3CXCF

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cxcF00
1NJIH 2CZWA 3LWRC 1N8RH 1XBIA 4BW0B 1KC8H 1QVGF 2OTJF 5A2QM 5GANK 3MCAB 1K73H 3CMEF 5GIOC 1W41A 3RA5A 1DT9A 1W3EX 1NMUB 3NK7A 3PAFA 5FLXM 1VQLF 1VQ9F 2HVYD 1GO0A 5GAPK 1Q7YH 1RA4A 5G4UC 3OBYA 2VGNA 3VI6A 3WXMB 1YJ9F 3CPWF 1YI2F 1YJNF 4C4WC 3LWPC 3CC7F 1T0KB 3J81M 3LWVC 3G4SF 5GINC 3HJWC 3SIVA 3GYQA 1PXWA 1VQ4F 3CXCF 1M1KH 3OBWA 3E1YA 1W2BF 3NVIB 1VQ8F 3CCRF 5GIPC 1VQ5F 1S72F 1Q86H 3CCMF 3RA6A 3HAXD 5DCVA 1VQMF 2ALEA 2QI2A 1QVFF 4NUTA 1YHQF 1YIJF 1X7OA 2KTUA 2LBXA 2KG4A 3V7QA 3CCUF 1JJ2F 3FFMA 3CCLF 5FJ4C 3CPQA 3I55F 2I6DA 3CC4F 2WALA 2LBWA 1GZ0A 3VMFB 1K9MH 3CCQF 2KTVA 1VQKF 3CCVF 3E20B 1VQNF 3SIUA 2QA4F 3OW2F 3NVKE 3O85A 3V7EA 5G4VC 1VQ7F 3CG6A 5EO3A 1Q82H 2VGMA 3PLAC 2FC3A 1X7PA 3N4ZA 5IT9M 3LWOC 2QEXF 2AIFA 1RLGA 3J7AR 4LCKA 3JCMM 1K8AH 1E7KA 3LFOA 3G71F 1VQPF 4X3LA 1YJWF 1W42A 3JAMM 1GO1A 3NK6A 1M90H 1SDSA 3CCSF 2OTLF 1CK2A 5EWRA 2OZBA 3CD6F 1CN7A 3CCJF 1IPAA 4BY9D 3IR9A 1X52A 3CMAF 4TZZA 2OHWA 1VQOF 3CCEF 3ON1A 1VQ6F 1Q81H 3N4YA 1KD1H 1H7MA 3J80M 3AGKA 3LWQC 3NMUC 2BO1A 3I56F 1YITF 3CC2F 1KQSF 2JNBA 3G6EF 1W40A 1ZWZA 4X3MA
chains in the Genus database with same CATH superfamily
3WPWA 3L7QA 1NJIH 1IV1A 1W5EA 3LWRC 1N8RH 5FNVB 4BW0B 2VAMA 1DBFA 4I4TA 5EYPB 5LP6C 1PF5A 2HP3A 5IJ9A 1IV2A 2UZHA 1DT9A 2UYNB 3FBAA 1KNJA 1TVKA 3PAFA 5CB4A 3F0DA 2CVLA 3Q8HA 1ODEA 3KIZA 3WGNA 3K0TA 4G4VA 1T0AA 5ITZA 1QD9A 1VH8A 2PMPA 3OBYA 4O4HB 4C8GA 3HKEA 3HTNA 3KJJA 3CPWF 2NMUA 2HP0A 4BVQA 3J81M 3CC7F 1RQ2A 1T0KB 3HJWC 4O4IB 4ZOLA 3N2KA 3CYQA 3GYQA 5LP6A 3WJQA 4DRXB 2Z1UA 2HS3A 4IHJA 2OTMA 1VQ5F 1U43A 3S0WA 1FNJA 3HAXD 2ALEA 2GVIA 2QI2A 1QVFF 4NUTA 1YHQF 3TD4A 2R751 3CPQA 4U3JB 2BTOA 5HP8A 3C9UA 3JAWB 4I50A 4F6RB 4HNAB 3S0HA 4O4LA 3KJKA 5LYJA 2KTVA 2AMTA 2CW4A 3CCVF 2P6YA 5CA1A 3F0EA 1JFFB 3SIUA 1W55A 2F9ZC 5MN6A 3GHZA 3RYFB 3JATB 4DXDA 2Q1XA 3N4ZA 4FFBB 2QEXF 2AIFA 3J7AR 5HXUA 1K8AH 2Z01A 3RYHA 4ERHA 1H47A 1FSZA 3HKDB 3JAKB 5J2TA 1VQVA 3VYTC 4NWOB 4X20B 1XHOA 1SDSA 2OTLF 5EWRA 