3G6EF

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g6eF00
3CC2F 1H7MA 3SIUA 3CCQF 5GIOC 3RA5A 3NVIB 1CK2A 3CC4F 1SDSA 3CMEF 3N4ZA 3G4SF 1XBIA 3CXCF 3CCSF 2LBXA 1YHQF 3JCMM 1YJWF 1QVFF 3AGKA 3CCRF 4C4WC 3LWRC 2JNBA 1Q86H 1GO0A 5GANK 1NMUB 1M90H 1W41A 3PAFA 4TZZA 3E20B 2KTUA 3I56F 1VQ9F 3LWVC 3HJWC 1VQ4F 2OTLF 1K73H 1DT9A 1Q7YH 2QI2A 2KTVA 3RA6A 3CCMF 3CD6F 3J80M 3LWPC 1W42A 2LBWA 2KG4A 3G6EF 1YIJF 1JJ2F 3PLAC 3SIVA 1W3EX 3CCVF 4BW0B 2OZBA 1VQMF 2QEXF 3NK6A 3V7EA 1KQSF 1Q82H 1YITF 3CMAF 1GO1A 1W2BF 3OW2F 3ON1A 2WALA 1VQKF 1VQ6F 5G4VC 2OHWA 2VGNA 1S72F 3NVKE 4BY9D 3CC7F 3J7AR 2ALEA 1VQLF 1W40A 3NMUC 1VQ8F 1QVGF 2QA4F 1VQOF 1VQ5F 5FLXM 2AIFA 3IR9A 5GINC 2CZWA 3VMFB 3GYQA 1X52A 4X3LA 1E7KA 5DCVA 2OTJF 4LCKA 1T0KB 1ZWZA 1K8AH 1Q81H 2HVYD 5FJ4C 3LFOA 1GZ0A 3V7QA 2BO1A 3CPWF 1PXWA 3CCUF 2VGMA 3MCAB 5EWRA 3LWOC 1K9MH 2I6DA 3CG6A 4X3MA 3G71F 1NJIH 3OBWA 1VQ7F 3I55F 3LWQC 5GIPC 5A2QM 3CCLF 3FFMA 3CPQA 5EO3A 1CN7A 1X7PA 1RLGA 3OBYA 1VQPF 2FC3A 3O85A 3J81M 3VI6A 5GAPK 5IT9M 1YJNF 3E1YA 3JAMM 3WXMB 3HAXD 5G4UC 1N8RH 3N4YA 3CCJF 1KD1H 1KC8H 1VQNF 1IPAA 1YI2F 1X7OA 3CCEF 1YJ9F 3NK7A 1M1KH 1RA4A 4NUTA
chains in the Genus database with same CATH superfamily
1JY8A 3GTZA 3N2GB 1W5AA 1W5EA 3VYUC 3CMEF 4X1KB 3CXCF 4IIJA 1W5BA 3DDNA 1VHAA 4TV9A 1KNJA 4BT4A 4X1YB 3S0HA 4DRXA 1NMUB 4U3JB 3LMEA 4XCQA 1M90H 3PAFA 4IHJA 1IV4A 3MBMA 5JH7B 1W55A 3ESJA 5J2TA 1VQ9F 1KNKA 3HJWC 2B33A 2CW4A 1VQ4F 2GLZA 1Q7YH 2ZVZA 3QUWA 2KTVA 3S06A 3F0FA 2AMTA 3CD6F 3IMPA 5C8YA 3I3FA 2P6YA 1JFFA 2KG4A 3JALB 3G6EF 3PLAC 4B62A 1W3EX 5CB4A 2OZBA 1U3LA 5IYZA 4DRXB 5KMGA 1YITF 1Q82H 3RYIB 4IHJB 3OW2F 3ON1A 5GONB 5J2TB 5G4VC 2OHWA 1S72F 3TD5A 4BY9D 3CC7F 5MN6A 3NMUC 3C9UA 1VQ8F 3TD4A 1VQ5F 1COMA 5C8YB 1PF5A 4BT6A 5MN4A 1QU9A 3JATB 4C8GA 5CB4B 2F9ZC 2CZWA 3HWUA 4X3LA 1E7KA 4O4IB 3IKEA 5DCVA 1T0KB 1ZWZA 1Q81H 4B46A 2HVYD 1GZ0A 4X1IA 3S02A 2GZLA 3VO8A 2VGMA 3M1XA 2IG8A 1W57A 1DBFA 3LWOC 2I6DA 3S03A 1Z5VA 2Z1UA 2ZOVA 5EYPA 3VOBA 1VQ7F 1ODEA 2ZF8A 1W59A 3IEQA 5GIPC 3HKBA 4LNUA 