2CHTA

Crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords CHORISMATE MUTASE
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2chtA00
2CHTA 2IG8A 5HP7A 1QU9A 2CWJA 5HP8A 3R0PA 3ZP4A 3V4DA 3D01A 2CHSA 1J7HA 1ODEA 3M1XA 3QUWA 1COMA 1XHOA 1NQ3A 2B33A 3L7QA 3I7TA 1PF5A 3LYBA 3ZOPA 1X25A 1QD9A 1QAHA 1FNKA 3KJKA 3ZP7A 2UYKA 3K0TA 3I3FA 2CW4A 1UI9A 4NWOB 1JD1A 2UYNB 1ONIA 3GTZA 2UYPA 3M4SA 3VCZA 3ZO8A 2CVLA 2CSLA 2OTMA 3K12A 4ZK7A 1XRGA 2EWCA 2DYYA 2UYJA 1FNJA 3KJJA 1DBFA 3LMEA 3MQWA 2UYNA 1UFYA
chains in the Genus database with same CATH superfamily
1IPAA 1Z5VA 1TUBA 3CMAF 2HP0B 1COMA 4ZOLA 3HKBB 5JH7A 1QD9A 3ERNA 3CCSF 5C8YB 2UYKA 3K0TA 5KX5B 1RQ7A 3M4SA 3OW2F 1CK2A 3F0GA 3N2GA 5KMGA 1W5FA 2VAPA 4O4IA 5BMVB 3MBMA 4C81A 3ESJA 2QEXF 3CCMF 1W2BF 4G4XA 3HKCB 3CCUF 3J7AR 4X20B 1QVGF 1VQVA 2V9YA 3FD5A 2Q1YA 3LWVC 1W57A 2VXYA 3OONA 3E1YA 5EB0A 3TD3A 5LP6B 4X1KA 1IV1A 2QI2A 3F0DA 4BT4A 1JJ2F 3CC7F 4O2AB 4O2BB 1KC8H 3MCQA 4ZI7B 1IV3A 1IV2A 4X3MA 3GTZA 2HP3A 1R1MA 3QTYA 3CYPB 2FGYA 2GLZA 3RYCA 1GX1A 2RHOA 1OAPA 2ZVYA 5IJ9B 3S02A 5IJ0B 1W41A 5J2UB 2LBWA 1U40A 3IR9A 4LNUA 1H48A 4TV8B 3JALB 1RQ2A 5HWEA 1W5EA 1U3PA 3FD6A 2RHHA 3AGKA 3WPXA 2Z1FA 3JASB 5ITZB 5FNVA 3HAXD 5A2QM 4U39A 2Q1XA 2VAMA 5KMGB 4F6RB 3VYTC 1W5AA 2R6R1 3J80M 5CA0A 5JVDB 3ZO8A 3CB2A 3LDTA 2RHLA 1Q82H 1DBFA 5G4UC 4O4JB 5B8FA 5IYZB 1QVFF 5IYZA 3G6EF 3OBYA 3P0ZA 4FFBB 1KNKA 3VO8A 2Z1EA 2P6YA 2LCAA 3WJRA 2HP0A 4X1YB 3DDNA 3ON1A 4BVSA 1YIJF 3CG6A 4U3JA 3JAKA 1VQ6F 3LWRC 1SA0B 1VQPF 4B46A 3NVKE 5LYJA 2ZVZA 3IEQA 1Q86H 4YJ3B 4LNUB 5LOVB 3JAWB 3HWUA 5JH7B 1Q8RA 1ZWZA 3NVIB 4PWTA 4BT5A 3D00A 5KX5A 3QUWA 1YQNA 5GINC 3ELCA 5J2TB 4XCQA 4B45A 5LP6A 4C8EA 4O4IB 2HRUA 5BMVA 3V3TA 3VMFB 1TUBB 1W3EX 4NWOB 4EI9A 2UYPA 2HX0A 1W59A 3CPWF 2IQQA 2OTMA 4KWEA 5JCOA 2LBTA 3I56F 5DCVA 5EIBC 5JQGB 4FFBA 2CHTA 2KG4A 4TV9A 4B62A 5HP7A 5HP8A 5MN4A 4O4HB 4RHAA 4TV8A 5MN5A 3CC2F 5EYPA 5EIBD 2G9IA 1XHOA 5EYPB 3L7QA 2W8BC 3F0EA 5HXZA 4C8GA 5FNVB 1U43A 2CZWA 1FNKA 3RYCB 3JAMM 5EAZA 5LYJB 2LBXA 3F0FA 1XBIA 1H7MA 2Z01A 2ALEA 1U3LA 3TD5A 5GONA 