3CXCF

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3cxcF00
3PLAC 3VI6A 1YJWF 5GIOC 1VQKF 3NK7A 3ON1A 1YIJF 1S72F 3LWRC 5GINC 3HJWC 2VGNA 3AGKA 3CCLF 3LWVC 2ALEA 1K8AH 1VQ7F 4NUTA 3CG6A 1KQSF 1T0KB 2HVYD 1YJNF 3E20B 1W3EX 3SIVA 1W42A 1M1KH 1GO0A 3O85A 1VQPF 3CCUF 2LBWA 3LWQC 2VGMA 2WALA 3CC2F 3E1YA 3OW2F 1QVFF 3OBWA 3NMUC 3V7QA 3RA5A 2OZBA 2JNBA 3CCVF 5FJ4C 3J81M 1ZWZA 3FFMA 3CCJF 1IPAA 3NK6A 3CXCF 1Q82H 1QVGF 1VQ8F 3CCSF 2BO1A 4BY9D 2FC3A 4TZZA 3HAXD 1DT9A 3NVIB 2QA4F 3G4SF 5GAPK 3N4YA 1VQ5F 1VQ4F 3CCMF 5DCVA 3PAFA 3CC7F 3OBYA 1YITF 2QEXF 4C4WC 3CCRF 4X3LA 3CCEF 1NJIH 3CC4F 1RLGA 5G4UC 1GO1A 1NMUB 1CK2A 1VQLF 4BW0B 1E7KA 3JCMM 1XBIA 5FLXM 3SIUA 1YI2F 3V7EA 1H7MA 2KG4A 1K73H 5EO3A 3WXMB 3JAMM 1KC8H 5EWRA 2QI2A 1X52A 3G6EF 5IT9M 1X7OA 2KTUA 1KD1H 1VQ9F 2OTLF 1W41A 1VQOF 2LBXA 3J7AR 3MCAB 1Q86H 3CMEF 2OHWA 1W40A 3CD6F 3J80M 1RA4A 4X3MA 3IR9A 3NVKE 2OTJF 1N8RH 1VQ6F 5A2QM 3LWOC 1PXWA 3N4ZA 3CMAF 3I55F 1GZ0A 1VQNF 3I56F 1Q7YH 1M90H 1JJ2F 1YJ9F 5GIPC 3LFOA 1CN7A 1K9MH 3VMFB 5G4VC 1SDSA 3CCQF 1VQMF 3CPQA 3LWPC 1X7PA 2AIFA 3G71F 3CPWF 1Q81H 1YHQF 2CZWA 2KTVA 4LCKA 1W2BF 2I6DA 3RA6A 5GANK 3GYQA
chains in the Genus database with same CATH superfamily
1JFFA 5GONB 1TVKB 3RYIB 4C8GA 4ZI7A 4BVQA 3HJWC 2DYYA 4EB6B 3FD6A 3CCLF 3S06A 1SZQA 1K8AH 3CG6A 1KQSF 1ONIA 3WGKA 3HKCB 4TV9B 1Z5VA 5CA0B 4PWTA 3SIVA 1M1KH 1GO0A 3O85A 3IKFA 4TUYA 1JY8A 2LBWA 5LYJB 1KNJA 2IG8A 2Z1EA 3E1YA 1QVFF 3VYSC 3N2GA 3VO8A 2V9YA 3N2KB 5CB4B 5LP6C 4O2BB 4IIJB 3FFMA 4X20A 3JAKB 2GZLA 3CCJF 3NK6A 4IHJA 3C9UA 3CCSF 3ELCA 3MBMA 2HX0A 1Z5WA 4I50A 1FFXA 5JCOC 3NVIB 3ZP4A 4TV8A 2QA4F 3HKBB 3N4YA 4NQ3A 4WBNA 4G88A 3I3FA 2QEXF 2UYNB 3VYUC 5G4UC 3FBAA 1GO1A 1OFUA 3WPXA 4I55B 3Q8HA 3P0ZA 1XBIA 5FLXM 5HY2A 1YQNA 2F9ZC 5ITZA 4U3JB 4BT3A 3TD5A 3JAWA 5BMVB 3P10A 5C8YB 1X52A 2L26A 3DDNA 5IT9M 5CA1B 3J7AR 2LBXA 3KE1A 3F0GA 1Q86H 5LOVB 2OHWA 1W40A 1RA4A 4LNUA 4O4IA 3K12A 2CW4A 1QU9A 5A2QM 3RYCB 3QHDA 3TD4A 4BVSA 2CSLA 3RYHB 4ZOLB 1JJ2F 2DT4A 5GIPC 3S0YA 4BVRA 3R0PA 3WJRA 5G4VC 