4BT7A 3HKCA 3JAKA 3RE3A 5EO3A 4PWTA 4X1IB 1X7PA 5JVDB 3OBYA 1Q8RA 3VIUA 3VI6A 1JN1A 3V4DA 3GHZA 5LP6A 3WJQA 3CYQA 3WXMB 3HAXD 5JQGA 5G4UC 2IAFA 1N8RH 5LP6C 3N4YA 3K2XA 4O2BA 1U40A 3HKBB 1X7OA 4LNUB 3HKCB 1R1MA 3JAKB 3JARB 3ZP4A 4C81A 1RA4A 2CWJA 2CHSA 4G4WA 2DYYA 3N2KA 2Z1EA 4TV8A 4RHAA 4BT3A 3P4EA 4B45A 2CHTA 5FNVB 3FD6A 3QTYA 3SIUA 4G4VA 3JAWA 3WGLA 1W581 3NVIB 3E22A 4EB6B 1SDSA 1XBIA 5JQGB 3C9TA 5HY0A 3CCSF 3N2GA 2RB9A 2KGWA 1FFXB 4O4HA 2HX0A 4O2BB 1QVFF 3AGKA 2OTMA 4C4WC 2W8BC 3V3TA 1Q86H 4M8IA 4X1KA 4DXDA 5GANK 3WGMA 4TV8B 1TVKB 3E20B 3P0ZA 4ZK7A 2KTUA 3I56F 2VAWA 4I50A 2OTLF 5AVMA 3JAWB 4U3JA 1K73H 4EI8A 5JH7A 2PMPA 3CCMF 2HS4A 3J80M 2ZODA 4O4HB 2LBWA 3VYSC 4NQ3A 1JJ2F 3SIVA 3QHDA 3MCQA 3RYFB 4BW0B 3WJPA 3CCVF 3TD3A 5EB1B 2QEXF 3V7EA 1KQSF 3M4SA 3CMAF 3MQWA 3JALA 1IV3A 5EB0A 3WGKA 2H8CA 4G4XA 3M84A 4I50B 3FBAA 3D54A 5KX5A 2ALEA 3RYIA 1VQLF 5GONA 3C8LA 3F6MA 2AIFA 3CYPB 2LBTA 5HY2A 3GYQA 1X52A 3R0PA 5J2UA 2Q1YA 4BVTA 2OTJF 4LCKA 1VH8A 3JATA 5LYJB 1K8AH 2RHHA 2CSLA 2IQQA 3C9RA 5CA1B 4O4IA 3V7QA 5KX5B 2BO1A 3CPWF 1PXWA 3CCUF 1TUBA 3MDOA 4C8IA 2ZAUA 5IJ0B 3MCAB 5LOVB 4X20B 1QD9A 1K9MH 2HRUA 2H6LA 2VAPA 4ZOLB 2R6R1 5LA6A 1IV2A 3G71F 1NJIH 3OBWA 3JASB 5J2UB 2UZHA 3FFMA 3T80A 2AIZP 3WGNA 5B8FA 2DT4A 3BYQA 1VQPF 3J81M 1TUBB 5CA0A 3ZP7A 1GX1A 5EZYA 3EORA 2UYNB 5HY1A 5LXTA 5LA6B 3HKEA 2HS3A 3CCJF 2L26A 1OFUA 2YYEA 1VQNF 1IPAA 2HS0A 2I6RA 3ERNA 3NK7A 1M1KH 1VK3A 1UFYA 1YGYA 1VQOF 3RYHB 2LCAA 5CA0B 3CC2F 1FNJA 3VYTC 3JARA 5EZYB 3CC4F 5LXTB 3Q8HA 3HKEB 1YHQF 1H47A 3JCMM 4RQOA 5FNVA 3CCRF 4E6EA 4EB6A 1GO0A 3B6NA 2G9IA 1FFXA 4TZZA 1H48A 3LWVC 3ELCA 1TVKA 2QI2A 2HP0A 3RA6A 1OAPA 1VQVA 4R40B 1JD1A 3RYCB 1VQMF 2Z1TA 4YJ3B 1CLIA 1GO1A 5HWEA 2WALA 3RYFA 5HP8A 3NVKE 4I55B 3U0OA 2BTUA 3UT5B 5MN5A 2HP0B 4ZI7A 5FLXM 3VTIC 4C8EA 3FPIA 5GINC 4I4TB 1U43A 2Z1FA 5EAZA 3LYBA 5HXZA 5FJ4C 3LFOA 5EIBD 2VAMA 4BT2A 2MQEA 1T0AA 1W5FA 5LYJA 4ZI7B 4ZHWA 5ITZB 5CA1A 3CG6A 2QTPA 2Q1XA 1XRGA 5IJ0A 2NMUA 5LOVA 3I55F 2V9YA 2UYKA 2EWCA 4X20A 2RHLA 3CCLF 4ZOLA 1YQNA 