2CHTA

Crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2chtA00
1FNKA 2UYJA 1QD9A 2OTMA 2CSLA 3MQWA 3LYBA 3VCZA 3KJJA 3M4SA 3ZO8A 1ONIA 2CW4A 1ODEA 3K0TA 3K12A 1X25A 2IG8A 2UYPA 3ZP4A 1UFYA 1QU9A 5HP8A 1DBFA 2EWCA 2CVLA 5HP7A 2UYNB 3M1XA 1JD1A 3I7TA 1FNJA 2UYKA 1J7HA 2CHSA 3ZP7A 1XRGA 1XHOA 3I3FA 1QAHA 4ZK7A 1UI9A 1PF5A 3LMEA 2CHTA 2B33A 3L7QA 4NWOB 3ZOPA 2DYYA 3D01A 1NQ3A 2CWJA 3V4DA 2UYNA 3GTZA 3KJKA 1COMA 3R0PA 3QUWA
chains in the Genus database with same CATH superfamily
3OBWA 3EORA 1GO1A 2HP0A 3C9TA 3RYFB 2QEXF 3N2KA 3RYCB 2G9IA 3ZO8A 1W2BF 1ODEA 4RQOA 3RA5A 1U3LA 4ZHWA 1TVKA 2EWCA 5LXTB 5J2UB 3E20B 3VMFB 1W41A 3JATA 3I3FA 1XV2A 2K1SA 3BYQA 4XCQA 1K8AH 1VQ5F 3E1YA 3NVKE 1GX1A 1COMA 2Q1YA 3LWQC 4ZI7B 1VH8A 5GAPK 3Q8HA 2F9ZC 4BVTA 1YIJF 3VYTC 1W5BA 3RA6A 4NQ3A 3P10A 3P0ZA 2QA4F 2RHHA 5IJ0B 2IG8A 1IV3A 2UYPA 4BT5A 4I4TB 1YHQF 1TVKB 3I7TA 5C8YA 5LOVA 1U43A 1J7HA 1CLIA 3JATB 1QAHA 3CYPB 1VQPF 1FFXA 5JVDB 4X1IB 3FPIA 1Q7YH 4IHJB 3ON1A 1YGYA 3R0PA 1K9MH 3N4YA 5IJ0A 1VK3A 1X7OA 2UYJA 1QD9A 1VQVA 2AIZP 2CSLA 2ZF8A 3JASA 3S06A 5DCVA 4NUTA 3CCJF 4U3JA 3K0TA 1H47A 1YI2F 1W55A 2OHWA 1Q82H 1SDSA 3GHZA 2HS3A 3JARB 3LFOA 4TV8B 5LA6A 1VQ7F 4X3MA 3C9SA 1QVFF 2BO1A 3MCQA 1PF5A 5CA0B 1N8RH 4NWOB 3D54A 2ZAUA 5LYJA 4O4HA 3VIUA 3LWRC 3CCRF 1YJ9F 4YJ3A 5LP6C 5LA6B 2ZOVA 2IQQA 1X25A 3ZP4A 4ZHQB 5LP6B 5HP7A 5MN6A 4BVQA 4X1KB 4X1YB 3F0DA 3F0EA 1GZ0A 1XRGA 2ZODA 3S0HA 4G4VA 4EB6B 1YITF 3GYQA 5JH7A 1QVGF 4TV9A 4ZHQA 4X20A 3TD3A 3WPWA 2VAWA 4G4YA 3M4SA 3HKDB 2W8BC 4X1KA 2JNBA 5GINC 3WPXA 5LP6A 2HP3A 3NVIB 2VAMA 1M90H 1KD1H 3IR9A 1JFFA 4EI8A 1KNKA 5EAZA 5EZYB 1VQOF 1VQLF 4ZHVA 3B6NA 4ZHYB 3GTZA 3LWVC 3JVHA 3VYUC 1E7KA 3KJJA 3G71F 5GIPC 5EYPB 3JAKA 5HY1A 3RYHA 3M84A 5KMGA 1JD1A 1FNJA 5JQGA 2QI2A 3WGLA 3JASB 3J80M 4C8EA 3U0OA 3HAXD 3WXMB 4E6EA 5FNVA 4TZZA 3JAWB 4BT6A 4C8GA 4I50A 1NQ3A 1Z5WA 1K73H 4U39A 1VQKF 5CA1A 3CPWF 4FFBB 2RHLA 2IAFA 2VXYA 3TD4A 4BY9D 3N2GB 5GONA 2P6YA 2ALEA 5LOVB 3DC2A 4TV9B 4M8IA 4BT4A 2H8CA 1KC8H 4DRXB 2FGYA 5ITZB 3CCMF 3RE3A 1SZQA 3JALB 2AMTA 2LCAA 3O85A 