2CHTA

Crystal structures of the monofunctional chorismate mutase from bacillus subtilis and its complex with a transition state analog
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHORISMATE MUTASE
publication title Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 29
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 1994-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 2chtA00
2CHSA 1FNJA 2UYNB 3L7QA 2IG8A 1X25A 1QU9A 1FNKA 3M4SA 1XRGA 3QUWA 3D01A 3ZP4A 2UYJA 3KJKA 1J7HA 3K0TA 3ZP7A 3VCZA 1COMA 3I7TA 1NQ3A 2UYPA 3LMEA 3ZOPA 3ZO8A 2CVLA 3V4DA 3KJJA 2B33A 1PF5A 1QD9A 2OTMA 2EWCA 3R0PA 3LYBA 5HP8A 1XHOA 3K12A 4NWOB 4ZK7A 5HP7A 3M1XA 2CWJA 2UYKA 1ONIA 3GTZA 1UI9A 1UFYA 2UYNA 2CHTA 2CW4A 1DBFA 1JD1A 1QAHA 3MQWA 2DYYA 1ODEA 2CSLA 3I3FA
chains in the Genus database with same CATH superfamily
3CYPB 4ZI7A 3V7EA 4G4ZA 4PWTA 3U0OA 1IV2A 2Q1XA 4DXDA 4ZHYB 2KTVA 2RHHA 1M90H 1FFXB 3AGKA 4KWEA 3JAWB 2UYPA 3LMEA 3ZOPA 1Q86H 1YGYA 3VOAA 5KX5B 1W5BA 4E6EA 1YHQF 3F0EA 2RHJA 5B8FA 3GYQA 2PMPA 2JNBA 3E22B 2AMTA 5CB4A 1Q81H 4BVRA 5LXTA 4G4VA 1QAHA 3CB2A 2DT4A 1U40A 1W42A 5LOVB 1R1MA 4G4WA 5J2TA 3OW2F 3FD5A 5LYJB 5IJ9A 1VK3A 4I55B 4X1KA 3HKCB 2HP3A 4X20A 1PF5A 4X1IB 1YJWF 2EWCA 4BT6A 1VQMF 3RA5A 1TVKB 3IMPA 4TZZA 1K73H 1W5AA 3ESJA 2HRUA 2I6RA 3KHNA 4BVSA 4EB6A 3CMEF 4O4JB 4U39A 3HKBA 3RYFB 3QUWA 5AVMA 3RYCB 3D01A 4ZHVA 2PHNA 3SIUA 1YQNA 3JARB 5CA1A 4G4XA 3I7TA 3WGLA 5JQGB 2R6R1 1ZWZA 3N2GB 5EYPA 2VAMA 4X1KB 2OTMA 5EIBD 3RA6A 3LWOC 3G4SF 2IAFA 4NWOB 3BYQA 4WBNA 1K8AH 4C81A 3PLAC 3HJWC 3PAFA 5J2UA 3N4ZA 1GX1A 2W8BC 4YJ3A 1SA0A 5EIBC 2ALEA 2CSLA 3B6NA 3I3FA 2I6DA 3VYTC 2QEXF 2H8CA 3JALA 3SIVA 3D54A 1GO1A 5LA6A 2VAPA 3RYIA 2ZAUA 1W3EX 3HKDA 3QTYA 3HKEB 3VTIC 4O4HB 1NJIH 3LYBA 1N8RH 4TV8A 5KMGB 1IPAA 3N4YA 4BT2A 3S03A 3CCRF 3S06A 1KC8H 1S72F 1W41A 1FNJA 4YJ2B 1JN1A 2ZVZA 2HP0B 3M4SA 3P0ZA 2LBXA 5HXUA 3T80A 1FFXA 5HY1A 2OZBA 3JAWA 1H48A 5LP6A 2QA4F 2YYEA 5KX5A 5JH7B 4B5CA 3J81M 2RHLA 2GVIA 3IKFA 3Q8HA 3E22A 3R0PA 3GHZA 2Z1TA 1VQ6F 3MCAB 1IV4A 4IIJB 3N2KB 1UFYA 3UT5B 3MQWA 5LOVA 3V7QA 1U43A 5IJ0B 5FNVB 4O2AB 3FFMA 3TD5A 