3KHNA 4G4ZA 3ZOPA 3JASA 3L7QA 4YJ2A 5IT9M 4TUYA 1YJNF 3WPXA 3K0TA 3JAMM 3S0WA 4WBNB 4BVRA 1KC8H 5IJ9A 1YI2F 3CCEF 3C9SA 2UYNA 4ZHQA 1YJ9F 4F6RA 4O4JA 2FGYA 2R751 2CVLA 4IIJB 2RHOA 3OONA 3F0GA 4TV9B 1H7MA 3LDTA 4YJ2B 3IEWA 4TUYB 5HP7A 5GIOC 3CCQF 3RA5A 1CK2A 1NQ3A 3N4ZA 3D00A 1IV1A 3G4SF 5HY4A 2LBXA 3RYHA 4ZHVA 3JVHA 5EIBC 3WGJA 4C82A 1YJWF 3KJKA 3P10A 5IJ9B 2K1SA 4ZHYB 1RQ7A 3LWRC 2JNBA 4ZHQB 3KJJA 4F6RB 3HTNA 1W41A 4O4JB 1RQ2A 3F0DA 1JFFB 1DT9A 1FNKA 2YXZA 1FSZA 1QAHA 3WJRA 4KWEA 5IYZB 5JCOA 5KMGB 1W42A 3HKDA 4G88A 4NWOB 1YIJF 4ERHA 5JCOC 3NK6A 1W2BF 3WPWA 3DC2A 1VQKF 1VQ6F 4FFBA 2VGNA 3RYCA 2HQSC 3J7AR 2Z01A 4YJ3A 1W40A 1QVGF 2QA4F 5BMVA 4O2AA 3HKDB 1RLUA 3K12A 4I55A 3IR9A 2PHNA 3UT5A 4U39A 3VMFB 4EI7A 3KIZA 2VXYA 4HNAA 4BVSA 2BTOA 2HRYA 4FFBB 4G4YA 3FD5A 4I4TA 3ZO8A 1ONIA 3KE1A 3IKFA 5EYPB 4EI9A 5HXUA 1XHOA 5EWRA 5BMVB 4O2AB 3VOAA 3I7TA 4X3MA 1XV2A 1SA0A 3VCZA 1J7HA 4B5CA 3LWQC 5ITZA 5A2QM 3F0EA 2ZVYA 4HNAB 3CPQA 5LP6B 4O4LA 5JVDA 1CN7A 2RHJA 3CB2A 1RLGA 2FC3A 3O85A 3D01A 1U3PA 2UYPA 5GAPK 3E1YA 2GVIA 1SA0B 1Z5WA 4BVQA 2H8EA 1X25A 2BTQB 4BT5A 3K14A 3N2KB 1KD1H 1UI9A 2N48A 1SZQA 3S0YA 4X1YA 2UYJA 2HP3A 4NUTA 3LWPC 4O4LB 3E22B 4WBNA
chains in the Genus database with same CATH topology
3CC2F 1H7MA 3SIUA 3CCQF 5GIOC 3RA5A 3NVIB 1CK2A 3CC4F 1SDSA 3CMEF 3N4ZA 3D00A 3G4SF 1XBIA 3CXCF 5HY0A 5HY4A 3CCSF 2LBXA 1YHQF 3JCMM 1YJWF 1QVFF 3AGKA 3CCRF 4C4WC 3V3TA 3LWRC 2JNBA 1Q86H 1GO0A 5GANK 1NMUB 4XCQA 1W41A 3PAFA 4TZZA 3E20B 1M90H 2KTUA 3I56F 1VQ9F 3LWVC 3HJWC 1VQ4F 2GLZA 2OTLF 1K73H 1DT9A 1Q7YH 4EI8A 2QI2A 2KTVA 3RA6A 3CCMF 3CD6F 3J80M 3LWPC 1W42A 2LBWA 2KG4A 4NQ3A 3G6EF 1YIJF 1JJ2F 3PLAC 3SIVA 1W3EX 3CCVF 4BW0B 2OZBA 1VQMF 2QEXF 3NK6A 3V7EA 1KQSF 1Q82H 1YITF 3CMAF 1GO1A 1W2BF 3OW2F 5HWEA 3ON1A 2WALA 1VQKF 1VQ6F 5G4VC 2OHWA 2VGNA 1S72F 3NVKE 4BY9D 3CC7F 3J7AR 2ALEA 1VQLF 1W40A 3NMUC 1VQ8F 1QVGF 2QA4F 1VQOF 1VQ5F 5FLXM 2AIFA 3IR9A 5GINC 2F9ZC 5HY2A 2CZWA 4EI7A 3VMFB 3GYQA 1X52A 4X3LA 1E7KA 5DCVA 4BVTA 2OTJF 4LCKA 1T0KB 1ZWZA 1K8AH 1Q81H 