2CHTA

Crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE
publication title Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2chtA00
1J7HA 2CVLA 2CWJA 2IG8A 1QD9A 2CHSA 3I7TA 1QAHA 2UYKA 1NQ3A 3KJKA 3V4DA 1QU9A 2B33A 3QUWA 3ZO8A 2CSLA 1JD1A 1FNJA 3I3FA 3ZOPA 1ONIA 3MQWA 5HP8A 2CHTA 1X25A 2DYYA 4NWOB 1UI9A 5HP7A 3ZP4A 2EWCA 4ZK7A 2UYJA 2UYPA 3K0TA 1XRGA 3KJJA 1ODEA 1UFYA 2UYNA 3L7QA 3LMEA 3ZP7A 1FNKA 1COMA 3M1XA 1DBFA 3GTZA 3D01A 3M4SA 1PF5A 2CW4A 2UYNB 3K12A 3R0PA 3VCZA 1XHOA 2OTMA 3LYBA
chains in the Genus database with same CATH superfamily
3WGJA 2ZOVA 1TVKB 1VQ9F 1VQNF 1IPAA 4BT3A 4O4HB 5J2UA 3FBAA 3ON1A 3QUWA 2YXZA 3WPWA 3J81M 5EYPB 4DXDA 1U40A 1Q8RA 4WBNB 1JY8A 3SIVA 4YJ2B 1DT9A 5IT9M 5G4VC 5FJ4C 1IV3A 4ERHA 5EAZA 1U3LA 1IV4A 2HRYA 3F0EA 3VO8A 4EI8A 4TV8A 4X20B 4ZOLB 4ZHQA 1YJWF 5EB0A 3MCQA 1R1MA 3JARB 3P10A 5J2TA 4ZHVA 1W55A 5HWEA 4RHAA 5FLXM 1QVFF 3HKDA 1KD1H 2HS0A 3MCAB 4U3JA 4X3LA 1H7MA 3WGNA 2ZF8A 5JVDA 1K8AH 3NVIB 1COMA 1W41A 5JCOA 3JATB 5FNVB 2CZWA 5GONA 4X3MA 3M84A 2HQSC 5JCOC 3SIUA 2KG4A 1RLGA 2G9IA 3S0WA 5CA1A 1JN1A 1W57A 3IKFA 1VH8A 3CYQA 1ZWZA 4IIJA 2YYEA 3RYFA 3ZP4A 3JAWA 3PAFA 3CC2F 3E1YA 3BYQA 2UYPA 3CPWF 1XRGA 1VQ6F 1E7KA 1YI2F 4XCQA 2IQQA 5EIBC 2OZBA 2IG8A 1RLUA 4O2BA 4O4JB 4TV9A 5C8YB 5CA0B 5EZYA 1SA0B 3WJRA 3RYIB 4YJ3B 1KQSF 4X1KA 5EO3A 5EWRA 3I56F 3VTIC 4G4YA 2HP0B 1W5BA 2LBXA 3N2GB 3DDNA 1H47A 1W581 1VHAA 2FC3A 3M1XA 1SZQA 4G4WA 2CW4A 3RYHA 1XHOA 4EI9A 2OTJF 3J80M 4EB6A 5HY2A 3K2XA 2RHLA 4BW0B 3VOBA 1Z5WA 2DT4A 5JQGA 4LNUB 3CCUF 1TUBA 2CSLA 5MN4A 1M90H 2Z01A 1X7OA 4I50B 5ITZA 3D54A 2ALEA 1UI9A 5JH7B 5MN6A 3CCEF 3CCMF 3NK7A 2EWCA 3JASA 3CCVF 1GO0A 2MQEA 4X1YB 3WXMB 4U39A 3R0PA 3M4SA 1PF5A 1W42A 2AMTA 5GIOC 3CXCF 3QTYA 2JNBA 5KMGB 5LOVA 1JJ2F 3WJPA 4PWTA 2BTUA 2GVIA 4F6RA 5KX5A 5GIPC 4C8IA 4M8IA 3KJKA 3P4EA 2Z1TA 4ZI7A 1YJNF 5J2UB 3I3FA 2R751 5LYJB 4LCKA 1H48A 4HNAA 3HKEB 2KTVA 3VOAA 3OBYA 5G4UC 3TD3A 3LFOA 2LBTA 1U43A 2P6YA 3B6NA 4ZK7A 1VQVA 2FGYA 3RA6A 5GINC 3J7AR 1QVGF 2UYNA 4R40B 4BVQA 1NJIH 3JAKA 3HKCA 3VCZA 3VYSC 4O4HA 3U0OA 2VAPA 