2CHTA

Crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE
publication title Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2chtA00
3ZO8A 2UYKA 1ODEA 2EWCA 2IG8A 3V4DA 3VCZA 3ZOPA 2CWJA 2CSLA 3M1XA 1XRGA 3ZP4A 2CW4A 3QUWA 1DBFA 3LMEA 2B33A 2UYJA 2CHSA 5HP8A 3R0PA 1X25A 1J7HA 3D01A 1QAHA 2UYNA 3ZP7A 1ONIA 3MQWA 1FNKA 4ZK7A 3I3FA 2CVLA 1UI9A 1QU9A 3L7QA 3KJKA 3K12A 1JD1A 1NQ3A 1FNJA 1COMA 3KJJA 3GTZA 3I7TA 2UYNB 3K0TA 1UFYA 2DYYA 3M4SA 3LYBA 4NWOB 1QD9A 2UYPA 2CHTA 1PF5A 1XHOA 2OTMA 5HP7A
chains in the Genus database with same CATH superfamily
2UYKA 2GLZA 5LOVA 3RA6A 4R40B 1YJWF 2R751 1W5EA 5EZYB 2ZVZA 4DXDA 3S03A 4BT6A 5BMVB 1DBFA 3OONA 3WGKA 4BVRA 3ELCA 5EB1B 5HP8A 4ZHQA 5G4VC 3CCRF 5IJ9A 1Q82H 1VQ7F 5FNVA 1W5BA 1TUBA 4U3JA 1FNKA 2ZAUA 3WJQA 3WPXA 1QU9A 1M90H 3HKCB 4HNAA 3F6MA 1PF5A 3HKEB 5CA1B 3FD5A 2H6LA 4I4TB 3CPWF 5J2UA 3VMFB 2CWJA 3CMAF 3M1XA 5HY1A 3LMEA 4O4JA 4X1KA 2BTUA 4IIJA 2VAMA 3VYTC 4O4HB 1Q81H 1VQMF 1W3EX 1ZWZA 3HTNA 4YJ2A 3JAKA 1KNJA 3HKBB 3S0HA 2UYPA 1X52A 4EI9A 1SDSA 4TUYB 4DRXA 5HP7A 3DC2A 5JQGB 4M8IA 2EWCA 3VOBA 3VI6A 2FC3A 4PWTA 4X20A 5JH7A 1GZ0A 4BT7A 1S72F 4TV8A 4RHAA 4G4XA 3C9SA 5CB4B 1GO1A 4TV9B 3R0PA 1QVFF 3FBAA 4FFBA 3VO8A 4BT3A 1W2BF 5C8YB 1ONIA 3RYIA 3J7AR 3WJPA 5HXZA 1CN7A 3JASB 1VQ4F 5B8FA 5ITZA 1CK2A 3CCLF 1KQSF 3VYSC 1IV2A 3K0TA 3HWUA 4I50A 1CLIA 2HS3A 1IV1A 4BT2A 2LBWA 3ZO8A 5EIBD 3C9UA 2IG8A 5JCOA 4ZHYB 1SZQA 1K9MH 2RHOA 5LOVB 3ESJA 3HKDB 1VH8A 3NVKE 2AMTA 3LFOA 4ZHVA 4ZHQB 2HP0B 3JAMM 2LBTA 3S0YA 1W55A 1X7PA 3KJJA 3V7QA 4U3JB 1VQ5F 3IEWA 3FFMA 5LA6A 2OTMA 1Q7YH 4HNAB 5LYJB 4O4IB 5HWEA 1T0KB 1JJ2F 4C8GA 3CCSF 1JFFB 4BT4A 3N4ZA 3F0FA 3MDOA 4G4VA 5GIOC 2CHSA 2HRYA 3JATA 3CXCF 2Q1XA 3JARB 3K14A 2YXZA 4RQOA 4EI7A 5KMGA 4NUTA 3E22A 3EORA 4IIJB 2ZOVA 3CB2A 3KJKA 3K12A 1VHAA 3RE3A 3LYBA 1W57A 3JAKB 3VOAA 2G9IA 3MCQA 3P10A 1FFXA 3P4EA 2V9YA 1U3PA 2KTVA 4DRXB 3U0OA 2AIFA 4F6RA 3TD5A 4BT5A 5KX5A 3N2GA 1W59A 3S0WA 2LCAA 2UYNA 4I55B 3G71F 4O4LA 3KIZA 1Q8RA 4FFBB 2QA4F 4O2BA 4O2AA 1Z5WA 3I7TA 2Z01A 3PAFA 3NMUC 5ITZB 3CG6A 2OTJF 2AIZP 3QTYA 