4BT4A 3MCQA 3CPQA 4EI7A 3U0OA 3CPWF 3CB2A 1Q81H 1YHQF 3FPIA 1W2BF 5JH7B 2I6DA 5HP7A 3KJJA 3PLAC 2UYJA 3VI6A 1YJWF 4NWOB 5LA6B 5GIOC 3NK7A 2FGYA 1VQKF 4ERHA 1YIJF 2CWJA 3VCZA 1S72F 1H48A 1IV4A 5KMGA 3JASA 2GVIA 4YJ3B 3UT5B 3AGKA 3T80A 2CVLA 5J2TA 3WJPA 1YGYA 2H8EA 3LDTA 3L7QA 4NUTA 5KX5A 4YJ2A 1T0KB 2LCAA 4E6EA 3JALB 3M1XA 4BT2A 3E20B 5EZYA 2VAMA 3RYFA 1JFFB 3CCUF 1IV2A 3CC2F 1IV1A 2ZF8A 3FD5A 4BT7A 3JARA 5LP6A 3VOAA 4ZHWA 2Q1YA 4ZI7B 1TUBA 2HS4A 2OZBA 2ZVYA 2HP0A 3CYQA 1ZWZA 2K1SA 3K2XA 2RHLA 4F6RA 1SA0A 2R751 2HRUA 1QVGF 3S0WA 4C8EA 2FC3A 2IQQA 3HAXD 2PMPA 3HKEA 1DT9A 3S03A 2RHHA 1VHAA 4TUYB 1VQ5F 3HTNA 5DCVA 3PAFA 3VYTC 5GONA 3CCRF 3F0FA 3IKEA 3N2GB 4BW0B 1W5EA 1KNKA 4G4YA 4X20B 1R1MA 3V7EA 1IV3A 4IHJB 2PHNA 4XCQA 4B45A 1VK3A 5EO3A 3WXMB 3JAMM 1J7HA 2P6YA 2QI2A 1NQ3A 3E22A 4I50B 3G6EF 4X1YA 4I4TA 1FFXB 2Z01A 2OTLF 4O2AA 4TV8B 1RQ7A 4ZHQA 5HY0A 2AMTA 3CD6F 4X3MA 2LBTA 3IR9A 2EWCA 1UFYA 3N4ZA 3D54A 5HXZA 3I56F 1Q7YH 1VQNF 1VH8A 3CYPB 2UYPA 4O4JA 3VMFB 1UI9A 3VOBA 3JAWB 1H47A 1SDSA 3CCQF 1VQMF 3D00A 1X7PA 3G71F 4G4ZA 2ZVZA 3DC2A 3HKBA 5JQGA 4O4IB 4LNUB 5GANK 3GYQA 1QAHA 4M8IA 2ZAUA 4O4HA 4BVTA 3ON1A 3WJQA 4I55A 3HWUA 3M4SA 5FNVA 3ERNA 5J2UA 3LWRC 5GINC 4X1IA 3KIZA 1W581 2VGNA 2AIZP 2BTOA 5EAZA 3LWVC 2ALEA 3V3TA 1U3PA 1VQ7F 2BTUA 3ZO8A 5IYZA 1CLIA 1Q8RA 1YJNF 3C9TA 4ZHVA 1W3EX 5IJ0B 2VAWA 2CHSA 1W55A 3BYQA 1VQPF 1VQVA 2NMUA 3ZOPA 3LWQC 4C82A 1W5AA 3WGMA 3OW2F 4FFBA 1U40A 3I7TA 3OBWA 4O4LA 4G4XA 4C81A 5KMGB 3RA5A 1X25A 3JASB 3JATA 2JNBA 4C8IA 2RHJA 5FJ4C 4DRXB 3J81M 5J2TB 4B62A 5IJ9A 1IPAA 3MQWA 2Z1TA 3CXCF 1Q82H 5AVMA 4BY9D 2BO1A 5KX5B 4YJ2B 1FNJA 2KGWA 1T0AA 5EZYB 3RYFB 3G4SF 3C8LA 5GAPK 1VQ4F 3CCMF 5JVDA 3TD3A 4X3LA 3S0HA 1NJIH 1CK2A 1NMUB 4R40B 1TUBB 1E7KA 3K14A 3JCMM 3KJKA 3C9RA 2HP0B 3JVHA 4F6RB 4BT5A 1SA0B 3VTIC 1H7MA 5EYPA 5MN5A 1PF5A 3HKDA 2KG4A 3F0DA 4X1KA 3QUWA 5EWRA 2HQSC 2H8CA 2HS0A 5JCOA 3HKEB 3WGJA 1X7OA 2KTUA 1KD1H 2RB9A 5LXTA 1W41A 5HY4A 1VQOF 3CMEF 4HNAA 2RHOA 2OTJF 1N8RH 4G4VA 2UZHA 3LWOC 1ODEA 1TVKA 3RYIA 3CMAF 