3JALA 3HJWC 2UYNA 3JATA 5LXTB 1QU9A 2K1SA 1SZQA 1Z5WA 3V4DA 3CXCF 3LWPC 1ODEA 5LP6C 1PXWA 1X52A 2B33A 1FFXA 3C9RA 3ZOPA 1YI2F 4O4LB 3HKBA 3JVHA 3LWQC 3CCQF 3V7QA 3GYQA 3FPIA 1VQ4F 2UZHA 3UT5B 2RHJA 3JARB 3VOBA 3JARA 3WPWA 1N8RH 3FFMA 2DT4A 1KQSF 3LMEA 3JCMM 3MQWA 4O4HA 3VYUC 3HKEB 3MCAB 3RA5A 3HKEA 3NMUC 3RYIA 1FSZA 4G4WA 5CB4B 4DRXB 3M1XA 1PF5A 2VAWA 5MN6A 4BVRA 3I55F 3C8LA 4ZHWA 2YYEA 5EWRA 2KGWA 3KIZA 4ZHYB 3VCZA 1W55A 4ZI7A 2CSLA 4O2BA 4ZHQA 3WJPA 3CC4F 4O4JA 3KJJA 1YJNF 2HS0A 2RB9A 3CCVF 3S06A 3RYHB 1X7PA 4M8IA 1VHAA 1YJWF 2Z1TA 1X7OA 3F6MA 4BVQA 2IAFA 3WGNA 3D01A 3E22A 2CHSA 2MQEA 5GANK 4G4ZA 4EB6A 4I55A 1NQ3A 3JAKB 3K14A 1SDSA 3K2XA 3JASA 3S0HA 3LWOC 3IMPA 3G71F 1UI9A 3VI6A 1XV2A 3GHZA 3BYQA 2CVLA 1NJIH 4HNAA 5G4VC 1IV4A 3K12A 3KE1A 3N2GB 2KTUA 1W5BA 3RYIB 1S72F 2HS3A 2ZODA 3HKDA 4I4TA 2ZOVA 4IHJA 2OTJF 3RYFB 4I4TB 1W581 3NK7A 1JFFA 1H47A 4EI8A 1VQLF 3HTNA 4F6RA 3WGKA 4IIJA 3DC2A 4NQ3A 2HRYA 2I6DA 4EB6B 2HVYD 3RE3A 3PLAC 1JD1A 2UYNB 3KHNA 3M84A 3J81M 4RQOA 2OTLF 3QHDA 3S0WA 1DT9A 4ERHA 2R751 5IJ9A 3S0YA 2AMTA 5J2UA 2OHWA 3IKEA 5HY4A 4BT3A 5IJ0A 1VQ7F 2I6RA 5LOVA 1M1KH 3TD4A 1TVKB 3RYFA 2KTVA 4E6EA 3LFOA 1OFUA 2GZLA 3ZP7A 4HNAB 1GZ0A 4G4YA 1T0AA 5CA0B 4X1KB 4YJ2A 4YJ3A 3OBWA 1GO0A 4YJ2B 5GONB 3WGJA 4BY9D 1VQNF 2BO1A 4B5CA 1YITF 1VQKF 1CLIA 2ZF8A 4BW0B 4I50B 1GO1A 4TUYA 5FJ4C 2H8EA 3V7EA 1FNJA 4X20A 5JCOC 1UFYA 3S03A 3SIVA 3UT5A 3WGMA 5EO3A 4DXDA 5JQGA 3SIUA 1Q7YH 3E22B 3CPQA 4BT6A 2AIZP 1T0KB 3T80A 3IKFA 3LYBA 1RLGA 4WBNA 1KD1H 4BT2A 4WBNB 5HXUA 3VTIC 1K9MH 5C8YA 2VGMA 1VQ5F 4ZK7A 1XRGA 3RA6A 2EWCA 5EB1B 1VQMF 4X3LA 3P4EA 1YGYA 3VOAA 3CYQA 4C8IA 2CWJA 2BTUA 2Z1UA 4DRXA 3WXMB 5CB4A 3HKCA 5EZYB 5ITZA 1J7HA 3VIUA 1JFFB 3B6NA 2F9ZC 2H6LA 5HY2A 3I7TA 4X1IB 1X25A 2YXZA 2HS4A 2PHNA 5CA1B 4LCKA 3KJKA 4O2AA 3I3FA 3Q8HA 4ZHQB 3WJQA 5HY0A 1E7KA 2QA4F 1FFXB 2ZAUA 1CN7A 3R0PA 1VH8A 2AIFA 1JY8A 3N4ZA 4O4LA 3IEWA 4ZHVA 3WGLA 1VQ8F 2L26A 4ZOLB 4BT7A 1KNJA 2WALA 5AVMA 5GIOC 5HY1A 4EI7A 1QAHA 1YJ9F 5IT9M 1ONIA 3N4YA 2VGNA 5J2TA 5GAPK 3N2KA 4C4WC 4G4VA 5FLXM 3O85A 5JVDA 3HKDB 4IHJB 3C9UA 