5J2TA 3E20B 4YJ3A 5GIPC 3RYHA 3VCZA 4LNUA 2DT4A 2RHJA 3WGNA 2L26A 2VGMA 1VQOF 2BO1A 4KWEA 5MN4A 3GYQA 1R1MA 1W5AA 2Z1UA 1YIJF 3LWQC 3ZP7A 2IQQA 3F0DA 3WGJA 3RYFA 1YQNA 1OAPA 3S02A 1FNJA 3CC7F 1YGYA 3JALA 3C9TA 5IYZB 1SA0B 1XHOA 3C8LA 1H48A 1RA4A 2JNBA 1RQ2A 4ZOLB 2CSLA 2IAFA 1XV2A 2VXYA 4IHJB 5EYPA 3SIVA 3PLAC 3UT5B 5GONA 1K73H 5IJ0B 3D01A 3IKFA 4X1IA 5JVDA 5A2QM 4X1YA 4BVSA 5LXTB 3WGMA 3JATB 1H7MA 4ZI7A 3CPQA 3RYCB 1TVKA 2OHWA 3GTZA 4E6EA 1UFYA 1W581 3CC2F 4G88A 5LP6B 4BVQA 1YJ9F 1U3LA 3KE1A 1KNKA 3N2KA 5CA0B 4EB6A 4EI8A 3V4DA 4WBNB 2I6RA 3IKEA 1VQVA 5EB0A 3VIUA 1VQKF 3J80M 5FLXM 3HKCA 3QHDA 4XCQA 3SIUA 5KX5B 1X7OA 3CYQA 1KC8H 3HKEA 5CA1A 3CCUF 4I4TA 1Z5VA 2KG4A 2ZODA 4C8IA 5IJ9B 3LWOC 1COMA 3I56F 5FNVB 3OW2F 1RLGA 1TUBB 4O4LB 3MCAB 5HXUA 3JVHA 2PHNA 1QD9A 2H8EA 4LCKA 2RHHA 1VQNF 3B6NA 3LWRC 3WJRA 1NJIH 3ZP4A 4C82A 4YJ3B 5J2TB 2OTLF 3RYHB 4C4WC 5J2UB 5JCOC 4X3LA 3C9RA 3TD4A 2FGYA 3HKBA 3I3FA 4O4JB 4X1KB 4G4YA 2OZBA 1VQLF 5JQGA 2F9ZC 3DDNA 3F0GA 3AGKA 4YJ2B 2CHTA 4B45A 3WGLA 5CB4A 1W40A 1GX1A 4TV9A 2HRUA 1W41A 4B5CA 3CCEF 2Z1EA 3S06A 2KGWA 3D00A 4X20B 5JH7B 2GVIA 2GZLA 4TV8B 3CMEF 4ZK7A 2HX0A 3CCQF 3NK6A 1JD1A 1VK3A 5IT9M 3FPIA 3Q8HA 5EWRA 3JAWA 2HVYD 3RYIB 5LP6C 1H47A 2VAPA 3CCVF 2HS0A 1U40A 4B62A 5MN5A 1YI2F 1W5FA 3P0ZA 5FJ4C 4I50B 3HKDA 4ERHA 3V7EA 2CW4A 3N2KB 4U39A 3IMPA 4EB6B 2HP0A 3M84A 1FSZA 3L7QA 5LYJA 1JN1A 4O4IA 3VYUC 4NWOB 3OBWA 1JFFA 5GINC 2Z1FA 2BTQB 2RHLA 1M1KH 3ZOPA 5HY4A 2RB9A 3JARA 3I55F 3LWPC 2PMPA 3N4YA 5LA6B 3CC4F 1JY8A 5EAZA 3CCJF 1X25A 5MN6A 3WPWA 1DT9A 2N48A 2K1SA 3J81M 1E7KA 1NQ3A 5KMGB 5G4UC 3F0EA 3WXMB 2QI2A 1T0AA 1VQPF 3FD6A 3E22B 5EZYA 5AVMA 3HAXD 3RA5A 5GANK 1YHQF 5BMVA 3T80A 3NVIB 2HP3A 2UZHA 1GO0A 2NMUA 1XRGA 2Q1YA 2MQEA 4I55A 3MBMA 4NQ3A 1Q86H 2HQSC 1FFXB 3CCMF 2HS4A 5EO3A 1N8RH 4C8EA 3LWVC 1QAHA 3MQWA 4F6RB 1PXWA 2LBXA 3NK7A 3N2GB 5DCVA 2CVLA 5HY0A 1YJNF 1VQ9F 4B46A 2I6DA 2UYNB 2YYEA 3BYQA 3M4SA 1K8AH 3ON1A 2ALEA 3LDTA 1U43A 4O2BB 3JAWB 5HY2A 4O2AB 4BVTA 1NMUB 1ODEA 1IV4A 2CZWA 1KD1H 2P6YA 3O85A 3QUWA 1QVGF 4O4HA 2UYJA 1OFUA 1VQ8F 1IPAA 