3I55F 1FSZA 5EB0A 1W59A 3D01A 1M90H 3LMEA 3MDOA 1QD9A 1YJ9F 2I6RA 4KWEA 2OTMA 3GTZA 1CN7A 4EB6A 2YXZA 3GHZA 3E22B 4X1YB 3IEWA 4I4TB 5HP8A 4O2AB 3KHNA 4ZHQB 2AIFA 5EB1B 1FNKA 1DBFA 3HKCA 1GX1A 2CZWA 2KTVA 2Q1XA 4TV9A 5CA0A 4B5CA 1VQ8F 2W8BC 3RA6A 4WBNB 4LCKA 1JN1A 5LYJA 5HY1A 5EIBC 3N2KA 5CB4A 5HXUA 2Z1UA 4O2BA 3IEQA 1W5BA 4IIJA 4O4JB 3F0EA 3EORA 5ITZB 3JAKA 2MQEA 3QTYA 2HVYD 4U39A 4DXDA 5JQGB 4ZK7A 1W42A 4O4HB 1COMA 2VGMA 2WALA 1XV2A 2UYNA 5MN6A 5FNVB 3NMUC 2YYEA 5J2UB 3V7QA 3WGLA 4X1IB 3WGNA 3S02A 3CCVF 5MN4A 4BT6A 5B8FA 3C9SA 2HS3A 1U3LA 2ZOVA 2HP3A 4U3JA 5IYZB 4ZHYB 2B33A 1RQ2A 5BMVA 3IMPA 4TZZA 1JD1A 5C8YA 5HWEA 2N48A 5CA1A 4EI8A 4G4WA 3B6NA 1W57A 5LOVA 2Z1FA 3CC7F 3OBYA 1YITF 4C4WC 4FFBB 4O4LB 3CCEF 3M84A 3CC4F 1RLGA 3RYCA 2CHTA 3ESJA 3P4EA 1VQLF 3JATB 3ZP7A 2QTPA 2VAPA 3SIUA 3RYHA 4ZOLA 1W5FA 2BTQB 1YI2F 5IJ9B 1XHOA 2IAFA 3OONA 4EI9A 2ZODA 1K73H 1KC8H 3RE3A 2G9IA 1VQ9F 2GLZA 3V4DA 5EIBD 5IJ0A 3F6MA 3MCAB 5JVDB 3J80M 5JH7A 3NVKE 3K0TA 1VQ6F 2HRYA 3WPWA 2VXYA 4RHAA 3JARB 1PXWA 3VIUA 1RLUA 5LA6A 5LP6B 4B46A 1GZ0A 4DRXA 2R6R1 5EYPB 3LFOA 3HKDB 3UT5A 4YJ3A 1K9MH 4X1KB 3LYBA 3LWPC 1OAPA 5LXTB 2UYKA 4RQOA 3JALA 1U43A 4HNAB 1XRGA 2H6LA
chains in the Genus database with same CATH topology
3PLAC 3VI6A 1YJWF 5HY1A 4BVTA 5GIOC 1VQKF 3NK7A 2FGYA 3ON1A 1YIJF 1S72F 4BVQA 3LWRC 5HXUA 5GINC 3HJWC 2VGNA 3AGKA 3CCLF 3LWVC 2ALEA 3V3TA 1K8AH 1VQ7F 4NUTA 3CG6A 1KQSF 1T0KB 2HVYD 1YJNF 3E20B 1W3EX 3SIVA 1W42A 1M1KH 1GO0A 3O85A 1VQPF 3CCUF 2LBWA 3LWQC 2VGMA 2WALA 3CC2F 3E1YA 3OW2F 1QVFF 3OBWA 3NMUC 3V7QA 3RA5A 2OZBA 2JNBA 3CCVF 5FJ4C 3J81M 1ZWZA 3FFMA 3CCJF 1IPAA 3NK6A 3CXCF 1Q82H 1QVGF 1VQ8F 3CCSF 2BO1A 4BY9D 2FC3A 4TZZA 3HAXD 1DT9A 5HWEA 3NVIB 2QA4F 3G4SF 5GAPK 3N4YA 4EI8A 4NQ3A 1VQ5F 1VQ4F 3CCMF 5DCVA 3PAFA 3CC7F 3OBYA 1YITF 2QEXF 4C4WC 3CCRF 4X3LA 3CCEF 1NJIH 3CC4F 1RLGA 5G4UC 1GO1A 1NMUB 1CK2A 1VQLF 4BW0B 1E7KA 3JCMM 1XBIA 5FLXM 5HY2A 3SIUA 1YI2F 3V7EA 1H7MA 2F9ZC 4EI9A 2KG4A 4XCQA 1K73H 5EO3A 3WXMB 3JAMM 1KC8H 5EWRA 2QI2A 1X52A 3G6EF 5IT9M 