3CXCF

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cxcF00
1VQ6F 3RA6A 3G71F 3E1YA 3OBWA 3CMAF 1VQPF 1K73H 3CD6F 2QI2A 3AGKA 3VI6A 3WXMB 1YITF 3G4SF 4BY9D 1W3EX 5EO3A 1W41A 3LWRC 4BW0B 2LBXA 3SIVA 3LWOC 1GO0A 3LWQC 2WALA 1K9MH 1YJ9F 3JAMM 3CG6A 1VQ7F 3NMUC 1N8RH 2AIFA 3PLAC 3NK6A 1H7MA 4C4WC 1XBIA 1X52A 3G6EF 5EWRA 1KQSF 3HJWC 2ALEA 1X7OA 1ZWZA 3MCAB 2CZWA 3V7QA 5GIOC 3HAXD 1PXWA 1VQ5F 5DCVA 1VQLF 1QVFF 2VGNA 1VQMF 5FJ4C 1YJWF 5GIPC 3RA5A 1GZ0A 2QEXF 1NMUB 3N4ZA 1IPAA 3J81M 2BO1A 2OTJF 4LCKA 5G4UC 3NVKE 3J80M 3NK7A 1VQOF 3CC7F 1VQ8F 1DT9A 1GO1A 1VQKF 3I55F 1W40A 3OBYA 2VGMA 3CCEF 2LBWA 3LWVC 3OW2F 1VQNF 2FC3A 3CCQF 5GINC 1YHQF 3CC4F 3N4YA 2JNBA 2KG4A 3PAFA 1QVGF 5FLXM 2QA4F 3I56F 3IR9A 1Q81H 3LFOA 3JCMM 1Q82H 1KD1H 1VQ4F 2I6DA 1YI2F 5IT9M 4TZZA 1X7PA 1YIJF 5G4VC 1YJNF 1S72F 3NVIB 3V7EA 1CK2A 2KTVA 3FFMA 2OTLF 3CC2F 3CCRF 1M1KH 1E7KA 1JJ2F 2OHWA 1Q7YH 3GYQA 1VQ9F 3CCUF 1NJIH 3LWPC 1K8AH 1M90H 1RLGA 3E20B 4NUTA 3CMEF 2HVYD 1CN7A 3CPQA 4X3LA 3CCSF 1KC8H 2OZBA 5GANK 3CXCF 1Q86H 1W42A 4X3MA 2KTUA 3CCJF 1RA4A 3SIUA 3O85A 3ON1A 5GAPK 3CPWF 3CCMF 3VMFB 1SDSA 1T0KB 3CCLF 1W2BF 5A2QM 3CCVF 3J7AR
chains in the Genus database with same CATH superfamily
5EZYA 2L26A 5GONA 1ODEA 3RA6A 3E1YA 4O4IB 3CMAF 3C9SA 3VI6A 1YITF 4O4HA 5EO3A 3D01A 4ZI7A 2HP0B 4I55B 1TUBA 3SIVA 3MDOA 3LWOC 1IV2A 4X20B 1YJ9F 3JAMM 5EB1B 4O2AB 4C4WC 4BT6A 3WGLA 3M4SA 3WJRA 2HP0A 4I55A 2ZOVA 1X52A 1KQSF 3JAWB 4X1IB 2I6RA 4X20A 4BVTA 4U3JB 5HY2A 3JALA 4B45A 3V7QA 1YQNA 2GVIA 2IG8A 4O2AA 3WGJA 1U3PA 1PXWA 2Z01A 1JD1A 5JVDB 1VQLF 5FJ4C 3UT5B 3WGMA 4C8IA 1GZ0A 3RYCB 3JAWA 4X1IA 3N4ZA 2OTJF 2B33A 5EYPA 2QTPA 4U3JA 3IMPA 3NK7A 1VQOF 3C9UA 4EI9A 1GO1A 4I50B 4G4ZA 3WGNA 3HWUA 3R0PA 3HKCA 5JVDA 5HP8A 3UT5A 3VIUA 3LWVC 1VQNF 5LP6B 3RYCA 1IV3A 4C8GA 5MN6A 3CCQF 2CW4A 3F6MA 3CC4F 2JNBA 2KG4A 1SZQA 4G88A 3I56F 1Q81H 4I50A 4E6EA 2HX0A 1VQ4F 3V4DA 1YI2F 4C8EA 4ZHVA 4TZZA 1X7PA 3VCZA 5G4VC 3HTNA 1S72F 5LP6A 4X1YB 1FSZA 3V7EA 3HKBA 1RQ2A 4F6RB 3CC2F 1W5AA 5C8YB 3LDTA 1JJ2F 2OHWA 