4B5CA 1W57A 4EI9A 3CCLF 1VQ8F 2HX0A 1JJ2F 5EZYA 1SA0B 5HY2A 4EI7A 3PAFA 3V4DA 5LXTA 2RB9A 4YJ3B 2Z1FA 5IYZB 3N4ZA 3VOAA 2Z1EA 3VCZA 5FJ4C 3D00A 1ONIA 1YQNA 4C81A 3LWOC 4F6RB 3FD6A 1JY8A 5HXUA 4HNAB 3PLAC 1Q86H 5B8FA 2LBXA 5KX5B 3VO8A 1PXWA 3NK7A 4O4IB 2KGWA 2FC3A 3JAKB 1W5FA 3RYIB 3J7AR 1W40A 3CCVF 3CCEF 3F0GA 5G4UC 3F0FA 2Z1UA 3CPQA 3ESJA 2GVIA 4O2BB 1OAPA 4IIJB 5KX5A 2I6RA 3MQWA 4BT7A 4HNAA 3IEWA 5CA1B 4LNUB 3S02A 1NJIH 5JQGB 3E22B 5HY4A 2RHOA 4F6RA 5C8YB 2VGMA 1DT9A 4O2AA 3M1XA 3LWPC 2PHNA 5FLXM 1RA4A 2HRYA 1OFUA 1SA0A 1T0AA 2AIFA 5EB1B 1H7MA 2CHTA 3S0WA 3L7QA 2DYYA 3D01A 4ZOLB 2CWJA 3HKCB 4LCKA 2BTUA 5EWRA 2VAPA 3AGKA 3MBMA 3JAMM 1KNJA 3QUWA 2HQSC 4R40B 4U3JB 3K2XA 5MN5A 4BT3A 4BT2A 4PWTA 4BW0B 1VQ4F 3CB2A 4FFBA 4ERHA 1S72F 2KTVA 2CVLA 3G4SF 3NMUC 5HWEA 3SIUA 2H6LA 4IHJA 5GONB 3VYSC 2OTLF 1RQ7A 3FFMA 1VQMF 3I56F 2RHJA 4O4LA 3I55F 4IIJA 2B33A 2OZBA 1H48A 3CC2F 4I50B 5BMVA 5J2TA 1X52A 3V7EA 2YXZA 3WJQA 2BTQB 4TUYB 2LBWA 1FFXB 5JVDA 2HS4A 3CXCF 3RYIA 3CC4F 2GLZA 4C8IA 2YYEA 2KTUA 4B46A 5GANK 2DT4A 4I4TA 3HKCA 2UYKA 1YJNF 3HWUA 3CCUF 3LDTA 3FBAA 1KQSF 3UT5A 5GIOC 3WGKA 3T80A 3ELCA 3ZOPA 3NK6A 2HS0A 4WBNA 5IT9M 5CB4B 1FNKA 3OBYA 4KWEA 3WJRA 1GO0A 3HTNA 5IYZA 2CW4A 3K12A 4YJ2B 5IJ9A 5HP8A 5HY0A 1IV1A 2CZWA 2CHSA 3ERNA 2QTPA 4BVSA 5JH7B 3RYFA 2PMPA 3C8LA 1IPAA 3IKFA 3JARA 4X3LA 4ZK7A 1T0KB 1W5AA 3WGNA 2V9YA 1VQNF 4G4WA 2HVYD 3MCAB 5G4VC 3KJKA 1ZWZA 3V7QA 5BMVB 5EIBC 4BVRA 5J2TB 3G6EF 1CK2A 4YJ2A 2GZLA 4O4LB 3OONA 5AVMA 3CCQF 5JCOC 4G88A 4TUYA 3KHNA 3F6MA 3WJPA 1IV2A 1X7PA 4WBNB 2OTJF 5HXZA 5KMGB 5MN4A 3V3TA 4O4HB 3ZP7A 1Q81H 1Q8RA 2VGNA 3CD6F 1UI9A 3C9RA 2ZVYA 2LBTA 1VQ6F 5CB4A 4O4JB 4TV8A 3DDNA 3HKEA 1U40A 4ZI7A 1VQ9F 3JALA 3TD5A 2L26A 5JCOA 1VHAA 5CA0A 1RLGA 3UT5B 1CN7A 2H8EA 5EIBD 3CYQA 3KE1A 3N2GA 4B62A 3IKEA 1XBIA 3CCSF 4DXDA 3HJWC 1JFFB 1U3PA 2I6DA 3HKBA 1UFYA 4ZOLA 2NMUA 2UYNB 4O4JA 2Z1TA 3JAWA 4X1IA 1XHOA 4I55A 3HKDA 3CMEF 2WALA 3CG6A 2N48A 2UYNA 3WGJA 5FNVB 2HRUA 1TUBA 3N2KB 3RYCA 5EYPA 4I55B 1Z5VA 4RHAA 3S0YA 1RLUA 4X1YA 3CC7F 2Q1XA 3WGMA 3RYHB 3HKBB 