2H8CA 3IEWA 2RHHA 4EI7A 3T80A 3MBMA 4NUTA 4TV8B 3V4DA 5LXTA 1QU9A 2B33A 3V7EA 2R6R1 4ZHQB 2F9ZC 1Q7YH 1FNJA 2BTQB 3HTNA 2ZAUA 3LWRC 1VQOF 3PLAC 5J2TB 3HKDB 1VQKF 1W59A 3CPQA 4U3JB 1M1KH 3G4SF 2IAFA 3C8LA 3VIUA 4BVTA 3RYCA 2W8BC 3JVHA 5JVDB 3K12A 5LP6A 1Q81H 4IHJA 3MDOA 3VYUC 2HX0A 5IJ9A 1YGYA 4ZOLA 2CWJA 5LP6C 3WGLA 1OAPA 5GONB 1VQMF 3N2KA 3S03A 2AIZP 3F0FA 4I4TA 3I55F 3FD6A 5CA1B 3Q8HA 1RQ2A 2ZVZA 3ZOPA 3CCRF 5CB4A 1W3EX 3KHNA 2PMPA 2I6RA 4IIJB 5BMVA 1YIJF 3E22A 3RYFB 3JAWB 2GZLA 4C8EA 3CMAF 4B45A 1RA4A 1RQ7A 2UZHA 2HVYD 2CVLA 2V9YA 1CLIA 3OBWA 4BT5A 5IYZA 4O2BB 4BT6A 3F0DA 4TV9B 1VQ7F 5HY0A 3HWUA 5EZYB 1JFFA 2LBWA 4DRXA 2HP3A 2VAWA 3E20B 2VAMA 1ONIA 3WJQA 1FFXB 3LWOC 1VQ5F 1W2BF 4X1KB 4TZZA 5GAPK 5LA6A 2KTUA 2GLZA 1YITF 3V3TA 1UFYA 3L7QA 4ZHWA 1FNKA 3HKBA 3KE1A 3QHDA 3VYTC 1T0KB 3RYHB 4EB6B 5MN5A 4BT7A 2CHSA 4X1IB 3CCQF 2UYKA 4B46A 1NQ3A 4C4WC 3JALA 4FFBA 5JQGB 3F6MA 4O4LA 3F0GA 1TUBB 2AIFA 3MQWA 3JCMM 1KNJA 2N48A 1PXWA 5ITZB 1X7PA 3CCJF 2Q1YA 2Z1EA 5DCVA 1NMUB 3ZP7A 5AVMA 3HJWC 3JASB 3FFMA 3UT5A 5IJ0A 3TD4A 3C9RA 2H6LA 4B62A 3LDTA 4I55B 1QD9A 4F6RB 2KGWA 4BVRA 5KX5B 1CN7A 1OFUA 4ZI7B 4C8GA 1VQLF 3S0HA 2VXYA 4O4IA 3IKEA 4O2AA 4ZHYB 5HP7A 4BT2A 3CCLF 3FD5A 4X1YA 3S0YA 3K0TA 3CC7F 2ZVYA 1IV1A 3WGKA 3WPXA 5B8FA 2BTOA 4TUYA 2UYNB 3CC4F 1TVKA 3EORA 3K14A 3JAKB 3HKCB 3CMEF 1YJ9F 5HXUA 3G71F 3WGMA 2VGNA 5LYJA 3CCSF 3HKEA 5EYPA 3V7QA 5LXTB 3JAMM 4WBNA 1W5EA 4G88A 3VMFB 4YJ2A 4RQOA 4KWEA 2UYJA 3N4ZA 1ODEA 3RA5A 3RYCB 5HXZA 3G6EF 4NQ3A 5EB1B 2OTMA 5LP6B 3CG6A 1W5FA 4G4VA 4IHJB 4X20A 5IJ9B 1T0AA 2H8EA 2WALA 3NMUC 1GO1A 2OHWA 1Z5VA 3I7TA 3JARA 1W5AA 1U3PA 2HS4A 1K9MH 3CD6F 4G4ZA 2NMUA 3AGKA 3N2KB 4I4TB 3TD5A 1N8RH 3NVKE 2CHTA 1X25A 2DYYA 5CB4B 2LCAA 3N4YA 5BMVB 2QEXF 3LWPC 2I6DA 3CYPB 2QTPA 4BT4A 1VK3A 3E22B 3LMEA 2Z1FA 1Q82H 3ESJA 3IMPA 1DBFA 3JATA 3D01A 3O85A 5FNVA 5GANK 1K73H 1GZ0A 1J7HA 3KIZA 2ZODA 5HY1A 3D00A 1SDSA 5EIBD 5IYZB 3DC2A 1JD1A 3GYQA 3LWVC 1JFFB 4DRXB 3C9TA 1VQ4F 1YQNA 4NWOB 2HRUA 2RHOA 3HAXD 4B5CA 5A2QM 5LA6B 3LWQC 3IR9A 2RB9A 3C9SA 3HKBB 1X52A 1KC8H 3LYBA 4O4JA 