4X1IB 2G9IA 4TV8B 5J2UB 1CN7A 5EZYB 4X1YA 3VCZA 1OFUA 3ZOPA 2AIZP 1YGYA 3TD5A 2H8EA 3I3FA 3RYCA 1H7MA 4ZI7A 3CC2F 1KQSF 5GONB 3G6EF 3D01A 2GLZA 4YJ2B 4ZHQB 5LA6A 2ZF8A 3DC2A 2N48A 2Q1YA 3HKCB 4E6EA 2W8BC 3VO8A 2OTJF 2CHTA 1JY8A 4TUYA 3E22A 3RA5A 3JVHA 4O2BB 1W3EX 3NK7A 3VYSC 1J7HA 2IAFA 2VXYA 4C8EA 5HY4A 2HVYD 3HKBB 3IKEA 5HY0A 4BT6A 5G4UC 1W5AA 4O4JA 5CA0A 3IEWA 4C4WC 3LWPC 5KMGA 3LWVC 3JARB 3G4SF 3SIVA 3I7TA 2IQQA 3CXCF 3WJRA 5C8YB 1M1KH 5IYZA 5LOVA 3CCRF 2MQEA 4EB6B 3OONA 1S72F 4ZHYB 3KE1A 5MN4A 2RHJA 4XCQA 1YIJF 3C8LA 2KTUA 3CCUF 2YYEA 3FFMA 3I55F 1SZQA 2I6DA 1W581 5BMVA 1Z5VA 3VMFB 4I55A 1K9MH 2ZODA 2BTUA 3ERNA 3LMEA 3VIUA 3JASA 5KMGB 1IV4A 2HRUA 3FD6A 1VQNF 4O2AA 3OW2F 3B6NA 3O85A 1IV3A 4I4TB 3U0OA 5IJ9B 5G4VC 5EO3A 1Z5WA 1Q82H 1FNKA 2B33A 3PLAC 2FC3A 1X7PA 4C82A 2PHNA 1W5FA 1TVKB 3RE3A 5CB4B 3LDTA 2Z1FA 2QTPA 2H8CA 2H6LA 1YJWF 4C8IA 4BT5A 5ITZB 1M90H 3D54A 4EI7A 2K1SA 2CWJA 3V4DA 3CD6F 1W57A 3HKEB 4WBNA 3M4SA 5EAZA 1W5BA 2HP0B 2DT4A 3F0FA 4BVSA 2Z1EA 1SA0A 4ZOLB 5IJ0A 3N2KB 2OHWA 2RHHA 4TZZA 5LP6B 4BT3A 2FGYA 3N4YA 1KD1H 3J80M 4IHJB 5HP7A 2JNBA 2Z1TA 1W40A 3M84A 3N2GA 4M8IA 4TV9A 2L26A 2ZVYA 1QVGF 4G88A 5A2QM 5GANK 3MCAB 1K73H 1NQ3A 1XRGA 5GIOC 4I50B 1FFXA 1GX1A 3C9TA 4O4LB 5JQGA 1TUBA 5LYJB 1NMUB 3K2XA 3IEQA 3WJPA 5HXZA 2CHSA 3WPXA 5FLXM 5CA1B 1VQ9F 5GAPK 1QU9A 4LNUA 2I6RA 2VAPA 3MCQA 4YJ3A 3P0ZA 5EB0A 4G4YA 1VHAA 3UT5A 1YJ9F 3ZP7A 4R40B 1YI2F 2UYJA 1YJNF 1Q8RA 2KGWA 1COMA 4BT7A 5KX5A 5JH7A 5GINC 1XV2A 2RHLA 3RYHB 1QAHA 5J2TB 1PXWA 3RYIA 1VQ4F 5JVDA 3OBWA 3E1YA 1W2BF 4IIJA 1VQ8F 3NVIB 4KWEA 5HY1A 5GIPC 5LXTA 1Q86H 4X1KA 3RA6A 3FD5A 5MN5A 5DCVA 3M1XA 1CLIA 4X1YB 3K14A 2UYKA 1YQNA 5JCOC 3V7QA 1JJ2F 3P10A 5FNVA 3RYCB 5EYPA 3JALA 2CSLA 4ZI7B 2R6R1 3CC4F 3CYPB 2LBWA 1RLUA 2UYNA 4G4WA 4B62A 5LA6B 5HY2A 1H48A 1JD1A 2UYPA 1VQ7F 3TD3A 4O4HA 2VGMA 4TUYB 3S0YA 3F0GA 5LXTB 1RQ7A 2EWCA 3E22B 4BT4A 2RB9A 3LWOC 4ZHVA 1RLGA 5HWEA 3C9RA 5JCOA 3JCMM 4O4IA 3QUWA 4BVTA 3LFOA 3G71F 1VQPF 4X3LA 4DRXA 1GO1A 3IKFA 3DDNA 3CB2A 4RQOA 3JALB 3QHDA 