1X7OA 2KTUA 1KD1H 1VQ9F 2OTLF 2GLZA 1W41A 5HY4A 2LBXA 1VQOF 3J7AR 5HY0A 3MCAB 1Q86H 3CMEF 2OHWA 1W40A 3CD6F 3J80M 1RA4A 4X3MA 3IR9A 3NVKE 2OTJF 1N8RH 1VQ6F 5A2QM 3LWOC 1PXWA 3N4ZA 4BVSA 3CMAF 3I55F 1GZ0A 5HXZA 3I56F 1Q7YH 1M90H 1VQNF 1JJ2F 1YJ9F 5GIPC 3LFOA 1CN7A 1K9MH 4BVRA 3VMFB 5G4VC 1SDSA 3CCQF 4EI7A 3CPQA 3D00A 3LWPC 1VQMF 1X7PA 2AIFA 3G71F 3CPWF 1Q81H 1YHQF 2CZWA 2KTVA 4LCKA 1W2BF 2I6DA 3RA6A 5GANK 3GYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLA C;  3VI6 A;  1YJW F;  5GIO C;  1VQK F;  3NK7 A;  3ON1 A;  1YIJ F;  1S72 F;  3LWR C;  5GIN C;  3HJW C;  2VGN A;  3AGK A;  3CCL F;  3LWV C;  2ALE A;  1K8A H;  1VQ7 F;  4NUT A;  3CG6 A;  1KQS F;  1T0K B;  2HVY D;  1YJN F;  3E20 B;  1W3E X;  3SIV A;  1W42 A;  1M1K H;  1GO0 A;  3O85 A;  1VQP F;  3CCU F;  2LBW A;  3LWQ C;  2VGM A;  2WAL A;  3CC2 F;  3E1Y A;  3OW2 F;  1QVF F;  3OBW A;  3NMU C;  3V7Q A;  3RA5 A;  2OZB A;  2JNB A;  3CCV F;  5FJ4 C;  3J81 M;  1ZWZ A;  3FFM A;  3CCJ F;  1IPA A;  3NK6 A;  3CXC F;  1Q82 H;  1QVG F;  1VQ8 F;  3CCS F;  2BO1 A;  4BY9 D;  2FC3 A;  4TZZ A;  3HAX D;  1DT9 A;  3NVI B;  2QA4 F;  3G4S F;  5GAP K;  3N4Y A;  1VQ5 F;  1VQ4 F;  3CCM F;  5DCV A;  3PAF A;  3CC7 F;  3OBY A;  1YIT F;  2QEX F;  4C4W C;  3CCR F;  4X3L A;  3CCE F;  1NJI H;  3CC4 F;  1RLG A;  5G4U C;  1GO1 A;  1NMU B;  1CK2 A;  1VQL F;  4BW0 B;  1E7K A;  3JCM M;  1XBI A;  5FLX M;  3SIU A;  1YI2 F;  3V7E A;  1H7M A;  2KG4 A;  1K73 H;  5EO3 A;  3WXM B;  3JAM M;  1KC8 H;  5EWR A;  2QI2 A;  1X52 A;  3G6E F;  5IT9 M;  1X7O A;  2KTU A;  1KD1 H;  1VQ9 F;  2OTL F;  1W41 A;  1VQO F;  2LBX A;  3J7A R;  3MCA B;  1Q86 H;  3CME F;  2OHW A;  1W40 A;  3CD6 F;  3J80 M;  1RA4 A;  4X3M A;  3IR9 A;  3NVK E;  2OTJ F;  1N8R H;  1VQ6 F;  5A2Q M;  3LWO C;  1PXW A;  3N4Z A;  3CMA F;  3I55 F;  1GZ0 A;  1VQN F;  3I56 F;  1Q7Y H;  1M90 H;  1JJ2 F;  1YJ9 F;  5GIP C;  3LFO A;  1CN7 A;  1K9M H;  3VMF B;  5G4V C;  1SDS A;  3CCQ F;  1VQM F;  3CPQ A;  3LWP C;  1X7P A;  2AIF A;  3G71 F;  3CPW F;  1Q81 H;  1YHQ F;  2CZW A;  2KTV A;  4LCK A;  1W2B F;  2I6D A;  3RA6 A;  5GAN K;  3GYQ A; 