2QI2A 5C8YA 5CA0A 4C81A 1SA0A 1QAHA 3RYIA 2Z1UA 2QA4F 4YJ3A 4G4XA 1FFXA 3JALB 3CB2A 4FFBB 2K1SA 4O4LB 3ELCA 2HP0A 3VI6A 4C82A 3RE3A 3N2GA 1KNKA 1IV2A 2RHJA 3GTZA 1Q86H 1CK2A 4BY9D 3UT5B 3S02A 2OTLF 5IJ0B 3GHZA 2VGMA 3ERNA 4X1IA 1S72F 4E6EA 2BO1A 1XBIA 4LNUA 3FPIA 3P0ZA 5LOVB 3C9UA 3ZO8A 4BVSA 3OW2F 5HY4A 1VQPF 3NK6A 3IEQA 1FSZA 2HS3A 4I50A 5JH7A 2Q1XA 1W40A 5HP8A 1XV2A 2PHNA 4O2AB 4O4IB 4HNAB 3S06A 1VQ8F 2L26A 3OONA 3KJJA 1YHQF 4I55A 5KMGA 4TUYB 1GX1A
chains in the Genus database with same CATH topology
1J7HA 2CVLA 2CWJA 2IG8A 1QD9A 2CHSA 3I7TA 1QAHA 2UYKA 1NQ3A 3KJKA 3V4DA 1QU9A 2B33A 3QUWA 3ZO8A 2CSLA 1JD1A 1FNJA 3I3FA 3ZOPA 1ONIA 3MQWA 5HP8A 2CHTA 1X25A 2DYYA 4NWOB 1UI9A 5HP7A 3ZP4A 2EWCA 4ZK7A 2UYJA 2UYPA 3K0TA 1XRGA 3KJJA 1ODEA 1UFYA 2UYNA 3L7QA 3LMEA 3ZP7A 1FNKA 1COMA 3M1XA 1DBFA 3GTZA 3D01A 3M4SA 1PF5A 2CW4A 2UYNB 3K12A 3R0PA 3VCZA 1XHOA 2OTMA 3LYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7H A;  2CVL A;  2CWJ A;  2IG8 A;  1QD9 A;  2CHS A;  3I7T A;  1QAH A;  2UYK A;  1NQ3 A;  3KJK A;  3V4D A;  1QU9 A;  2B33 A;  3QUW A;  3ZO8 A;  2CSL A;  1JD1 A;  1FNJ A;  3I3F A;  3ZOP A;  1ONI A;  3MQW A;  5HP8 A;  2CHT A;  1X25 A;  2DYY A;  4NWO B;  1UI9 A;  5HP7 A;  3ZP4 A;  2EWC A;  4ZK7 A;  2UYJ A;  2UYP A;  3K0T A;  1XRG A;  3KJJ A;  1ODE A;  1UFY A;  2UYN A;  3L7Q A;  3LME A;  3ZP7 A;  1FNK A;  1COM A;  3M1X A;  1DBF A;  3GTZ A;  3D01 A;  3M4S A;  1PF5 A;  2CW4 A;  2UYN B;  3K12 A;  3R0P A;  3VCZ A;  1XHO A;  2OTM A;  3LYB A; 
#chains in the Genus database with same CATH topology
 3WGJ A;  2ZOV A;  1TVK B;  1VQ9 F;  1VQN F;  1IPA A;  4BT3 A;  4O4H B;  5J2U A;  3FBA A;  3ON1 A;  3QUW A;  2YXZ A;  3WPW A;  3J81 M;  5EYP B;  4DXD A;  1U40 A;  1Q8R A;  4WBN B;  1JY8 A;  3SIV A;  4YJ2 B;  1DT9 A;  5IT9 M;  5G4V C;  5FJ4 C;  1IV3 A;  4ERH A;  5EAZ A;  1U3L A;  1IV4 A;  2HRY A;  3F0E A;  3VO8 A;  4EI8 A;  4TV8 A;  4X20 B;  4ZOL B;  4ZHQ A;  1YJW F;  5EB0 A;  3MCQ A;  1R1M A;  3JAR B;  3P10 A;  5J2T A;  4ZHV A;  1W55 A;  5HWE A;  4RHA A;  5FLX M;  1QVF F;  3HKD A;  1KD1 