4O4JB 5CA0B 4PWTA 2OZBA 1JN1A 3CCJF 1X52A 3CMAF 3ESJA 2HX0A 3V3TA 3ON1A 1VQ6F 5IYZB 3MQWA 3VTIC 5LOVB 4U3JA 3QTYA 2BO1A 3I56F 1YITF 3IMPA 3JAWA 3WGMA 3WGKA 4F6RA 4HNAA 4X3MA 3EORA 5EIBC 2BTQB 2CZWA 5AVMA 1JFFA 3S03A 4B45A 2LBTA 1XBIA 1KC8H 3RYFA 3WGLA 2HS4A 3JATA 3S06A 4ZK7A 5BMVB 3CMEF 1W41A 4I55B 3WGJA 4FFBA 3T80A 3JASB 2IG8A 3HKDA 1U3PA 3JAKA 5B8FA 1VQLF 4O2AB 1GO0A 3FPIA 1Q7YH 1RA4A 4X20A 1U40A 2VGNA 3VI6A 1ONIA 3ELCA 3MDOA 3WXMB 4X1IA 4TV8A 5J2UA 5EZYA 1X25A 3MBMA 3F6MA 4EI8A 2YXZA 1KNKA 5GONA 2V9YA 4WBNB 2HQSC 3HWUA 3CCMF 4YJ2A 4ZHWA 3D00A 3R0PA 1VK3A 1VQMF 4ZHQA 1SA0B 5IJ0B 1X7OA 2KG4A 2LBXA 2HRYA 3P4EA 3HKCA 3CCLF 5FJ4C 4NQ3A 2LCAA 2WALA 1GZ0A 2RHOA 3CCQF 4U39A 4O2BA 1VQKF 3LYBA 3N2GB 3VOAA 2GZLA 1UI9A 1R1MA 3E20B 2ZOVA 3VYUC 1U3LA 4B5CA 2QA4F 3HKBA 4TV9B 3NVKE 3V7EA 3S02A 3CG6A 4RHAA 1FFXB 2ZAUA 5JQGB 5IT9M 1TUBB 2HS0A 2DYYA 4LCKA 2VAWA 3JARA 4B46A 1E7KA 1UFYA 3C9SA 4BVRA 1W42A 4LNUB 5C8YA 3JAMM 4G4ZA 3NK6A 4YJ3B 5EB1B 4EB6A 3UT5B 3CCSF 1CK2A 1W59A 1IPAA 5EIBD 4BY9D 1OAPA 5KX5B 3IR9A 3K12A 5JH7B 1VQOF 4BT2A 3RYIB 3CCEF 2ZVZA 1Q81H 4G4XA 3ZO8A 5JVDB 4EI9A 4IIJB 3AGKA 3LWQC 3VOBA 3KHNA 3ZP4A 4C81A 3NMUC 3GTZA 3BYQA 4X1KB 1ZWZA
chains in the Genus database with same CATH topology
2GLZA 1NJIH 2CZWA 3LWRC 1N8RH 1XBIA 4BW0B 1KC8H 1QVGF 2OTJF 5A2QM 5GANK 3MCAB 1K73H 3CMEF 5GIOC 1W41A 3RA5A 1DT9A 1W3EX 1NMUB 3NK7A 3PAFA 5HXZA 5FLXM 1VQLF 5HY4A 1VQ9F 2HVYD 1GO0A 5GAPK 1Q7YH 1RA4A 5HY0A 5G4UC 3OBYA 2VGNA 3VI6A 3WXMB 1YJ9F 3CPWF 1YI2F 1YJNF 4C4WC 3LWPC 3CC7F 4BVQA 3J81M 1T0KB 3LWVC 3G4SF 5GINC 3HJWC 3SIVA 3GYQA 1PXWA 1VQ4F 3CXCF 1M1KH 3OBWA 4EI8A 3E1YA 1W2BF 3NVIB 1VQ8F 3CCRF 5HY1A 5GIPC 1VQ5F 1S72F 1Q86H 3CCMF 3RA6A 3D00A 3HAXD 5DCVA 1VQMF 2ALEA 2QI2A 4XCQA 1QVFF 4NUTA 1YHQF 1YIJF 1X7OA 2KTUA 2LBXA 2KG4A 3V7QA 3CCUF 1JJ2F 3FFMA 3CCLF 5FJ4C 3CPQA 4NQ3A 3I55F 2I6DA 3CC4F 2WALA 2LBWA 1GZ0A 3VMFB 1K9MH 3CCQF 2KTVA 1VQKF 3CCVF 5HY2A 3E20B 1VQNF 3SIUA 2QA4F 2F9ZC 3OW2F 3NVKE 3O85A 3V7EA 5G4VC 1VQ7F 3CG6A 5EO3A 1Q82H 2VGMA 3PLAC 2FC3A 