2Z01A 1DBFA 3KIZA 2R6R1 4EB6A 1NMUB 3HKEB 3C9UA 3FD5A 1JN1A 3K14A 3MDOA 1W5EA 5EO3A 4C82A 4G4ZA 1W42A 1W59A 3P4EA 5IJ9B 3S03A 5J2UA 4O2AB 3E22A 3CMAF 1YJWF 2BTOA 2OTMA 3LYBA 2R751 2HP0B 1W581 2MQEA 2ZVZA 3IEQA 3VTIC 3VI6A 1QU9A 5LYJB 3SIVA 4LNUA 3J81M 4DRXA 3QHDA 5EB0A 4B45A 3IMPA 1W3EX 3QTYA 2UZHA 4X20B 5A2QM 4O2BA 3LMEA 3OW2F 1FSZA 1TUBB 4G4XA 4C4WC 2KG4A 1IV4A 5ITZA 1R1MA 1RQ2A 3JCMM 3VOBA 1M1KH 4O4IA
chains in the Genus database with same CATH topology
1FNKA 2UYJA 1QD9A 2OTMA 2CSLA 3MQWA 3LYBA 3VCZA 3KJJA 3M4SA 3ZO8A 1ONIA 2CW4A 1ODEA 3K0TA 3K12A 1X25A 2IG8A 2UYPA 3ZP4A 1UFYA 1QU9A 5HP8A 1DBFA 2EWCA 2CVLA 5HP7A 2UYNB 3M1XA 1JD1A 3I7TA 1FNJA 2UYKA 1J7HA 2CHSA 3ZP7A 1XRGA 1XHOA 3I3FA 1QAHA 4ZK7A 1UI9A 1PF5A 3LMEA 2CHTA 2B33A 3L7QA 4NWOB 3ZOPA 2DYYA 3D01A 1NQ3A 2CWJA 3V4DA 2UYNA 3GTZA 3KJKA 1COMA 3R0PA 3QUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNK A;  2UYJ A;  1QD9 A;  2OTM A;  2CSL A;  3MQW A;  3LYB A;  3VCZ A;  3KJJ A;  3M4S A;  3ZO8 A;  1ONI A;  2CW4 A;  1ODE A;  3K0T A;  3K12 A;  1X25 A;  2IG8 A;  2UYP A;  3ZP4 A;  1UFY A;  1QU9 A;  5HP8 A;  1DBF A;  2EWC A;  2CVL A;  5HP7 A;  2UYN B;  3M1X A;  1JD1 A;  3I7T A;  1FNJ A;  2UYK A;  1J7H A;  2CHS A;  3ZP7 A;  1XRG A;  1XHO A;  3I3F A;  1QAH A;  4ZK7 A;  1UI9 A;  1PF5 A;  3LME A;  2CHT A;  2B33 A;  3L7Q A;  4NWO B;  3ZOP A;  2DYY A;  3D01 A;  1NQ3 A;  2CWJ A;  3V4D A;  2UYN A;  3GTZ A;  3KJK A;  1COM A;  3R0P A;  3QUW A; 
#chains in the Genus database with same CATH topology
 3OBW A;  3EOR A;  1GO1 A;  2HP0 A;  3C9T A;  3RYF B;  2QEX F;  3N2K A;  3RYC B;  2G9I A;  3ZO8 A;  1W2B F;  1ODE A;  4RQO A;  3RA5 A;  1U3L A;  4ZHW A;  1TVK A;  2EWC A;  5LXT B;  5J2U B;  3E20 B;  3VMF B;  1W41 A;  3JAT A;  3I3F A;  1XV2 A;  2K1S A;  3BYQ A;  4XCQ A;  1K8A H;  1VQ5 F;  3E1Y A;  3NVK E;  1GX1 A;  1COM A;  2Q1Y A;  3LWQ C;  4ZI7 B;  1VH8 A;  5GAP K;  3Q8H A;  2F9Z C;  4BVT A;  1YIJ F;  3VYT C;  1W5B A;  3RA6 A;  4NQ3 A;  3P10 A;  3P0Z A;  2QA4 F;  2RHH A;  5IJ0 B;  2IG8 A;  1IV3 A;  2UYP A;  4BT5 A;  4I4T