H;  2HS0 A;  3MCA B;  4U3J A;  4X3L A;  1H7M A;  3WGN A;  2ZF8 A;  5JVD A;  1K8A H;  3NVI B;  1COM A;  1W41 A;  5JCO A;  3JAT B;  5FNV B;  2CZW A;  5GON A;  4X3M A;  3M84 A;  2HQS C;  5JCO C;  3SIU A;  2KG4 A;  1RLG A;  2G9I A;  3S0W A;  5CA1 A;  1JN1 A;  1W57 A;  3IKF A;  1VH8 A;  3CYQ A;  1ZWZ A;  4IIJ A;  2YYE A;  3RYF A;  3ZP4 A;  3JAW A;  3PAF A;  3CC2 F;  3E1Y A;  3BYQ A;  2UYP A;  3CPW F;  1XRG A;  1VQ6 F;  1E7K A;  1YI2 F;  4XCQ A;  2IQQ A;  5EIB C;  2OZB A;  2IG8 A;  1RLU A;  4O2B A;  4O4J B;  4TV9 A;  5C8Y B;  5CA0 B;  5EZY A;  1SA0 B;  3WJR A;  3RYI B;  4YJ3 B;  1KQS F;  4X1K A;  5EO3 A;  5EWR A;  3I56 F;  3VTI C;  4G4Y A;  2HP0 B;  1W5B A;  2LBX A;  3N2G B;  3DDN A;  1H47 A;  1W58 1;  1VHA A;  2FC3 A;  3M1X A;  1SZQ A;  4G4W A;  2CW4 A;  3RYH A;  1XHO A;  4EI9 A;  2OTJ F;  3J80 M;  4EB6 A;  5HY2 A;  3K2X A;  2RHL A;  4BW0 B;  3VOB A;  1Z5W A;  2DT4 A;  5JQG A;  4LNU B;  3CCU F;  1TUB A;  2CSL A;  5MN4 A;  1M90 H;  2Z01 A;  1X7O A;  4I50 B;  5ITZ A;  3D54 A;  2ALE A;  1UI9 A;  5JH7 B;  5MN6 A;  3CCE F;  3CCM F;  3NK7 A;  2EWC A;  3JAS A;  3CCV F;  1GO0 A;  2MQE A;  4X1Y B;  3WXM B;  4U39 A;  3R0P A;  3M4S A;  1PF5 A;  1W42 A;  2AMT A;  5GIO C;  3CXC F;  3QTY A;  2JNB A;  5KMG B;  5LOV A;  1JJ2 F;  3WJP A;  4PWT A;  2BTU A;  2GVI A;  4F6R A;  5KX5 A;  5GIP C;  4C8I A;  4M8I A;  3KJK A;  3P4E A;  2Z1T A;  4ZI7 A;  1YJN F;  5J2U B;  3I3F A;  2R75 1;  5LYJ B;  4LCK A;  1H48 A;  4HNA A;  3HKE B;  2KTV A;  3VOA A;  3OBY A;  5G4U C;  3TD3 A;  3LFO A;  2LBT A;  1U43 A;  2P6Y A;  3B6N A;  4ZK7 A;  1VQV A;  2FGY A;  3RA6 A;  5GIN C;  3J7A R;  1QVG F;  2UYN A;  4R40 B;  4BVQ A;  1NJI H;  3JAK A;  3HKC A;  3VCZ A;  3VYS C;  4O4H A;  3U0O A;  2VAP A;  2H8C A;  3IEW A;  2RHH A;  4EI7 A;  3T80 A;  3MBM A;  4NUT A;  4TV8 B;  3V4D A;  5LXT A;  1QU9 A;  2B33 A;  3V7E A;  2R6R 1;  4ZHQ B;  2F9Z C;  1Q7Y H;  1FNJ A;  2BTQ B;  3HTN A;  2ZAU A;  3LWR C;  1VQO F;  3PLA C;  5J2T B;  3HKD B;  1VQK F;  1W59 A;  3CPQ A;  4U3J B;  1M1K H;  3G4S F;  2IAF A;  3C8L A;  3VIU A;  4BVT A;  3RYC