1X7PA 3N4ZA 5IT9M 3LWOC 2QEXF 2AIFA 1RLGA 5HWEA 5HXUA 3J7AR 3JCMM 1K8AH 4LCKA 1E7KA 4BVRA 3LFOA 4BVTA 3G71F 4X3LA 1VQPF 1YJWF 1W42A 3JAMM 1GO1A 3NK6A 1M90H 4EI7A 1SDSA 3CCSF 2OTLF 1CK2A 5EWRA 2OZBA 3CD6F 1CN7A 3CCJF 1IPAA 4BVSA 4BY9D 3IR9A 1X52A 3CMAF 4TZZA 2OHWA 1VQOF 3V3TA 3CCEF 3ON1A 1VQ6F 2FGYA 1Q81H 3N4YA 4EI9A 1KD1H 1H7MA 3J80M 3AGKA 3LWQC 3NMUC 2BO1A 3I56F 1YITF 3CC2F 1KQSF 2JNBA 3G6EF 1W40A 1ZWZA 4X3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI H;  2CZW A;  3LWR C;  1N8R H;  1XBI A;  4BW0 B;  1KC8 H;  1QVG F;  2OTJ F;  5A2Q M;  5GAN K;  3MCA B;  1K73 H;  3CME F;  5GIO C;  1W41 A;  3RA5 A;  1DT9 A;  1W3E X;  1NMU B;  3NK7 A;  3PAF A;  5FLX M;  1VQL F;  1VQ9 F;  2HVY D;  1GO0 A;  5GAP K;  1Q7Y H;  1RA4 A;  5G4U C;  3OBY A;  2VGN A;  3VI6 A;  3WXM B;  1YJ9 F;  3CPW F;  1YI2 F;  1YJN F;  4C4W C;  3LWP C;  3CC7 F;  1T0K B;  3J81 M;  3LWV C;  3G4S F;  5GIN C;  3HJW C;  3SIV A;  3GYQ A;  1PXW A;  1VQ4 F;  3CXC F;  1M1K H;  3OBW A;  3E1Y A;  1W2B F;  3NVI B;  1VQ8 F;  3CCR F;  5GIP C;  1VQ5 F;  1S72 F;  1Q86 H;  3CCM F;  3RA6 A;  3HAX D;  5DCV A;  1VQM F;  2ALE A;  2QI2 A;  1QVF F;  4NUT A;  1YHQ F;  1YIJ F;  1X7O A;  2KTU A;  2LBX A;  2KG4 A;  3V7Q A;  3CCU F;  1JJ2 F;  3FFM A;  3CCL F;  5FJ4 C;  3CPQ A;  3I55 F;  2I6D A;  3CC4 F;  2WAL A;  2LBW A;  1GZ0 A;  3VMF B;  1K9M H;  3CCQ F;  2KTV A;  1VQK F;  3CCV F;  3E20 B;  1VQN F;  3SIU A;  2QA4 F;  3OW2 F;  3NVK E;  3O85 A;  3V7E A;  5G4V C;  1VQ7 F;  3CG6 A;  5EO3 A;  1Q82 H;  2VGM A;  3PLA C;  2FC3 A;  1X7P A;  3N4Z A;  5IT9 M;  3LWO C;  2QEX F;  2AIF A;  1RLG A;  3J7A R;  4LCK A;  3JCM M;  1K8A H;  1E7K A;  3LFO A;  3G71 F;  1VQP F;  4X3L A;  1YJW F;  1W42 A;  3JAM M;  1GO1 A;  3NK6 A;  1M90 H;  1SDS A;  3CCS F;  2OTL F;  1CK2 A;  5EWR A;  2OZB A;  3CD6 F;  1CN7 A;  3CCJ F;  1IPA A;  4BY9 D;  3IR9 A;  1X52 A;  3CMA F;  4TZZ A;  2OHW A;  1VQO F;  3CCE F;  3ON1 A;  1VQ6 F;  1Q81 H;  3N4Y A;  1KD1 H;  1H7M A;  3J80 M;  3AGK A;  3LWQ C;  3NMU C;  2BO1 A;  3I56 F;  1YIT F;  3CC2 F;  1KQS F;  2JNB A;  3G6E F;  1W40 A;  1ZWZ A;  4X3M A; 
