2CHTA

Crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE
publication title Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2chtA00
2UYJA 4ZK7A 4NWOB 1PF5A 1UFYA 1X25A 3I7TA 2EWCA 2CHTA 5HP7A 3K12A 3L7QA 2CSLA 2UYNA 3V4DA 3K0TA 2CW4A 2CWJA 1J7HA 1QAHA 3VCZA 1XHOA 2DYYA 5HP8A 2UYKA 3D01A 3ZOPA 2OTMA 1FNKA 3I3FA 1JD1A 2CHSA 2UYPA 1FNJA 3MQWA 1UI9A 2CVLA 1ONIA 2UYNB 3LYBA 3M4SA 3GTZA 3ZP4A 1QD9A 3LMEA 1COMA 1XRGA 3ZO8A 2IG8A 3KJKA 3R0PA 3KJJA 1QU9A 3M1XA 3QUWA 1DBFA 1ODEA 3ZP7A 1NQ3A 2B33A
chains in the Genus database with same CATH superfamily
1KNJA 3LFOA 3CCEF 5HY1A 3S0HA 4X1IB 5ITZA 5GANK 2MQEA 5FNVB 1J7HA 1RQ7A 3MCQA 3FBAA 1YITF 3VOAA 5GINC 3JAKB 1VQ4F 3CYPB 4TUYB 4HNAB 3N2KA 1YHQF 2H6LA 3C9RA 3VMFB 5EYPB 3CCUF 2ZODA 1E7KA 3LDTA 5LP6A 3E22A 3SIVA 2QEXF 2ZAUA 1NMUB 3HWUA 1FSZA 1K73H 3VO8A 3JALA 5HP7A 3ERNA 5LOVA 4B5CA 1W3EX 3WGLA 2YXZA 3D01A 3C8LA 2ZVYA 1VQOF 4C82A 1R1MA 1FNJA 1S72F 4B62A 4ZI7B 1XRGA 3P10A 3HJWC 5JH7A 5MN5A 1FFXB 4BT4A 5IYZB 3CG6A 5EZYA 5DCVA 1ODEA 3JAWA 4X3MA 3I56F 2VAPA 2VGNA 2UYJA 2K1SA 5LXTB 5JQGA 1VQPF 5GONA 1TVKB 3S06A 1XBIA 3K14A 2RHJA 4BT7A 1SA0B 1JY8A 2CW4A 3F0GA 3HAXD 4O4LA 4X3LA 1XHOA 3WPWA 2KTVA 3FPIA 4B45A 1T0KB 1W59A 5G4UC 4I50A 3UT5A 3G6EF 3G71F 1W581 3F6MA 5ITZB 4YJ3A 5LYJA 3LMEA 1X52A 1TUBA 3BYQA 1IV1A 3CD6F 4IHJA 2V9YA 3C9UA 3M1XA 3MCAB 2QA4F 2UYPA 4WBNA 3TD4A 1W42A 3CCRF 4G88A 3N2KB 3OONA 2CSLA 3NK6A 3K0TA 1RA4A 2AIZP 3CMAF 5LP6B 3E22B 1Q7YH 4X1YA 4U3JA 1YQNA 5AVMA 2KTUA 3JALB 2HRYA 3ZP4A 4IIJA 3J80M 1OFUA 5CB4A 4LNUA 1QU9A 2L26A 2LBTA 3WGNA 3N2GA 3V3TA 3D00A 3CCQF 5JH7B 4I4TA 1VQ6F 4C4WC 4BT6A 5EZYB 4BT5A 5J2TA 3JAWB 3JVHA 3DC2A 2UYKA 2R6R1 4G4ZA 3MBMA 2DT4A 5JQGB 3HKBB 1N8RH 3JATA 5GONB 5JVDA 5IT9M 3LWOC 1YIJF 1ONIA 3LYBA 1H7MA 3ELCA 3R0PA 4O4LB 1TVKA 5IJ0A 3GYQA 3QUWA 5HXUA 2I6RA 5EO3A 5HY2A 4I50B 1NQ3A 3LWVC 3UT5B 4YJ3B 5LYJB 2F9ZC 1TUBB 1CK2A 1U40A 4IHJB 5GIPC 2IQQA 2CWJA 3SIUA 4M8IA 2LBXA 4KWEA 3IEQA 4E6EA 5HY4A 3JAMM 1VQLF 4WBNB 2HS4A 1M90H 2VAMA 1X7PA 4BVTA 4G4WA 5EB0A 4EI7A 3CCJF 1IPAA 3KJKA 4X1YB 4U3JB 1KD1H 2GVIA 