A;  2W8B C;  3JVH A;  5JVD B;  3K12 A;  5LP6 A;  1Q81 H;  4IHJ A;  3MDO A;  3VYU C;  2HX0 A;  5IJ9 A;  1YGY A;  4ZOL A;  2CWJ A;  5LP6 C;  3WGL A;  1OAP A;  5GON B;  1VQM F;  3N2K A;  3S03 A;  2AIZ P;  3F0F A;  4I4T A;  3I55 F;  3FD6 A;  5CA1 B;  3Q8H A;  1RQ2 A;  2ZVZ A;  3ZOP A;  3CCR F;  5CB4 A;  1W3E X;  3KHN A;  2PMP A;  2I6R A;  4IIJ B;  5BMV A;  1YIJ F;  3E22 A;  3RYF B;  3JAW B;  2GZL A;  4C8E A;  3CMA F;  4B45 A;  1RA4 A;  1RQ7 A;  2UZH A;  2HVY D;  2CVL A;  2V9Y A;  1CLI A;  3OBW A;  4BT5 A;  5IYZ A;  4O2B B;  4BT6 A;  3F0D A;  4TV9 B;  1VQ7 F;  5HY0 A;  3HWU A;  5EZY B;  1JFF A;  2LBW A;  4DRX A;  2HP3 A;  2VAW A;  3E20 B;  2VAM A;  1ONI A;  3WJQ A;  1FFX B;  3LWO C;  1VQ5 F;  1W2B F;  4X1K B;  4TZZ A;  5GAP K;  5LA6 A;  2KTU A;  2GLZ A;  1YIT F;  3V3T A;  1UFY A;  3L7Q A;  4ZHW A;  1FNK A;  3HKB A;  3KE1 A;  3QHD A;  3VYT C;  1T0K B;  3RYH B;  4EB6 B;  5MN5 A;  4BT7 A;  2CHS A;  4X1I B;  3CCQ F;  2UYK A;  4B46 A;  1NQ3 A;  4C4W C;  3JAL A;  4FFB A;  5JQG B;  3F6M A;  4O4L A;  3F0G A;  1TUB B;  2AIF A;  3MQW A;  3JCM M;  1KNJ A;  2N48 A;  1PXW A;  5ITZ B;  1X7P A;  3CCJ F;  2Q1Y A;  2Z1E A;  5DCV A;  1NMU B;  3ZP7 A;  5AVM A;  3HJW C;  3JAS B;  3FFM A;  3UT5 A;  5IJ0 A;  3TD4 A;  3C9R A;  2H6L A;  4B62 A;  3LDT A;  4I55 B;  1QD9 A;  4F6R B;  2KGW A;  4BVR A;  5KX5 B;  1CN7 A;  1OFU A;  4ZI7 B;  4C8G A;  1VQL F;  3S0H A;  2VXY A;  4O4I A;  3IKE A;  4O2A A;  4ZHY B;  5HP7 A;  4BT2 A;  3CCL F;  3FD5 A;  4X1Y A;  3S0Y A;  3K0T A;  3CC7 F;  2ZVY A;  1IV1 A;  3WGK A;  3WPX A;  5B8F A;  2BTO A;  4TUY A;  2UYN B;  3CC4 F;  1TVK A;  3EOR A;  3K14 A;  3JAK B;  3HKC B;  3CME F;  1YJ9 F;  5HXU A;  3G71 F;  3WGM A;  2VGN A;  5LYJ A;  3CCS F;  3HKE A;  5EYP A;  3V7Q A;  5LXT B;  3JAM M;  4WBN A;  1W5E A;  4G88 A;  3VMF B;  4YJ2 A;  4RQO A;  4KWE A;  2UYJ A;  3N4Z A;  1ODE A;  3RA5 A;  3RYC B;  5HXZ A;  3G6E F;  4NQ3 A;  5EB1 B;  2OTM A;  5LP6 B;  3CG6 A;  1W5F A;  4G4V A;  4IHJ B;  4X20 A;  5IJ9 B;  1T0A A;  2H8E A;  2WAL A;  3NMU C;  1GO1 A;  2OHW A;  1Z5V A;  3I7T A;  