#chains in the Genus database with same CATH topology
 3WPW A;  3L7Q A;  1NJI H;  1IV1 A;  1W5E A;  3LWR C;  1N8R H;  5FNV B;  4BW0 B;  2VAM A;  1DBF A;  4I4T A;  5EYP B;  5LP6 C;  1PF5 A;  2HP3 A;  5IJ9 A;  1IV2 A;  2UZH A;  1DT9 A;  2UYN B;  3FBA A;  1KNJ A;  1TVK A;  3PAF A;  5CB4 A;  3F0D A;  2CVL A;  3Q8H A;  1ODE A;  3KIZ A;  3WGN A;  3K0T A;  4G4V A;  1T0A A;  5ITZ A;  1QD9 A;  1VH8 A;  2PMP A;  3OBY A;  4O4H B;  4C8G A;  3HKE A;  3HTN A;  3KJJ A;  3CPW F;  2NMU A;  2HP0 A;  4BVQ A;  3J81 M;  3CC7 F;  1RQ2 A;  1T0K B;  3HJW C;  4O4I B;  4ZOL A;  3N2K A;  3CYQ A;  3GYQ A;  5LP6 A;  3WJQ A;  4DRX B;  2Z1U A;  2HS3 A;  4IHJ A;  2OTM A;  1VQ5 F;  1U43 A;  3S0W A;  1FNJ A;  3HAX D;  2ALE A;  2GVI A;  2QI2 A;  1QVF F;  4NUT A;  1YHQ F;  3TD4 A;  2R75 1;  3CPQ A;  4U3J B;  2BTO A;  5HP8 A;  3C9U A;  3JAW B;  4I50 A;  4F6R B;  4HNA B;  3S0H A;  4O4L A;  3KJK A;  5LYJ A;  2KTV A;  2AMT A;  2CW4 A;  3CCV F;  2P6Y A;  5CA1 A;  3F0E A;  1JFF B;  3SIU A;  1W55 A;  2F9Z C;  5MN6 A;  3GHZ A;  3RYF B;  3JAT B;  4DXD A;  2Q1X A;  3N4Z A;  4FFB B;  2QEX F;  2AIF A;  3J7A R;  5HXU A;  1K8A H;  2Z01 A;  3RYH A;  4ERH A;  1H47 A;  1FSZ A;  3HKD B;  3JAK B;  5J2T A;  1VQV A;  3VYT C;  4NWO B;  4X20 B;  1XHO A;  1SDS A;  2OTL F;  5EWR A;  4X1I B;  2G9I A;  4TV8 B;  5J2U B;  1CN7 A;  5EZY B;  4X1Y A;  3VCZ A;  1OFU A;  3ZOP A;  2AIZ P;  1YGY A;  3TD5 A;  2H8E A;  3I3F A;  3RYC A;  1H7M A;  4ZI7 A;  3CC2 F;  1KQS F;  5GON B;  3G6E F;  3D01 A;  2GLZ A;  4YJ2 B;  4ZHQ B;  5LA6 A;  2ZF8 A;  3DC2 A;  2N48 A;  2Q1Y A;  3HKC B;  4E6E A;  2W8B C;  3VO8 A;  2OTJ F;  2CHT A;  1JY8 A;  4TUY A;  3E22 A;  3RA5 A;  3JVH A;  4O2B B;  1W3E X;  3NK7 A;  3VYS C;  1J7H A;  2IAF A;  2VXY A;  4C8E A;  5HY4 A;  2HVY D;  3HKB B;  3IKE A;  5HY0 A;  4BT6 A;  5G4U C;  1W5A A;  4O4J A;  5CA0 A;  3IEW A;  4C4W C;  3LWP C;  5KMG A;  3LWV C;  3JAR B;  3G4S F;  3SIV A;  3I7T A;  2IQQ A;  3CXC F;  3WJR A;  