3G6EF

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g6eF00
1GO1A 3OBWA 1K9MH 2LBWA 1YIJF 3E1YA 4BW0B 3CC4F 3J80M 1GZ0A 3VMFB 1N8RH 1M90H 5GINC 3JAMM 3LWPC 2OHWA 2CZWA 2VGMA 2KTVA 3CCMF 3CD6F 1NMUB 2VGNA 3MCAB 3JCMM 1VQ9F 1KC8H 1VQPF 3CCRF 3SIUA 1VQKF 3PAFA 5G4UC 2QA4F 3WXMB 1IPAA 1VQNF 4BY9D 3CMEF 1RLGA 1VQ8F 3NVKE 3CXCF 3I56F 3LWOC 3OBYA 3I55F 1W3EX 3CCSF 2KG4A 2LBXA 3LWRC 2ALEA 1E7KA 3CCJF 1H7MA 4X3MA 1YJ9F 1Q82H 5A2QM 1T0KB 3AGKA 1KD1H 3NVIB 1VQ4F 1VQMF 3NK7A 3O85A 1YITF 1K73H 1PXWA 3FFMA 1VQ7F 1X7OA 2OTJF 4X3LA 1S72F 1NJIH 1M1KH 3CCUF 5GANK 5FLXM 3CC2F 1W41A 3E20B 3V7EA 3N4ZA 2AIFA 5DCVA 3J7AR 3RA6A 1DT9A 1XBIA 1VQ6F 5EO3A 3OW2F 3SIVA 1CK2A 1ZWZA 1X7PA 2KTUA 1W40A 3CC7F 1YJNF 1VQOF 3CCQF 1X52A 1K8AH 2FC3A 3J81M 5EWRA 1VQ5F 1W2BF 1VQLF 2OTLF 5GAPK 3CCVF 2BO1A 2I6DA 2HVYD 1YI2F 3LWQC 2OZBA 5GIOC 2JNBA 3HJWC 3G71F 3NK6A 3RA5A 3PLAC 1SDSA 3V7QA 1Q7YH 3G4SF 4C4WC 3CPQA 1QVGF 3LWVC 1Q81H 3VI6A 1KQSF 4LCKA 1W42A 1YHQF 1CN7A 1YJWF 2QI2A 3ON1A 1GO0A 5FJ4C 1QVFF 5G4VC 2QEXF 3N4YA 2WALA 4TZZA 3CMAF 1Q86H 5IT9M 3G6EF 1JJ2F 3CG6A 3CCEF 5GIPC 3GYQA 1RA4A 3CCLF 3IR9A 3LFOA 4NUTA 3CPWF 3NMUC 3HAXD
chains in the Genus database with same CATH superfamily
1GO1A 5CA0B 3BYQA 5JCOC 3CC4F 4I4TB 3S03A 2PMPA 1GZ0A 3LYBA 3VMFB 5BMVB 5GINC 3JAMM 3HKBB 2GLZA 4HNAA 4TUYB 3CD6F 4O4IB 5AVMA 3L7QA 1IV2A 3RE3A 3SIUA 3FD6A 2OTMA 4IIJA 5G4UC 4TV8A 1IPAA 3LMEA 2HP0B 1VQNF 1UFYA 5LYJA 1RLGA 1VQ8F 3NVKE 1QD9A 3ELCA 3I55F 5IJ9B 4FFBA 5LOVB 2UYNA 2LBXA 5EZYA 5J2UB 1TVKA 1RQ2A 3M1XA 1W581 1H7MA 4X3MA 2DT4A 4DRXA 1Q82H 5LP6C 1IV4A 1YITF 1K73H 3FFMA 1X7OA 2ZOVA 2ZAUA 4O4LA 3MDOA 3N2KB 3RYIA 1W59A 3V3TA 1NJIH 2PHNA 4ZK7A 3JALA 4ZI7B 5HWEA 1W41A 3ZOPA 2DYYA 1SA0A 2R751 4X1YB 5FNVB 3T80A 5DCVA 2CHSA 2H8CA 2VAWA 4G4YA 3FBAA 5EO3A 1ZWZA 1VQVA 2KGWA 1W40A 4DXDA 3JATA 5EIBC 2FGYA 2FC3A 5EWRA 2RHOA 1VQ5F 5GAPK 2HP3A 2UZHA 3CCVF 4F6RA 