1Q7YH 1E7KA 3GYQA 1JN1A 4C82A 1K8AH 1M90H 1RLGA 3E20B 1GX1A 4NUTA 4PWTA 2IAFA 2ZODA 3M84A 4X1YA 4B46A 5AVMA 2DYYA 5MN5A 3WPWA 4ERHA 2NMUA 5C8YA 2YYEA 4BT4A 3FD5A 3HKEB 4EB6B 5CA1B 1Z5WA 3JATB 3SIUA 3ON1A 3CPWF 5JCOA 2Z1UA 3VOAA 1SDSA 5JQGB 2HRYA 5J2UB 3CYPB 2PMPA 4BW0B 1FNJA 3HKEA 4EB6A 1VQ6F 5CA1A 3I3FA 1W5FA 3JATA 1VQPF 3QUWA 4DXDA 1K73H 2KGWA 3G4SF 5JQGA 1W3EX 5HXUA 2LBXA 5J2UA 3IKEA 3LWQC 3CG6A 1VQ7F 2VAWA 5JH7B 3VYTC 5HXZA 4TV8B 4U39A 5LA6B 3FD6A 3FPIA 1XBIA 3F0GA 4X1KB 3WJPA 3G6EF 3RE3A 3VYSC 3K12A 1IV1A 1X7OA 2PHNA 3C9RA 5JH7A 4TV8A 5LA6A 5GIOC 2EWCA 3HAXD 4R40B 4IIJB 3S0WA 5DCVA 1QVFF 1VQMF 3WJQA 4X1KA 3RA5A 2HS4A 1W57A 4G4YA 1NMUB 3RYHB 1IPAA 4G4VA 2BO1A 4LCKA 4ZHWA 3J80M 5KX5B 3WGKA 2YXZA 4O4IA 2H6LA 2HS3A 2HS0A 5EIBC 3I55F 4IIJA 1XRGA 4LNUB 1W40A 3OBYA 2VGMA 4BT3A 1W59A 1U43A 4BT7A 3IKFA 4KWEA 3RYHA 3ESJA 3JVHA 2K1SA 3E22B 4I4TB 1W5BA 4B5CA 4EI8A 5KX5A 1TVKB 2ZAUA 2CHSA 3PAFA 4ZOLB 3S03A 1XHOA 2BTQB 2I6DA 3N2GB 4DRXB 1VK3A 4LNUA 2HP3A 4NWOB 5IT9M 3F0EA 4EI7A 1YIJF 4TUYB 3HKDB 1YJNF 2Q1YA 1CLIA 2GLZA 2CVLA 2DT4A 2KTVA 5EB0A 1DBFA 3FFMA 4XCQA 1TVKA 4ZOLA 3JASB 3CCRF 5IYZB 4C81A 4TV9B 1JFFB 3KIZA 3N2GA 4DRXA 2Q1XA 3LWPC 1FFXB 3KJKA 3K2XA 3HKDA 4TUYA 3CPQA 4X3LA 2BTOA 3N2KB 2LBTA 2OZBA 5GANK 3JASA 4M8IA 3OONA 5IYZA 5KMGB 4TV9A 3M1XA 5HY0A 1W42A 3WPXA 4X3MA 5CA0B 4ZK7A 2KTUA 1W5EA 3CCJF 2AIZP 3VOBA 1JY8A 1FFXA 1RA4A 3CYQA 1XV2A 3GTZA 4BT2A 1T0AA 2HQSC 3N2KA 2RHHA 3S06A 5CB4B 3TD5A 1Q8RA 4ZHQB 5CA0A 3D00A 3OBWA 3CD6F 3CB2A 2QI2A 3AGKA 2LCAA 3WXMB 3KJJA 5ITZB 4BVRA 1W41A 5HY1A 3S02A 3EORA 3P4EA 4O4JB 5CB4A 4F6RA 1GO0A 1RLUA 3B6NA 1J7HA 3NMUC 3F0DA 2V9YA 1VHAA 1U40A 5ITZA 3KE1A 4O4JA 2UYKA 5IJ0B 5EWRA 3HJWC 5MN4A 1NQ3A 2CZWA 4YJ2B 1VH8A 2UYPA 1VQ5F 5BMVB 1X25A 2VGNA 3TD4A 5LYJB 5IJ0A 5LXTB 2QEXF 3V3TA 3J81M 1OAPA 1RQ7A 3NVKE 1OFUA 3C9TA 1DT9A 3KHNA 5BMVA 3ERNA 3QHDA 5LYJA 3ZP4A 5LXTA 4RQOA 5FNVB 3N4YA 1QVGF 5FLXM 4WBNB 2QA4F 3LFOA 3JCMM 2OTMA 3RYFB 3LMEA 5GONB 1YGYA 3Q8HA 3NVIB 2BTUA 2CHTA 1CK2A 3IEQA 3VO8A 4O4HB 3DC2A 3MQWA 