3JAR A;  1W5A A;  1U3P A;  2HS4 A;  1K9M H;  3CD6 F;  4G4Z A;  2NMU A;  3AGK A;  3N2K B;  4I4T B;  3TD5 A;  1N8R H;  3NVK E;  2CHT A;  1X25 A;  2DYY A;  5CB4 B;  2LCA A;  3N4Y A;  5BMV B;  2QEX F;  3LWP C;  2I6D A;  3CYP B;  2QTP A;  4BT4 A;  1VK3 A;  3E22 B;  3LME A;  2Z1F A;  1Q82 H;  3ESJ A;  3IMP A;  1DBF A;  3JAT A;  3D01 A;  3O85 A;  5FNV A;  5GAN K;  1K73 H;  1GZ0 A;  1J7H A;  3KIZ A;  2ZOD A;  5HY1 A;  3D00 A;  1SDS A;  5EIB D;  5IYZ B;  3DC2 A;  1JD1 A;  3GYQ A;  3LWV C;  1JFF B;  4DRX B;  3C9T A;  1VQ4 F;  1YQN A;  4NWO B;  2HRU A;  2RHO A;  3HAX D;  4B5C A;  5A2Q M;  5LA6 B;  3LWQ C;  3IR9 A;  2RB9 A;  3C9S A;  3HKB B;  1X52 A;  1KC8 H;  3LYB A;  4O4J A;  2QI2 A;  5C8Y A;  5CA0 A;  4C81 A;  1SA0 A;  1QAH A;  3RYI A;  2Z1U A;  2QA4 F;  4YJ3 A;  4G4X A;  1FFX A;  3JAL B;  3CB2 A;  4FFB B;  2K1S A;  4O4L B;  3ELC A;  2HP0 A;  3VI6 A;  4C82 A;  3RE3 A;  3N2G A;  1KNK A;  1IV2 A;  2RHJ A;  3GTZ A;  1Q86 H;  1CK2 A;  4BY9 D;  3UT5 B;  3S02 A;  2OTL F;  5IJ0 B;  3GHZ A;  2VGM A;  3ERN A;  4X1I A;  1S72 F;  4E6E A;  2BO1 A;  1XBI A;  4LNU A;  3FPI A;  3P0Z A;  5LOV B;  3C9U A;  3ZO8 A;  4BVS A;  3OW2 F;  5HY4 A;  1VQP F;  3NK6 A;  3IEQ A;  1FSZ A;  2HS3 A;  4I50 A;  5JH7 A;  2Q1X A;  1W40 A;  5HP8 A;  1XV2 A;  2PHN A;  4O2A B;  4O4I B;  4HNA B;  3S06 A;  1VQ8 F;  2L26 A;  3OON A;  3KJJ A;  1YHQ F;  4I55 A;  5KMG A;  4TUY B;  1GX1 A; 
#chains in the Genus database with same CATH homology
 1J7H A;  2CVL A;  2CWJ A;  2IG8 A;  1QD9 A;  2CHS A;  3I7T A;  1QAH A;  2UYK A;  1NQ3 A;  3KJK A;  3V4D A;  1QU9 A;  2B33 A;  3QUW A;  3ZO8 A;  2CSL A;  1JD1 A;  1FNJ A;  3I3F A;  3ZOP A;  1ONI A;  3MQW A;  5HP8 A;  2CHT A;  1X25 A;  2DYY A;  4NWO B;  1UI9 A;  5HP7 A;  3ZP4 A;  2EWC A;  4ZK7 A;  2UYJ A;  2UYP A;  3K0T A;  1XRG A;  3KJJ A;  1ODE A;  1UFY A;  2UYN A;  3L7Q A;  3LME A;  3ZP7 A;  1FNK A;  1COM A;  3M1X A;  1DBF A;  3GTZ A;  3D01 A;  3M4S A;  1PF5 A;  2CW4 A;  2UYN B;  3K12 A;  3R0P A;  3VCZ A;  1XHO A;  2OTM A;  3LYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...