4BVSA 2HVYD 5HXZA 5FJ4C 3LFOA 1GZ0A 3V7QA 2BO1A 3CPWF 1PXWA 3CCUF 2VGMA 5HXUA 4EI9A 3MCAB 5EWRA 3LWOC 1K9MH 2I6DA 3CG6A 4X3MA 3G71F 1NJIH 3OBWA 1VQ7F 3I55F 3LWQC 5GIPC 5A2QM 3CCLF 3FFMA 3CPQA 5EO3A 1CN7A 1X7PA 1RLGA 3OBYA 1VQPF 2FC3A 3O85A 3J81M 3VI6A 5GAPK 5IT9M 1YJNF 3E1YA 3JAMM 5HY1A 3WXMB 4BVQA 3HAXD 5G4UC 1N8RH 3N4YA 3CCJF 1KD1H 4BVRA 1KC8H 1VQNF 1IPAA 1YI2F 1X7OA 3CCEF 1YJ9F 3NK7A 1M1KH 1RA4A 4NUTA 2FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 F;  1H7M A;  3SIU A;  3CCQ F;  5GIO C;  3RA5 A;  3NVI B;  1CK2 A;  3CC4 F;  1SDS A;  3CME F;  3N4Z A;  3G4S F;  1XBI A;  3CXC F;  3CCS F;  2LBX A;  1YHQ F;  3JCM M;  1YJW F;  1QVF F;  3AGK A;  3CCR F;  4C4W C;  3LWR C;  2JNB A;  1Q86 H;  1GO0 A;  5GAN K;  1NMU B;  1M90 H;  1W41 A;  3PAF A;  4TZZ A;  3E20 B;  2KTU A;  3I56 F;  1VQ9 F;  3LWV C;  3HJW C;  1VQ4 F;  2OTL F;  1K73 H;  1DT9 A;  1Q7Y H;  2QI2 A;  2KTV A;  3RA6 A;  3CCM F;  3CD6 F;  3J80 M;  3LWP C;  1W42 A;  2LBW A;  2KG4 A;  3G6E F;  1YIJ F;  1JJ2 F;  3PLA C;  3SIV A;  1W3E X;  3CCV F;  4BW0 B;  2OZB A;  1VQM F;  2QEX F;  3NK6 A;  3V7E A;  1KQS F;  1Q82 H;  1YIT F;  3CMA F;  1GO1 A;  1W2B F;  3OW2 F;  3ON1 A;  2WAL A;  1VQK F;  1VQ6 F;  5G4V C;  2OHW A;  2VGN A;  1S72 F;  3NVK E;  4BY9 D;  3CC7 F;  3J7A R;  2ALE A;  1VQL F;  1W40 A;  3NMU C;  1VQ8 F;  1QVG F;  2QA4 F;  1VQO F;  1VQ5 F;  5FLX M;  2AIF A;  3IR9 A;  5GIN C;  2CZW A;  3VMF B;  3GYQ A;  1X52 A;  4X3L A;  1E7K A;  5DCV A;  2OTJ F;  4LCK A;  1T0K B;  1ZWZ A;  1K8A H;  1Q81 H;  2HVY D;  5FJ4 C;  3LFO A;  1GZ0 A;  3V7Q A;  2BO1 A;  3CPW F;  1PXW A;  3CCU F;  2VGM A;  3MCA B;  5EWR A;  3LWO C;  1K9M H;  2I6D A;  3CG6 A;  4X3M A;  3G71 F;  1NJI H;  3OBW A;  1VQ7 F;  3I55 F;  3LWQ C;  5GIP C;  5A2Q M;  3CCL F;  3FFM A;  3CPQ A;  5EO3 A;  1CN7 A;  1X7P A;  1RLG A;  3OBY A;  1VQP F;  2FC3 A;  3O85 A;  3J81 M;  3VI6 A;  5GAP K;  5IT9 M;  1YJN F;  3E1Y A;  3JAM M;  3WXM B;  3HAX D;  5G4U C;  1N8R H;  3N4Y A;  3CCJ F;  1KD1 H;  1KC8 H;  1VQN F;  1IPA A;  1YI2 F;  1X7O A;  3CCE F;  1YJ9 F;  3NK7 A;  1M1K H;  1RA4 A;  4NUT A; 