2Z1FA 1FSZA 3LWQC 3ESJA 3GTZA 4KWEA 5CA0A 3G71F 3NK6A 3RA5A 3HJWC 1SDSA 4PWTA 4I4TA 3TD3A 2P6YA 3K0TA 4G4ZA 4NWOB 4O4JB 5BMVA 2RHJA 3WJRA 4X1KA 1Q81H 2Q1XA 3HKBA 1RQ7A 4TUYA 5LYJB 4C8GA 1FFXA 1W5EA 2Z1EA 3KJJA 3ON1A 5FJ4C 5EAZA 3JAWB 5LA6B 4YJ3B 3JASA 1OFUA 5EB1B 3KE1A 5EZYB 4R40B 2Q1YA 3G6EF 3CG6A 3F0GA 3CCEF 4DRXB 1GX1A 1ONIA 5IJ9A 3MQWA 3CCLF 3RYFB 3OONA 3HKEB 4O4LB 3RYIB 4G4WA 3HAXD 4X1IB 1YIJF 1Q8RA 5HY2A 3J80M 1SA0B 2VAPA 4I55B 4BVTA 3WPWA 2HS3A 2UYPA 2YYEA 4LNUB 5JQGB 2VGMA 4IHJB 3N2KA 3IMPA 1NMUB 3JCMM 4ZI7A 3JATB 1VQKF 4X1YA 3P4EA 3PAFA 5IYZA 5FNVA 5GONB 5JVDB 4O4HA 4B62A 1ODEA 3WJPA 4M8IA 3JAKA 1Z5WA 3I3FA 4F6RB 3I56F 3OBYA 3CCSF 4BT6A 5ITZB 1W57A 2H8EA 3TD4A 2UYKA 3CYPB 3R0PA 1E7KA 4X1KB 3UT5B 3IKEA 2IQQA 1KD1H 5HP8A 1FFXB 2OTJF 2N48A 3M84A 3JASB 1W55A 4WBNA 4O4JA 5FLXM 5GANK 4C81A 3E20B 2AIFA 3RA6A 3GHZA 5CB4B 1DT9A 2CVLA 3JAWA 5LA6A 1U43A 4YJ3A 4B5CA 3SIVA 3WPXA 1IV3A 1X25A 5B8FA 5IJ0B 1Z5VA 3S0HA 4O2BA 1X52A 3CCQF 3J81M 1U40A 3DC2A 3C9RA 2OTLF 2ZODA 2HX0A 2BO1A 3C9UA 3S02A 2I6DA 2HVYD 1YI2F 3RYFA 4G88A 3HKEA 3F0EA 3PLAC 1TUBB 4X1IA 3V7QA 3KIZA 1Q7YH 3G4SF 4I55A 4X20B 5IYZB 1XV2A 3LWVC 4G4VA 4O4HB 1W42A 4LNUA 5JQGA 1YHQF 1KNKA 4IHJA 4C82A 3JAKB 1CN7A 4E6EA 1QVFF 3JARB 3VO8A 2CHTA 3S06A 5GONA 4BVQA 5JVDA 2QTPA 2WALA 3CMAF 1Q86H 3WGJA 2CSLA 2K1SA 3VIUA 5GIPC 5ITZA 1FNKA 2AIZP 4NUTA 2AMTA 3P0ZA 3N2GA 4WBNB 4ERHA 1K9MH 3UT5A 3D00A 3E1YA 5J2TB 1J7HA 3D54A 1M90H 4EB6B 1W5BA 2CW4A 3C8LA 2OHWA 2KTVA 5HY0A 3CCMF 2VGNA 3WGMA 3WJQA 2I6RA 3MCAB 1VQ9F 1VQPF 4NQ3A 3VYSC 1H48A 1YQNA 3F0DA 3HKDA 4O2BB 4B46A 2F9ZC 5CB4A 5EB0A 3WXMB 1JY8A 3HTNA 5KX5B 4BY9D 3CMEF 2VAMA 2IG8A 1FNJA 1COMA 3LWOC 1W3EX 5IJ0A 5C8YB 2KG4A 3U0OA 4ZHQB 4YJ2A 3CCJF 5A2QM 5MN4A 3AGKA 1T0KB 3FPIA 2HS0A 4XCQA 2BTOA 1TUBA 1PXWA 2R6R1 4X3LA 1S72F 3RYHB 5HP7A 3TD5A 4X20A 3CCUF 2B33A 3KJKA 4G4XA 3QHDA 4ZHWA 4BT2A 1JN1A 4EI8A 1R1MA 3J7AR 