TV8A 3PLAC 1Q81H 3NMUC 4EB6A 1W3EX 2Z1UA 3CG6A 3M4SA 3OBYA 3VCZA 1CK2A 1COMA 3WJPA 3KE1A 3OBWA 4F6RA 4RQOA 3EORA 3UT5B 4I55A 1XHOA 4I50A 3CC7F 3VTIC 1OAPA 1RA4A 2BO1A 3KHNA 1Q86H 1JJ2F 1VQ6F 5EZYA 3JCMM 5JH7B 1Q7YH 2R6R1 5EYPA 4U3JA 2Q1YA 1VQLF 2ZAUA 3LMEA 2DT4A 4TV9A 1YJ9F 4BT5A 3CCVF 3V7QA 3N4ZA 4X1YA 3I56F 5GIPC 5IJ0A 3CCEF 2I6DA 4ZOLA 3C9UA 3FFMA 3JVHA 5JCOA 3MDOA 4C82A 3ERNA 5JQGA 1XBIA 1RQ7A 5J2UA 2CHSA 4YJ3A 3I3FA 3S0YA 3DDNA 3HKEA 4C8GA 5BMVA 2HP0B 5LA6B 4NUTA 3WPWA 5C8YA 4O2BA 2Z01A 1YIJF 1JD1A 3VO8A 5GAPK 1U3PA 4FFBB 3M1XA 2RHJA 3L7QA 3CCRF 3F0DA 2R751 4TUYA 3N2GA 2UYPA 3RYCB 2IG8A 1VQKF 2QTPA 3LWQC 1E7KA 1GO1A 2LBXA 3P10A 5ITZB 5FNVA 2RHHA 3JATA 4TZZA 4BT4A 3N2KA 1U3LA 2RB9A 2VGMA 5IT9M 5CB4A 2IAFA 2YXZA 3MBMA 1W40A 2G9IA 1Q8RA 3ZO8A 3IR9A 3KJKA 3LFOA 4O4LB 2ZF8A 3S03A 1SDSA 3JAWB 2BTQB 5HXUA 3RE3A 2UYJA 1VH8A 3QUWA 2OTLF 3IMPA 4BT7A 3N2KB 1IPAA 3GHZA 5LXTA 3JATB 3NVKE 2H8EA 3TD5A 3E1YA 4DRXA 5MN6A 2UYNA 3P0ZA 3VIUA 1W5AA 2OTMA 4O4IB 3JAMM 1X7PA 3GYQA 3F6MA 1UI9A 5EIBC 5CA1B 4O4HB 5C8YB 5GONB 4EI7A 3VI6A 5HP7A 2FGYA 4O4IA 1PF5A 3HKEB 2UYKA 2ZODA 1QAHA 5G4VC 2VXYA 4IIJB 2QI2A 3PAFA 2EWCA 3IEQA 1XV2A 3DC2A 1IV4A 2LBTA 3FBAA 3LDTA 4G4WA 1GZ0A 3LWOC 5IJ0B 1UFYA 5B8FA 1VQPF 2WALA 3G6EF 3K14A 5GIOC 3K12A 3WXMB 3CYPB 3WJQA 3LWRC 1DT9A 5HY0A 1QU9A 5HP8A 3ELCA 1W41A 3R0PA 1M1KH 1QD9A 5FNVB 4I55B 2VAWA 4F6RB 1KQSF 1W5EA 2AIZP 1KNKA 3RYCA 4X3MA 3M84A 3N2GB 4TUYB 5EWRA 4EI8A 1Z5WA 3O85A 3HKDA 1JFFB 3WGJA 1R1MA 5GINC 3WJRA 3CCQF 3TD3A 2HS3A 2V9YA 4ZI7B 4O2BB 2W8BC 4LNUB 1RLGA 2P6YA 3OW2F 4BT6A 2HS0A 5IYZB 3KJJA 1W2BF 3CCLF 1SA0B 3CMAF 4BY9D 2PHNA 4C4WC 2HRYA 3RA6A 4B45A 1VQ4F 2CWJA 1CN7A 5DCVA 4DXDA 3RYIA 4I4TA 3S0HA 2H8CA 2GLZA 3U0OA 3FPIA 3NVIB 5J2TA 1FSZA 3HWUA 3MQWA 5KX5A 4X1YB 3V3TA 3IEWA 3HKBB 2QEXF 2CSLA 3GTZA 1VQ9F 2AMTA 4G4ZA 4YJ2A 1FNKA 2KTVA 4O4JA 3WGKA 4U3JB 1YJWF 1H48A 3JALA 1Z5VA 1YI2F 3RYIB 3JARB 4B5CA 4E6EA 1QVGF 4PWTA 1OFUA 2BTOA 3JAKB 2VAPA 1VQMF 3UT5A 1W5FA 3HKCA 5JCOC 5HY4A 2HX0A 3F0EA 5HWEA 5IYZA 1K73H 5LP6B 5LOVA 3VYTC 4EB6B 2FC3A 2HS4A 1VQ8F 4LNUA 3RYFA 4ZI7A 1ZWZA 