2VGNA 4LNUB 4G4WA 4X3MA 4BY9D 5IYZA 1SA0A 1UI9A 1IV3A 4TUYA 2ZF8A 2DYYA 4ZOLA 4TZZA 2H8CA 2QEXF 3RYFB 3CYPB 1XBIA 1YITF 3IR9A 3TD3A 4IHJA 5GAPK 2W8BC 3JALB 1RLUA 3UT5A 2BTOA 5IJ0A 2Z1TA 5LXTA 3IEQA 3KHNA 3CD6F 4C81A 3VTIC 5C8YA 2B33A 4G4ZA 3G4SF 1W42A 3JASA 3RYCA 1J7HA 3V3TA 3G6EF 2WALA 5LP6A 3JCMM 2VAWA 1VQ6F 5EIBC 5EYPB 3GHZA 5GONB 2R6R1 3ERNA 5CA0A 3D54A 2KTUA 4X1IB 3E1YA 5JVDB 4X1YB 4WBNA 3OBYA 4BW0B 2ZVYA 3HJWC 2QTPA 4ZI7B 4ZHWA 3K2XA 1RQ7A 1TVKB
chains in the Genus database with same CATH topology
3ZO8A 2UYKA 1ODEA 2EWCA 2IG8A 3V4DA 3VCZA 3ZOPA 2CWJA 2CSLA 3M1XA 1XRGA 3ZP4A 2CW4A 3QUWA 1DBFA 3LMEA 2B33A 2UYJA 2CHSA 5HP8A 3R0PA 1X25A 1J7HA 3D01A 1QAHA 2UYNA 3ZP7A 1ONIA 3MQWA 1FNKA 4ZK7A 3I3FA 2CVLA 1UI9A 1QU9A 3L7QA 3KJKA 3K12A 1JD1A 1NQ3A 1FNJA 1COMA 3KJJA 3GTZA 3I7TA 2UYNB 3K0TA 1UFYA 2DYYA 3M4SA 3LYBA 4NWOB 1QD9A 2UYPA 2CHTA 1PF5A 1XHOA 2OTMA 5HP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZO8 A;  2UYK A;  1ODE A;  2EWC A;  2IG8 A;  3V4D A;  3VCZ A;  3ZOP A;  2CWJ A;  2CSL A;  3M1X A;  1XRG A;  3ZP4 A;  2CW4 A;  3QUW A;  1DBF A;  3LME A;  2B33 A;  2UYJ A;  2CHS A;  5HP8 A;  3R0P A;  1X25 A;  1J7H A;  3D01 A;  1QAH A;  2UYN A;  3ZP7 A;  1ONI A;  3MQW A;  1FNK A;  4ZK7 A;  3I3F A;  2CVL A;  1UI9 A;  1QU9 A;  3L7Q A;  3KJK A;  3K12 A;  1JD1 A;  1NQ3 A;  1FNJ A;  1COM A;  3KJJ A;  3GTZ A;  3I7T A;  2UYN B;  3K0T A;  1UFY A;  2DYY A;  3M4S A;  3LYB A;  4NWO B;  1QD9 A;  2UYP A;  2CHT A;  1PF5 A;  1XHO A;  2OTM A;  5HP7 A; 
#chains in the Genus database with same CATH topology
 2UYK A;  2GLZ A;  5LOV A;  3RA6 A;  4R40 B;  1YJW F;  2R75 1;  1W5E A;  5EZY B;  2ZVZ A;  4DXD A;  3S03 A;  4BT6 A;  5BMV B;  1DBF A;  3OON A;  3WGK A;  4BVR A;  3ELC A;  5EB1 B;  5HP8 A;  4ZHQ A;  5G4V C;  3CCR F;  5IJ9 A;  1Q82 H;  1VQ7 F;  5FNV A;  1W5B A;  1TUB A;  4U3J A;  1FNK A;  2ZAU A;  3WJQ A;  3WPX A;  1QU9 A;  1M90 H;  3HKC B;  4HNA A;  3F6M A;  1PF5 A;  3HKE B;  5CA1 B;  3FD5 A;  2H6L A;  4I4T B;  3CPW F;  5J2U A;  3VMF B;  2CWJ A;  3CMA F;  3M1X A;  5HY1 A;  3LME A;  4O4J