1QAHA 3C9TA 3D01A 1XBIA 3JARA 1W5AA 5JH7A 1VQ6F 1SZQA 1IV1A 3OW2F 1CK2A 4U3JB 1QU9A 3ERNA 1X7PA 3CC7F 3LDTA 3N2GB 3ZP7A 5CA1B 1U3LA 1VQOF 3MCQA 1K8AH 2W8BC 2ZF8A 3IKFA 1W2BF 5LXTB 3RYCB 3DDNA 4BT4A 3I7TA 3IEWA 4ZHYB 2OZBA 2GZLA 5GIOC 1OAPA 2JNBA 2Z1UA 3CB2A 4BT7A 5J2TA 4C4WC 3HKDB 5EYPA 1QVGF 4EB6A 1KQSF 4LCKA 4ZOLB 2BTUA 1YGYA 3P10A 2HQSC 1JFFB 2QI2A 1GO0A 3HWUA 4ZHVA 2UYJA 5HY1A 3KHNA 5G4VC 2QEXF 4TV9B 1VK3A 3N4YA 5KX5A 3VCZA 5MN5A 4YJ2B 3F0FA 3C9SA 5KMGA 3K14A 2YXZA 2EWCA 2V9YA 5C8YA 3CPWF 4ZHQA 3IEQA 3OBWA 2LBWA 4C8EA 4BT5A 4BW0B 3QUWA 5EIBD 1N8RH 3E22A 3K2XA 4C8IA 3LWPC 2CZWA 5HY4A 3RYHA 5JH7B 2L26A 2GVIA 1KC8H 2HRUA 3CCRF 2H6LA 3Q8HA 2QA4F 3VOAA 1JD1A 3WGLA 4EI7A 3HKCB 2CWJA 2HRYA 2Z1TA 4U3JA 3CXCF 3S0WA 4O2AB 5LP6B 5CA1A 2NMUA 3LWRC 4I50A 3ZP4A 2ALEA 3WGNA 4BVRA 5LXTA 5EYPB 1YJ9F 3RYCA 3NVIB 1VQ4F 1VQMF 3NK7A 3O85A 5HXUA 2RHLA 2ZVZA 1VQ7F 4HNAB 4U39A 2VXYA 1UI9A 1M1KH 3ZO8A 3CC2F 4ZOLA 1NQ3A 3VYUC 2LBTA 2BTQB 2G9IA 3V7EA 3N4ZA 4IIJB 1PF5A 3VOBA 4TV8B 1JFFA 3VYTC 5KMGB 1RLUA 1CLIA 5MN6A 2Z01A 4O4IA 4TV9A 2KTUA 3VTIC 4FFBB 1YJNF 2UYNB 4RQOA 3S0YA 1TVKB 1VQLF 3B6NA 5JCOA 2HP0A 3E22B 3K12A 1T0AA 3QTYA 2RB9A 1KNJA 1XRGA 5LOVA 3WGKA 4BT3A 3MBMA 2IAFA 5J2UA 4RHAA 1XHOA 3CYQA 3F6MA 5HXZA 3CPQA 3V4DA 3JALB 3M4SA 3VI6A 3JVHA 1H47A 2LCAA 1YJWF 1W5FA 3EORA 2RHHA 1DBFA 1U3PA 1VHAA 4I50B 4TZZA 3HKCA 5IT9M 1JJ2F 4BVSA 4EI9A 3GYQA 2MQEA 1VH8A 3FD5A 4O2AA 1RA4A 5LP6A 4B45A 2ZVYA 3IR9A 3LFOA 3NMUC 2HS4A
chains in the Genus database with same CATH topology
1GO1A 3OBWA 1K9MH 2LBWA 1YIJF 3D00A 3E1YA 4BW0B 5HY2A 3CC4F 3J80M 4BVTA 1GZ0A 3VMFB 1N8RH 1M90H 5GINC 3JAMM 2GLZA 3LWPC 2OHWA 2CZWA 2VGMA 5HY4A 2KTVA 5HY0A 3CCMF 3CD6F 1NMUB 2VGNA 3MCAB 3JCMM 1VQ9F 1KC8H 1VQPF 4NQ3A 3CCRF 3SIUA 1VQKF 3PAFA 5G4UC 2QA4F 2F9ZC 3WXMB 1IPAA 4EI7A 1VQNF 4BY9D 3CMEF 1RLGA 1VQ8F 3NVKE 3CXCF 3I56F 3LWOC 3OBYA 3I55F 1W3EX 3CCSF 2KG4A 2LBXA 