2AMTA

Structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with a cdp derived fluorescent inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
156
Chain Sequence
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Fluorescent Inhibitors for IspF, an Enzyme in the Non-Mevalonate Pathway for Isoprenoid Biosynthesis and a Potential Target for Antimalarial Therapy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 43
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2005-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 2amtA00
3K14A 3K2XA 1JY8A 1JN1A 4C82A 1U43A 3GHZA 3IKFA 1VH8A 4C8GA 3JVHA 1U3LA 1KNJA 1U40A 3IEWA 3KE1A 1H47A 3F6MA 5B8FA 3F0FA 3T80A 1IV1A 3P0ZA 3QHDA 1KNKA 3FPIA 1GX1A 2GZLA 4C8EA 1T0AA 3ESJA 4C8IA 1IV4A 1U3PA 3EORA 3ERNA 3IKEA 4C81A 3RE3A 3ELCA 3MBMA 2PMPA 3F0DA 1H48A 3FBAA 1YQNA 1W55A 1W57A 2UZHA 3B6NA 1IV3A 1VHAA 2AMTA 3F0EA 3P10A 3IEQA 1IV2A 3F0GA 3Q8HA
chains in the Genus database with same CATH superfamily
2DYYA 1H7MA 3CCSF 1QAHA 3JCMM 3LWRC 1IV1A 2RHOA 2JNBA 5JH7A 5JQGA 5JH7B 5JQGB 4I55A 4IIJA 3LFOA 4I55B 4IIJB 3P4EA 3ZP7A 3G4SF 2CHTA 3KJKA 2H8EA 1GO1A 1VQVA 1XV2A 4R40B 4BT3A 2ZVYA 1QVFF 3RYFA 3SIVA 3RYFB 3KIZA 2IQQA 4HNAA 1YIJF 4LCKA 2BTUA 2I6RA 4HNAB 3LYBA 4ZHVA 1U3LA 1K73H 5AVMA 5KX5A 5KX5B 4ZHYB 1KD1H 2OHWA 3EORA 1ONIA 2RHLA 1PF5A 3VCZA 3TD4A 5J2TA 2YYEA 2HRUA 1VK3A 1IV2A 4LNUA 5J2TB 3Q8HA 5MN4A 5HP8A 3I3FA 3K14A 3K2XA 4BT7A 3OBYA 5IJ9A 5IJ9B 3CB2A 5HY2A 5LXTA 3F6MA 3HWUA 3CG6A 5LXTB 5HP7A 3LWVC 3J7AR 2KTUA 4DXDA 1VQNF 3VTIC 2ZODA 3FD6A 2FC3A 3CPWF 2ZAUA 3MCQA 4I4TA 3CCJF 5GINC 1W57A 1VHAA 4I4TB 5HXUA 5JCOC 2RHHA 4RQOA 3F0GA 3LWPC 3G6EF 4X3MA 2AIFA 5FJ4C 3PAFA 5GIPC 3GTZA 1ODEA 2GVIA 3WXMB 5B8FA 3HKEA 3HKBA 2H6LA 3HKEB 1VQLF 3HKBB 2UYPA 1Z5WA 5EYPA 3V3TA 5EYPB 1VQPF 3KHNA 4B62A 2UYNA 4DRXA 2UYNB 4X20A 1TUBA 4EI9A 4TUYA 3D00A 3JARA 4X20B 4X1YA 1TUBB 4G4VA 2KGWA 4TUYB 3JARB 1Q86H 4X1YB 1FNKA 3ZO8A 1VQ6F 3RYCB 1FNJA 1XRGA 3D54A 3JAMM 1FSZA 1KC8H 3GHZA 1UI9A 1W5EA 2BTQB 4G4YA 4C8GA 1FFXA 4ZOLA 2ZVZA 5MN5A 1FFXB 4ZOLB 1VQ5F 3WGNA 4ERHA 2HX0A 2OZBA 3CD6F 3NK7A 3JATA 3KJJA 2LBTA 4BVRA 1XHOA 3CMEF 