A;  4X1K A;  2BTU A;  4IIJ A;  2VAM A;  3VYT C;  4O4H B;  1Q81 H;  1VQM F;  1W3E X;  1ZWZ A;  3HTN A;  4YJ2 A;  3JAK A;  1KNJ A;  3HKB B;  3S0H A;  2UYP A;  1X52 A;  4EI9 A;  1SDS A;  4TUY B;  4DRX A;  5HP7 A;  3DC2 A;  5JQG B;  4M8I A;  2EWC A;  3VOB A;  3VI6 A;  2FC3 A;  4PWT A;  4X20 A;  5JH7 A;  1GZ0 A;  4BT7 A;  1S72 F;  4TV8 A;  4RHA A;  4G4X A;  3C9S A;  5CB4 B;  1GO1 A;  4TV9 B;  3R0P A;  1QVF F;  3FBA A;  4FFB A;  3VO8 A;  4BT3 A;  1W2B F;  5C8Y B;  1ONI A;  3RYI A;  3J7A R;  3WJP A;  5HXZ A;  1CN7 A;  3JAS B;  1VQ4 F;  5B8F A;  5ITZ A;  1CK2 A;  3CCL F;  1KQS F;  3VYS C;  1IV2 A;  3K0T A;  3HWU A;  4I50 A;  1CLI A;  2HS3 A;  1IV1 A;  4BT2 A;  2LBW A;  3ZO8 A;  5EIB D;  3C9U A;  2IG8 A;  5JCO A;  4ZHY B;  1SZQ A;  1K9M H;  2RHO A;  5LOV B;  3ESJ A;  3HKD B;  1VH8 A;  3NVK E;  2AMT A;  3LFO A;  4ZHV A;  4ZHQ B;  2HP0 B;  3JAM M;  2LBT A;  3S0Y A;  1W55 A;  1X7P A;  3KJJ A;  3V7Q A;  4U3J B;  1VQ5 F;  3IEW A;  3FFM A;  5LA6 A;  2OTM A;  1Q7Y H;  4HNA B;  5LYJ B;  4O4I B;  5HWE A;  1T0K B;  1JJ2 F;  4C8G A;  3CCS F;  1JFF B;  4BT4 A;  3N4Z A;  3F0F A;  3MDO A;  4G4V A;  5GIO C;  2CHS A;  2HRY A;  3JAT A;  3CXC F;  2Q1X A;  3JAR B;  3K14 A;  2YXZ A;  4RQO A;  4EI7 A;  5KMG A;  4NUT A;  3E22 A;  3EOR A;  4IIJ B;  2ZOV A;  3CB2 A;  3KJK A;  3K12 A;  1VHA A;  3RE3 A;  3LYB A;  1W57 A;  3JAK B;  3VOA A;  2G9I A;  3MCQ A;  3P10 A;  1FFX A;  3P4E A;  2V9Y A;  1U3P A;  2KTV A;  4DRX B;  3U0O A;  2AIF A;  4F6R A;  3TD5 A;  4BT5 A;  5KX5 A;  3N2G A;  1W59 A;  3S0W A;  2LCA A;  2UYN A;  4I55 B;  3G71 F;  4O4L A;  3KIZ A;  1Q8R A;  4FFB B;  2QA4 F;  4O2B A;  4O2A A;  1Z5W A;  3I7T A;  2Z01 A;  3PAF A;  3NMU C;  5ITZ B;  3CG6 A;  2OTJ F;  2AIZ P;  3QTY A;  5J2T A;  3E20 B;  4YJ3 A;  5GIP C;  3RYH A;  3VCZ A;  4LNU A;  2DT4 A;  2RHJ A;  3WGN A;  2L26 A;  2VGM A;  1VQO F;  2BO1 A;  4KWE A;  5MN4 A;  3GYQ A;  1R1M A;  1W5A A;  2Z1U A;  1YIJ F;  3LWQ C;  3ZP7 A;  2IQQ A;  3F0D A;  3WGJ A;  3RYF A;  1YQN A;  1OAP A;  3S02 A;  1FNJ A;  3CC7 F;  1YGY A;  3JAL A;  3C9T A;  5IYZ B;  1SA0 