5LYJA 1Z5VA 3S02A 4I55A 5EAZA 1CLIA 1W581 3C8LA 3HKCA 5LP6C 4X1IA 3JAKB 3LWPC 3OBYA 5LP6B 2B33A 1TVKA 2FC3A 2H8EA 5HY0A 4ZK7A 1VQ8F 3IEQA 1VQPF 3P4EA 4EI7A 4ZHQB 1UI9A 3F6MA 3DDNA 2HVYD 3CXCF 3FD6A 3CC7F 1VQ9F 4O4JA 3RYFA 3RYHB 1W5EA 2BTQB 3J80M 3RYCA 2IG8A 3CC4F 1X25A 3ELCA 2YXZA 1QU9A 3JARA 3WJPA 1Q82H 3VO8A 3EORA 2GZLA 2UYJA 5JQGA 5HWEA 3K0TA 3N2GA 1NQ3A 2KTUA 2LCAA 1YJNF 3DC2A 4BVQA 5GIOC 4I50B 2IQQA 2OHWA 1QD9A 1YIJF 3WGJA 1YI2F 3M1XA 5G4UC 5BMVB 3CG6A 3S0WA 3JASB 4IHJB 1E7KA 4TUYB 3VYSC 5JVDB 5JCOC 3CCMF 4BY9D 3NK7A 5IYZB 3FPIA 3FBAA 2K1SA 3CC2F 3I55F 3QHDA 5C8YB 1M1KH 3HKEA 4LCKA 3CCLF 4O4HA 2G9IA 2P6YA 4BT3A 4C4WC 4ZHWA 3LFOA 5HXZA 3C9SA 4F6RB 2CVLA 3G71F 3KJJA 5G4VC 5KMGA 3LWVC 1XHOA 2QTPA 1X52A 1YJ9F 3CPQA 2NMUA 4XCQA 2CWJA 2L26A 1XV2A 2Q1YA 4BT4A 4YJ2A 2HP0A 1ODEA 1W40A 2H6LA 2VGNA 2MQEA 4TV9B 5GONB 4U3JB 3V3TA 4O4LB 5JH7A 1KNJA 1RQ7A 3CCEF 3HWUA 5CA0B 2BO1A 4EI9A 1COMA 5GANK 1KD1H 1X7OA 4IIJA 1K9MH 3N2KA 3CMAF 3HTNA 2F9ZC 4G88A 1Z5WA 1OFUA 3UT5A 4C8GA 1VQ5F 5IJ0A 5FNVA 4O2AA 3TD4A 2CHTA 2CW4A 1VQOF 1GO0A 2KG4A 4HNAB 4G4YA 3ERNA 3LWRC 3VMFB 2WALA 1VQ7F 1GZ0A 3RE3A 3S0HA 2AIZP 3IEWA 1TUBB 4NQ3A 1JJ2F 3JAKA 4B62A 3NMUC 1DT9A 3KJKA 3C9UA 4M8IA 3KE1A 3ZO8A 4C8IA 4C82A 2RHOA 4BVTA 5IT9M 4ZHQA 2ZODA 4I4TB 5EZYB 5HP7A 3F0GA 1KQSF 1JFFB 2HRYA 3C9RA 1QVGF 3RYHA 3NVIB 4DRXB 5EB0A 5MN5A 3K2XA 3ON1A 4R40B 1XRGA 2ZF8A 4NUTA 1OAPA 2HS0A 4FFBB 3VI6A 2LBWA 4I50A 2QI2A 3VCZA 3E20B 3C9TA 1PXWA 5BMVA 3JASA 4IHJA 5HP8A 4B46A 4TUYA 1W55A 5JVDA 2UYKA 2UYNA 5IYZA 4X3MA 3NVKE 4C8EA 5JCOA 2LBTA 5C8YA 3MCQA 3WXMB 3L7QA 5EB1B 1JY8A 5GIPC 4O4IB 3LWQC 1FNKA 3JATB 4X1YB 1YITF 4O2BB 2VGMA 2VXYA 4F6RA 1J7HA 1SZQA 3ZP7A 2BTOA 4LNUA 3WJRA 1W5FA 3VOBA 3LDTA 2Z1EA 2ZOVA 5GAPK 1VHAA 2UZHA 4TV9A 5GONA 3NK6A 4ZOLB 4U3JA 5ITZB 4B45A 4O4LA 2HS4A 3JAMM 2UYNB 2Z01A 1QVFF 3KIZA 5CA0A 4ZI7B 3ZP4A 1XBIA 5DCVA 1H7MA 2ZVYA 3E1YA 3WPWA 2KGWA 5FLXM 3MDOA 3CYQA 1W2BF 1RLGA 5MN4A 4LNUB 3K12A 1CK2A 3WPXA 1W57A 4HNAA 1Q8RA 5EWRA 5MN6A 1IV1A 2DYYA 3CPWF 5CB4B 2AIFA 4BT7A 3CCSF 2HX0A 5LXTB 1TUBA 3I56F 2OTLF 1CN7A 5HY2A 5J2TB 1VQVA 3OONA 1U3LA 4EI8A 2VAWA 