2OTMA 4NWOB 2R751 3F0DA 3MDOA 3O85A 5C8YA 2OTJF 3B6NA 5C8YB 3RYIA 5LP6A 1W59A 3MQWA 3ON1A 4G4XA 3RYIB 5LP6B 5EIBD 3VOAA 4KWEA 1VQMF 3C9SA 3C9RA 1YJ9F 1DBFA 2CZWA 2Z1EA 5G4UC 3LDTA 3F0FA 5FLXM 3P0ZA 5GONA 2KG4A 4O4HA 3JASA 3VYUC 4O4HB 3S0WA 1IPAA 1Q81H 3JASB 3I55F 1IV3A 4BT2A 3LWQC 4NQ3A 5HY1A 3VOBA 5LYJA 3HKDA 4O2BA 2B33A 4O2BB 4F6RA 4F6RB 4YJ2A 2HS3A 1U40A 2Z1UA 4YJ2B 5MN6A 1CLIA 3CCQF 4X1IA 3CYPB 4WBNA 4X1IB 4WBNB 5G4VC 1YJWF 2HS0A 3TD5A 4IHJA 2VAWA 2Q1YA 1IV4A 5CA1A 4IHJB 2FGYA 4C81A 3VI6A 1OFUA 2PMPA 3J80M 3CMAF 2MQEA 5EZYA 4EI7A 1J7HA 1E7KA 3WPWA 5EZYB 4BVTA 3WJPA 3NVKE 5LA6A 5LA6B 2F9ZC 4LNUB 1T0KB 2IG8A 4X1KA 1YITF 4TZZA 4X1KB 5EIBC 3RA6A 2Z1TA 3AGKA 1Q8RA 4B46A 3WGJA 4O4IA 4EI8A 2VGNA 3JALA 1X7OA 4O4IB 3JALB 2RB9A 1U3PA 4G4WA 1XBIA 3RE3A 3HJWC 5CB4A 1RLGA 2VXYA 3WJRA 4TV9A 5CB4B 3QUWA 3E20B 4TV9B 5LP6C 1W2BF 1W40A 3CCRF 2AIZP 3M84A 2HQSC 2N48A 4TV8A 2VGMA 1VQ4F 3JVHA 2R6R1 2P6YA 5IYZA 1X52A 2LBXA 5IYZB 3IR9A 1RQ7A 2HP0A 3CC4F 2HP0B 3FD5A 3E1YA 4BT5A 5HY0A 3WGMA 1W55A 3L7QA 2ZF8A 1VQ7F 3P10A 4DRXB 3N2KA 3N2KB 3PLAC 2HVYD 1U43A 4YJ3A 2QA4F 4YJ3B 1KNJA 4G4ZA 3IEWA 3K0TA 1QD9A 1RA4A 2LBWA 5A2QM 1TVKA 1CN7A 3JAKA 1VQ8F 1TVKB 1NQ3A 3JAKB 3VO8A 1W42A 1K9MH 3ZOPA 3RYHA 3JATB 3ERNA 3RYHB 4O4LA 1VQ9F 3CCEF 2V9YA 4O4LB 2AMTA 1KQSF 1ZWZA 3C8LA 5JVDA 5ITZA 4BT4A 5JVDB 2BO1A 3RA5A 5ITZB 1GZ0A 5CA0A 1N8RH 5CA0B 4X3LA 3VYTC 3CCLF 3GYQA 1RQ2A 1JD1A 4BVSA 1RLUA 1GX1A 1VQKF 3S0YA 5GONB 5EB1B 4C8IA 2HP3A 2DT4A 2ZOVA 2GLZA 1JFFA 4M8IA 1JFFB 2Z1FA 3LMEA 1X25A 1YJNF 3N4ZA 5LYJB 5GIOC 3HKDB 4BW0B 5DCVA 4I50A 1VH8A 3V7EA 4B5CA 4I50B 1YI2F 1QU9A 3IMPA 3V4DA 4U39A 4ZHQA 2HRYA 4ZHQB 2CW4A 2GZLA 1W581 4C8EA 1T0AA 3ESJA 3K12A 3SIUA 2L26A 3MBMA 3FBAA 5CA1B 3JAWA 3BYQA 3JAWB 4PWTA 3N2GA 3NK6A 2UYKA 2LCAA 3N2GB 2I6DA 1JN1A 1W41A 2RHJA 3CXCF 4C4WC 1YHQF 4BT6A 2W8BC 3CC7F 3OW2F 3OBWA 1Z5VA 2BTOA 3M4SA 2CHSA 4EB6A 5LOVA 4EB6B 5LOVB 5GAPK 2WALA 2H8CA 1NJIH 4U3JA 5HXZA 5EO3A 4U3JB 2UZHA 1M1KH 3NVIB 3N4YA 3LWOC 2HS4A 1M90H 4O4JA 5KMGA 1SA0A 4RHAA 4O4JB 5KMGB 1SA0B 5EWRA 1UFYA 1W5BA 1DT9A 1S72F 3HKCA 3D01A 3WGLA 2CSLA 4TV8B 3HKCB 3S03A 3KE1A 3UT5A 3DDNA 3UT5B 