2BTOA 2UYJA 2OZBA 2PMPA 3U0OA 3CMEF 2GVIA 4C82A 3D54A 5LA6A 3ZP4A 2FC3A 3RYHA 3CCRF 3CD6F 4X1IA 2JNBA 4BVTA 4TV9B 4IIJB 4TZZA 5CA1A 1VK3A 3CCEF 1M90H 1Q81H 4X1YA 4I50A 4TUYB 3NK6A 3C9TA 4I55B 3PAFA 4U3JB 4NUTA 1VQOF 3G4SF 1NMUB 3MDOA 1JN1A 1K73H 2DYYA 1K8AH 5GIPC 2IG8A 4G88A 3E20B 1RA4A 1TVKA 3FBAA 2BTQB 1W42A 5LA6B 3P10A 2H8CA 2HQSC 3N2KB 2CW4A 2QTPA 3JAWA 3VYSC 3CCJF 1YHQF 1RLUA 4R40B 3JATB 1W40A 5LXTA 2N48A 3C9SA 5EZYA 1VQ9F 3CCLF 2NMUA 3EORA 1SA0A
chains in the Genus database with same CATH topology
2CHTA 2IG8A 5HP7A 1QU9A 2CWJA 5HP8A 3R0PA 3ZP4A 3V4DA 3D01A 2CHSA 1J7HA 1ODEA 3M1XA 3QUWA 1COMA 1XHOA 1NQ3A 2B33A 3L7QA 3I7TA 1PF5A 3LYBA 3ZOPA 1X25A 1QD9A 1QAHA 1FNKA 3KJKA 3ZP7A 2UYKA 3K0TA 3I3FA 2CW4A 1UI9A 4NWOB 1JD1A 2UYNB 1ONIA 3GTZA 2UYPA 3M4SA 3VCZA 3ZO8A 2CVLA 2CSLA 2OTMA 3K12A 4ZK7A 1XRGA 2EWCA 2DYYA 2UYJA 1FNJA 3KJJA 1DBFA 3LMEA 3MQWA 2UYNA 1UFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHT A;  2IG8 A;  5HP7 A;  1QU9 A;  2CWJ A;  5HP8 A;  3R0P A;  3ZP4 A;  3V4D A;  3D01 A;  2CHS A;  1J7H A;  1ODE A;  3M1X A;  3QUW A;  1COM A;  1XHO A;  1NQ3 A;  2B33 A;  3L7Q A;  3I7T A;  1PF5 A;  3LYB A;  3ZOP A;  1X25 A;  1QD9 A;  1QAH A;  1FNK A;  3KJK A;  3ZP7 A;  2UYK A;  3K0T A;  3I3F A;  2CW4 A;  1UI9 A;  4NWO B;  1JD1 A;  2UYN B;  1ONI A;  3GTZ A;  2UYP A;  3M4S A;  3VCZ A;  3ZO8 A;  2CVL A;  2CSL A;  2OTM A;  3K12 A;  4ZK7 A;  1XRG A;  2EWC A;  2DYY A;  2UYJ A;  1FNJ A;  3KJJ A;  1DBF A;  3LME A;  3MQW A;  2UYN A;  1UFY A; 
#chains in the Genus database with same CATH topology
 1IPA A;  1Z5V A;  1TUB A;  3CMA F;  2HP0 B;  1COM A;  4ZOL A;  3HKB B;  5JH7 A;  1QD9 A;  3ERN A;  3CCS F;  5C8Y B;  2UYK A;  3K0T A;  5KX5 B;  1RQ7 A;  3M4S A;  3OW2 F;  1CK2 A;  3F0G A;  3N2G A;  5KMG A;  1W5F A;  2VAP A;  4O4I A;  5BMV B;  3MBM A;  4C81 A;  3ESJ A;  2QEX F;  3CCM F;  1W2B F;  4G4X A;  3HKC B;  3CCU F;  3J7A R;  4X20 B;  1QVG F;  1VQV A;  2V9Y A;  3FD5 A;  2Q1Y A;  3LWV C;  1W57 A;  2VXY A;  3OON A;  3E1Y A;  5EB0 A;  3TD3 A;  5LP6 B;  4X1K A;  1IV1 A;  2QI2 A;  3F0D