#chains in the Genus database with same CATH topology
 1JY8 A;  3GTZ A;  3N2G B;  1W5A A;  1W5E A;  3VYU C;  3CME F;  4X1K B;  3CXC F;  4IIJ A;  1W5B A;  3DDN A;  1VHA A;  4TV9 A;  1KNJ A;  4BT4 A;  4X1Y B;  3S0H A;  4DRX A;  1NMU B;  4U3J B;  3LME A;  4XCQ A;  1M90 H;  3PAF A;  4IHJ A;  1IV4 A;  3MBM A;  5JH7 B;  1W55 A;  3ESJ A;  5J2T A;  1VQ9 F;  1KNK A;  3HJW C;  2B33 A;  2CW4 A;  1VQ4 F;  2GLZ A;  1Q7Y H;  2ZVZ A;  3QUW A;  2KTV A;  3S06 A;  3F0F A;  2AMT A;  3CD6 F;  3IMP A;  5C8Y A;  3I3F A;  2P6Y A;  1JFF A;  2KG4 A;  3JAL B;  3G6E F;  3PLA C;  4B62 A;  1W3E X;  5CB4 A;  2OZB A;  1U3L A;  5IYZ A;  4DRX B;  5KMG A;  1YIT F;  1Q82 H;  3RYI B;  4IHJ B;  3OW2 F;  3ON1 A;  5GON B;  5J2T B;  5G4V C;  2OHW A;  1S72 F;  3TD5 A;  4BY9 D;  3CC7 F;  5MN6 A;  3NMU C;  3C9U A;  1VQ8 F;  3TD4 A;  1VQ5 F;  1COM A;  5C8Y B;  1PF5 A;  4BT6 A;  5MN4 A;  1QU9 A;  3JAT B;  4C8G A;  5CB4 B;  2F9Z C;  2CZW A;  3HWU A;  4X3L A;  1E7K A;  4O4I B;  3IKE A;  5DCV A;  1T0K B;  1ZWZ A;  1Q81 H;  4B46 A;  2HVY D;  1GZ0 A;  4X1I A;  3S02 A;  2GZL A;  3VO8 A;  2VGM A;  3M1X A;  2IG8 A;  1W57 A;  1DBF A;  3LWO C;  2I6D A;  3S03 A;  1Z5V A;  2Z1U A;  2ZOV A;  5EYP A;  3VOB A;  1VQ7 F;  1ODE A;  2ZF8 A;  1W59 A;  3IEQ A;  5GIP C;  3HKB A;  4LNU A;  4BT7 A;  3HKC A;  3JAK A;  3RE3 A;  5EO3 A;  4PWT A;  4X1I B;  1X7P A;  5JVD B;  3OBY A;  1Q8R A;  3VIU A;  3VI6 A;  1JN1 A;  3V4D A;  3GHZ A;  5LP6 A;  3WJQ A;  3CYQ A;  3WXM B;  3HAX D;  5JQG A;  5G4U C;  2IAF A;  1N8R H;  5LP6 C;  3N4Y A;  3K2X A;  4O2B A;  1U40 A;  3HKB B;  1X7O A;  4LNU B;  3HKC B;  1R1M A;  3JAK B;  3JAR B;  3ZP4 A;  4C81 A;  1RA4 A;  2CWJ A;  2CHS A;  4G4W A;  2DYY A;  3N2K A;  2Z1E A;  4TV8 A;  4RHA A;  4BT3 A;  3P4E A;  4B45 A;  2CHT A;  5FNV B;  3FD6 A;  3QTY A;  3SIU A;  4G4V A;  3JAW A;  3WGL A;  1W58 1;  3NVI B;  3E22 A;  4EB6 B;  1SDS A;  1XBI A;  5JQG B;  3C9T A;  5HY0 A;  3CCS F;  3N2G A;  2RB9 A;  2KGW A;  