1COMA 3HAXD 5EB0A 3WJQA 4BVQA 3CCUF 3VIUA 3C9UA 3T80A 3TD3A 3NMUC 3I7TA 3CYQA 3S02A 5FNVA 4XCQA 2ALEA 5FNVB 1Q82H 5GANK 1H48A 5EAZA 1R1MA 4ZHWA 4ZI7A 2CWJA 4ZI7B 3HTNA 2VAMA 2NMUA 1PXWA 1X7PA 4C82A 3MCAB 3IKFA 2IAFA 2G9IA 3FFMA 4FFBA 1NMUB 3M1XA 4FFBB 3R0PA 2PHNA 1H47A 3ZP4A 2YXZA 1CK2A 3S0HA 5HWEA 3QHDA 1KNKA 4E6EA 2OTLF 1QVGF 3VYSC 1SDSA 3IKEA 3ELCA 4BY9D 1YQNA 3WGKA 1YGYA 3CPQA 2Q1XA 1K8AH 3QTYA 2K1SA 3RYCA 3IEQA 2CVLA 5IJ0A 3WPXA 4ZK7A 1JJ2F 5IJ0B 1JY8A 3CCVF 5J2UA 2QTPA 5J2UB 3C9TA 4O2AA 3E22A 3I56F 1VQOF 3S06A 1W3EX 4O2AB 5BMVA 3E22B 4NUTA 3VMFB 5BMVB 3G71F 5IT9M 2VAPA 3OONA 3FPIA 3J81M 2UYJA 2QEXF 1Q7YH 1OAPA 2Z01A 4G88A 1SZQA 2KTVA 2QI2A 5JCOA 4B45A 3CC2F 1GO0A 5HY4A 3V7QA 2EWCA 3F0EA 1W5AA 3DC2A 3CCMF 1W5FA 3U0OA
chains in the Genus database with same CATH topology
3K14A 3K2XA 1JY8A 1JN1A 4C82A 1U43A 3GHZA 3IKFA 1VH8A 4C8GA 3JVHA 1U3LA 1KNJA 1U40A 3IEWA 3KE1A 1H47A 3F6MA 5B8FA 3F0FA 3T80A 1IV1A 3P0ZA 3QHDA 1KNKA 3FPIA 1GX1A 2GZLA 4C8EA 1T0AA 3ESJA 4C8IA 1IV4A 1U3PA 3EORA 3ERNA 3IKEA 4C81A 3RE3A 3ELCA 3MBMA 2PMPA 3F0DA 1H48A 3FBAA 1YQNA 1W55A 1W57A 2UZHA 3B6NA 1IV3A 1VHAA 2AMTA 3F0EA 3P10A 3IEQA 1IV2A 3F0GA 3Q8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K14 A;  3K2X A;  1JY8 A;  1JN1 A;  4C82 A;  1U43 A;  3GHZ A;  3IKF A;  1VH8 A;  4C8G A;  3JVH A;  1U3L A;  1KNJ A;  1U40 A;  3IEW A;  3KE1 A;  1H47 A;  3F6M A;  5B8F A;  3F0F A;  3T80 A;  1IV1 A;  3P0Z A;  3QHD A;  1KNK A;  3FPI A;  1GX1 A;  2GZL A;  4C8E A;  1T0A A;  3ESJ A;  4C8I A;  1IV4 A;  1U3P A;  3EOR A;  3ERN A;  3IKE A;  4C81 A;  3RE3 A;  3ELC A;  3MBM A;  2PMP A;  3F0D A;  1H48 A;  3FBA A;  1YQN A;  1W55 A;  1W57 A;  2UZH A;  3B6N A;  1IV3 A;  1VHA A;  2AMT A;  3F0E A;  3P10 A;  3IEQ A;  1IV2 A;  3F0G A;  3Q8H A; 
#chains in the Genus database with same CATH topology