3RYIA 2Z1TA 3K12A 4IIJB 4O2AA 3NMUC 5CB4B 5HXZA 4LNUB 3KHNA 3C9SA 4O4IA 4TV9A 1VQNF 2DYYA 1YJWF 3N2GB 1ZWZA 3TD5A 3QHDA 3NVIB 4BVSA 3WXMB 3RE3A 1UI9A 3JCMM 3F0FA 1VK3A 2VAWA 4I4TB 3CCLF 3N4ZA 3RA5A 5JCOC 5J2TB 2IG8A 5EWRA 3RYCA 3CC2F 5GAPK 3ESJA 4DXDA 3VYSC 3JATB 1M1KH 5JVDB 3S0YA 1PF5A 3F0DA 3VYUC 2EWCA 2CHTA 4C8IA 1VQMF 4C81A 3HKBA 2OZBA 2UYNA 5LA6A 5IJ0B 3FD6A 1U3PA 1VQKF 2W8BC 5HP8A 5MN4A 5HWEA 1CLIA 3I3FA 2H8EA 1YI2F 1XV2A 2HS3A 4NQ3A 3GTZA 1W5EA 4LCKA 3O85A 4TZZA 4DRXA 4X1KA 1KNKA 4ZHWA 2UZHA 2JNBA 4ERHA 1VQ7F 3CCMF 3ZP7A 2HVYD 2GLZA 5GIOC 4NWOB 1X25A 3WGJA 2KG4A 1Z5VA 2Q1XA 1VQ9F 1W57A 3RYIB 4F6RA 4O4HA 4O2AB 5MN6A 3CXCF 3MQWA 3J7AR 3GHZA 3CPWF 2VXYA 2HRUA 4O2BB 4O4IB 4TV9B 1GX1A 2VGMA 1DT9A 3VYTC 1RQ2A 2Z1EA 1IV3A 1W5BA 1X7OA 3P4EA 2PHNA 2RHLA 4U39A 3D54A 3M84A 2OTLF 1IV4A 2OHWA 3L7QA 2BTOA 3V4DA 3WPXA 2CZWA 4R40B 3RYCB 3VCZA 5EAZA 3VI6A 1RLGA 2HX0A 2OTMA 3RYHA 3RYFA 3K2XA 5J2UA 5G4VC 3VOBA 3G4SF 1T0AA 2UYNB 5LA6B 5C8YA 3HKEB 4BT2A 4BVRA 1KC8H 2H8CA 1CN7A 3ZO8A 4ZOLB 3S0WA 1VHAA 2AIFA 3I55F 4NUTA 2QTPA 1PXWA 3OBYA 2G9IA 1W40A 2LCAA 3CMEF 3CC7F 1VQ8F 3IEWA 4O4JA 5KMGA 4DRXB 4X1KB 1YJNF 3RA6A 5A2QM 5FJ4C 5EB1B 3AGKA 1FNKA 2HQSC 3N4YA 4G4XA 2CVLA 3M4SA 3MDOA 5BMVA 1QD9A 3E1YA 2BTUA 2IAFA 2RHOA 4F6RB 3TD3A 4YJ2A 4O4HB 5LP6C 1Q82H 3B6NA 5CA0A 3OW2F 1UFYA 1YJ9F 3P0ZA 4BVQA 1GO1A 4ZHYB 2HP0A 2WALA 5IJ9A 3F0EA 3NK7A 2BTQB 4O2BA 4EB6A 3PAFA 2GZLA 3HTNA 2FC3A 3WGKA 1Z5WA 4I55A 4FFBA 1KQSF 1JFFA 3CPQA 3HKCA 4X20A 4C8EA 1H47A 1DBFA 3RYFB 3RYHB 5J2UB 3CCSF 2RHHA 4G4VA 1GZ0A 3WJQA 4TV8A 3I7TA 5C8YB 1YGYA 4G4YA 1W5FA 4ZHQA 2HS0A 2FGYA 3HKDA 3HKEA 3IMPA 4ZOLA 2RB9A 3WJPA 4RHAA 5JCOA 4B46A 1OAPA 4O4JB 5KMGB 3C9TA 2OTJF 1W55A 4EI8A 5CA1A 3WGMA 3LWPC 2I6DA 3JARA 3EORA 2KGWA 1SDSA 3IKEA 3KIZA 4EI9A 5EIBC 3OBWA 2B33A 4ZK7A 1W41A 5KX5B 3JASA 2BO1A 5BMVB 3CC4F 4BY9D 2QI2A 4XCQA 4C8GA 4ZHVA 2NMUA 3CYQA 2LBWA 1QAHA 1K8AH 1GO0A 4YJ2B 1RLUA 2ZF8A 5CA0B 3S03A 2Z1UA 3KE1A 3ON1A 2HP0B 5IJ9B 3S02A 3QTYA 1K9MH 1Q8RA 3Q8HA 4X1IA 3KJJA 5FNVA 3V7QA 3CCVF 4EB6B 2R751 2ZOVA 1W2BF 1SZQA 3FFMA 3LWRC 