#chains in the Genus database with same CATH topology
 1JFF A;  5GON B;  1TVK B;  3RYI B;  4C8G A;  4ZI7 A;  4BVQ A;  3HJW C;  2DYY A;  4EB6 B;  3FD6 A;  3CCL F;  3S06 A;  1SZQ A;  1K8A H;  3CG6 A;  1KQS F;  1ONI A;  3WGK A;  3HKC B;  4TV9 B;  1Z5V A;  5CA0 B;  4PWT A;  3SIV A;  1M1K H;  1GO0 A;  3O85 A;  3IKF A;  4TUY A;  1JY8 A;  2LBW A;  5LYJ B;  1KNJ A;  2IG8 A;  2Z1E A;  3E1Y A;  1QVF F;  3VYS C;  3N2G A;  3VO8 A;  2V9Y A;  3N2K B;  5CB4 B;  5LP6 C;  4O2B B;  4IIJ B;  3FFM A;  4X20 A;  3JAK B;  2GZL A;  3CCJ F;  3NK6 A;  4IHJ A;  3C9U A;  3CCS F;  3ELC A;  3MBM A;  2HX0 A;  1Z5W A;  4I50 A;  1FFX A;  5JCO C;  3NVI B;  3ZP4 A;  4TV8 A;  2QA4 F;  3HKB B;  3N4Y A;  4NQ3 A;  4WBN A;  4G88 A;  3I3F A;  2QEX F;  2UYN B;  3VYU C;  5G4U C;  3FBA A;  1GO1 A;  1OFU A;  3WPX A;  4I55 B;  3Q8H A;  3P0Z A;  1XBI A;  5FLX M;  5HY2 A;  1YQN A;  2F9Z C;  5ITZ A;  4U3J B;  4BT3 A;  3TD5 A;  3JAW A;  5BMV B;  3P10 A;  5C8Y B;  1X52 A;  2L26 A;  3DDN A;  5IT9 M;  5CA1 B;  3J7A R;  2LBX A;  3KE1 A;  3F0G A;  1Q86 H;  5LOV B;  2OHW A;  1W40 A;  1RA4 A;  4LNU A;  4O4I A;  3K12 A;  2CW4 A;  1QU9 A;  5A2Q M;  3RYC B;  3QHD A;  3TD4 A;  4BVS A;  2CSL A;  3RYH B;  4ZOL B;  1JJ2 F;  2DT4 A;  5GIP C;  3S0Y A;  4BVR A;  3R0P A;  3WJR A;  5G4V C;  4BT4 A;  3MCQ A;  3CPQ A;  4EI7 A;  3U0O A;  3CPW F;  3CB2 A;  1Q81 H;  1YHQ F;  3FPI A;  1W2B F;  5JH7 B;  2I6D A;  5HP7 A;  3KJJ A;  3PLA C;  2UYJ A;  3VI6 A;  1YJW F;  4NWO B;  5LA6 B;  5GIO C;  3NK7 A;  2FGY A;  1VQK F;  4ERH A;  1YIJ F;  2CWJ A;  3VCZ A;  1S72 F;  1H48 A;  1IV4 A;  5KMG A;  3JAS A;  2GVI A;  4YJ3 B;  3UT5 B;  3AGK A;  3T80 A;  2CVL A;  5J2T A;  3WJP A;  1YGY A;  2H8E A;  3LDT A;  3L7Q A;  4NUT A;  5KX5 A;  4YJ2 A;  1T0K B;  2LCA A;  4E6E A;  3JAL B;  3M1X A;  4BT2 A;  3E20 B;  5EZY A;  2VAM A;  3RYF A;  1JFF B;  3CCU F;  1IV2 A;  3CC2 F;  1IV1 A;  2ZF8 A;  3FD5 A;  4BT7 A;  3JAR A;  5LP6 A;  3VOA A;  4ZHW A;  2Q1Y A;  