3LWRC 2ALEA 4BVRA 1E7KA 3CCJF 1H7MA 4X3MA 1YJ9F 1Q82H 5A2QM 1T0KB 3AGKA 1KD1H 3NVIB 1VQ4F 1VQMF 3NK7A 3O85A 4XCQA 5HXUA 1YITF 1K73H 1PXWA 3FFMA 1VQ7F 1X7OA 2OTJF 4X3LA 1S72F 1NJIH 3V3TA 1M1KH 3CCUF 5GANK 5FLXM 3CC2F 5HWEA 1W41A 3E20B 3V7EA 3N4ZA 2AIFA 4EI8A 5DCVA 3J7AR 3RA6A 1DT9A 1XBIA 1VQ6F 5EO3A 3OW2F 3SIVA 1CK2A 1ZWZA 1X7PA 2KTUA 1W40A 3CC7F 2FGYA 1YJNF 1VQOF 3CCQF 1X52A 1K8AH 2FC3A 3J81M 5EWRA 1VQ5F 1W2BF 1VQLF 2OTLF 5GAPK 3CCVF 2BO1A 2I6DA 2HVYD 1YI2F 3LWQC 2OZBA 5GIOC 2JNBA 3HJWC 3G71F 3NK6A 3RA5A 3PLAC 1SDSA 3V7QA 1Q7YH 3G4SF 4C4WC 5HXZA 3CPQA 1QVGF 3LWVC 1Q81H 3VI6A 1KQSF 4LCKA 1W42A 1YHQF 1CN7A 1YJWF 2QI2A 3ON1A 1GO0A 5FJ4C 1QVFF 5HY1A 5G4VC 2QEXF 4BVQA 3N4YA 2WALA 4TZZA 3CMAF 1Q86H 5IT9M 3G6EF 1JJ2F 3CG6A 4BVSA 4EI9A 5GIPC 3CCEF 3GYQA 1RA4A 3CCLF 3IR9A 3LFOA 4NUTA 3CPWF 3NMUC 3HAXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO1 A;  3OBW A;  1K9M H;  2LBW A;  1YIJ F;  3E1Y A;  4BW0 B;  3CC4 F;  3J80 M;  1GZ0 A;  3VMF B;  1N8R H;  1M90 H;  5GIN C;  3JAM M;  3LWP C;  2OHW A;  2CZW A;  2VGM A;  2KTV A;  3CCM F;  3CD6 F;  1NMU B;  2VGN A;  3MCA B;  3JCM M;  1VQ9 F;  1KC8 H;  1VQP F;  3CCR F;  3SIU A;  1VQK F;  3PAF A;  5G4U C;  2QA4 F;  3WXM B;  1IPA A;  1VQN F;  4BY9 D;  3CME F;  1RLG A;  1VQ8 F;  3NVK E;  3CXC F;  3I56 F;  3LWO C;  3OBY A;  3I55 F;  1W3E X;  3CCS F;  2KG4 A;  2LBX A;  3LWR C;  2ALE A;  1E7K A;  3CCJ F;  1H7M A;  4X3M A;  1YJ9 F;  1Q82 H;  5A2Q M;  1T0K B;  3AGK A;  1KD1 H;  3NVI B;  1VQ4 F;  1VQM F;  3NK7 A;  3O85 A;  1YIT F;  1K73 H;  1PXW A;  3FFM A;  1VQ7 F;  1X7O A;  2OTJ F;  4X3L A;  1S72 F;  1NJI H;  1M1K H;  3CCU F;  5GAN K;  5FLX M;  3CC2 F;  1W41 A;  3E20 B;  3V7E A;  3N4Z A;  2AIF A;  5DCV A;  3J7A R;  3RA6 A;  1DT9 A;  1XBI A;  1VQ6 F;  5EO3 A;  3OW2 F;  3SIV A;  1CK2 A;  1ZWZ A;  1X7P A;  2KTU A;  1W40 A;  3CC7 F;  1YJN F;  1VQO F;  3CCQ F;  1X52 A;  1K8A