3U0OA 1VH8A 2N48A 4I55B 3DDNA 3JAKA 2Q1YA 1QVGF 3E20B 4FFBB 1Q86H 1JFFB 1W5AA 3HKCB 4TUYA 4X20B 2Z1FA 4HNAA 2HP3A 1JJ2F 2YYEA 5EYPA 3ZOPA 3LWQC 5B8FA 1VQ5F 4TV8B 2CHSA 5LOVB 4ZHQB 3VTIC 3CB2A 3HKDB 2P6YA 3PLAC 4PWTA 5FLXM 1QVFF 5CA1B 1JN1A 3JARB 4RQOA 4ZI7A 3J81M 1FFXA 5IYZA 3FD5A 2ZVZA 3JASB 4BT3A 1H48A 3NVKE 1JD1A 1VQVA 3IR9A 3WJRA 5LXTA 5KX5A 1Q81H 1COMA 3IKFA 1U43A 1SA0A 2ALEA 3V7EA 2PMPA 1U3LA 1IV2A 3T80A 5HY0A 2Z01A 1NJIH 5EIBD 2AMTA 3VIUA 4BW0B
chains in the Genus database with same CATH topology
2UYJA 4ZK7A 4NWOB 1PF5A 1UFYA 1X25A 3I7TA 2EWCA 2CHTA 5HP7A 3K12A 3L7QA 2CSLA 2UYNA 3V4DA 3K0TA 2CW4A 2CWJA 1J7HA 1QAHA 3VCZA 1XHOA 2DYYA 5HP8A 2UYKA 3D01A 3ZOPA 2OTMA 1FNKA 3I3FA 1JD1A 2CHSA 2UYPA 1FNJA 3MQWA 1UI9A 2CVLA 1ONIA 2UYNB 3LYBA 3M4SA 3GTZA 3ZP4A 1QD9A 3LMEA 1COMA 1XRGA 3ZO8A 2IG8A 3KJKA 3R0PA 3KJJA 1QU9A 3M1XA 3QUWA 1DBFA 1ODEA 3ZP7A 1NQ3A 2B33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYJ A;  4ZK7 A;  4NWO B;  1PF5 A;  1UFY A;  1X25 A;  3I7T A;  2EWC A;  2CHT A;  5HP7 A;  3K12 A;  3L7Q A;  2CSL A;  2UYN A;  3V4D A;  3K0T A;  2CW4 A;  2CWJ A;  1J7H A;  1QAH A;  3VCZ A;  1XHO A;  2DYY A;  5HP8 A;  2UYK A;  3D01 A;  3ZOP A;  2OTM A;  1FNK A;  3I3F A;  1JD1 A;  2CHS A;  2UYP A;  1FNJ A;  3MQW A;  1UI9 A;  2CVL A;  1ONI A;  2UYN B;  3LYB A;  3M4S A;  3GTZ A;  3ZP4 A;  1QD9 A;  3LME A;  1COM A;  1XRG A;  3ZO8 A;  2IG8 A;  3KJK A;  3R0P A;  3KJJ A;  1QU9 A;  3M1X A;  3QUW A;  1DBF A;  1ODE A;  3ZP7 A;  1NQ3 A;  2B33 A; 
#chains in the Genus database with same CATH topology
 1KNJ A;  3LFO A;  3CCE F;  5HY1 A;  3S0H A;  4X1I B;  5ITZ A;  5GAN K;  2MQE A;  5FNV B;  1J7H A;  1RQ7 A;  3MCQ A;  3FBA A;  1YIT F;  3VOA A;  5GIN C;  3JAK B;  1VQ4 F;  3CYP B;  4TUY B;  4HNA B;  3N2K A;  1YHQ F;  2H6L A;  3C9R A;  3VMF B;  5EYP B;  3CCU F;  2ZOD A;  1E7K A;  3LDT A;  5LP6 A;  3E22 A;  3SIV A;  2QEX F;  2ZAU A;  1NMU B;  3HWU A;  1FSZ A;  1K73 H;  3VO8 A;  3JAL A;  5HP7 A;  3ERN A;  5LOV A;  4B5C A;  1W3E X;  3WGL A;  2YXZ A;  3D01 A;  3C8L A;  2ZVY A;  1VQO F;  4C82 