3G6EF 4I4TA 5EZYA 3V4DA 5IJ9B 3P10A 1JFFA 3WGNA 2HQSC 4X20B 1U3PA 3WJQA 4DRXA 3CD6F 3F0FA 2Z1FA 4BT5A 2GLZA 2OTJF 3JVHA 1W59A 2FGYA 3F0DA 5A2QM 4RHAA 1H47A 4FFBA 1VQNF 3CCJF 4EB6B 3D00A 3CCUF 5GINC 3CCQF 3HKBB 3J7AR 1KNKA 5EO3A 1VQKF 2N48A 1SDSA 3K14A 5CA1B 1NMUB 1RQ2A 3CCVF 2Z1UA 1VH8A 4RQOA 5EYPB 3VIUA 2V9YA 1RA4A 4BW0B 4WBNB 1T0AA 1RLUA 4O4IA 3JATA 5J2UB 3VYUC 4YJ3B 2CHSA 3S0YA 3OBWA 2CZWA 4X1YA 4ERHA 1SA0B 1VQLF 3WGKA 3WGMA 1FSZA 4O2BA 1VQ4F 3TD3A 1IV3A 3IR9A 4X3LA 3JALB 3M84A 1T0KB 1X7PA 5LA6B 2R751 3JCMM 3IKEA 3RYIB 3HKDB 5FJ4C 1Q7YH 2RB9A 3MBMA 3O85A 5HY4A 4ZOLA 1ONIA 3GTZA 3HAXD 5ITZA 2BTUA 2HS3A 4TV8B 1DBFA 1JD1A
chains in the Genus database with same CATH topology
2CHSA 1FNJA 2UYNB 3L7QA 2IG8A 1X25A 1QU9A 1FNKA 3M4SA 1XRGA 3QUWA 3D01A 3ZP4A 2UYJA 3KJKA 1J7HA 3K0TA 3ZP7A 3VCZA 1COMA 3I7TA 1NQ3A 2UYPA 3LMEA 3ZOPA 3ZO8A 2CVLA 3V4DA 3KJJA 2B33A 1PF5A 1QD9A 2OTMA 2EWCA 3R0PA 3LYBA 5HP8A 1XHOA 3K12A 4NWOB 4ZK7A 5HP7A 3M1XA 2CWJA 2UYKA 1ONIA 3GTZA 1UI9A 1UFYA 2UYNA 2CHTA 2CW4A 1DBFA 1JD1A 1QAHA 3MQWA 2DYYA 1ODEA 2CSLA 3I3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHS A;  1FNJ A;  2UYN B;  3L7Q A;  2IG8 A;  1X25 A;  1QU9 A;  1FNK A;  3M4S A;  1XRG A;  3QUW A;  3D01 A;  3ZP4 A;  2UYJ A;  3KJK A;  1J7H A;  3K0T A;  3ZP7 A;  3VCZ A;  1COM A;  3I7T A;  1NQ3 A;  2UYP A;  3LME A;  3ZOP A;  3ZO8 A;  2CVL A;  3V4D A;  3KJJ A;  2B33 A;  1PF5 A;  1QD9 A;  2OTM A;  2EWC A;  3R0P A;  3LYB A;  5HP8 A;  1XHO A;  3K12 A;  4NWO B;  4ZK7 A;  5HP7 A;  3M1X A;  2CWJ A;  2UYK A;  1ONI A;  3GTZ A;  1UI9 A;  1UFY A;  2UYN A;  2CHT A;  2CW4 A;  1DBF A;  1JD1 A;  1QAH A;  3MQW A;  2DYY A;  1ODE A;  2CSL A;  3I3F A; 
#chains in the Genus database with same CATH topology
 3CYP B;  4ZI7 A;  3V7E A;  4G4Z A;  4PWT A;  3U0O A;  1IV2 A;  2Q1X A;  4DXD A;  4ZHY B;  2KTV A;  2RHH A;  1M90 H;  1FFX B;  3AGK A;  4KWE A;  3JAW B;  2UYP A;  3LME A;  3ZOP A;  1Q86 H;  1YGY A;  3VOA A;  5KX5 B;  1W5B A;  4E6E A;  1YHQ F;  3F0E A;  2RHJ A;  5B8F A;  3GYQ A;  2PMP A;  2JNB A;  3E22 B;  2AMT A;  5CB4 A;  1Q81 H;  4BVR A;  5LXT A;  4G4V A;  