4ZI7 B;  1TUB A;  2HS4 A;  2OZB A;  2ZVY A;  2HP0 A;  3CYQ A;  1ZWZ A;  2K1S A;  3K2X A;  2RHL A;  4F6R A;  1SA0 A;  2R75 1;  2HRU A;  1QVG F;  3S0W A;  4C8E A;  2FC3 A;  2IQQ A;  3HAX D;  2PMP A;  3HKE A;  1DT9 A;  3S03 A;  2RHH A;  1VHA A;  4TUY B;  1VQ5 F;  3HTN A;  5DCV A;  3PAF A;  3VYT C;  5GON A;  3CCR F;  3F0F A;  3IKE A;  3N2G B;  4BW0 B;  1W5E A;  1KNK A;  4G4Y A;  4X20 B;  1R1M A;  3V7E A;  1IV3 A;  4IHJ B;  2PHN A;  4XCQ A;  4B45 A;  1VK3 A;  5EO3 A;  3WXM B;  3JAM M;  1J7H A;  2P6Y A;  2QI2 A;  1NQ3 A;  3E22 A;  4I50 B;  3G6E F;  4X1Y A;  4I4T A;  1FFX B;  2Z01 A;  2OTL F;  4O2A A;  4TV8 B;  1RQ7 A;  4ZHQ A;  5HY0 A;  2AMT A;  3CD6 F;  4X3M A;  2LBT A;  3IR9 A;  2EWC A;  1UFY A;  3N4Z A;  3D54 A;  5HXZ A;  3I56 F;  1Q7Y H;  1VQN F;  1VH8 A;  3CYP B;  2UYP A;  4O4J A;  3VMF B;  1UI9 A;  3VOB A;  3JAW B;  1H47 A;  1SDS A;  3CCQ F;  1VQM F;  3D00 A;  1X7P A;  3G71 F;  4G4Z A;  2ZVZ A;  3DC2 A;  3HKB A;  5JQG A;  4O4I B;  4LNU B;  5GAN K;  3GYQ A;  1QAH A;  4M8I A;  2ZAU A;  4O4H A;  4BVT A;  3ON1 A;  3WJQ A;  4I55 A;  3HWU A;  3M4S A;  5FNV A;  3ERN A;  5J2U A;  3LWR C;  5GIN C;  4X1I A;  3KIZ A;  1W58 1;  2VGN A;  2AIZ P;  2BTO A;  5EAZ A;  3LWV C;  2ALE A;  3V3T A;  1U3P A;  1VQ7 F;  2BTU A;  3ZO8 A;  5IYZ A;  1CLI A;  1Q8R A;  1YJN F;  3C9T A;  4ZHV A;  1W3E X;  5IJ0 B;  2VAW A;  2CHS A;  1W55 A;  3BYQ A;  1VQP F;  1VQV A;  2NMU A;  3ZOP A;  3LWQ C;  4C82 A;  1W5A A;  3WGM A;  3OW2 F;  4FFB A;  1U40 A;  3I7T A;  3OBW A;  4O4L A;  4G4X A;  4C81 A;  5KMG B;  3RA5 A;  1X25 A;  3JAS B;  3JAT A;  2JNB A;  4C8I A;  2RHJ A;  5FJ4 C;  4DRX B;  3J81 M;  5J2T B;  4B62 A;  5IJ9 A;  1IPA A;  3MQW A;  2Z1T A;  3CXC F;  1Q82 H;  5AVM A;  4BY9 D;  2BO1 A;  5KX5 B;  4YJ2 B;  1FNJ A;  2KGW A;  1T0A A;  5EZY B;  3RYF B;  3G4S F;  3C8L A;  5GAP K;  1VQ4 F;  3CCM F;  5JVD A;  3TD3 A;  4X3L A;  3S0H A;  1NJI H;  1CK2 A;  1NMU B;  4R40 B;  1TUB B;  1E7K A;  3K14 A;  3JCM M;  3KJK A;  3C9R A;  2HP0 B;  3JVH A;  4F6R B;  4BT5 A;  1SA0 B;  3VTI C;  1H7M A;  5EYP A;  5MN5 A;  1PF5 A;  3HKD A;  2KG4 A;  3F0D A;  4X1K A;  3QUW A;  5EWR A;  2HQS C;  2H8C A;  2HS0 A;  5JCO A;  3HKE B;  3WGJ A;  1X7O A;  2KTU A;  1KD1 H;  2RB9 A;  5LXT A;  1W41 A;  5HY4 A;  1VQO F;  3CME F;  4HNA A;  2RHO A;  2OTJ F;  1N8R H;  4G4V A;  2UZH A;  3LWO C;  1ODE A;  1TVK A;  3RYI A;  3CMA F;  3I55 F;  1FSZ A;  5EB0 A;  1W59 A;  3D01 A;  1M90 H;  3LME A;  3MDO A;  1QD9 A;  1YJ9 F;  2I6R A;  4KWE A;  2OTM A;  3GTZ A;  1CN7 A;  4EB6 A;  2YXZ A;  3GHZ A;  3E22 B;  4X1Y B;  3IEW A;  4I4T B;  5HP8 A;  4O2A B;  3KHN A;  4ZHQ B;  2AIF A;  5EB1 B;  1FNK A;  1DBF A;  3HKC A;  1GX1 A;  2CZW A;  2KTV A;  2Q1X A;  4TV9 A;  5CA0 A;  4B5C A;  1VQ8 F;  2W8B C;  3RA6 A;  4WBN B;  4LCK A;  1JN1 A;  5LYJ A;  5HY1 A;  5EIB C;  3N2K A;  5CB4 A;  5HXU A;  2Z1U A;  4O2B A;  3IEQ A;  1W5B A;  4IIJ A;  4O4J B;  3F0E A;  3EOR A;  5ITZ B;  3JAK A;  2MQE A;  3QTY A;  2HVY D;  4U39 A;  4DXD A;  5JQG B;  4ZK7 A;  1W42 A;  4O4H B;  1COM A;  2VGM A;  2WAL A;  1XV2 A;  2UYN A;  5MN6 A;  5FNV B;  3NMU C;  2YYE A;  5J2U B;  3V7Q A;  3WGL A;  4X1I B;  3WGN A;  3S02 A;  3CCV F;  5MN4 A;  4BT6 A;  5B8F A;  3C9S A;  2HS3 A;  1U3L A;  2ZOV A;  2HP3 A;  4U3J A;  5IYZ B;  4ZHY B;  2B33 A;  1RQ2 A;  5BMV A;  3IMP A;  4TZZ A;  1JD1 A;  5C8Y A;  5HWE A;  2N48 A;  5CA1 A;  4EI8 A;  4G4W A;  3B6N A;  1W57 A;  5LOV A;  2Z1F A;  3CC7 F;  3OBY A;  1YIT F;  4C4W C;  4FFB B;  4O4L B;  3CCE F;  3M84 A;  3CC4 F;  1RLG A;  3RYC A;  2CHT A;  3ESJ A;  3P4E A;  1VQL F;  3JAT B;  3ZP7 A;  2QTP A;  2VAP A;  3SIU A;  3RYH A;  4ZOL A;  1W5F A;  2BTQ B;  1YI2 F;  5IJ9 B;  1XHO A;  2IAF A;  3OON A;  4EI9 A;  2ZOD A;  1K73 H;  1KC8 H;  3RE3 A;  2G9I A;  1VQ9 F;  2GLZ A;  3V4D A;  5EIB D;  5IJ0 A;  3F6M A;  3MCA B;  5JVD B;  3J80 M;  5JH7 A;  3NVK E;  3K0T A;  1VQ6 F;  2HRY A;  3WPW A;  2VXY A;  4RHA A;  3JAR B;  1PXW A;  3VIU A;  1RLU A;  5LA6 A;  5LP6 B;  4B46 A;  1GZ0 A;  4DRX A;  2R6R 1;  5EYP B;  3LFO A;  3HKD B;  3UT5 A;  4YJ3 A;  1K9M H;  4X1K B;  3LYB A;  3LWP C;  1OAP A;  5LXT B;  2UYK A;  4RQO A;  3JAL A;  1U43 A;  4HNA B;  1XRG A;  2H6L A; 