A;  1R1M A;  1FNJ A;  1S72 F;  4B62 A;  4ZI7 B;  1XRG A;  3P10 A;  3HJW C;  5JH7 A;  5MN5 A;  1FFX B;  4BT4 A;  5IYZ B;  3CG6 A;  5EZY A;  5DCV A;  1ODE A;  3JAW A;  4X3M A;  3I56 F;  2VAP A;  2VGN A;  2UYJ A;  2K1S A;  5LXT B;  5JQG A;  1VQP F;  5GON A;  1TVK B;  3S06 A;  1XBI A;  3K14 A;  2RHJ A;  4BT7 A;  1SA0 B;  1JY8 A;  2CW4 A;  3F0G A;  3HAX D;  4O4L A;  4X3L A;  1XHO A;  3WPW A;  2KTV A;  3FPI A;  4B45 A;  1T0K B;  1W59 A;  5G4U C;  4I50 A;  3UT5 A;  3G6E F;  3G71 F;  1W58 1;  3F6M A;  5ITZ B;  4YJ3 A;  5LYJ A;  3LME A;  1X52 A;  1TUB A;  3BYQ A;  1IV1 A;  3CD6 F;  4IHJ A;  2V9Y A;  3C9U A;  3M1X A;  3MCA B;  2QA4 F;  2UYP A;  4WBN A;  3TD4 A;  1W42 A;  3CCR F;  4G88 A;  3N2K B;  3OON A;  2CSL A;  3NK6 A;  3K0T A;  1RA4 A;  2AIZ P;  3CMA F;  5LP6 B;  3E22 B;  1Q7Y H;  4X1Y A;  4U3J A;  1YQN A;  5AVM A;  2KTU A;  3JAL B;  2HRY A;  3ZP4 A;  4IIJ A;  3J80 M;  1OFU A;  5CB4 A;  4LNU A;  1QU9 A;  2L26 A;  2LBT A;  3WGN A;  3N2G A;  3V3T A;  3D00 A;  3CCQ F;  5JH7 B;  4I4T A;  1VQ6 F;  4C4W C;  4BT6 A;  5EZY B;  4BT5 A;  5J2T A;  3JAW B;  3JVH A;  3DC2 A;  2UYK A;  2R6R 1;  4G4Z A;  3MBM A;  2DT4 A;  5JQG B;  3HKB B;  1N8R H;  3JAT A;  5GON B;  5JVD A;  5IT9 M;  3LWO C;  1YIJ F;  1ONI A;  3LYB A;  1H7M A;  3ELC A;  3R0P A;  4O4L B;  1TVK A;  5IJ0 A;  3GYQ A;  3QUW A;  5HXU A;  2I6R A;  5EO3 A;  5HY2 A;  4I50 B;  1NQ3 A;  3LWV C;  3UT5 B;  4YJ3 B;  5LYJ B;  2F9Z C;  1TUB B;  1CK2 A;  1U40 A;  4IHJ B;  5GIP C;  2IQQ A;  2CWJ A;  3SIU A;  4M8I A;  2LBX A;  4KWE A;  3IEQ A;  4E6E A;  5HY4 A;  3JAM M;  1VQL F;  4WBN B;  2HS4 A;  1M90 H;  2VAM A;  1X7P A;  4BVT A;  4G4W A;  5EB0 A;  4EI7 A;  3CCJ F;  1IPA A;  3KJK A;  4X1Y B;  4U3J B;  1KD1 H;  2GVI A;  3RYI A;  2Z1T A;  3K12 A;  4IIJ B;  4O2A A;  3NMU C;  5CB4 B;  5HXZ A;  4LNU B;  3KHN A;  3C9S A;  4O4I A;  4TV9 A;  1VQN F;  2DYY A;  1YJW F;  3N2G B;  1ZWZ A;  3TD5 A;  3QHD A;  3NVI B;  4BVS A;  3WXM B;  3RE3 A;  1UI9 A;  3JCM M;  3F0F A;  1VK3 A;  2VAW A;  4I4T B;  3CCL F;  3N4Z A;  3RA5 A;  5JCO C;  5J2T B;  2IG8 A;  5EWR