B;  1YHQ F;  1TVK B;  3I7T A;  5C8Y A;  5LOV A;  1U43 A;  1J7H A;  1CLI A;  3JAT B;  1QAH A;  3CYP B;  1VQP F;  1FFX A;  5JVD B;  4X1I B;  3FPI A;  1Q7Y H;  4IHJ B;  3ON1 A;  1YGY A;  3R0P A;  1K9M H;  3N4Y A;  5IJ0 A;  1VK3 A;  1X7O A;  2UYJ A;  1QD9 A;  1VQV A;  2AIZ P;  2CSL A;  2ZF8 A;  3JAS A;  3S06 A;  5DCV A;  4NUT A;  3CCJ F;  4U3J A;  3K0T A;  1H47 A;  1YI2 F;  1W55 A;  2OHW A;  1Q82 H;  1SDS A;  3GHZ A;  2HS3 A;  3JAR B;  3LFO A;  4TV8 B;  5LA6 A;  1VQ7 F;  4X3M A;  3C9S A;  1QVF F;  2BO1 A;  3MCQ A;  1PF5 A;  5CA0 B;  1N8R H;  4NWO B;  3D54 A;  2ZAU A;  5LYJ A;  4O4H A;  3VIU A;  3LWR C;  3CCR F;  1YJ9 F;  4YJ3 A;  5LP6 C;  5LA6 B;  2ZOV A;  2IQQ A;  1X25 A;  3ZP4 A;  4ZHQ B;  5LP6 B;  5HP7 A;  5MN6 A;  4BVQ A;  4X1K B;  4X1Y B;  3F0D A;  3F0E A;  1GZ0 A;  1XRG A;  2ZOD A;  3S0H A;  4G4V A;  4EB6 B;  1YIT F;  3GYQ A;  5JH7 A;  1QVG F;  4TV9 A;  4ZHQ A;  4X20 A;  3TD3 A;  3WPW A;  2VAW A;  4G4Y A;  3M4S A;  3HKD B;  2W8B C;  4X1K A;  2JNB A;  5GIN C;  3WPX A;  5LP6 A;  2HP3 A;  3NVI B;  2VAM A;  1M90 H;  1KD1 H;  3IR9 A;  1JFF A;  4EI8 A;  1KNK A;  5EAZ A;  5EZY B;  1VQO F;  1VQL F;  4ZHV A;  3B6N A;  4ZHY B;  3GTZ A;  3LWV C;  3JVH A;  3VYU C;  1E7K A;  3KJJ A;  3G71 F;  5GIP C;  5EYP B;  3JAK A;  5HY1 A;  3RYH A;  3M84 A;  5KMG A;  1JD1 A;  1FNJ A;  5JQG A;  2QI2 A;  3WGL A;  3JAS B;  3J80 M;  4C8E A;  3U0O A;  3HAX D;  3WXM B;  4E6E A;  5FNV A;  4TZZ A;  3JAW B;  4BT6 A;  4C8G A;  4I50 A;  1NQ3 A;  1Z5W A;  1K73 H;  4U39 A;  1VQK F;  5CA1 A;  3CPW F;  4FFB B;  2RHL A;  2IAF A;  2VXY A;  3TD4 A;  4BY9 D;  3N2G B;  5GON A;  2P6Y A;  2ALE A;  5LOV B;  3DC2 A;  4TV9 B;  4M8I A;  4BT4 A;  2H8C A;  1KC8 H;  4DRX B;  2FGY A;  5ITZ B;  3CCM F;  3RE3 A;  1SZQ A;  3JAL B;  2AMT A;  2LCA A;  3O85 A;  4B5C A;  1W57 A;  4EI9 A;  3CCL F;  1VQ8 F;  2HX0 A;  1JJ2 F;  5EZY A;  1SA0 B;  5HY2 A;  4EI7 A;  3PAF A;  3V4D A;  5LXT A;  2RB9 A;  4YJ3 B;  2Z1F A;  5IYZ B;  3N4Z A;  3VOA A;  2Z1E A;  3VCZ A;  5FJ4 C;  3D00 A;  1ONI A;  1YQN A;  4C81 A;  3LWO C;  4F6R B;  