1FFX B;  4O4H A;  2HX0 A;  4O2B B;  1QVF F;  3AGK A;  2OTM A;  4C4W C;  2W8B C;  3V3T A;  1Q86 H;  4M8I A;  4X1K A;  4DXD A;  5GAN K;  3WGM A;  4TV8 B;  1TVK B;  3E20 B;  3P0Z A;  4ZK7 A;  2KTU A;  3I56 F;  2VAW A;  4I50 A;  2OTL F;  5AVM A;  3JAW B;  4U3J A;  1K73 H;  4EI8 A;  5JH7 A;  2PMP A;  3CCM F;  2HS4 A;  3J80 M;  2ZOD A;  4O4H B;  2LBW A;  3VYS C;  4NQ3 A;  1JJ2 F;  3SIV A;  3QHD A;  3MCQ A;  3RYF B;  4BW0 B;  3WJP A;  3CCV F;  3TD3 A;  5EB1 B;  2QEX F;  3V7E A;  1KQS F;  3M4S A;  3CMA F;  3MQW A;  3JAL A;  1IV3 A;  5EB0 A;  3WGK A;  2H8C A;  4G4X A;  3M84 A;  4I50 B;  3FBA A;  3D54 A;  5KX5 A;  2ALE A;  3RYI A;  1VQL F;  5GON A;  3C8L A;  3F6M A;  2AIF A;  3CYP B;  2LBT A;  5HY2 A;  3GYQ A;  1X52 A;  3R0P A;  5J2U A;  2Q1Y A;  4BVT A;  2OTJ F;  4LCK A;  1VH8 A;  3JAT A;  5LYJ B;  1K8A H;  2RHH A;  2CSL A;  2IQQ A;  3C9R A;  5CA1 B;  4O4I A;  3V7Q A;  5KX5 B;  2BO1 A;  3CPW F;  1PXW A;  3CCU F;  1TUB A;  3MDO A;  4C8I A;  2ZAU A;  5IJ0 B;  3MCA B;  5LOV B;  4X20 B;  1QD9 A;  1K9M H;  2HRU A;  2H6L A;  2VAP A;  4ZOL B;  2R6R 1;  5LA6 A;  1IV2 A;  3G71 F;  1NJI H;  3OBW A;  3JAS B;  5J2U B;  2UZH A;  3FFM A;  3T80 A;  2AIZ P;  3WGN A;  5B8F A;  2DT4 A;  3BYQ A;  1VQP F;  3J81 M;  1TUB B;  5CA0 A;  3ZP7 A;  1GX1 A;  5EZY A;  3EOR A;  2UYN B;  5HY1 A;  5LXT A;  5LA6 B;  3HKE A;  2HS3 A;  3CCJ F;  2L26 A;  1OFU A;  2YYE A;  1VQN F;  1IPA A;  2HS0 A;  2I6R A;  3ERN A;  3NK7 A;  1M1K H;  1VK3 A;  1UFY A;  1YGY A;  1VQO F;  3RYH B;  2LCA A;  5CA0 B;  3CC2 F;  1FNJ A;  3VYT C;  3JAR A;  5EZY B;  3CC4 F;  5LXT B;  3Q8H A;  3HKE B;  1YHQ F;  1H47 A;  3JCM M;  4RQO A;  5FNV A;  3CCR F;  4E6E A;  4EB6 A;  1GO0 A;  3B6N A;  2G9I A;  1FFX A;  4TZZ A;  1H48 A;  3LWV C;  3ELC A;  1TVK A;  2QI2 A;  2HP0 A;  3RA6 A;  1OAP A;  1VQV A;  4R40 B;  1JD1 A;  3RYC B;  1VQM F;  2Z1T A;  4YJ3 B;  1CLI A;  1GO1 A;  5HWE A;  2WAL A;  3RYF A;  5HP8 A;  3NVK E;  4I55 B;  3U0O A;  2BTU A;  3UT5 B;  5MN5 A;  2HP0 B;  4ZI7 A;  5FLX M;  3VTI C;  4C8E A;  