4ZHYB 2OTLF 4WBNA 1VQ9F 3MCQA 2AMTA 3RYIB 3RYFA 2N48A 2ZF8A 4BT5A 1SA0B 1CN7A 3CCSF 3CXCF 2RHLA 2GZLA 2H8CA 2VXYA 5LOVB 3RYIA 1KNJA 3JALB 4G4XA 3O85A 5GAPK 1ONIA 3CCMF 1SA0A 5JCOC 3VMFB 5HY4A 1T0KB 3E22A 1U3LA 4I4TA 2G9IA 3JAKB 3GHZA 3CCLF 1W2BF 5A2QM 3CCVF 3K14A 5LOVA 5EYPB 2UYNB 3K0TA 3G71F 5B8FA 2CWJA 4BY9D 4RHAA 1PF5A 3L7QA 3HKCB 3LWRC 3JAKA 1KNKA 2P6YA 2WALA 3P0ZA 3VTIC 1K9MH 2F9ZC 5EIBD 1JFFA 1N8RH 2UYNA 2AIFA 2VAMA 4BVQA 5IJ9B 3PLAC 2FGYA 2HRUA 3NK6A 2CSLA 1H7MA 5HWEA 2R6R1 4YJ3B 2H8EA 3S0HA 3VYUC 5KMGA 1COMA 1QU9A 3C8LA 2ALEA 1FNKA 1ZWZA 3HKBB 2RHJA 1UI9A 3MCAB 5IJ9A 1H48A 3LYBA 3U0OA 1YJWF 5GIPC 3ZOPA 4YJ3A 3P10A 1UFYA 4ZHQA 1W55A 3I7TA 5G4UC 2R751 3QTYA 3TD3A 5HP7A 3CC7F 2ZVZA 3JARB 1VQ8F 3IEWA 2MQEA 2RHOA 1VQKF 1Z5VA 2Z1TA 1QD9A 1IV4A 4HNAB 3CCEF 2LBWA 3OW2F 3D54A 4NQ3A 3ZO8A 2FC3A 5GINC 1YHQF 1QAHA 3JARA 3IR9A 1Q82H 1KD1H 4O2BB 2UZHA 4HNAA 2RB9A 4BVSA 2Z1EA 4FFBB 4G4WA 2VAPA 3BYQA 3DDNA 4YJ2A 1M1KH 3CCUF 3S0YA 1NJIH 4O2BA 4IHJB 3FBAA 1R1MA 3CMEF 4B62A 2HVYD 4O4LB 1VQVA 4FFBA 1KC8H 3MBMA 3F0FA 5J2TB 2UYJA 3T80A 1Q86H 5EZYB 4IHJA 5EAZA 2Z1FA 2IQQA 2ZVYA 5LP6C 2W8BC 4O4LA 3ZP7A 4ZI7B 5FNVA 3ELCA 1TUBB 1W581 5J2TA 3J7AR 1H47A
chains in the Genus database with same CATH topology
1VQ6F 3RA6A 3D00A 3G71F 3E1YA 3OBWA 3CMAF 1VQPF 1K73H 3CD6F 2QI2A 3AGKA 3VI6A 3WXMB 1YITF 3G4SF 4BY9D 4BVRA 1W3EX 5EO3A 1W41A 5HY1A 5HXUA 3LWRC 2LBXA 3SIVA 3LWOC 1GO0A 3LWQC 2WALA 1K9MH 2F9ZC 1YJ9F 3JAMM 3CG6A 1VQ7F 3NMUC 1N8RH 2AIFA 4BVQA 5HXZA 3PLAC 2FGYA 3NK6A 1H7MA 4C4WC 1XBIA 5HWEA 1X52A 3G6EF 5EWRA 1KQSF 4BVTA 3HJWC 5HY2A 2ALEA 1X7OA 1ZWZA 3MCAB 2CZWA 3V7QA 5GIOC 3HAXD 1PXWA 1VQ5F 5DCVA 1VQLF 1QVFF 2VGNA 1VQMF 5FJ4C 1YJWF 5GIPC 3RA5A 1GZ0A 2QEXF 1NMUB 3V3TA 3N4ZA 1IPAA 3J81M 2BO1A 2OTJF 4LCKA 5G4UC 3NVKE 3J80M 3NK7A 1VQOF 3CC7F 1VQ8F 1DT9A 4EI9A 1GO1A 1VQKF 3I55F 1W40A 3OBYA 2VGMA 3CCEF 2LBWA 3LWVC 3OW2F 1VQNF 4NQ3A 2FC3A 3CCQF 5GINC 1YHQF 3CC4F 4EI8A 3N4YA 2JNBA 2KG4A 3PAFA 1QVGF 5FLXM 2QA4F 3I56F 3IR9A 1Q81H 3LFOA 3JCMM 1Q82H 1KD1H 1VQ4F 