5C8Y B;  1M1K H;  5IYZ A;  5LOV A;  3CCR F;  2MQE A;  4EB6 B;  3OON A;  1S72 F;  4ZHY B;  3KE1 A;  5MN4 A;  2RHJ A;  4XCQ A;  1YIJ F;  3C8L A;  2KTU A;  3CCU F;  2YYE A;  3FFM A;  3I55 F;  1SZQ A;  2I6D A;  1W58 1;  5BMV A;  1Z5V A;  3VMF B;  4I55 A;  1K9M H;  2ZOD A;  2BTU A;  3ERN A;  3LME A;  3VIU A;  3JAS A;  5KMG B;  1IV4 A;  2HRU A;  3FD6 A;  1VQN F;  4O2A A;  3OW2 F;  3B6N A;  3O85 A;  1IV3 A;  4I4T B;  3U0O A;  5IJ9 B;  5G4V C;  5EO3 A;  1Z5W A;  1Q82 H;  1FNK A;  2B33 A;  3PLA C;  2FC3 A;  1X7P A;  4C82 A;  2PHN A;  1W5F A;  1TVK B;  3RE3 A;  5CB4 B;  3LDT A;  2Z1F A;  2QTP A;  2H8C A;  2H6L A;  1YJW F;  4C8I A;  4BT5 A;  5ITZ B;  1M90 H;  3D54 A;  4EI7 A;  2K1S A;  2CWJ A;  3V4D A;  3CD6 F;  1W57 A;  3HKE B;  4WBN A;  3M4S A;  5EAZ A;  1W5B A;  2HP0 B;  2DT4 A;  3F0F A;  4BVS A;  2Z1E A;  1SA0 A;  4ZOL B;  5IJ0 A;  3N2K B;  2OHW A;  2RHH A;  4TZZ A;  5LP6 B;  4BT3 A;  2FGY A;  3N4Y A;  1KD1 H;  3J80 M;  4IHJ B;  5HP7 A;  2JNB A;  2Z1T A;  1W40 A;  3M84 A;  3N2G A;  4M8I A;  4TV9 A;  2L26 A;  2ZVY A;  1QVG F;  4G88 A;  5A2Q M;  5GAN K;  3MCA B;  1K73 H;  1NQ3 A;  1XRG A;  5GIO C;  4I50 B;  1FFX A;  1GX1 A;  3C9T A;  4O4L B;  5JQG A;  1TUB A;  5LYJ B;  1NMU B;  3K2X A;  3IEQ A;  3WJP A;  5HXZ A;  2CHS A;  3WPX A;  5FLX M;  5CA1 B;  1VQ9 F;  5GAP K;  1QU9 A;  4LNU A;  2I6R A;  2VAP A;  3MCQ A;  4YJ3 A;  3P0Z A;  5EB0 A;  4G4Y A;  1VHA A;  3UT5 A;  1YJ9 F;  3ZP7 A;  4R40 B;  1YI2 F;  2UYJ A;  1YJN F;  1Q8R A;  2KGW A;  1COM A;  4BT7 A;  5KX5 A;  5JH7 A;  5GIN C;  1XV2 A;  2RHL A;  3RYH B;  1QAH A;  5J2T B;  1PXW A;  3RYI A;  1VQ4 F;  5JVD A;  3OBW A;  3E1Y A;  1W2B F;  4IIJ A;  1VQ8 F;  3NVI B;  4KWE A;  5HY1 A;  5GIP C;  5LXT A;  1Q86 H;  4X1K A;  3RA6 A;  3FD5 A;  5MN5 A;  5DCV A;  3M1X A;  1CLI A;  4X1Y B;  3K14 A;  2UYK A;  1YQN A;  5JCO C;  3V7Q A;  1JJ2 F;  3P10 A;  5FNV A;  3RYC B;  5EYP A;  3JAL A;  2CSL A;  4ZI7 B;  2R6R 1;  3CC4 F;  3CYP B;  2LBW A;  1RLU A;  2UYN A;  4G4W A;  4B62 A;  5LA6 B;  5HY2 A;  1H48 A;  