A;  4BT4 A;  1JJ2 F;  3CC7 F;  4O2A B;  4O2B B;  1KC8 H;  3MCQ A;  4ZI7 B;  1IV3 A;  1IV2 A;  4X3M A;  3GTZ A;  2HP3 A;  1R1M A;  3QTY A;  3CYP B;  2FGY A;  2GLZ A;  3RYC A;  1GX1 A;  2RHO A;  1OAP A;  2ZVY A;  5IJ9 B;  3S02 A;  5IJ0 B;  1W41 A;  5J2U B;  2LBW A;  1U40 A;  3IR9 A;  4LNU A;  1H48 A;  4TV8 B;  3JAL B;  1RQ2 A;  5HWE A;  1W5E A;  1U3P A;  3FD6 A;  2RHH A;  3AGK A;  3WPX A;  2Z1F A;  3JAS B;  5ITZ B;  5FNV A;  3HAX D;  5A2Q M;  4U39 A;  2Q1X A;  2VAM A;  5KMG B;  4F6R B;  3VYT C;  1W5A A;  2R6R 1;  3J80 M;  5CA0 A;  5JVD B;  3ZO8 A;  3CB2 A;  3LDT A;  2RHL A;  1Q82 H;  1DBF A;  5G4U C;  4O4J B;  5B8F A;  5IYZ B;  1QVF F;  5IYZ A;  3G6E F;  3OBY A;  3P0Z A;  4FFB B;  1KNK A;  3VO8 A;  2Z1E A;  2P6Y A;  2LCA A;  3WJR A;  2HP0 A;  4X1Y B;  3DDN A;  3ON1 A;  4BVS A;  1YIJ F;  3CG6 A;  4U3J A;  3JAK A;  1VQ6 F;  3LWR C;  1SA0 B;  1VQP F;  4B46 A;  3NVK E;  5LYJ A;  2ZVZ A;  3IEQ A;  1Q86 H;  4YJ3 B;  4LNU B;  5LOV B;  3JAW B;  3HWU A;  5JH7 B;  1Q8R A;  1ZWZ A;  3NVI B;  4PWT A;  4BT5 A;  3D00 A;  5KX5 A;  3QUW A;  1YQN A;  5GIN C;  3ELC A;  5J2T B;  4XCQ A;  4B45 A;  5LP6 A;  4C8E A;  4O4I B;  2HRU A;  5BMV A;  3V3T A;  3VMF B;  1TUB B;  1W3E X;  4NWO B;  4EI9 A;  2UYP A;  2HX0 A;  1W59 A;  3CPW F;  2IQQ A;  2OTM A;  4KWE A;  5JCO A;  2LBT A;  3I56 F;  5DCV A;  5EIB C;  5JQG B;  4FFB A;  2CHT A;  2KG4 A;  4TV9 A;  4B62 A;  5HP7 A;  5HP8 A;  5MN4 A;  4O4H B;  4RHA A;  4TV8 A;  5MN5 A;  3CC2 F;  5EYP A;  5EIB D;  2G9I A;  1XHO A;  5EYP B;  3L7Q A;  2W8B C;  3F0E A;  5HXZ A;  4C8G A;  5FNV B;  1U43 A;  2CZW A;  1FNK A;  3RYC B;  3JAM M;  5EAZ A;  5LYJ B;  2LBX A;  3F0F A;  1XBI A;  1H7M A;  2Z01 A;  2ALE A;  1U3L A;  3TD5 A;  5GON A;  3JAL A;  3HJW C;  2UYN A;  3JAT A;  5LXT B;  1QU9 A;  2K1S A;  1SZQ A;  1Z5W A;  3V4D A;  3CXC F;  3LWP C;  1ODE A;  5LP6 C;  1PXW A;  1X52 A;  2B33 A;  1FFX A;  3C9R A;  3ZOP A;  1YI2 F;  4O4L B;  3HKB A;  3JVH A;  3LWQ C;  3CCQ F;  3V7Q A;  3GYQ A;  3FPI A;  1VQ4 F;  2UZH A;  3UT5 B;  2RHJ A;  3JAR B;  3VOB A;  3JAR A;  3WPW A;  