3FD6 A;  1JY8 A;  5HXU A;  4HNA B;  3PLA C;  1Q86 H;  5B8F A;  2LBX A;  5KX5 B;  3VO8 A;  1PXW A;  3NK7 A;  4O4I B;  2KGW A;  2FC3 A;  3JAK B;  1W5F A;  3RYI B;  3J7A R;  1W40 A;  3CCV F;  3CCE F;  3F0G A;  5G4U C;  3F0F A;  2Z1U A;  3CPQ A;  3ESJ A;  2GVI A;  4O2B B;  1OAP A;  4IIJ B;  5KX5 A;  2I6R A;  3MQW A;  4BT7 A;  4HNA A;  3IEW A;  5CA1 B;  4LNU B;  3S02 A;  1NJI H;  5JQG B;  3E22 B;  5HY4 A;  2RHO A;  4F6R A;  5C8Y B;  2VGM A;  1DT9 A;  4O2A A;  3M1X A;  3LWP C;  2PHN A;  5FLX M;  1RA4 A;  2HRY A;  1OFU A;  1SA0 A;  1T0A A;  2AIF A;  5EB1 B;  1H7M A;  2CHT A;  3S0W A;  3L7Q A;  2DYY A;  3D01 A;  4ZOL B;  2CWJ A;  3HKC B;  4LCK A;  2BTU A;  5EWR A;  2VAP A;  3AGK A;  3MBM A;  3JAM M;  1KNJ A;  3QUW A;  2HQS C;  4R40 B;  4U3J B;  3K2X A;  5MN5 A;  4BT3 A;  4BT2 A;  4PWT A;  4BW0 B;  1VQ4 F;  3CB2 A;  4FFB A;  4ERH A;  1S72 F;  2KTV A;  2CVL A;  3G4S F;  3NMU C;  5HWE A;  3SIU A;  2H6L A;  4IHJ A;  5GON B;  3VYS C;  2OTL F;  1RQ7 A;  3FFM A;  1VQM F;  3I56 F;  2RHJ A;  4O4L A;  3I55 F;  4IIJ A;  2B33 A;  2OZB A;  1H48 A;  3CC2 F;  4I50 B;  5BMV A;  5J2T A;  1X52 A;  3V7E A;  2YXZ A;  3WJQ A;  2BTQ B;  4TUY B;  2LBW A;  1FFX B;  5JVD A;  2HS4 A;  3CXC F;  3RYI A;  3CC4 F;  2GLZ A;  4C8I A;  2YYE A;  2KTU A;  4B46 A;  5GAN K;  2DT4 A;  4I4T A;  3HKC A;  2UYK A;  1YJN F;  3HWU A;  3CCU F;  3LDT A;  3FBA A;  1KQS F;  3UT5 A;  5GIO C;  3WGK A;  3T80 A;  3ELC A;  3ZOP A;  3NK6 A;  2HS0 A;  4WBN A;  5IT9 M;  5CB4 B;  1FNK A;  3OBY A;  4KWE A;  3WJR A;  1GO0 A;  3HTN A;  5IYZ A;  2CW4 A;  3K12 A;  4YJ2 B;  5IJ9 A;  5HP8 A;  5HY0 A;  1IV1 A;  2CZW A;  2CHS A;  3ERN A;  2QTP A;  4BVS A;  5JH7 B;  3RYF A;  2PMP A;  3C8L A;  1IPA A;  3IKF A;  3JAR A;  4X3L A;  4ZK7 A;  1T0K B;  1W5A A;  3WGN A;  2V9Y A;  1VQN F;  4G4W A;  2HVY D;  3MCA B;  5G4V C;  3KJK A;  1ZWZ A;  3V7Q A;  5BMV B;  5EIB C;  4BVR A;  5J2T B;  3G6E F;  1CK2 A;  4YJ2 A;  2GZL A;  4O4L B;  3OON A;  5AVM A;  3CCQ F;  5JCO C;  4G88 A;  4TUY A;  3KHN A;  3F6M A;  3WJP A;  1IV2 A;  1X7P A;  4WBN B;  2OTJ F;  5HXZ A;  5KMG B;  5MN4 A;  3V3T A;  4O4H B;  3ZP7 A;  1Q81 H;  1Q8R A;  2VGN A;  3CD6 F;  1UI9 A;  3C9R A;  2ZVY A;  2LBT A;  1VQ6 F;  5CB4 A;  4O4J B;  4TV8 A;  3DDN A;  3HKE A;  1U40 A;  4ZI7 A;  1VQ9 F;  3JAL A;  3TD5 A;  2L26 A;  5JCO A;  1VHA A;  5CA0 A;  1RLG A;  3UT5 B;  1CN7 A;  2H8E A;  5EIB D;  3CYQ A;  3KE1 A;  3N2G A;  4B62 A;  3IKE A;  1XBI A;  3CCS F;  4DXD A;  3HJW C;  1JFF B;  1U3P A;  2I6D A;  3HKB A;  1UFY A;  4ZOL A;  2NMU A;  2UYN B;  4O4J A;  2Z1T A;  3JAW A;  4X1I A;  1XHO A;  4I55 A;  3HKD A;  3CME F;  2WAL A;  3CG6 A;  2N48 A;  2UYN A;  3WGJ A;  5FNV B;  2HRU A;  1TUB A;  3N2K B;  3RYC A;  5EYP A;  4I55 B;  1Z5V A;  4RHA A;  3S0Y A;  1RLU A;  4X1Y A;  3CC7 F;  2Q1X A;  3WGM A;  3RYH B;  3HKB B;  2Z01 A;  1DBF A;  3KIZ A;  2R6R 1;  4EB6 A;  1NMU B;  3HKE B;  3C9U A;  3FD5 A;  1JN1 A;  3K14 A;  3MDO A;  1W5E A;  5EO3 A;  4C82 A;  4G4Z A;  1W42 A;  1W59 A;  3P4E A;  5IJ9 B;  3S03 A;  5J2U A;  4O2A B;  3E22 A;  3CMA F;  1YJW F;  2BTO A;  2OTM A;  3LYB A;  2R75 1;  2HP0 B;  1W58 1;  2MQE A;  2ZVZ A;  3IEQ A;  3VTI C;  3VI6 A;  1QU9 A;  5LYJ B;  3SIV A;  4LNU A;  3J81 M;  4DRX A;  3QHD A;  5EB0 A;  4B45 A;  3IMP A;  1W3E X;  3QTY A;  2UZH A;  4X20 B;  5A2Q M;  4O2B A;  3LME A;  3OW2 F;  1FSZ A;  1TUB B;  4G4X A;  4C4W C;  2KG4 A;  1IV4 A;  5ITZ A;  1R1M A;  1RQ2 A;  3JCM M;  3VOB A;  1M1K H;  4O4I A; 
#chains in the Genus database with same CATH homology
 1FNK A;  2UYJ A;  1QD9 A;  2OTM A;  2CSL A;  3MQW A;  3LYB A;  3VCZ A;  3KJJ A;  3M4S A;  3ZO8 A;  1ONI A;  2CW4 A;  1ODE A;  3K0T A;  3K12 A;  1X25 A;  2IG8 A;  2UYP A;  3ZP4 A;  1UFY A;  1QU9 A;  5HP8 A;  1DBF A;  2EWC A;  2CVL A;  5HP7 A;  2UYN B;  3M1X A;  1JD1 A;  3I7T A;  1FNJ A;  2UYK A;  1J7H A;  2CHS A;  3ZP7 A;  1XRG A;  1XHO A;  3I3F A;  1QAH A;  4ZK7 A;  1UI9 A;  1PF5 A;  3LME A;  2CHT A;  2B33 A;  3L7Q A;  4NWO B;  3ZOP A;  2DYY A;  3D01 A;  1NQ3 A;  2CWJ A;  3V4D A;  2UYN A;  3GTZ A;  3KJK A;  1COM A;  3R0P A;  3QUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...