2I6DA 1YI2F 5IT9M 4TZZA 1X7PA 4EI7A 4BVSA 1YIJF 5G4VC 1YJNF 1S72F 3NVIB 3V7EA 2GLZA 1CK2A 2KTVA 3FFMA 2OTLF 4XCQA 3CC2F 3CCRF 1M1KH 1E7KA 1JJ2F 2OHWA 1Q7YH 3GYQA 1VQ9F 3CCUF 1NJIH 3LWPC 1K8AH 1M90H 1RLGA 3E20B 4NUTA 3CMEF 2HVYD 1CN7A 3CPQA 4X3LA 3CCSF 1KC8H 2OZBA 5GANK 3CXCF 1Q86H 5HY0A 1W42A 4X3MA 2KTUA 3CCJF 1RA4A 5A2QM 3SIUA 3O85A 3ON1A 5GAPK 3CPWF 3CCMF 3VMFB 5HY4A 1SDSA 1T0KB 3CCLF 1W2BF 4BW0B 3CCVF 3J7AR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 F;  3RA6 A;  3G71 F;  3E1Y A;  3OBW A;  3CMA F;  1VQP F;  1K73 H;  3CD6 F;  2QI2 A;  3AGK A;  3VI6 A;  3WXM B;  1YIT F;  3G4S F;  4BY9 D;  1W3E X;  5EO3 A;  1W41 A;  3LWR C;  4BW0 B;  2LBX A;  3SIV A;  3LWO C;  1GO0 A;  3LWQ C;  2WAL A;  1K9M H;  1YJ9 F;  3JAM M;  3CG6 A;  1VQ7 F;  3NMU C;  1N8R H;  2AIF A;  3PLA C;  3NK6 A;  1H7M A;  4C4W C;  1XBI A;  1X52 A;  3G6E F;  5EWR A;  1KQS F;  3HJW C;  2ALE A;  1X7O A;  1ZWZ A;  3MCA B;  2CZW A;  3V7Q A;  5GIO C;  3HAX D;  1PXW A;  1VQ5 F;  5DCV A;  1VQL F;  1QVF F;  2VGN A;  1VQM F;  5FJ4 C;  1YJW F;  5GIP C;  3RA5 A;  1GZ0 A;  2QEX F;  1NMU B;  3N4Z A;  1IPA A;  3J81 M;  2BO1 A;  2OTJ F;  4LCK A;  5G4U C;  3NVK E;  3J80 M;  3NK7 A;  1VQO F;  3CC7 F;  1VQ8 F;  1DT9 A;  1GO1 A;  1VQK F;  3I55 F;  1W40 A;  3OBY A;  2VGM A;  3CCE F;  2LBW A;  3LWV C;  3OW2 F;  1VQN F;  2FC3 A;  3CCQ F;  5GIN C;  1YHQ F;  3CC4 F;  3N4Y A;  2JNB A;  2KG4 A;  3PAF A;  1QVG F;  5FLX M;  2QA4 F;  3I56 F;  3IR9 A;  1Q81 H;  3LFO A;  3JCM M;  1Q82 H;  1KD1 H;  1VQ4 F;  2I6D A;  1YI2 F;  5IT9 M;  4TZZ A;  1X7P A;  1YIJ F;  5G4V C;  1YJN F;  1S72 F;  3NVI B;  3V7E A;  1CK2 A;  2KTV A;  3FFM A;  2OTL F;  3CC2 F;  3CCR F;  1M1K H;  1E7K A;  1JJ2 F;  2OHW A;  1Q7Y H;  3GYQ A;  1VQ9 F;  3CCU F;  1NJI H;  3LWP C;  1K8A H;  1M90 H;  1RLG A;  3E20 B;  4NUT A;  3CME F;  2HVY D;  1CN7 A;  3CPQ A;  4X3L A;  3CCS F;  1KC8 H;  2OZB A;  5GAN K;  3CXC F;  1Q86 H;  1W42 A;  4X3M A;  2KTU A;  3CCJ F;  1RA4 A;  3SIU A;  3O85 A;  3ON1 A;  5GAP K;  3CPW F;  3CCM F;  3VMF B;  1SDS A;  1T0K B;  3CCL F;  1W2B F;  5A2Q M;  3CCV F;  3J7A R; 
#chains in the Genus database with same CATH topology
 5EZY A;  2L26 A;  5GON A;  1ODE A;  3RA6 A;  3E1Y A;  4O4I B;  3CMA F;  3C9S A;  3VI6 A;  1YIT F;  4O4H A;  5EO3 A;  3D01 A;  4ZI7 A;  2HP0 B;  4I55 B;  1TUB A;  3SIV A;  3MDO A;  3LWO C;  1IV2 A;  4X20 B;  1YJ9 F;  3JAM M;  5EB1 B;  4O2A B;  4C4W C;  4BT6 A;  3WGL A;  3M4S A;  3WJR A;  2HP0 A;  4I55 A;  2ZOV A;  1X52 A;  1KQS F;  3JAW B;  4X1I B;  2I6R A;  4X20 A;  4BVT A;  4U3J B;  5HY2 A;  3JAL A;  4B45 A;  3V7Q A;  1YQN A;  2GVI A;  2IG8 A;  4O2A A;  3WGJ A;  1U3P A;  1PXW A;  2Z01 A;  1JD1 A;  5JVD B;  1VQL F;  5FJ4 C;  3UT5 B;  3WGM A;  4C8I A;  1GZ0 A;  3RYC B;  3JAW A;  4X1I A;  3N4Z A;  2OTJ F;  2B33 A;  5EYP A;  2QTP A;  4U3J A;  3IMP A;  3NK7 A;  1VQO F;  3C9U A;  4EI9 A;  1GO1 A;  4I50 B;  4G4Z A;  3WGN A;  3HWU A;  3R0P A;  3HKC A;  5JVD A;  5HP8 A;  3UT5 A;  3VIU A;  3LWV C;  1VQN F;  5LP6 B;  3RYC A;  1IV3 A;  4C8G A;  5MN6 A;  3CCQ F;  2CW4 A;  3F6M A;  3CC4 F;  2JNB A;  2KG4 A;  1SZQ A;  4G88 A;  3I56 F;  1Q81 H;  4I50 A;  4E6E A;  2HX0 A;  1VQ4 F;  3V4D A;  1YI2 F;  4C8E A;  4ZHV A;  4TZZ A;  1X7P A;  3VCZ A;  5G4V C;  3HTN A;  1S72 F;  5LP6 A;  4X1Y B;  1FSZ A;  3V7E A;  3HKB A;  1RQ2 A;  4F6R B;  3CC2 F;  1W5A A;  5C8Y B;  3LDT A;  1JJ2 F;  2OHW A;  1Q7Y H;  1E7K A;  3GYQ A;  1JN1 A;  4C82 A;  1K8A H;  1M90 H;  1RLG A;  3E20 B;  1GX1 A;  4NUT A;  4PWT A;  2IAF A;  2ZOD A;  3M84 A;  4X1Y A;  4B46 A;  5AVM A;  2DYY A;  5MN5 A;  3WPW A;  4ERH A;  2NMU A;  5C8Y A;  2YYE A;  4BT4 A;  3FD5 A;  3HKE B;  4EB6 B;  5CA1 B;  1Z5W A;  3JAT B;  3SIU A;  3ON1 A;  3CPW F;  5JCO A;  2Z1U A;  3VOA A;  1SDS A;  5JQG B;  2HRY A;  5J2U B;  3CYP B;  2PMP A;  4BW0 B;  1FNJ A;  3HKE A;  4EB6 A;  1VQ6 F;  5CA1 A;  3I3F A;  1W5F A;  3JAT A;  1VQP F;  3QUW A;  4DXD A;  1K73 H;  2KGW A;  3G4S F;  5JQG A;  1W3E X;  5HXU A;  2LBX A;  5J2U A;  3IKE A;  3LWQ C;  3CG6 A;  1VQ7 F;  2VAW A;  5JH7 B;  3VYT C;  5HXZ A;  4TV8 