B;  1XHO A;  3C8L A;  1H48 A;  1RA4 A;  2JNB A;  1RQ2 A;  4ZOL B;  2CSL A;  2IAF A;  1XV2 A;  2VXY A;  4IHJ B;  5EYP A;  3SIV A;  3PLA C;  3UT5 B;  5GON A;  1K73 H;  5IJ0 B;  3D01 A;  3IKF A;  4X1I A;  5JVD A;  5A2Q M;  4X1Y A;  4BVS A;  5LXT B;  3WGM A;  3JAT B;  1H7M A;  4ZI7 A;  3CPQ A;  3RYC B;  1TVK A;  2OHW A;  3GTZ A;  4E6E A;  1UFY A;  1W58 1;  3CC2 F;  4G88 A;  5LP6 B;  4BVQ A;  1YJ9 F;  1U3L A;  3KE1 A;  1KNK A;  3N2K A;  5CA0 B;  4EB6 A;  4EI8 A;  3V4D A;  4WBN B;  2I6R A;  3IKE A;  1VQV A;  5EB0 A;  3VIU A;  1VQK F;  3J80 M;  5FLX M;  3HKC A;  3QHD A;  4XCQ A;  3SIU A;  5KX5 B;  1X7O A;  3CYQ A;  1KC8 H;  3HKE A;  5CA1 A;  3CCU F;  4I4T A;  1Z5V A;  2KG4 A;  2ZOD A;  4C8I A;  5IJ9 B;  3LWO C;  1COM A;  3I56 F;  5FNV B;  3OW2 F;  1RLG A;  1TUB B;  4O4L B;  3MCA B;  5HXU A;  3JVH A;  2PHN A;  1QD9 A;  2H8E A;  4LCK A;  2RHH A;  1VQN F;  3B6N A;  3LWR C;  3WJR A;  1NJI H;  3ZP4 A;  4C82 A;  4YJ3 B;  5J2T B;  2OTL F;  3RYH B;  4C4W C;  5J2U B;  5JCO C;  4X3L A;  3C9R A;  3TD4 A;  2FGY A;  3HKB A;  3I3F A;  4O4J B;  4X1K B;  4G4Y A;  2OZB A;  1VQL F;  5JQG A;  2F9Z C;  3DDN A;  3F0G A;  3AGK A;  4YJ2 B;  2CHT A;  4B45 A;  3WGL A;  5CB4 A;  1W40 A;  1GX1 A;  4TV9 A;  2HRU A;  1W41 A;  4B5C A;  3CCE F;  2Z1E A;  3S06 A;  2KGW A;  3D00 A;  4X20 B;  5JH7 B;  2GVI A;  2GZL A;  4TV8 B;  3CME F;  4ZK7 A;  2HX0 A;  3CCQ F;  3NK6 A;  1JD1 A;  1VK3 A;  5IT9 M;  3FPI A;  3Q8H A;  5EWR A;  3JAW A;  2HVY D;  3RYI B;  5LP6 C;  1H47 A;  2VAP A;  3CCV F;  2HS0 A;  1U40 A;  4B62 A;  5MN5 A;  1YI2 F;  1W5F A;  3P0Z A;  5FJ4 C;  4I50 B;  3HKD A;  4ERH A;  3V7E A;  2CW4 A;  3N2K B;  4U39 A;  3IMP A;  4EB6 B;  2HP0 A;  3M84 A;  1FSZ A;  3L7Q A;  5LYJ A;  1JN1 A;  4O4I A;  3VYU C;  4NWO B;  3OBW A;  1JFF A;  5GIN C;  2Z1F A;  2BTQ B;  2RHL A;  1M1K H;  3ZOP A;  5HY4 A;  2RB9 A;  3JAR A;  3I55 F;  3LWP C;  2PMP A;  3N4Y A;  5LA6 B;  3CC4 F;  1JY8 A;  5EAZ A;  3CCJ F;  1X25 A;  5MN6 A;  3WPW A;  1DT9 A;  2N48 A;  2K1S A;  3J81 M;  1E7K A;  1NQ3 A;  5KMG B;  5G4U C;  3F0E A;  3WXM B;  