H;  2FC3 A;  3J81 M;  5EWR A;  1VQ5 F;  1W2B F;  1VQL F;  2OTL F;  5GAP K;  3CCV F;  2BO1 A;  2I6D A;  2HVY D;  1YI2 F;  3LWQ C;  2OZB A;  5GIO C;  2JNB A;  3HJW C;  3G71 F;  3NK6 A;  3RA5 A;  3PLA C;  1SDS A;  3V7Q A;  1Q7Y H;  3G4S F;  4C4W C;  3CPQ A;  1QVG F;  3LWV C;  1Q81 H;  3VI6 A;  1KQS F;  4LCK A;  1W42 A;  1YHQ F;  1CN7 A;  1YJW F;  2QI2 A;  3ON1 A;  1GO0 A;  5FJ4 C;  1QVF F;  5G4V C;  2QEX F;  3N4Y A;  2WAL A;  4TZZ A;  3CMA F;  1Q86 H;  5IT9 M;  3G6E F;  1JJ2 F;  3CG6 A;  3CCE F;  5GIP C;  3GYQ A;  1RA4 A;  3CCL F;  3IR9 A;  3LFO A;  4NUT A;  3CPW F;  3NMU C;  3HAX D; 
#chains in the Genus database with same CATH topology
 1GO1 A;  5CA0 B;  3BYQ A;  5JCO C;  3CC4 F;  4I4T B;  3S03 A;  2PMP A;  1GZ0 A;  3LYB A;  3VMF B;  5BMV B;  5GIN C;  3JAM M;  3HKB B;  2GLZ A;  4HNA A;  4TUY B;  3CD6 F;  4O4I B;  5AVM A;  3L7Q A;  1IV2 A;  3RE3 A;  3SIU A;  3FD6 A;  2OTM A;  4IIJ A;  5G4U C;  4TV8 A;  1IPA A;  3LME A;  2HP0 B;  1VQN F;  1UFY A;  5LYJ A;  1RLG A;  1VQ8 F;  3NVK E;  1QD9 A;  3ELC A;  3I55 F;  5IJ9 B;  4FFB A;  5LOV B;  2UYN A;  2LBX A;  5EZY A;  5J2U B;  1TVK A;  1RQ2 A;  3M1X A;  1W58 1;  1H7M A;  4X3M A;  2DT4 A;  4DRX A;  1Q82 H;  5LP6 C;  1IV4 A;  1YIT F;  1K73 H;  3FFM A;  1X7O A;  2ZOV A;  2ZAU A;  4O4L A;  3MDO A;  3N2K B;  3RYI A;  1W59 A;  3V3T A;  1NJI H;  2PHN A;  4ZK7 A;  3JAL A;  4ZI7 B;  5HWE A;  1W41 A;  3ZOP A;  2DYY A;  1SA0 A;  2R75 1;  4X1Y B;  5FNV B;  3T80 A;  5DCV A;  2CHS A;  2H8C A;  2VAW A;  4G4Y A;  3FBA A;  5EO3 A;  1ZWZ A;  1VQV A;  2KGW A;  1W40 A;  4DXD A;  3JAT A;  5EIB C;  2FGY A;  2FC3 A;  5EWR A;  2RHO A;  1VQ5 F;  5GAP K;  2HP3 A;  2UZH A;  3CCV F;  4F6R A;  2Z1F A;  1FSZ A;  3LWQ C;  3ESJ A;  3GTZ A;  4KWE A;  5CA0 A;  3G71 F;  3NK6 A;  3RA5 A;  3HJW C;  1SDS A;  4PWT A;  4I4T A;  3TD3 A;  2P6Y A;  3K0T A;  4G4Z A;  4NWO B;  4O4J B;  5BMV A;  2RHJ A;  3WJR A;  4X1K A;  1Q81 H;  2Q1X A;  3HKB A;  1RQ7 A;  4TUY A;  5LYJ B;  4C8G A;  1FFX A;  1W5E A;  2Z1E A;  3KJJ A;  3ON1 A;  5FJ4 C;  5EAZ A;  3JAW B;  5LA6 B;  4YJ3 B;  3JAS A;  1OFU A;  5EB1 B;  3KE1 A;  5EZY B;  4R40 B;  2Q1Y A;  3G6E F;  3CG6 A;  3F0G A;  3CCE F;  4DRX B;  1GX1 A;  1ONI A;  5IJ9 A;  3MQW A;  3CCL F;  3RYF B;  3OON A;  3HKE B;  4O4L B;  3RYI B;  4G4W A;  3HAX D;  4X1I B;  1YIJ F;  1Q8R A;  5HY2 A;  3J80 M;  1SA0 B;  2VAP A;  4I55 B;  4BVT A;  3WPW A;  2HS3 A;  2UYP A;  2YYE A;  4LNU B;  5JQG B;  2VGM A;  4IHJ B;  3N2K A;  3IMP A;  1NMU B;  3JCM M;  4ZI7 A;  3JAT B;  1VQK F;  4X1Y A;  3P4E A;  3PAF A;  5IYZ A;  5FNV A;  5GON B;  5JVD B;  4O4H A;  4B62 A;  1ODE A;  3WJP A;  4M8I A;  3JAK A;  1Z5W A;  3I3F A;  4F6R B;  3I56 F;  3OBY A;  3CCS F;  4BT6 A;  5ITZ B;  1W57 A;  2H8E A;  3TD4 A;  2UYK A;  3CYP B;  3R0P A;  1E7K A;  4X1K B;  3UT5 B;  3IKE A;  2IQQ A;  1KD1 H;  5HP8 A;  1FFX B;  2OTJ F;  2N48 A;  3M84 A;  3JAS B;  1W55 A;  4WBN A;  4O4J A;  5FLX M;  5GAN K;  4C81 A;  3E20 B;  2AIF A;  3RA6 A;  3GHZ A;  5CB4 B;  1DT9 A;  2CVL A;  3JAW A;  5LA6 A;  1U43 A;  4YJ3 A;  4B5C A;  3SIV A;  3WPX A;  1IV3 A;  1X25 A;  5B8F A;  5IJ0 B;  1Z5V A;  3S0H A;  4O2B A;  1X52 A;  3CCQ F;  3J81 M;  1U40 A;  3DC2 A;  3C9R A;  2OTL F;  2ZOD A;  2HX0 A;  2BO1 A;  3C9U A;  3S02 A;  2I6D A;  2HVY D;  1YI2 F;  3RYF A;  4G88 A;  3HKE A;  3F0E A;  3PLA C;  1TUB B;  4X1I A;  3V7Q A;  3KIZ A;  1Q7Y H;  3G4S F;  4I55 A;  4X20 B;  5IYZ B;  1XV2 A;  3LWV C;  4G4V A;  4O4H B;  1W42 A;  4LNU A;  5JQG A;  1YHQ F;  1KNK A;  4IHJ A;  4C82 A;  3JAK B;  1CN7 A;  4E6E A;  1QVF F;  3JAR B;  3VO8 A;  2CHT A;  3S06 A;  5GON A;  4BVQ A;  5JVD A;  2QTP A;  2WAL A;  3CMA F;  1Q86 H;  3WGJ A;  2CSL A;  2K1S A;  3VIU A;  5GIP C;  5ITZ A;  1FNK A;  2AIZ P;  4NUT A;  2AMT A;  3P0Z A;  3N2G A;  4WBN B;  4ERH A;  1K9M H;  