B;  4U39 A;  5LA6 B;  3FD6 A;  3FPI A;  1XBI A;  3F0G A;  4X1K B;  3WJP A;  3G6E F;  3RE3 A;  3VYS C;  3K12 A;  1IV1 A;  1X7O A;  2PHN A;  3C9R A;  5JH7 A;  4TV8 A;  5LA6 A;  5GIO C;  2EWC A;  3HAX D;  4R40 B;  4IIJ B;  3S0W A;  5DCV A;  1QVF F;  1VQM F;  3WJQ A;  4X1K A;  3RA5 A;  2HS4 A;  1W57 A;  4G4Y A;  1NMU B;  3RYH B;  1IPA A;  4G4V A;  2BO1 A;  4LCK A;  4ZHW A;  3J80 M;  5KX5 B;  3WGK A;  2YXZ A;  4O4I A;  2H6L A;  2HS3 A;  2HS0 A;  5EIB C;  3I55 F;  4IIJ A;  1XRG A;  4LNU B;  1W40 A;  3OBY A;  2VGM A;  4BT3 A;  1W59 A;  1U43 A;  4BT7 A;  3IKF A;  4KWE A;  3RYH A;  3ESJ A;  3JVH A;  2K1S A;  3E22 B;  4I4T B;  1W5B A;  4B5C A;  4EI8 A;  5KX5 A;  1TVK B;  2ZAU A;  2CHS A;  3PAF A;  4ZOL B;  3S03 A;  1XHO A;  2BTQ B;  2I6D A;  3N2G B;  4DRX B;  1VK3 A;  4LNU A;  2HP3 A;  4NWO B;  5IT9 M;  3F0E A;  4EI7 A;  1YIJ F;  4TUY B;  3HKD B;  1YJN F;  2Q1Y A;  1CLI A;  2GLZ A;  2CVL A;  2DT4 A;  2KTV A;  5EB0 A;  1DBF A;  3FFM A;  4XCQ A;  1TVK A;  4ZOL A;  3JAS B;  3CCR F;  5IYZ B;  4C81 A;  4TV9 B;  1JFF B;  3KIZ A;  3N2G A;  4DRX A;  2Q1X A;  3LWP C;  1FFX B;  3KJK A;  3K2X A;  3HKD A;  4TUY A;  3CPQ A;  4X3L A;  2BTO A;  3N2K B;  2LBT A;  2OZB A;  5GAN K;  3JAS A;  4M8I A;  3OON A;  5IYZ A;  5KMG B;  4TV9 A;  3M1X A;  5HY0 A;  1W42 A;  3WPX A;  4X3M A;  5CA0 B;  4ZK7 A;  2KTU A;  1W5E A;  3CCJ F;  2AIZ P;  3VOB A;  1JY8 A;  1FFX A;  1RA4 A;  3CYQ A;  1XV2 A;  3GTZ A;  4BT2 A;  1T0A A;  2HQS C;  3N2K A;  2RHH A;  3S06 A;  5CB4 B;  3TD5 A;  1Q8R A;  4ZHQ B;  5CA0 A;  3D00 A;  3OBW A;  3CD6 F;  3CB2 A;  2QI2 A;  3AGK A;  2LCA A;  3WXM B;  3KJJ A;  5ITZ B;  4BVR A;  1W41 A;  5HY1 A;  3S02 A;  3EOR A;  3P4E A;  4O4J B;  5CB4 A;  4F6R A;  1GO0 A;  1RLU A;  3B6N A;  1J7H A;  3NMU C;  3F0D A;  2V9Y A;  1VHA A;  1U40 A;  5ITZ A;  3KE1 A;  4O4J A;  2UYK A;  5IJ0 B;  5EWR A;  3HJW C;  5MN4 A;  1NQ3 A;  2CZW A;  4YJ2 B;  1VH8 A;  2UYP A;  1VQ5 F;  5BMV B;  1X25 A;  2VGN A;  3TD4 A;  5LYJ B;  5IJ0 A;  5LXT B;  2QEX F;  3V3T A;  3J81 M;  