3FPI A;  5GIN C;  4I4T B;  1U43 A;  2Z1F A;  5EAZ A;  3LYB A;  5HXZ A;  5FJ4 C;  3LFO A;  5EIB D;  2VAM A;  4BT2 A;  2MQE A;  1T0A A;  1W5F A;  5LYJ A;  4ZI7 B;  4ZHW A;  5ITZ B;  5CA1 A;  3CG6 A;  2QTP A;  2Q1X A;  1XRG A;  5IJ0 A;  2NMU A;  5LOV A;  3I55 F;  2V9Y A;  2UYK A;  2EWC A;  4X20 A;  2RHL A;  3CCL F;  4ZOL A;  1YQN A;  3KHN A;  4G4Z A;  3ZOP A;  3JAS A;  3L7Q A;  4YJ2 A;  5IT9 M;  4TUY A;  1YJN F;  3WPX A;  3K0T A;  3JAM M;  3S0W A;  4WBN B;  4BVR A;  1KC8 H;  5IJ9 A;  1YI2 F;  3CCE F;  3C9S A;  2UYN A;  4ZHQ A;  1YJ9 F;  4F6R A;  4O4J A;  2FGY A;  2R75 1;  2CVL A;  4IIJ B;  2RHO A;  3OON A;  3F0G A;  4TV9 B;  1H7M A;  3LDT A;  4YJ2 B;  3IEW A;  4TUY B;  5HP7 A;  5GIO C;  3CCQ F;  3RA5 A;  1CK2 A;  1NQ3 A;  3N4Z A;  3D00 A;  1IV1 A;  3G4S F;  5HY4 A;  2LBX A;  3RYH A;  4ZHV A;  3JVH A;  5EIB C;  3WGJ A;  4C82 A;  1YJW F;  3KJK A;  3P10 A;  5IJ9 B;  2K1S A;  4ZHY B;  1RQ7 A;  3LWR C;  2JNB A;  4ZHQ B;  3KJJ A;  4F6R B;  3HTN A;  1W41 A;  4O4J B;  1RQ2 A;  3F0D A;  1JFF B;  1DT9 A;  1FNK A;  2YXZ A;  1FSZ A;  1QAH A;  3WJR A;  4KWE A;  5IYZ B;  5JCO A;  5KMG B;  1W42 A;  3HKD A;  4G88 A;  4NWO B;  1YIJ F;  4ERH A;  5JCO C;  3NK6 A;  1W2B F;  3WPW A;  3DC2 A;  1VQK F;  1VQ6 F;  4FFB A;  2VGN A;  3RYC A;  2HQS C;  3J7A R;  2Z01 A;  4YJ3 A;  1W40 A;  1QVG F;  2QA4 F;  5BMV A;  4O2A A;  3HKD B;  1RLU A;  3K12 A;  4I55 A;  3IR9 A;  2PHN A;  3UT5 A;  4U39 A;  3VMF B;  4EI7 A;  3KIZ A;  2VXY A;  4HNA A;  4BVS A;  2BTO A;  2HRY A;  4FFB B;  4G4Y A;  3FD5 A;  4I4T A;  3ZO8 A;  1ONI A;  3KE1 A;  3IKF A;  5EYP B;  4EI9 A;  5HXU A;  1XHO A;  5EWR A;  5BMV B;  4O2A B;  3VOA A;  3I7T A;  4X3M A;  1XV2 A;  1SA0 A;  3VCZ A;  1J7H A;  4B5C A;  3LWQ C;  5ITZ A;  5A2Q M;  3F0E A;  2ZVY A;  4HNA B;  3CPQ A;  5LP6 B;  4O4L A;  5JVD A;  1CN7 A;  2RHJ A;  3CB2 A;  1RLG A;  2FC3 A;  3O85 A;  3D01 A;  1U3P A;  2UYP A;  5GAP K;  3E1Y A;  2GVI A;  1SA0 B;  1Z5W A;  4BVQ A;  2H8E A;  1X25 A;  2BTQ B;  4BT5 A;  3K14 A;  3N2K B;  1KD1 H;  1UI9 A;  2N48 A;  1SZQ A;  3S0Y A;  4X1Y A;  2UYJ A;  2HP3 A;  4NUT A;  3LWP C;  4O4L B;  3E22 B;  4WBN A; 