3UT5 A;  3D00 A;  3E1Y A;  5J2T B;  1J7H A;  3D54 A;  1M90 H;  4EB6 B;  1W5B A;  2CW4 A;  3C8L A;  2OHW A;  2KTV A;  5HY0 A;  3CCM F;  2VGN A;  3WGM A;  3WJQ A;  2I6R A;  3MCA B;  1VQ9 F;  1VQP F;  4NQ3 A;  3VYS C;  1H48 A;  1YQN A;  3F0D A;  3HKD A;  4O2B B;  4B46 A;  2F9Z C;  5CB4 A;  5EB0 A;  3WXM B;  1JY8 A;  3HTN A;  5KX5 B;  4BY9 D;  3CME F;  2VAM A;  2IG8 A;  1FNJ A;  1COM A;  3LWO C;  1W3E X;  5IJ0 A;  5C8Y B;  2KG4 A;  3U0O A;  4ZHQ B;  4YJ2 A;  3CCJ F;  5A2Q M;  5MN4 A;  3AGK A;  1T0K B;  3FPI A;  2HS0 A;  4XCQ A;  2BTO A;  1TUB A;  1PXW A;  2R6R 1;  4X3L A;  1S72 F;  3RYH B;  5HP7 A;  3TD5 A;  4X20 A;  3CCU F;  2B33 A;  3KJK A;  4G4X A;  3QHD A;  4ZHW A;  4BT2 A;  1JN1 A;  4EI8 A;  1R1M A;  3J7A R;  1QAH A;  3C9T A;  3D01 A;  1XBI A;  3JAR A;  1W5A A;  5JH7 A;  1VQ6 F;  1SZQ A;  1IV1 A;  3OW2 F;  1CK2 A;  4U3J B;  1QU9 A;  3ERN A;  1X7P A;  3CC7 F;  3LDT A;  3N2G B;  3ZP7 A;  5CA1 B;  1U3L A;  1VQO F;  3MCQ A;  1K8A H;  2W8B C;  2ZF8 A;  3IKF A;  1W2B F;  5LXT B;  3RYC B;  3DDN A;  4BT4 A;  3I7T A;  3IEW A;  4ZHY B;  2OZB A;  2GZL A;  5GIO C;  1OAP A;  2JNB A;  2Z1U A;  3CB2 A;  4BT7 A;  5J2T A;  4C4W C;  3HKD B;  5EYP A;  1QVG F;  4EB6 A;  1KQS F;  4LCK A;  4ZOL B;  2BTU A;  1YGY A;  3P10 A;  2HQS C;  1JFF B;  2QI2 A;  1GO0 A;  3HWU A;  4ZHV A;  2UYJ A;  5HY1 A;  3KHN A;  5G4V C;  2QEX F;  4TV9 B;  1VK3 A;  3N4Y A;  5KX5 A;  3VCZ A;  5MN5 A;  4YJ2 B;  3F0F A;  3C9S A;  5KMG A;  3K14 A;  2YXZ A;  2EWC A;  2V9Y A;  5C8Y A;  3CPW F;  4ZHQ A;  3IEQ A;  3OBW A;  2LBW A;  4C8E A;  4BT5 A;  4BW0 B;  3QUW A;  5EIB D;  1N8R H;  3E22 A;  3K2X A;  4C8I A;  3LWP C;  2CZW A;  5HY4 A;  3RYH A;  5JH7 B;  2L26 A;  2GVI A;  1KC8 H;  2HRU A;  3CCR F;  2H6L A;  3Q8H A;  2QA4 F;  3VOA A;  1JD1 A;  3WGL A;  4EI7 A;  3HKC B;  2CWJ A;  2HRY A;  2Z1T A;  4U3J A;  3CXC F;  3S0W A;  4O2A B;  5LP6 B;  5CA1 A;  