A;  3RYC A;  3CC2 F;  5GAP K;  3ESJ A;  4DXD A;  3VYS C;  3JAT B;  1M1K H;  5JVD B;  3S0Y A;  1PF5 A;  3F0D A;  3VYU C;  2EWC A;  2CHT A;  4C8I A;  1VQM F;  4C81 A;  3HKB A;  2OZB A;  2UYN A;  5LA6 A;  5IJ0 B;  3FD6 A;  1U3P A;  1VQK F;  2W8B C;  5HP8 A;  5MN4 A;  5HWE A;  1CLI A;  3I3F A;  2H8E A;  1YI2 F;  1XV2 A;  2HS3 A;  4NQ3 A;  3GTZ A;  1W5E A;  4LCK A;  3O85 A;  4TZZ A;  4DRX A;  4X1K A;  1KNK A;  4ZHW A;  2UZH A;  2JNB A;  4ERH A;  1VQ7 F;  3CCM F;  3ZP7 A;  2HVY D;  2GLZ A;  5GIO C;  4NWO B;  1X25 A;  3WGJ A;  2KG4 A;  1Z5V A;  2Q1X A;  1VQ9 F;  1W57 A;  3RYI B;  4F6R A;  4O4H A;  4O2A B;  5MN6 A;  3CXC F;  3MQW A;  3J7A R;  3GHZ A;  3CPW F;  2VXY A;  2HRU A;  4O2B B;  4O4I B;  4TV9 B;  1GX1 A;  2VGM A;  1DT9 A;  3VYT C;  1RQ2 A;  2Z1E A;  1IV3 A;  1W5B A;  1X7O A;  3P4E A;  2PHN A;  2RHL A;  4U39 A;  3D54 A;  3M84 A;  2OTL F;  1IV4 A;  2OHW A;  3L7Q A;  2BTO A;  3V4D A;  3WPX A;  2CZW A;  4R40 B;  3RYC B;  3VCZ A;  5EAZ A;  3VI6 A;  1RLG A;  2HX0 A;  2OTM A;  3RYH A;  3RYF A;  3K2X A;  5J2U A;  5G4V C;  3VOB A;  3G4S F;  1T0A A;  2UYN B;  5LA6 B;  5C8Y A;  3HKE B;  4BT2 A;  4BVR A;  1KC8 H;  2H8C A;  1CN7 A;  3ZO8 A;  4ZOL B;  3S0W A;  1VHA A;  2AIF A;  3I55 F;  4NUT A;  2QTP A;  1PXW A;  3OBY A;  2G9I A;  1W40 A;  2LCA A;  3CME F;  3CC7 F;  1VQ8 F;  3IEW A;  4O4J A;  5KMG A;  4DRX B;  4X1K B;  1YJN F;  3RA6 A;  5A2Q M;  5FJ4 C;  5EB1 B;  3AGK A;  1FNK A;  2HQS C;  3N4Y A;  4G4X A;  2CVL A;  3M4S A;  3MDO A;  5BMV A;  1QD9 A;  3E1Y A;  2BTU A;  2IAF A;  2RHO A;  4F6R B;  3TD3 A;  4YJ2 A;  4O4H B;  5LP6 C;  1Q82 H;  3B6N A;  5CA0 A;  3OW2 F;  1UFY A;  1YJ9 F;  3P0Z A;  4BVQ A;  1GO1 A;  4ZHY B;  2HP0 A;  2WAL A;  5IJ9 A;  3F0E A;  3NK7 A;  2BTQ B;  4O2B A;  4EB6 A;  3PAF A;  2GZL A;  3HTN A;  2FC3 A;  3WGK A;  1Z5W A;  4I55 A;  4FFB A;  1KQS F;  1JFF A;  3CPQ A;  3HKC A;  4X20 A;  4C8E A;  1H47 A;  1DBF A;  3RYF B;  3RYH B;  5J2U B;  3CCS F;  2RHH A;  4G4V A;  1GZ0 A;  3WJQ A;  4TV8 A;  3I7T A;  5C8Y B;  1YGY A;  4G4Y A;  1W5F A;  4ZHQ A;  2HS0 A;  2FGY A;  