1QAH A;  3CB2 A;  2DT4 A;  1U40 A;  1W42 A;  5LOV B;  1R1M A;  4G4W A;  5J2T A;  3OW2 F;  3FD5 A;  5LYJ B;  5IJ9 A;  1VK3 A;  4I55 B;  4X1K A;  3HKC B;  2HP3 A;  4X20 A;  1PF5 A;  4X1I B;  1YJW F;  2EWC A;  4BT6 A;  1VQM F;  3RA5 A;  1TVK B;  3IMP A;  4TZZ A;  1K73 H;  1W5A A;  3ESJ A;  2HRU A;  2I6R A;  3KHN A;  4BVS A;  4EB6 A;  3CME F;  4O4J B;  4U39 A;  3HKB A;  3RYF B;  3QUW A;  5AVM A;  3RYC B;  3D01 A;  4ZHV A;  2PHN A;  3SIU A;  1YQN A;  3JAR B;  5CA1 A;  4G4X A;  3I7T A;  3WGL A;  5JQG B;  2R6R 1;  1ZWZ A;  3N2G B;  5EYP A;  2VAM A;  4X1K B;  2OTM A;  5EIB D;  3RA6 A;  3LWO C;  3G4S F;  2IAF A;  4NWO B;  3BYQ A;  4WBN A;  1K8A H;  4C81 A;  3PLA C;  3HJW C;  3PAF A;  5J2U A;  3N4Z A;  1GX1 A;  2W8B C;  4YJ3 A;  1SA0 A;  5EIB C;  2ALE A;  2CSL A;  3B6N A;  3I3F A;  2I6D A;  3VYT C;  2QEX F;  2H8C A;  3JAL A;  3SIV A;  3D54 A;  1GO1 A;  5LA6 A;  2VAP A;  3RYI A;  2ZAU A;  1W3E X;  3HKD A;  3QTY A;  3HKE B;  3VTI C;  4O4H B;  1NJI H;  3LYB A;  1N8R H;  4TV8 A;  5KMG B;  1IPA A;  3N4Y A;  4BT2 A;  3S03 A;  3CCR F;  3S06 A;  1KC8 H;  1S72 F;  1W41 A;  1FNJ A;  4YJ2 B;  1JN1 A;  2ZVZ A;  2HP0 B;  3M4S A;  3P0Z A;  2LBX A;  5HXU A;  3T80 A;  1FFX A;  5HY1 A;  2OZB A;  3JAW A;  1H48 A;  5LP6 A;  2QA4 F;  2YYE A;  5KX5 A;  5JH7 B;  4B5C A;  3J81 M;  2RHL A;  2GVI A;  3IKF A;  3Q8H A;  3E22 A;  3R0P A;  3GHZ A;  2Z1T A;  1VQ6 F;  3MCA B;  1IV4 A;  4IIJ B;  3N2K B;  1UFY A;  3UT5 B;  3MQW A;  5LOV A;  3V7Q A;  1U43 A;  5IJ0 B;  5FNV B;  4O2A B;  3FFM A;  3TD5 A;  5LYJ A;  1Z5V A;  3S02 A;  4I55 A;  5EAZ A;  1CLI A;  1W58 1;  3C8L A;  3HKC A;  5LP6 C;  4X1I A;  3JAK B;  3LWP C;  3OBY A;  5LP6 B;  2B33 A;  1TVK A;  2FC3 A;  2H8E A;  5HY0 A;  4ZK7 A;  1VQ8 F;  3IEQ A;  1VQP F;  3P4E A;  4EI7 A;  4ZHQ B;  1UI9 A;  3F6M A;  3DDN A;  2HVY D;  3CXC F;  3FD6 A;  3CC7 F;  1VQ9 F;  4O4J A;  3RYF A;  3RYH B;  1W5E A;  2BTQ B;  3J80 M;  3RYC A;  2IG8 A;  3CC4 F;  1X25 A;  3ELC A;  2YXZ A;  1QU9 A;  3JAR A;  3WJP A;  1Q82 H;  3VO8 A;  3EOR A;  2GZL A;  2UYJ A;  5JQG A;  5HWE A;  3K0T A;  3N2G A;  1NQ3 A;  2KTU A;  2LCA A;  1YJN