1JFFA 1ODEA 1JN1A 3CPQA 3RYFB 4G4VA 3C8LA 5G4UC 3I7TA 2KGWA 2HRUA 5LP6A 1TVKB 1VQNF 3HKCB 1NQ3A 3JAKA 3C9SA 3ESJA 5EB0A 3S02A 1XRGA 3HTNA 3JARA 1T0AA 1YQNA 3JALB 3CCUF 2RHLA 3CYQA 3JASA 2MQEA 2L26A 4YJ2B 3MCQA 2HP3A 3J80M 1W42A 2K1SA 3J81M 3HKBA 3OONA 3BYQA 1YJNF 4G4XA 5KMGB 2CHTA 3CB2A 4B62A 2HVYD 5MN5A 3FD6A 2CVLA 3F0GA 2Q1XA 1TUBA 5HXZA 4LCKA 4O2AB 2ZVZA 2N48A 1KD1H 3KIZA 3VYSC 4HNAA 4WBNB 5GONA 2JNBA 1VQOF 1YHQF 3MCAB 3D54A 2YYEA 4X3LA 3NK6A 3ON1A 1VQVA 3K2XA 4X20B 5EIBD 3I55F 4IHJA 1W581 2VAMA 3HKDB 1DBFA 3J7AR 1IV3A 4ZHQB
chains in the Genus database with same CATH topology
3B6NA 4C8IA 3RE3A 1JY8A 1U40A 3IKFA 3JVHA 1H48A 1VH8A 1W55A 3IKEA 3F0FA 3T80A 3KE1A 4C82A 3EORA 1IV1A 3ERNA 3P10A 3F0GA 3GHZA 3ELCA 1GX1A 1H47A 3ESJA 3F0DA 3IEQA 1U3LA 3QHDA 1IV4A 1YQNA 1T0AA 3P0ZA 3Q8HA 4C81A 1KNJA 1U43A 4C8GA 3FBAA 1KNKA 3FPIA 3F0EA 3MBMA 2UZHA 1IV2A 4C8EA 3F6MA 2PMPA 5B8FA 3IEWA 2GZLA 3K14A 3K2XA 1VHAA 1U3PA 1IV3A 2AMTA 1JN1A 1W57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6N A;  4C8I A;  3RE3 A;  1JY8 A;  1U40 A;  3IKF A;  3JVH A;  1H48 A;  1VH8 A;  1W55 A;  3IKE A;  3F0F A;  3T80 A;  3KE1 A;  4C82 A;  3EOR A;  1IV1 A;  3ERN A;  3P10 A;  3F0G A;  3GHZ A;  3ELC A;  1GX1 A;  1H47 A;  3ESJ A;  3F0D A;  3IEQ A;  1U3L A;  3QHD A;  1IV4 A;  1YQN A;  1T0A A;  3P0Z A;  3Q8H A;  4C81 A;  1KNJ A;  1U43 A;  4C8G A;  3FBA A;  1KNK A;  3FPI A;  3F0E A;  3MBM A;  2UZH A;  1IV2 A;  4C8E A;  3F6M A;  2PMP A;  5B8F A;  3IEW A;  2GZL A;  3K14 A;  3K2X A;  1VHA A;  1U3P A;  1IV3 A;  2AMT A;  1JN1 A;  1W57 A; 
#chains in the Genus database with same CATH topology
 3RA5 A;  3B6N A;  3CD6 F;  3CME F;  4ZK7 A;  3WPX A;  4R40 B;  3LYB A;  3C9T A;  3V7E A;  3V4D A;  2UYN B;  4DRX B;  1S72 F;  3RYH A;  5EB1 B;  2OHW A;  4U39 A;  1QVF F;  5CA0 A;  3CC2 F;  3E22 B;  4BVS A;  5EO3 A;  4BVT A;  5MN4 A;  1VQ5 F;  2B33 A;  3NK7 A;  2LBW A;  1VK3 A;  1W57 A;  3CCJ F;  4C8I A;  4X1K A;  5FLX M;  3CCS F;  1NMU B;  1J7H A;  3T80 A;  2CZW A;  1GX1 A;  1H47 A;  2Z1F A;  1N8R H;  1VQ7 F;  3P4E A;  4IIJ A;  5ITZ A;  