 2DYY A;  1H7M A;  3CCS F;  1QAH A;  3JCM M;  3LWR C;  1IV1 A;  2RHO A;  2JNB A;  5JH7 A;  5JQG A;  5JH7 B;  5JQG B;  4I55 A;  4IIJ A;  3LFO A;  4I55 B;  4IIJ B;  3P4E A;  3ZP7 A;  3G4S F;  2CHT A;  3KJK A;  2H8E A;  1GO1 A;  1VQV A;  1XV2 A;  4R40 B;  4BT3 A;  2ZVY A;  1QVF F;  3RYF A;  3SIV A;  3RYF B;  3KIZ A;  2IQQ A;  4HNA A;  1YIJ F;  4LCK A;  2BTU A;  2I6R A;  4HNA B;  3LYB A;  4ZHV A;  1U3L A;  1K73 H;  5AVM A;  5KX5 A;  5KX5 B;  4ZHY B;  1KD1 H;  2OHW A;  3EOR A;  1ONI A;  2RHL A;  1PF5 A;  3VCZ A;  3TD4 A;  5J2T A;  2YYE A;  2HRU A;  1VK3 A;  1IV2 A;  4LNU A;  5J2T B;  3Q8H A;  5MN4 A;  5HP8 A;  3I3F A;  3K14 A;  3K2X A;  4BT7 A;  3OBY A;  5IJ9 A;  5IJ9 B;  3CB2 A;  5HY2 A;  5LXT A;  3F6M A;  3HWU A;  3CG6 A;  5LXT B;  5HP7 A;  3LWV C;  3J7A R;  2KTU A;  4DXD A;  1VQN F;  3VTI C;  2ZOD A;  3FD6 A;  2FC3 A;  3CPW F;  2ZAU A;  3MCQ A;  4I4T A;  3CCJ F;  5GIN C;  1W57 A;  1VHA A;  4I4T B;  5HXU A;  5JCO C;  2RHH A;  4RQO A;  3F0G A;  3LWP C;  3G6E F;  4X3M A;  2AIF A;  5FJ4 C;  3PAF A;  5GIP C;  3GTZ A;  1ODE A;  2GVI A;  3WXM B;  5B8F A;  3HKE A;  3HKB A;  2H6L A;  3HKE B;  1VQL F;  3HKB B;  2UYP A;  1Z5W A;  5EYP A;  3V3T A;  5EYP B;  1VQP F;  3KHN A;  4B62 A;  2UYN A;  4DRX A;  2UYN B;  4X20 A;  1TUB A;  4EI9 A;  4TUY A;  3D00 A;  3JAR A;  4X20 B;  4X1Y A;  1TUB B;  4G4V A;  2KGW A;  4TUY B;  3JAR B;  1Q86 H;  4X1Y B;  1FNK A;  3ZO8 A;  1VQ6 F;  3RYC B;  1FNJ A;  1XRG A;  3D54 A;  3JAM M;  1FSZ A;  1KC8 H;  3GHZ A;  1UI9 A;  1W5E A;  2BTQ B;  4G4Y A;  4C8G A;  1FFX A;  4ZOL A;  2ZVZ A;  5MN5 A;  1FFX B;  4ZOL B;  1VQ5 F;  3WGN A;  4ERH A;  2HX0 A;  2OZB A;  3CD6 F;  3NK7 A;  3JAT A;  3KJJ A;  2LBT A;  4BVR A;  1XHO A;  3CME F;  2OTM A;  4NWO B;  2R75 1;  3F0D A;  3MDO A;  3O85 A;  5C8Y A;  2OTJ F;  3B6N A;  5C8Y B;  3RYI A;  5LP6 A;  1W59 A;  3MQW A;  3ON1 A;  4G4X A;  3RYI B;  5LP6 B;  5EIB D;  3VOA A;  4KWE A;  1VQM F;  3C9S A;  3C9R A;  1YJ9 F;  1DBF A;  2CZW A;  2Z1E A;  5G4U C;  3LDT A;  3F0F A;  5FLX M;  3P0Z A;  5GON A;  2KG4 A;  4O4H A;  3JAS A;  3VYU C;  4O4H B;  3S0W A;  1IPA A;  1Q81 H;  3JAS B;  3I55 F;  1IV3 A;  4BT2 A;  3LWQ C;  4NQ3 A;  5HY1 A;  3VOB A;  5LYJ A;  3HKD A;  4O2B A;  2B33 A;  4O2B B;  4F6R A;  4F6R B;  4YJ2 A;  2HS3 A;  1U40 A;  2Z1U A;  4YJ2 B;  5MN6 A;  1CLI A;  3CCQ F;  4X1I A;  3CYP B;  4WBN A;  4X1I B;  4WBN B;  5G4V C;  1YJW F;  2HS0 A;  3TD5 A;  4IHJ A;  2VAW A;  2Q1Y A;  1IV4 