1JD1 A;  2UYP A;  1VQ7 F;  3TD3 A;  4O4H A;  2VGM A;  4TUY B;  3S0Y A;  3F0G A;  5LXT B;  1RQ7 A;  2EWC A;  3E22 B;  4BT4 A;  2RB9 A;  3LWO C;  4ZHV A;  1RLG A;  5HWE A;  3C9R A;  5JCO A;  3JCM M;  4O4I A;  3QUW A;  4BVT A;  3LFO A;  3G71 F;  1VQP F;  4X3L A;  4DRX A;  1GO1 A;  3IKF A;  3DDN A;  3CB2 A;  4RQO A;  3JAL B;  3QHD A;  4O4J B;  5CA0 B;  4PWT A;  2OZB A;  1JN1 A;  3CCJ F;  1X52 A;  3CMA F;  3ESJ A;  2HX0 A;  3V3T A;  3ON1 A;  1VQ6 F;  5IYZ B;  3MQW A;  3VTI C;  5LOV B;  4U3J A;  3QTY A;  2BO1 A;  3I56 F;  1YIT F;  3IMP A;  3JAW A;  3WGM A;  3WGK A;  4F6R A;  4HNA A;  4X3M A;  3EOR A;  5EIB C;  2BTQ B;  2CZW A;  5AVM A;  1JFF A;  3S03 A;  4B45 A;  2LBT A;  1XBI A;  1KC8 H;  3RYF A;  3WGL A;  2HS4 A;  3JAT A;  3S06 A;  4ZK7 A;  5BMV B;  3CME F;  1W41 A;  4I55 B;  3WGJ A;  4FFB A;  3T80 A;  3JAS B;  2IG8 A;  3HKD A;  1U3P A;  3JAK A;  5B8F A;  1VQL F;  4O2A B;  1GO0 A;  3FPI A;  1Q7Y H;  1RA4 A;  4X20 A;  1U40 A;  2VGN A;  3VI6 A;  1ONI A;  3ELC A;  3MDO A;  3WXM B;  4X1I A;  4TV8 A;  5J2U A;  5EZY A;  1X25 A;  3MBM A;  3F6M A;  4EI8 A;  2YXZ A;  1KNK A;  5GON A;  2V9Y A;  4WBN B;  2HQS C;  3HWU A;  3CCM F;  4YJ2 A;  4ZHW A;  3D00 A;  3R0P A;  1VK3 A;  1VQM F;  4ZHQ A;  1SA0 B;  5IJ0 B;  1X7O A;  2KG4 A;  2LBX A;  2HRY A;  3P4E A;  3HKC A;  3CCL F;  5FJ4 C;  4NQ3 A;  2LCA A;  2WAL A;  1GZ0 A;  2RHO A;  3CCQ F;  4U39 A;  4O2B A;  1VQK F;  3LYB A;  3N2G B;  3VOA A;  2GZL A;  1UI9 A;  1R1M A;  3E20 B;  2ZOV A;  3VYU C;  1U3L A;  4B5C A;  2QA4 F;  3HKB A;  4TV9 B;  3NVK E;  3V7E A;  3S02 A;  3CG6 A;  4RHA A;  1FFX B;  2ZAU A;  5JQG B;  5IT9 M;  1TUB B;  2HS0 A;  2DYY A;  4LCK A;  2VAW A;  3JAR A;  4B46 A;  1E7K A;  1UFY A;  3C9S A;  4BVR A;  1W42 A;  4LNU B;  5C8Y A;  3JAM M;  4G4Z A;  3NK6 A;  4YJ3 B;  5EB1 B;  4EB6 A;  3UT5 B;  3CCS F;  1CK2 A;  1W59 A;  1IPA A;  5EIB D;  4BY9 D;  1OAP A;  5KX5 B;  3IR9 A;  3K12 A;  5JH7 B;  1VQO F;  4BT2 A;  3RYI B;  3CCE F;  2ZVZ A;  1Q81 H;  4G4X A;  3ZO8 A;  5JVD B;  4EI9 A;  4IIJ B;  3AGK A;  3LWQ C;  3VOB A;  3KHN A;  3ZP4 A;  4C81 A;  3NMU C;  3GTZ A;  3BYQ A;  4X1K B;  1ZWZ A; 