1OAP A;  1RQ7 A;  3NVK E;  1OFU A;  3C9T A;  1DT9 A;  3KHN A;  5BMV A;  3ERN A;  3QHD A;  5LYJ A;  3ZP4 A;  5LXT A;  4RQO A;  5FNV B;  3N4Y A;  1QVG F;  5FLX M;  4WBN B;  2QA4 F;  3LFO A;  3JCM M;  2OTM A;  3RYF B;  3LME A;  5GON B;  1YGY A;  3Q8H A;  3NVI B;  2BTU A;  2CHT A;  1CK2 A;  3IEQ A;  3VO8 A;  4O4H B;  3DC2 A;  3MQW A;  4ZHY B;  2OTL F;  4WBN A;  1VQ9 F;  3MCQ A;  2AMT A;  3RYI B;  3RYF A;  2N48 A;  2ZF8 A;  4BT5 A;  1SA0 B;  1CN7 A;  3CCS F;  3CXC F;  2RHL A;  2GZL A;  2H8C A;  2VXY A;  5LOV B;  3RYI A;  1KNJ A;  3JAL B;  4G4X A;  3O85 A;  5GAP K;  1ONI A;  3CCM F;  1SA0 A;  5JCO C;  3VMF B;  5HY4 A;  1T0K B;  3E22 A;  1U3L A;  4I4T A;  2G9I A;  3JAK B;  3GHZ A;  3CCL F;  1W2B F;  5A2Q M;  3CCV F;  3K14 A;  5LOV A;  5EYP B;  2UYN B;  3K0T A;  3G71 F;  5B8F A;  2CWJ A;  4BY9 D;  4RHA A;  1PF5 A;  3L7Q A;  3HKC B;  3LWR C;  3JAK A;  1KNK A;  2P6Y A;  2WAL A;  3P0Z A;  3VTI C;  1K9M H;  2F9Z C;  5EIB D;  1JFF A;  1N8R H;  2UYN A;  2AIF A;  2VAM A;  4BVQ A;  5IJ9 B;  3PLA C;  2FGY A;  2HRU A;  3NK6 A;  2CSL A;  1H7M A;  5HWE A;  2R6R 1;  4YJ3 B;  2H8E A;  3S0H A;  3VYU C;  5KMG A;  1COM A;  1QU9 A;  3C8L A;  2ALE A;  1FNK A;  1ZWZ A;  3HKB B;  2RHJ A;  1UI9 A;  3MCA B;  5IJ9 A;  1H48 A;  3LYB A;  3U0O A;  1YJW F;  5GIP C;  3ZOP A;  4YJ3 A;  3P10 A;  1UFY A;  4ZHQ A;  1W55 A;  3I7T A;  5G4U C;  2R75 1;  3QTY A;  3TD3 A;  5HP7 A;  3CC7 F;  2ZVZ A;  3JAR B;  1VQ8 F;  3IEW A;  2MQE A;  2RHO A;  1VQK F;  1Z5V A;  2Z1T A;  1QD9 A;  1IV4 A;  4HNA B;  3CCE F;  2LBW A;  3OW2 F;  3D54 A;  4NQ3 A;  3ZO8 A;  2FC3 A;  5GIN C;  1YHQ F;  1QAH A;  3JAR A;  3IR9 A;  1Q82 H;  1KD1 H;  4O2B B;  2UZH A;  4HNA A;  2RB9 A;  4BVS A;  2Z1E A;  4FFB B;  4G4W A;  2VAP A;  3BYQ A;  3DDN A;  4YJ2 A;  1M1K H;  3CCU F;  3S0Y A;  1NJI H;  4O2B A;  4IHJ B;  3FBA A;  1R1M A;  3CME F;  4B62 A;  2HVY D;  4O4L B;  1VQV A;  4FFB A;  1KC8 H;  3MBM A;  3F0F A;  5J2T B;  2UYJ A;  3T80 A;  1Q86 H;  5EZY B;  4IHJ A;  5EAZ A;  2Z1F A;  2IQQ A;  2ZVY A;  5LP6 C;  2W8B C;  4O4L A;  3ZP7 A;  4ZI7 B;  5FNV A;  3ELC A;  1TUB B;  1W58 1;  5J2T A;  3J7A R;  1H47 A; 