A;  5CA1 A;  4IHJ B;  2FGY A;  4C81 A;  3VI6 A;  1OFU A;  2PMP A;  3J80 M;  3CMA F;  2MQE A;  5EZY A;  4EI7 A;  1J7H A;  1E7K A;  3WPW A;  5EZY B;  4BVT A;  3WJP A;  3NVK E;  5LA6 A;  5LA6 B;  2F9Z C;  4LNU B;  1T0K B;  2IG8 A;  4X1K A;  1YIT F;  4TZZ A;  4X1K B;  5EIB C;  3RA6 A;  2Z1T A;  3AGK A;  1Q8R A;  4B46 A;  3WGJ A;  4O4I A;  4EI8 A;  2VGN A;  3JAL A;  1X7O A;  4O4I B;  3JAL B;  2RB9 A;  1U3P A;  4G4W A;  1XBI A;  3RE3 A;  3HJW C;  5CB4 A;  1RLG A;  2VXY A;  3WJR A;  4TV9 A;  5CB4 B;  3QUW A;  3E20 B;  4TV9 B;  5LP6 C;  1W2B F;  1W40 A;  3CCR F;  2AIZ P;  3M84 A;  2HQS C;  2N48 A;  4TV8 A;  2VGM A;  1VQ4 F;  3JVH A;  2R6R 1;  2P6Y A;  5IYZ A;  1X52 A;  2LBX A;  5IYZ B;  3IR9 A;  1RQ7 A;  2HP0 A;  3CC4 F;  2HP0 B;  3FD5 A;  3E1Y A;  4BT5 A;  5HY0 A;  3WGM A;  1W55 A;  3L7Q A;  2ZF8 A;  1VQ7 F;  3P10 A;  4DRX B;  3N2K A;  3N2K B;  3PLA C;  2HVY D;  1U43 A;  4YJ3 A;  2QA4 F;  4YJ3 B;  1KNJ A;  4G4Z A;  3IEW A;  3K0T A;  1QD9 A;  1RA4 A;  2LBW A;  5A2Q M;  1TVK A;  1CN7 A;  3JAK A;  1VQ8 F;  1TVK B;  1NQ3 A;  3JAK B;  3VO8 A;  1W42 A;  1K9M H;  3ZOP A;  3RYH A;  3JAT B;  3ERN A;  3RYH B;  4O4L A;  1VQ9 F;  3CCE F;  2V9Y A;  4O4L B;  2AMT A;  1KQS F;  1ZWZ A;  3C8L A;  5JVD A;  5ITZ A;  4BT4 A;  5JVD B;  2BO1 A;  3RA5 A;  5ITZ B;  1GZ0 A;  5CA0 A;  1N8R H;  5CA0 B;  4X3L A;  3VYT C;  3CCL F;  3GYQ A;  1RQ2 A;  1JD1 A;  4BVS A;  1RLU A;  1GX1 A;  1VQK F;  3S0Y A;  5GON B;  5EB1 B;  4C8I A;  2HP3 A;  2DT4 A;  2ZOV A;  2GLZ A;  1JFF A;  4M8I A;  1JFF B;  2Z1F A;  3LME A;  1X25 A;  1YJN F;  3N4Z A;  5LYJ B;  5GIO C;  3HKD B;  4BW0 B;  5DCV A;  4I50 A;  1VH8 A;  3V7E A;  4B5C A;  4I50 B;  1YI2 F;  1QU9 A;  3IMP A;  3V4D A;  4U39 A;  4ZHQ A;  2HRY A;  4ZHQ B;  2CW4 A;  2GZL A;  1W58 1;  4C8E A;  1T0A A;  3ESJ A;  3K12 A;  3SIU A;  2L26 A;  3MBM A;  3FBA A;  5CA1 B;  3JAW A;  3BYQ A;  3JAW B;  4PWT A;  3N2G A;  3NK6 A;  2UYK A;  2LCA A;  3N2G B;  2I6D A;  1JN1 A;  1W41 A;  2RHJ A;  3CXC F;  4C4W C;  1YHQ F;  4BT6 A;  2W8B C;  3CC7 F;  3OW2 F;  3OBW A;  1Z5V A;  2BTO A;  3M4S A;  2CHS A;  4EB6 A;  5LOV A;  4EB6 B;  5LOV B;  5GAP K;  