2QI2 A;  1T0A A;  1VQP F;  3FD6 A;  3E22 B;  5EZY A;  5AVM A;  3HAX D;  3RA5 A;  5GAN K;  1YHQ F;  5BMV A;  3T80 A;  3NVI B;  2HP3 A;  2UZH A;  1GO0 A;  2NMU A;  1XRG A;  2Q1Y A;  2MQE A;  4I55 A;  3MBM A;  4NQ3 A;  1Q86 H;  2HQS C;  1FFX B;  3CCM F;  2HS4 A;  5EO3 A;  1N8R H;  4C8E A;  3LWV C;  1QAH A;  3MQW A;  4F6R B;  1PXW A;  2LBX A;  3NK7 A;  3N2G B;  5DCV A;  2CVL A;  5HY0 A;  1YJN F;  1VQ9 F;  4B46 A;  2I6D A;  2UYN B;  2YYE A;  3BYQ A;  3M4S A;  1K8A H;  3ON1 A;  2ALE A;  3LDT A;  1U43 A;  4O2B B;  3JAW B;  5HY2 A;  4O2A B;  4BVT A;  1NMU B;  1ODE A;  1IV4 A;  2CZW A;  1KD1 H;  2P6Y A;  3O85 A;  3QUW A;  1QVG F;  4O4H A;  2UYJ A;  1OFU A;  1VQ8 F;  1IPA A;  2VGN A;  4LNU B;  4G4W A;  4X3M A;  4BY9 D;  5IYZ A;  1SA0 A;  1UI9 A;  1IV3 A;  4TUY A;  2ZF8 A;  2DYY A;  4ZOL A;  4TZZ A;  2H8C A;  2QEX F;  3RYF B;  3CYP B;  1XBI A;  1YIT F;  3IR9 A;  3TD3 A;  4IHJ A;  5GAP K;  2W8B C;  3JAL B;  1RLU A;  3UT5 A;  2BTO A;  5IJ0 A;  2Z1T A;  5LXT A;  3IEQ A;  3KHN A;  3CD6 F;  4C81 A;  3VTI C;  5C8Y A;  2B33 A;  4G4Z A;  3G4S F;  1W42 A;  3JAS A;  3RYC A;  1J7H A;  3V3T A;  3G6E F;  2WAL A;  5LP6 A;  3JCM M;  2VAW A;  1VQ6 F;  5EIB C;  5EYP B;  3GHZ A;  5GON B;  2R6R 1;  3ERN A;  5CA0 A;  3D54 A;  2KTU A;  4X1I B;  3E1Y A;  5JVD B;  4X1Y B;  4WBN A;  3OBY A;  4BW0 B;  2ZVY A;  3HJW C;  2QTP A;  4ZI7 B;  4ZHW A;  3K2X A;  1RQ7 A;  1TVK B; 
#chains in the Genus database with same CATH homology
 3ZO8 A;  2UYK A;  1ODE A;  2EWC A;  2IG8 A;  3V4D A;  3VCZ A;  3ZOP A;  2CWJ A;  2CSL A;  3M1X A;  1XRG A;  3ZP4 A;  2CW4 A;  3QUW A;  1DBF A;  3LME A;  2B33 A;  2UYJ A;  2CHS A;  5HP8 A;  3R0P A;  1X25 A;  1J7H A;  3D01 A;  1QAH A;  2UYN A;  3ZP7 A;  1ONI A;  3MQW A;  1FNK A;  4ZK7 A;  3I3F A;  2CVL A;  1UI9 A;  1QU9 A;  3L7Q A;  3KJK A;  3K12 A;  1JD1 A;  1NQ3 A;  1FNJ A;  1COM A;  3KJJ A;  3GTZ A;  3I7T A;  2UYN B;  3K0T A;  1UFY A;  2DYY A;  3M4S A;  3LYB A;  4NWO B;  1QD9 A;  2UYP A;  2CHT A;  1PF5 A;  1XHO A;  2OTM A;  5HP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...