#chains in the Genus database with same CATH homology
 2GLZ A;  1NJI H;  2CZW A;  3LWR C;  1N8R H;  1XBI A;  4BW0 B;  1KC8 H;  1QVG F;  2OTJ F;  5A2Q M;  5GAN K;  3MCA B;  1K73 H;  3CME F;  5GIO C;  1W41 A;  3RA5 A;  1DT9 A;  1W3E X;  1NMU B;  3NK7 A;  3PAF A;  5HXZ A;  5FLX M;  1VQL F;  5HY4 A;  1VQ9 F;  2HVY D;  1GO0 A;  5GAP K;  1Q7Y H;  1RA4 A;  5HY0 A;  5G4U C;  3OBY A;  2VGN A;  3VI6 A;  3WXM B;  1YJ9 F;  3CPW F;  1YI2 F;  1YJN F;  4C4W C;  3LWP C;  3CC7 F;  4BVQ A;  3J81 M;  1T0K B;  3LWV C;  3G4S F;  5GIN C;  3HJW C;  3SIV A;  3GYQ A;  1PXW A;  1VQ4 F;  3CXC F;  1M1K H;  3OBW A;  4EI8 A;  3E1Y A;  1W2B F;  3NVI B;  1VQ8 F;  3CCR F;  5HY1 A;  5GIP C;  1VQ5 F;  1S72 F;  1Q86 H;  3CCM F;  3RA6 A;  3D00 A;  3HAX D;  5DCV A;  1VQM F;  2ALE A;  2QI2 A;  4XCQ A;  1QVF F;  4NUT A;  1YHQ F;  1YIJ F;  1X7O A;  2KTU A;  2LBX A;  2KG4 A;  3V7Q A;  3CCU F;  1JJ2 F;  3FFM A;  3CCL F;  5FJ4 C;  3CPQ A;  4NQ3 A;  3I55 F;  2I6D A;  3CC4 F;  2WAL A;  2LBW A;  1GZ0 A;  3VMF B;  1K9M H;  3CCQ F;  2KTV A;  1VQK F;  3CCV F;  5HY2 A;  3E20 B;  1VQN F;  3SIU A;  2QA4 F;  2F9Z C;  3OW2 F;  3NVK E;  3O85 A;  3V7E A;  5G4V C;  1VQ7 F;  3CG6 A;  5EO3 A;  1Q82 H;  2VGM A;  3PLA C;  2FC3 A;  1X7P A;  3N4Z A;  5IT9 M;  3LWO C;  2QEX F;  2AIF A;  1RLG A;  5HWE A;  5HXU A;  3J7A R;  3JCM M;  1K8A H;  4LCK A;  1E7K A;  4BVR A;  3LFO A;  4BVT A;  3G71 F;  4X3L A;  1VQP F;  1YJW F;  1W42 A;  3JAM M;  1GO1 A;  3NK6 A;  1M90 H;  4EI7 A;  1SDS A;  3CCS F;  2OTL F;  1CK2 A;  5EWR A;  2OZB A;  3CD6 F;  1CN7 A;  3CCJ F;  1IPA A;  4BVS A;  4BY9 D;  3IR9 A;  1X52 A;  3CMA F;  4TZZ A;  2OHW A;  1VQO F;  3V3T A;  3CCE F;  3ON1 A;  1VQ6 F;  2FGY A;  1Q81 H;  3N4Y A;  4EI9 A;  1KD1 H;  1H7M A;  3J80 M;  3AGK A;  3LWQ C;  3NMU C;  2BO1 A;  3I56 F;  1YIT F;  3CC2 F;  1KQS F;  2JNB A;  3G6E F;  1W40 A;  1ZWZ A;  4X3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...