2WAL A;  2H8C A;  1NJI H;  4U3J A;  5HXZ A;  5EO3 A;  4U3J B;  2UZH A;  1M1K H;  3NVI B;  3N4Y A;  3LWO C;  2HS4 A;  1M90 H;  4O4J A;  5KMG A;  1SA0 A;  4RHA A;  4O4J B;  5KMG B;  1SA0 B;  5EWR A;  1UFY A;  1W5B A;  1DT9 A;  1S72 F;  3HKC A;  3D01 A;  3WGL A;  2CSL A;  4TV8 B;  3HKC B;  3S03 A;  3KE1 A;  3UT5 A;  3DDN A;  3UT5 B;  1COM A;  3HAX D;  5EB0 A;  3WJQ A;  4BVQ A;  3CCU F;  3VIU A;  3C9U A;  3T80 A;  3TD3 A;  3NMU C;  3I7T A;  3CYQ A;  3S02 A;  5FNV A;  4XCQ A;  2ALE A;  5FNV B;  1Q82 H;  5GAN K;  1H48 A;  5EAZ A;  1R1M A;  4ZHW A;  4ZI7 A;  2CWJ A;  4ZI7 B;  3HTN A;  2VAM A;  2NMU A;  1PXW A;  1X7P A;  4C82 A;  3MCA B;  3IKF A;  2IAF A;  2G9I A;  3FFM A;  4FFB A;  1NMU B;  3M1X A;  4FFB B;  3R0P A;  2PHN A;  1H47 A;  3ZP4 A;  2YXZ A;  1CK2 A;  3S0H A;  5HWE A;  3QHD A;  1KNK A;  4E6E A;  2OTL F;  1QVG F;  3VYS C;  1SDS A;  3IKE A;  3ELC A;  4BY9 D;  1YQN A;  3WGK A;  1YGY A;  3CPQ A;  2Q1X A;  1K8A H;  3QTY A;  2K1S A;  3RYC A;  3IEQ A;  2CVL A;  5IJ0 A;  3WPX A;  4ZK7 A;  1JJ2 F;  5IJ0 B;  1JY8 A;  3CCV F;  5J2U A;  2QTP A;  5J2U B;  3C9T A;  4O2A A;  3E22 A;  3I56 F;  1VQO F;  3S06 A;  1W3E X;  4O2A B;  5BMV A;  3E22 B;  4NUT A;  3VMF B;  5BMV B;  3G71 F;  5IT9 M;  2VAP A;  3OON A;  3FPI A;  3J81 M;  2UYJ A;  2QEX F;  1Q7Y H;  1OAP A;  2Z01 A;  4G88 A;  1SZQ A;  2KTV A;  2QI2 A;  5JCO A;  4B45 A;  3CC2 F;  1GO0 A;  5HY4 A;  3V7Q A;  2EWC A;  3F0E A;  1W5A A;  3DC2 A;  3CCM F;  1W5F A;  3U0O A; 
#chains in the Genus database with same CATH homology
 3K14 A;  3K2X A;  1JY8 A;  1JN1 A;  4C82 A;  1U43 A;  3GHZ A;  3IKF A;  1VH8 A;  4C8G A;  3JVH A;  1U3L A;  1KNJ A;  1U40 A;  3IEW A;  3KE1 A;  1H47 A;  3F6M A;  5B8F A;  3F0F A;  3T80 A;  1IV1 A;  3P0Z A;  3QHD A;  1KNK A;  3FPI A;  1GX1 A;  2GZL A;  4C8E A;  1T0A A;  3ESJ A;  4C8I A;  1IV4 A;  1U3P A;  3EOR A;  3ERN A;  3IKE A;  4C81 A;  3RE3 A;  3ELC A;  3MBM A;  2PMP A;  3F0D A;  1H48 A;  3FBA A;  1YQN A;  1W55 A;  1W57 A;  2UZH A;  3B6N A;  1IV3 A;  1VHA A;  2AMT A;  3F0E A;  3P10 A;  3IEQ A;  1IV2 A;  3F0G A;  3Q8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...