#chains in the Genus database with same CATH homology
 1VQ6 F;  3RA6 A;  3D00 A;  3G71 F;  3E1Y A;  3OBW A;  3CMA F;  1VQP F;  1K73 H;  3CD6 F;  2QI2 A;  3AGK A;  3VI6 A;  3WXM B;  1YIT F;  3G4S F;  4BY9 D;  4BVR A;  1W3E X;  5EO3 A;  1W41 A;  5HY1 A;  5HXU A;  3LWR C;  2LBX A;  3SIV A;  3LWO C;  1GO0 A;  3LWQ C;  2WAL A;  1K9M H;  2F9Z C;  1YJ9 F;  3JAM M;  3CG6 A;  1VQ7 F;  3NMU C;  1N8R H;  2AIF A;  4BVQ A;  5HXZ A;  3PLA C;  2FGY A;  3NK6 A;  1H7M A;  4C4W C;  1XBI A;  5HWE A;  1X52 A;  3G6E F;  5EWR A;  1KQS F;  4BVT A;  3HJW C;  5HY2 A;  2ALE A;  1X7O A;  1ZWZ A;  3MCA B;  2CZW A;  3V7Q A;  5GIO C;  3HAX D;  1PXW A;  1VQ5 F;  5DCV A;  1VQL F;  1QVF F;  2VGN A;  1VQM F;  5FJ4 C;  1YJW F;  5GIP C;  3RA5 A;  1GZ0 A;  2QEX F;  1NMU B;  3V3T A;  3N4Z A;  1IPA A;  3J81 M;  2BO1 A;  2OTJ F;  4LCK A;  5G4U C;  3NVK E;  3J80 M;  3NK7 A;  1VQO F;  3CC7 F;  1VQ8 F;  1DT9 A;  4EI9 A;  1GO1 A;  1VQK F;  3I55 F;  1W40 A;  3OBY A;  2VGM A;  3CCE F;  2LBW A;  3LWV C;  3OW2 F;  1VQN F;  4NQ3 A;  2FC3 A;  3CCQ F;  5GIN C;  1YHQ F;  3CC4 F;  4EI8 A;  3N4Y A;  2JNB A;  2KG4 A;  3PAF A;  1QVG F;  5FLX M;  2QA4 F;  3I56 F;  3IR9 A;  1Q81 H;  3LFO A;  3JCM M;  1Q82 H;  1KD1 H;  1VQ4 F;  2I6D A;  1YI2 F;  5IT9 M;  4TZZ A;  1X7P A;  4EI7 A;  4BVS A;  1YIJ F;  5G4V C;  1YJN F;  1S72 F;  3NVI B;  3V7E A;  2GLZ A;  1CK2 A;  2KTV A;  3FFM A;  2OTL F;  4XCQ A;  3CC2 F;  3CCR F;  1M1K H;  1E7K A;  1JJ2 F;  2OHW A;  1Q7Y H;  3GYQ A;  1VQ9 F;  3CCU F;  1NJI H;  3LWP C;  1K8A H;  1M90 H;  1RLG A;  3E20 B;  4NUT A;  3CME F;  2HVY D;  1CN7 A;  3CPQ A;  4X3L A;  3CCS F;  1KC8 H;  2OZB A;  5GAN K;  3CXC F;  1Q86 H;  5HY0 A;  1W42 A;  4X3M A;  2KTU A;  3CCJ F;  1RA4 A;  5A2Q M;  3SIU A;  3O85 A;  3ON1 A;  5GAP K;  3CPW F;  3CCM F;  3VMF B;  5HY4 A;  1SDS A;  1T0K B;  3CCL F;  1W2B F;  4BW0 B;  3CCV F;  3J7A R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...