F;  3DC2 A;  4BVQ A;  5GIO C;  4I50 B;  2IQQ A;  2OHW A;  1QD9 A;  1YIJ F;  3WGJ A;  1YI2 F;  3M1X A;  5G4U C;  5BMV B;  3CG6 A;  3S0W A;  3JAS B;  4IHJ B;  1E7K A;  4TUY B;  3VYS C;  5JVD B;  5JCO C;  3CCM F;  4BY9 D;  3NK7 A;  5IYZ B;  3FPI A;  3FBA A;  2K1S A;  3CC2 F;  3I55 F;  3QHD A;  5C8Y B;  1M1K H;  3HKE A;  4LCK A;  3CCL F;  4O4H A;  2G9I A;  2P6Y A;  4BT3 A;  4C4W C;  4ZHW A;  3LFO A;  5HXZ A;  3C9S A;  4F6R B;  2CVL A;  3G71 F;  3KJJ A;  5G4V C;  5KMG A;  3LWV C;  1XHO A;  2QTP A;  1X52 A;  1YJ9 F;  3CPQ A;  2NMU A;  4XCQ A;  2CWJ A;  2L26 A;  1XV2 A;  2Q1Y A;  4BT4 A;  4YJ2 A;  2HP0 A;  1ODE A;  1W40 A;  2H6L A;  2VGN A;  2MQE A;  4TV9 B;  5GON B;  4U3J B;  3V3T A;  4O4L B;  5JH7 A;  1KNJ A;  1RQ7 A;  3CCE F;  3HWU A;  5CA0 B;  2BO1 A;  4EI9 A;  1COM A;  5GAN K;  1KD1 H;  1X7O A;  4IIJ A;  1K9M H;  3N2K A;  3CMA F;  3HTN A;  2F9Z C;  4G88 A;  1Z5W A;  1OFU A;  3UT5 A;  4C8G A;  1VQ5 F;  5IJ0 A;  5FNV A;  4O2A A;  3TD4 A;  2CHT A;  2CW4 A;  1VQO F;  1GO0 A;  2KG4 A;  4HNA B;  4G4Y A;  3ERN A;  3LWR C;  3VMF B;  2WAL A;  1VQ7 F;  1GZ0 A;  3RE3 A;  3S0H A;  2AIZ P;  3IEW A;  1TUB B;  4NQ3 A;  1JJ2 F;  3JAK A;  4B62 A;  3NMU C;  1DT9 A;  3KJK A;  3C9U A;  4M8I A;  3KE1 A;  3ZO8 A;  4C8I A;  4C82 A;  2RHO A;  4BVT A;  5IT9 M;  4ZHQ A;  2ZOD A;  4I4T B;  5EZY B;  5HP7 A;  3F0G A;  1KQS F;  1JFF B;  2HRY A;  3C9R A;  1QVG F;  3RYH A;  3NVI B;  4DRX B;  5EB0 A;  5MN5 A;  3K2X A;  3ON1 A;  4R40 B;  1XRG A;  2ZF8 A;  4NUT A;  1OAP A;  2HS0 A;  4FFB B;  3VI6 A;  2LBW A;  4I50 A;  2QI2 A;  3VCZ A;  3E20 B;  3C9T A;  1PXW A;  5BMV A;  3JAS A;  4IHJ A;  5HP8 A;  4B46 A;  4TUY A;  1W55 A;  5JVD A;  2UYK A;  2UYN A;  5IYZ A;  4X3M A;  3NVK E;  4C8E A;  5JCO A;  2LBT A;  5C8Y A;  3MCQ A;  3WXM B;  3L7Q A;  5EB1 B;  1JY8 A;  5GIP C;  4O4I B;  3LWQ C;  1FNK A;  3JAT B;  4X1Y B;  1YIT F;  4O2B B;  2VGM A;  2VXY A;  4F6R A;  1J7H A;  1SZQ A;  3ZP7 A;  2BTO A;  4LNU A;  3WJR A;  1W5F A;  3VOB A;  3LDT A;  2Z1E A;  2ZOV A;  5GAP K;  1VHA A;  2UZH A;  4TV9 A;  5GON A;  3NK6 A;  4ZOL B;  4U3J A;  5ITZ B;  4B45 A;  4O4L A;  