#chains in the Genus database with same CATH homology
 3PLA C;  3VI6 A;  1YJW F;  5HY1 A;  4BVT A;  5GIO C;  1VQK F;  3NK7 A;  2FGY A;  3ON1 A;  1YIJ F;  1S72 F;  4BVQ A;  3LWR C;  5HXU A;  5GIN C;  3HJW C;  2VGN A;  3AGK A;  3CCL F;  3LWV C;  2ALE A;  3V3T A;  1K8A H;  1VQ7 F;  4NUT A;  3CG6 A;  1KQS F;  1T0K B;  2HVY D;  1YJN F;  3E20 B;  1W3E X;  3SIV A;  1W42 A;  1M1K H;  1GO0 A;  3O85 A;  1VQP F;  3CCU F;  2LBW A;  3LWQ C;  2VGM A;  2WAL A;  3CC2 F;  3E1Y A;  3OW2 F;  1QVF F;  3OBW A;  3NMU C;  3V7Q A;  3RA5 A;  2OZB A;  2JNB A;  3CCV F;  5FJ4 C;  3J81 M;  1ZWZ A;  3FFM A;  3CCJ F;  1IPA A;  3NK6 A;  3CXC F;  1Q82 H;  1QVG F;  1VQ8 F;  3CCS F;  2BO1 A;  4BY9 D;  2FC3 A;  4TZZ A;  3HAX D;  1DT9 A;  5HWE A;  3NVI B;  2QA4 F;  3G4S F;  5GAP K;  3N4Y A;  4EI8 A;  4NQ3 A;  1VQ5 F;  1VQ4 F;  3CCM F;  5DCV A;  3PAF A;  3CC7 F;  3OBY A;  1YIT F;  2QEX F;  4C4W C;  3CCR F;  4X3L A;  3CCE F;  1NJI H;  3CC4 F;  1RLG A;  5G4U C;  1GO1 A;  1NMU B;  1CK2 A;  1VQL F;  4BW0 B;  1E7K A;  3JCM M;  1XBI A;  5FLX M;  5HY2 A;  3SIU A;  1YI2 F;  3V7E A;  1H7M A;  2F9Z C;  4EI9 A;  2KG4 A;  4XCQ A;  1K73 H;  5EO3 A;  3WXM B;  3JAM M;  1KC8 H;  5EWR A;  2QI2 A;  1X52 A;  3G6E F;  5IT9 M;  1X7O A;  2KTU A;  1KD1 H;  1VQ9 F;  2OTL F;  2GLZ A;  1W41 A;  5HY4 A;  2LBX A;  1VQO F;  3J7A R;  5HY0 A;  3MCA B;  1Q86 H;  3CME F;  2OHW A;  1W40 A;  3CD6 F;  3J80 M;  1RA4 A;  4X3M A;  3IR9 A;  3NVK E;  2OTJ F;  1N8R H;  1VQ6 F;  5A2Q M;  3LWO C;  1PXW A;  3N4Z A;  4BVS A;  3CMA F;  3I55 F;  1GZ0 A;  5HXZ A;  3I56 F;  1Q7Y H;  1M90 H;  1VQN F;  1JJ2 F;  1YJ9 F;  5GIP C;  3LFO A;  1CN7 A;  1K9M H;  4BVR A;  3VMF B;  5G4V C;  1SDS A;  3CCQ F;  4EI7 A;  3CPQ A;  3D00 A;  3LWP C;  1VQM F;  1X7P A;  2AIF A;  3G71 F;  3CPW F;  1Q81 H;  1YHQ F;  2CZW A;  2KTV A;  4LCK A;  1W2B F;  2I6D A;  3RA6 A;  5GAN K;  3GYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...