#chains in the Genus database with same CATH homology
 3CC2 F;  1H7M A;  3SIU A;  3CCQ F;  5GIO C;  3RA5 A;  3NVI B;  1CK2 A;  3CC4 F;  1SDS A;  3CME F;  3N4Z A;  3D00 A;  3G4S F;  1XBI A;  3CXC F;  5HY0 A;  5HY4 A;  3CCS F;  2LBX A;  1YHQ F;  3JCM M;  1YJW F;  1QVF F;  3AGK A;  3CCR F;  4C4W C;  3V3T A;  3LWR C;  2JNB A;  1Q86 H;  1GO0 A;  5GAN K;  1NMU B;  4XCQ A;  1W41 A;  3PAF A;  4TZZ A;  3E20 B;  1M90 H;  2KTU A;  3I56 F;  1VQ9 F;  3LWV C;  3HJW C;  1VQ4 F;  2GLZ A;  2OTL F;  1K73 H;  1DT9 A;  1Q7Y H;  4EI8 A;  2QI2 A;  2KTV A;  3RA6 A;  3CCM F;  3CD6 F;  3J80 M;  3LWP C;  1W42 A;  2LBW A;  2KG4 A;  4NQ3 A;  3G6E F;  1YIJ F;  1JJ2 F;  3PLA C;  3SIV A;  1W3E X;  3CCV F;  4BW0 B;  2OZB A;  1VQM F;  2QEX F;  3NK6 A;  3V7E A;  1KQS F;  1Q82 H;  1YIT F;  3CMA F;  1GO1 A;  1W2B F;  3OW2 F;  5HWE A;  3ON1 A;  2WAL A;  1VQK F;  1VQ6 F;  5G4V C;  2OHW A;  2VGN A;  1S72 F;  3NVK E;  4BY9 D;  3CC7 F;  3J7A R;  2ALE A;  1VQL F;  1W40 A;  3NMU C;  1VQ8 F;  1QVG F;  2QA4 F;  1VQO F;  1VQ5 F;  5FLX M;  2AIF A;  3IR9 A;  5GIN C;  2F9Z C;  5HY2 A;  2CZW A;  4EI7 A;  3VMF B;  3GYQ A;  1X52 A;  4X3L A;  1E7K A;  5DCV A;  4BVT A;  2OTJ F;  4LCK A;  1T0K B;  1ZWZ A;  1K8A H;  1Q81 H;  4BVS A;  2HVY D;  5HXZ A;  5FJ4 C;  3LFO A;  1GZ0 A;  3V7Q A;  2BO1 A;  3CPW F;  1PXW A;  3CCU F;  2VGM A;  5HXU A;  4EI9 A;  3MCA B;  5EWR A;  3LWO C;  1K9M H;  2I6D A;  3CG6 A;  4X3M A;  3G71 F;  1NJI H;  3OBW A;  1VQ7 F;  3I55 F;  3LWQ C;  5GIP C;  5A2Q M;  3CCL F;  3FFM A;  3CPQ A;  5EO3 A;  1CN7 A;  1X7P A;  1RLG A;  3OBY A;  1VQP F;  2FC3 A;  3O85 A;  3J81 M;  3VI6 A;  5GAP K;  5IT9 M;  1YJN F;  3E1Y A;  3JAM M;  5HY1 A;  3WXM B;  4BVQ A;  3HAX D;  5G4U C;  1N8R H;  3N4Y A;  3CCJ F;  1KD1 H;  4BVR A;  1KC8 H;  1VQN F;  1IPA A;  1YI2 F;  1X7O A;  3CCE F;  1YJ9 F;  3NK7 A;  1M1K H;  1RA4 A;  4NUT A;  2FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...