4X1I B;  3G4S F;  5A2Q M;  3C9R A;  2DYY A;  1K9M H;  5IJ9 B;  2UZH A;  4RHA A;  4C8E A;  5LYJ B;  3S06 A;  2KTU A;  2NMU A;  2HQS C;  5AVM A;  4O4H A;  4X20 A;  5CA1 A;  2ZVY A;  4EI9 A;  5LYJ A;  5LA6 A;  5GAN K;  2ALE A;  5IJ9 A;  2HP0 A;  1FNJ A;  2Z1E A;  3E20 B;  4O2A A;  4X1I A;  1IV1 A;  5HY2 A;  2KG4 A;  3D00 A;  3QTY A;  1PXW A;  1RLU A;  4BVQ A;  5LXT B;  5JQG B;  3QHD A;  4C81 A;  1X52 A;  3D01 A;  3S0W A;  4X1K B;  3WGL A;  5KMG A;  3WGN A;  4ZHV A;  3JAW A;  1SZQ A;  4BW0 B;  1VHA A;  4O4L A;  1YGY A;  4XCQ A;  1X25 A;  2IQQ A;  3E22 A;  1ONI A;  3JAS B;  5EYP B;  5CA0 B;  3CC4 F;  3IKE A;  1W55 A;  3K0T A;  5JH7 A;  5EZY B;  5CB4 B;  3VOA A;  4I50 B;  4ZHW A;  2RHO A;  2ZOV A;  2LCA A;  4BT3 A;  1H7M A;  3VYU C;  3RYH B;  5FJ4 C;  3Q8H A;  4G4Y A;  1M90 H;  3LWP C;  3SIU A;  4ZHY B;  3HJW C;  1IV2 A;  3TD4 A;  1YIT F;  4KWE A;  4ZHQ A;  3VMF B;  4FFB A;  4IHJ B;  3VOB A;  2OTJ F;  1RQ2 A;  2AIF A;  4HNA B;  4WBN A;  5LOV B;  3SIV A;  1U40 A;  3IKF A;  3CXC F;  1FFX B;  4B46 A;  5BMV B;  3CCM F;  4BVR A;  2F9Z C;  4YJ3 B;  1TUB B;  3LWV C;  4NWO B;  3ZP7 A;  5J2U B;  5HY1 A;  5JVD B;  2I6R A;  5LP6 C;  3WGM A;  1KNJ A;  1U43 A;  3HAX D;  2OZB A;  4ZOL B;  4O4J B;  2H6L A;  3ZOP A;  1CLI A;  2GZL A;  4NQ3 A;  2CW4 A;  4TV9 B;  1W5B A;  3AGK A;  3N4Y A;  1K8A H;  5KX5 B;  1JY8 A;  5J2T B;  4BT2 A;  2QA4 F;  3G71 F;  3F0F A;  1NJI H;  3ZP4 A;  1GO0 A;  4I4T B;  2BTU A;  5EAZ A;  5JVD A;  4ERH A;  2GVI A;  1T0K B;  4G88 A;  2VGN A;  2Z1T A;  1SA0 A;  3FD5 A;  1Q82 H;  1TVK A;  1W59 A;  1FFX A;  2PMP A;  4M8I A;  3CPW F;  1KC8 H;  1X7O A;  4TV8 B;  4TV8 A;  3PLA C;  1Q81 H;  3NMU C;  4EB6 A;  1W3E X;  2Z1U A;  3CG6 A;  3M4S A;  3OBY A;  3VCZ A;  1CK2 A;  1COM A;  3WJP A;  3KE1 A;  3OBW A;  4F6R A;  4RQO A;  3EOR A;  3UT5 B;  4I55 A;  1XHO A;  4I50 A;  3CC7 F;  3VTI C;  1OAP A;  1RA4 A;  2BO1 A;  3KHN A;  1Q86 H;  1JJ2 F;  1VQ6 F;  5EZY A;  3JCM M;  5JH7 B;  1Q7Y H;  2R6R 1;  5EYP A;  4U3J A;  2Q1Y A;  1VQL F;  2ZAU A;  3LME A;  2DT4 A;  4TV9 A;  1YJ9 F;  4BT5 A;  3CCV F;  