1N8R H;  3FFM A;  2DT4 A;  1KQS F;  3LME A;  3JCM M;  3MQW A;  4O4H A;  3VYU C;  3HKE B;  3MCA B;  3RA5 A;  3HKE A;  3NMU C;  3RYI A;  1FSZ A;  4G4W A;  5CB4 B;  4DRX B;  3M1X A;  1PF5 A;  2VAW A;  5MN6 A;  4BVR A;  3I55 F;  3C8L A;  4ZHW A;  2YYE A;  5EWR A;  2KGW A;  3KIZ A;  4ZHY B;  3VCZ A;  1W55 A;  4ZI7 A;  2CSL A;  4O2B A;  4ZHQ A;  3WJP A;  3CC4 F;  4O4J A;  3KJJ A;  1YJN F;  2HS0 A;  2RB9 A;  3CCV F;  3S06 A;  3RYH B;  1X7P A;  4M8I A;  1VHA A;  1YJW F;  2Z1T A;  1X7O A;  3F6M A;  4BVQ A;  2IAF A;  3WGN A;  3D01 A;  3E22 A;  2CHS A;  2MQE A;  5GAN K;  4G4Z A;  4EB6 A;  4I55 A;  1NQ3 A;  3JAK B;  3K14 A;  1SDS A;  3K2X A;  3JAS A;  3S0H A;  3LWO C;  3IMP A;  3G71 F;  1UI9 A;  3VI6 A;  1XV2 A;  3GHZ A;  3BYQ A;  2CVL A;  1NJI H;  4HNA A;  5G4V C;  1IV4 A;  3K12 A;  3KE1 A;  3N2G B;  2KTU A;  1W5B A;  3RYI B;  1S72 F;  2HS3 A;  2ZOD A;  3HKD A;  4I4T A;  2ZOV A;  4IHJ A;  2OTJ F;  3RYF B;  4I4T B;  1W58 1;  3NK7 A;  1JFF A;  1H47 A;  4EI8 A;  1VQL F;  3HTN A;  4F6R A;  3WGK A;  4IIJ A;  3DC2 A;  4NQ3 A;  2HRY A;  2I6D A;  4EB6 B;  2HVY D;  3RE3 A;  3PLA C;  1JD1 A;  2UYN B;  3KHN A;  3M84 A;  3J81 M;  4RQO A;  2OTL F;  3QHD A;  3S0W A;  1DT9 A;  4ERH A;  2R75 1;  5IJ9 A;  3S0Y A;  2AMT A;  5J2U A;  2OHW A;  3IKE A;  5HY4 A;  4BT3 A;  5IJ0 A;  1VQ7 F;  2I6R A;  5LOV A;  1M1K H;  3TD4 A;  1TVK B;  3RYF A;  2KTV A;  4E6E A;  3LFO A;  1OFU A;  2GZL A;  3ZP7 A;  4HNA B;  1GZ0 A;  4G4Y A;  1T0A A;  5CA0 B;  4X1K B;  4YJ2 A;  4YJ3 A;  3OBW A;  1GO0 A;  4YJ2 B;  5GON B;  3WGJ A;  4BY9 D;  1VQN F;  2BO1 A;  4B5C A;  1YIT F;  1VQK F;  1CLI A;  2ZF8 A;  4BW0 B;  4I50 B;  1GO1 A;  4TUY A;  5FJ4 C;  2H8E A;  3V7E A;  1FNJ A;  4X20 A;  5JCO C;  1UFY A;  3S03 A;  3SIV A;  3UT5 A;  3WGM A;  5EO3 A;  4DXD A;  5JQG A;  3SIU A;  1Q7Y H;  3E22 B;  3CPQ A;  4BT6 A;  2AIZ P;  1T0K B;  3T80 A;  3IKF A;  3LYB A;  1RLG A;  4WBN A;  1KD1 H;  4BT2 A;  4WBN B;  5HXU A;  3VTI C;  1K9M H;  5C8Y A;  2VGM A;  1VQ5 F;  4ZK7 A;  1XRG A;  3RA6 A;  2EWC A;  5EB1 B;  1VQM F;  4X3L A;  3P4E A;  1YGY A;  