3HKD A;  3HKE A;  3IMP A;  4ZOL A;  2RB9 A;  3WJP A;  4RHA A;  5JCO A;  4B46 A;  1OAP A;  4O4J B;  5KMG B;  3C9T A;  2OTJ F;  1W55 A;  4EI8 A;  5CA1 A;  3WGM A;  3LWP C;  2I6D A;  3JAR A;  3EOR A;  2KGW A;  1SDS A;  3IKE A;  3KIZ A;  4EI9 A;  5EIB C;  3OBW A;  2B33 A;  4ZK7 A;  1W41 A;  5KX5 B;  3JAS A;  2BO1 A;  5BMV B;  3CC4 F;  4BY9 D;  2QI2 A;  4XCQ A;  4C8G A;  4ZHV A;  2NMU A;  3CYQ A;  2LBW A;  1QAH A;  1K8A H;  1GO0 A;  4YJ2 B;  1RLU A;  2ZF8 A;  5CA0 B;  3S03 A;  2Z1U A;  3KE1 A;  3ON1 A;  2HP0 B;  5IJ9 B;  3S02 A;  3QTY A;  1K9M H;  1Q8R A;  3Q8H A;  4X1I A;  3KJJ A;  5FNV A;  3V7Q A;  3CCV F;  4EB6 B;  2R75 1;  2ZOV A;  1W2B F;  1SZQ A;  3FFM A;  3LWR C;  3U0O A;  1VH8 A;  2N48 A;  4I55 B;  3DDN A;  3JAK A;  2Q1Y A;  1QVG F;  3E20 B;  4FFB B;  1Q86 H;  1JFF B;  1W5A A;  3HKC B;  4TUY A;  4X20 B;  2Z1F A;  4HNA A;  2HP3 A;  1JJ2 F;  2YYE A;  5EYP A;  3ZOP A;  3LWQ C;  5B8F A;  1VQ5 F;  4TV8 B;  2CHS A;  5LOV B;  4ZHQ B;  3VTI C;  3CB2 A;  3HKD B;  2P6Y A;  3PLA C;  4PWT A;  5FLX M;  1QVF F;  5CA1 B;  1JN1 A;  3JAR B;  4RQO A;  4ZI7 A;  3J81 M;  1FFX A;  5IYZ A;  3FD5 A;  2ZVZ A;  3JAS B;  4BT3 A;  1H48 A;  3NVK E;  1JD1 A;  1VQV A;  3IR9 A;  3WJR A;  5LXT A;  5KX5 A;  1Q81 H;  1COM A;  3IKF A;  1U43 A;  1SA0 A;  2ALE A;  3V7E A;  2PMP A;  1U3L A;  1IV2 A;  3T80 A;  5HY0 A;  2Z01 A;  1NJI H;  5EIB D;  2AMT A;  3VIU A;  4BW0 B; 
#chains in the Genus database with same CATH homology
 2UYJ A;  4ZK7 A;  4NWO B;  1PF5 A;  1UFY A;  1X25 A;  3I7T A;  2EWC A;  2CHT A;  5HP7 A;  3K12 A;  3L7Q A;  2CSL A;  2UYN A;  3V4D A;  3K0T A;  2CW4 A;  2CWJ A;  1J7H A;  1QAH A;  3VCZ A;  1XHO A;  2DYY A;  5HP8 A;  2UYK A;  3D01 A;  3ZOP A;  2OTM A;  1FNK A;  3I3F A;  1JD1 A;  2CHS A;  2UYP A;  1FNJ A;  3MQW A;  1UI9 A;  2CVL A;  1ONI A;  2UYN B;  3LYB A;  3M4S A;  3GTZ A;  3ZP4 A;  1QD9 A;  3LME A;  1COM A;  1XRG A;  3ZO8 A;  2IG8 A;  3KJK A;  3R0P A;  3KJJ A;  1QU9 A;  3M1X A;  3QUW A;  1DBF A;  1ODE A;  3ZP7 A;  1NQ3 A;  2B33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...