3V7Q A;  3N4Z A;  4X1Y A;  3I56 F;  5GIP C;  5IJ0 A;  3CCE F;  2I6D A;  4ZOL A;  3C9U A;  3FFM A;  3JVH A;  5JCO A;  3MDO A;  4C82 A;  3ERN A;  5JQG A;  1XBI A;  1RQ7 A;  5J2U A;  2CHS A;  4YJ3 A;  3I3F A;  3S0Y A;  3DDN A;  3HKE A;  4C8G A;  5BMV A;  2HP0 B;  5LA6 B;  4NUT A;  3WPW A;  5C8Y A;  4O2B A;  2Z01 A;  1YIJ F;  1JD1 A;  3VO8 A;  5GAP K;  1U3P A;  4FFB B;  3M1X A;  2RHJ A;  3L7Q A;  3CCR F;  3F0D A;  2R75 1;  4TUY A;  3N2G A;  2UYP A;  3RYC B;  2IG8 A;  1VQK F;  2QTP A;  3LWQ C;  1E7K A;  1GO1 A;  2LBX A;  3P10 A;  5ITZ B;  5FNV A;  2RHH A;  3JAT A;  4TZZ A;  4BT4 A;  3N2K A;  1U3L A;  2RB9 A;  2VGM A;  5IT9 M;  5CB4 A;  2IAF A;  2YXZ A;  3MBM A;  1W40 A;  2G9I A;  1Q8R A;  3ZO8 A;  3IR9 A;  3KJK A;  3LFO A;  4O4L B;  2ZF8 A;  3S03 A;  1SDS A;  3JAW B;  2BTQ B;  5HXU A;  3RE3 A;  2UYJ A;  1VH8 A;  3QUW A;  2OTL F;  3IMP A;  4BT7 A;  3N2K B;  1IPA A;  3GHZ A;  5LXT A;  3JAT B;  3NVK E;  2H8E A;  3TD5 A;  3E1Y A;  4DRX A;  5MN6 A;  2UYN A;  3P0Z A;  3VIU A;  1W5A A;  2OTM A;  4O4I B;  3JAM M;  1X7P A;  3GYQ A;  3F6M A;  1UI9 A;  5EIB C;  5CA1 B;  4O4H B;  5C8Y B;  5GON B;  4EI7 A;  3VI6 A;  5HP7 A;  2FGY A;  4O4I A;  1PF5 A;  3HKE B;  2UYK A;  2ZOD A;  1QAH A;  5G4V C;  2VXY A;  4IIJ B;  2QI2 A;  3PAF A;  2EWC A;  3IEQ A;  1XV2 A;  3DC2 A;  1IV4 A;  2LBT A;  3FBA A;  3LDT A;  4G4W A;  1GZ0 A;  3LWO C;  5IJ0 B;  1UFY A;  5B8F A;  1VQP F;  2WAL A;  3G6E F;  3K14 A;  5GIO C;  3K12 A;  3WXM B;  3CYP B;  3WJQ A;  3LWR C;  1DT9 A;  5HY0 A;  1QU9 A;  5HP8 A;  3ELC A;  1W41 A;  3R0P A;  1M1K H;  1QD9 A;  5FNV B;  4I55 B;  2VAW A;  4F6R B;  1KQS F;  1W5E A;  2AIZ P;  1KNK A;  3RYC A;  4X3M A;  3M84 A;  3N2G B;  4TUY B;  5EWR A;  4EI8 A;  1Z5W A;  3O85 A;  3HKD A;  1JFF B;  3WGJ A;  1R1M A;  5GIN C;  3WJR A;  3CCQ F;  3TD3 A;  2HS3 A;  2V9Y A;  4ZI7 B;  4O2B B;  2W8B C;  4LNU B;  1RLG A;  2P6Y A;  3OW2 F;  4BT6 A;  2HS0 A;  5IYZ B;  3KJJ A;  1W2B F;  3CCL F;  1SA0 B;  3CMA F;  4BY9 D;  2PHN A;  4C4W C;  2HRY A;  3RA6 A;  4B45 A;  1VQ4 F;  2CWJ A;  1CN7 A;  5DCV A;  4DXD A;  3RYI A;  4I4T