3VOA A;  3CYQ A;  4C8I A;  2CWJ A;  2BTU A;  2Z1U A;  4DRX A;  3WXM B;  5CB4 A;  3HKC A;  5EZY B;  5ITZ A;  1J7H A;  3VIU A;  1JFF B;  3B6N A;  2F9Z C;  2H6L A;  5HY2 A;  3I7T A;  4X1I B;  1X25 A;  2YXZ A;  2HS4 A;  2PHN A;  5CA1 B;  4LCK A;  3KJK A;  4O2A A;  3I3F A;  3Q8H A;  4ZHQ B;  3WJQ A;  5HY0 A;  1E7K A;  2QA4 F;  1FFX B;  2ZAU A;  1CN7 A;  3R0P A;  1VH8 A;  2AIF A;  1JY8 A;  3N4Z A;  4O4L A;  3IEW A;  4ZHV A;  3WGL A;  1VQ8 F;  2L26 A;  4ZOL B;  4BT7 A;  1KNJ A;  2WAL A;  5AVM A;  5GIO C;  5HY1 A;  4EI7 A;  1QAH A;  1YJ9 F;  5IT9 M;  1ONI A;  3N4Y A;  2VGN A;  5J2T A;  5GAP K;  3N2K A;  4C4W C;  4G4V A;  5FLX M;  3O85 A;  5JVD A;  3HKD B;  4IHJ B;  3C9U A;  2BTO A;  2UYJ A;  2OZB A;  2PMP A;  3U0O A;  3CME F;  2GVI A;  4C82 A;  3D54 A;  5LA6 A;  3ZP4 A;  2FC3 A;  3RYH A;  3CCR F;  3CD6 F;  4X1I A;  2JNB A;  4BVT A;  4TV9 B;  4IIJ B;  4TZZ A;  5CA1 A;  1VK3 A;  3CCE F;  1M90 H;  1Q81 H;  4X1Y A;  4I50 A;  4TUY B;  3NK6 A;  3C9T A;  4I55 B;  3PAF A;  4U3J B;  4NUT A;  1VQO F;  3G4S F;  1NMU B;  3MDO A;  1JN1 A;  1K73 H;  2DYY A;  1K8A H;  5GIP C;  2IG8 A;  4G88 A;  3E20 B;  1RA4 A;  1TVK A;  3FBA A;  2BTQ B;  1W42 A;  5LA6 B;  3P10 A;  2H8C A;  2HQS C;  3N2K B;  2CW4 A;  2QTP A;  3JAW A;  3VYS C;  3CCJ F;  1YHQ F;  1RLU A;  4R40 B;  3JAT B;  1W40 A;  5LXT A;  2N48 A;  3C9S A;  5EZY A;  1VQ9 F;  3CCL F;  2NMU A;  3EOR A;  1SA0 A; 
#chains in the Genus database with same CATH homology
 2CHT A;  2IG8 A;  5HP7 A;  1QU9 A;  2CWJ A;  5HP8 A;  3R0P A;  3ZP4 A;  3V4D A;  3D01 A;  2CHS A;  1J7H A;  1ODE A;  3M1X A;  3QUW A;  1COM A;  1XHO A;  1NQ3 A;  2B33 A;  3L7Q A;  3I7T A;  1PF5 A;  3LYB A;  3ZOP A;  1X25 A;  1QD9 A;  1QAH A;  1FNK A;  3KJK A;  3ZP7 A;  2UYK A;  3K0T A;  3I3F A;  2CW4 A;  1UI9 A;  4NWO B;  1JD1 A;  2UYN B;  1ONI A;  3GTZ A;  2UYP A;  3M4S A;  3VCZ A;  3ZO8 A;  2CVL A;  2CSL A;  2OTM A;  3K12 A;  4ZK7 A;  1XRG A;  2EWC A;  2DYY A;  2UYJ A;  1FNJ A;  3KJJ A;  1DBF A;  3LME A;  3MQW A;  2UYN A;  1UFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...