2HS4 A;  3JAM M;  2UYN B;  2Z01 A;  1QVF F;  3KIZ A;  5CA0 A;  4ZI7 B;  3ZP4 A;  1XBI A;  5DCV A;  1H7M A;  2ZVY A;  3E1Y A;  3WPW A;  2KGW A;  5FLX M;  3MDO A;  3CYQ A;  1W2B F;  1RLG A;  5MN4 A;  4LNU B;  3K12 A;  1CK2 A;  3WPX A;  1W57 A;  4HNA A;  1Q8R A;  5EWR A;  5MN6 A;  1IV1 A;  2DYY A;  3CPW F;  5CB4 B;  2AIF A;  4BT7 A;  3CCS F;  2HX0 A;  5LXT B;  1TUB A;  3I56 F;  2OTL F;  1CN7 A;  5HY2 A;  5J2T B;  1VQV A;  3OON A;  1U3L A;  4EI8 A;  2VAW A;  3G6E F;  4I4T A;  5EZY A;  3V4D A;  5IJ9 B;  3P10 A;  1JFF A;  3WGN A;  2HQS C;  4X20 B;  1U3P A;  3WJQ A;  4DRX A;  3CD6 F;  3F0F A;  2Z1F A;  4BT5 A;  2GLZ A;  2OTJ F;  3JVH A;  1W59 A;  2FGY A;  3F0D A;  5A2Q M;  4RHA A;  1H47 A;  4FFB A;  1VQN F;  3CCJ F;  4EB6 B;  3D00 A;  3CCU F;  5GIN C;  3CCQ F;  3HKB B;  3J7A R;  1KNK A;  5EO3 A;  1VQK F;  2N48 A;  1SDS A;  3K14 A;  5CA1 B;  1NMU B;  1RQ2 A;  3CCV F;  2Z1U A;  1VH8 A;  4RQO A;  5EYP B;  3VIU A;  2V9Y A;  1RA4 A;  4BW0 B;  4WBN B;  1T0A A;  1RLU A;  4O4I A;  3JAT A;  5J2U B;  3VYU C;  4YJ3 B;  2CHS A;  3S0Y A;  3OBW A;  2CZW A;  4X1Y A;  4ERH A;  1SA0 B;  1VQL F;  3WGK A;  3WGM A;  1FSZ A;  4O2B A;  1VQ4 F;  3TD3 A;  1IV3 A;  3IR9 A;  4X3L A;  3JAL B;  3M84 A;  1T0K B;  1X7P A;  5LA6 B;  2R75 1;  3JCM M;  3IKE A;  3RYI B;  3HKD B;  5FJ4 C;  1Q7Y H;  2RB9 A;  3MBM A;  3O85 A;  5HY4 A;  4ZOL A;  1ONI A;  3GTZ A;  3HAX D;  5ITZ A;  2BTU A;  2HS3 A;  4TV8 B;  1DBF A;  1JD1 A; 
#chains in the Genus database with same CATH homology
 2CHS A;  1FNJ A;  2UYN B;  3L7Q A;  2IG8 A;  1X25 A;  1QU9 A;  1FNK A;  3M4S A;  1XRG A;  3QUW A;  3D01 A;  3ZP4 A;  2UYJ A;  3KJK A;  1J7H A;  3K0T A;  3ZP7 A;  3VCZ A;  1COM A;  3I7T A;  1NQ3 A;  2UYP A;  3LME A;  3ZOP A;  3ZO8 A;  2CVL A;  3V4D A;  3KJJ A;  2B33 A;  1PF5 A;  1QD9 A;  2OTM A;  2EWC A;  3R0P A;  3LYB A;  5HP8 A;  1XHO A;  3K12 A;  4NWO B;  4ZK7 A;  5HP7 A;  3M1X A;  2CWJ A;  2UYK A;  1ONI A;  3GTZ A;  1UI9 A;  1UFY A;  2UYN A;  2CHT A;  2CW4 A;  1DBF A;  1JD1 A;  1QAH A;  3MQW A;  2DYY A;  1ODE A;  2CSL A;  3I3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...