A;  3S0H A;  2H8C A;  2GLZ A;  3U0O A;  3FPI A;  3NVI B;  5J2T A;  1FSZ A;  3HWU A;  3MQW A;  5KX5 A;  4X1Y B;  3V3T A;  3IEW A;  3HKB B;  2QEX F;  2CSL A;  3GTZ A;  1VQ9 F;  2AMT A;  4G4Z A;  4YJ2 A;  1FNK A;  2KTV A;  4O4J A;  3WGK A;  4U3J B;  1YJW F;  1H48 A;  3JAL A;  1Z5V A;  1YI2 F;  3RYI B;  3JAR B;  4B5C A;  4E6E A;  1QVG F;  4PWT A;  1OFU A;  2BTO A;  3JAK B;  2VAP A;  1VQM F;  3UT5 A;  1W5F A;  3HKC A;  5JCO C;  5HY4 A;  2HX0 A;  3F0E A;  5HWE A;  5IYZ A;  1K73 H;  5LP6 B;  5LOV A;  3VYT C;  4EB6 B;  2FC3 A;  2HS4 A;  1VQ8 F;  4LNU A;  3RYF A;  4ZI7 A;  1ZWZ A;  1JFF A;  1ODE A;  1JN1 A;  3CPQ A;  3RYF B;  4G4V A;  3C8L A;  5G4U C;  3I7T A;  2KGW A;  2HRU A;  5LP6 A;  1TVK B;  1VQN F;  3HKC B;  1NQ3 A;  3JAK A;  3C9S A;  3ESJ A;  5EB0 A;  3S02 A;  1XRG A;  3HTN A;  3JAR A;  1T0A A;  1YQN A;  3JAL B;  3CCU F;  2RHL A;  3CYQ A;  3JAS A;  2MQE A;  2L26 A;  4YJ2 B;  3MCQ A;  2HP3 A;  3J80 M;  1W42 A;  2K1S A;  3J81 M;  3HKB A;  3OON A;  3BYQ A;  1YJN F;  4G4X A;  5KMG B;  2CHT A;  3CB2 A;  4B62 A;  2HVY D;  5MN5 A;  3FD6 A;  2CVL A;  3F0G A;  2Q1X A;  1TUB A;  5HXZ A;  4LCK A;  4O2A B;  2ZVZ A;  2N48 A;  1KD1 H;  3KIZ A;  3VYS C;  4HNA A;  4WBN B;  5GON A;  2JNB A;  1VQO F;  1YHQ F;  3MCA B;  3D54 A;  2YYE A;  4X3L A;  3NK6 A;  3ON1 A;  1VQV A;  3K2X A;  4X20 B;  5EIB D;  3I55 F;  4IHJ A;  1W58 1;  2VAM A;  3HKD B;  1DBF A;  3J7A R;  1IV3 A;  4ZHQ B; 
#chains in the Genus database with same CATH homology
 3B6N A;  4C8I A;  3RE3 A;  1JY8 A;  1U40 A;  3IKF A;  3JVH A;  1H48 A;  1VH8 A;  1W55 A;  3IKE A;  3F0F A;  3T80 A;  3KE1 A;  4C82 A;  3EOR A;  1IV1 A;  3ERN A;  3P10 A;  3F0G A;  3GHZ A;  3ELC A;  1GX1 A;  1H47 A;  3ESJ A;  3F0D A;  3IEQ A;  1U3L A;  3QHD A;  1IV4 A;  1YQN A;  1T0A A;  3P0Z A;  3Q8H A;  4C81 A;  1KNJ A;  1U43 A;  4C8G A;  3FBA A;  1KNK A;  3FPI A;  3F0E A;  3MBM A;  2UZH A;  1IV2 A;  4C8E A;  3F6M A;  2PMP A;  5B8F A;  3IEW A;  2GZL A;  3K14 A;  3K2X A;  1VHA A;  1U3P A;  1IV3 A;  2AMT A;  1JN1 A;  1W57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...