2NMU A;  3LWR C;  4I50 A;  3ZP4 A;  2ALE A;  3WGN A;  4BVR A;  5LXT A;  5EYP B;  1YJ9 F;  3RYC A;  3NVI B;  1VQ4 F;  1VQM F;  3NK7 A;  3O85 A;  5HXU A;  2RHL A;  2ZVZ A;  1VQ7 F;  4HNA B;  4U39 A;  2VXY A;  1UI9 A;  1M1K H;  3ZO8 A;  3CC2 F;  4ZOL A;  1NQ3 A;  3VYU C;  2LBT A;  2BTQ B;  2G9I A;  3V7E A;  3N4Z A;  4IIJ B;  1PF5 A;  3VOB A;  4TV8 B;  1JFF A;  3VYT C;  5KMG B;  1RLU A;  1CLI A;  5MN6 A;  2Z01 A;  4O4I A;  4TV9 A;  2KTU A;  3VTI C;  4FFB B;  1YJN F;  2UYN B;  4RQO A;  3S0Y A;  1TVK B;  1VQL F;  3B6N A;  5JCO A;  2HP0 A;  3E22 B;  3K12 A;  1T0A A;  3QTY A;  2RB9 A;  1KNJ A;  1XRG A;  5LOV A;  3WGK A;  4BT3 A;  3MBM A;  2IAF A;  5J2U A;  4RHA A;  1XHO A;  3CYQ A;  3F6M A;  5HXZ A;  3CPQ A;  3V4D A;  3JAL B;  3M4S A;  3VI6 A;  3JVH A;  1H47 A;  2LCA A;  1YJW F;  1W5F A;  3EOR A;  2RHH A;  1DBF A;  1U3P A;  1VHA A;  4I50 B;  4TZZ A;  3HKC A;  5IT9 M;  1JJ2 F;  4BVS A;  4EI9 A;  3GYQ A;  2MQE A;  1VH8 A;  3FD5 A;  4O2A A;  1RA4 A;  5LP6 A;  4B45 A;  2ZVY A;  3IR9 A;  3LFO A;  3NMU C;  2HS4 A; 
#chains in the Genus database with same CATH homology
 1GO1 A;  3OBW A;  1K9M H;  2LBW A;  1YIJ F;  3D00 A;  3E1Y A;  4BW0 B;  5HY2 A;  3CC4 F;  3J80 M;  4BVT A;  1GZ0 A;  3VMF B;  1N8R H;  1M90 H;  5GIN C;  3JAM M;  2GLZ A;  3LWP C;  2OHW A;  2CZW A;  2VGM A;  5HY4 A;  2KTV A;  5HY0 A;  3CCM F;  3CD6 F;  1NMU B;  2VGN A;  3MCA B;  3JCM M;  1VQ9 F;  1KC8 H;  1VQP F;  4NQ3 A;  3CCR F;  3SIU A;  1VQK F;  3PAF A;  5G4U C;  2QA4 F;  2F9Z C;  3WXM B;  1IPA A;  4EI7 A;  1VQN F;  4BY9 D;  3CME F;  1RLG A;  1VQ8 F;  3NVK E;  3CXC F;  3I56 F;  3LWO C;  3OBY A;  3I55 F;  1W3E X;  3CCS F;  2KG4 A;  2LBX A;  3LWR C;  2ALE A;  4BVR A;  1E7K A;  3CCJ F;  1H7M A;  4X3M A;  1YJ9 F;  1Q82 H;  5A2Q M;  1T0K B;  3AGK A;  1KD1 H;  3NVI B;  1VQ4 F;  1VQM F;  3NK7 A;  3O85 A;  4XCQ A;  5HXU A;  1YIT F;  1K73 H;  1PXW A;  3FFM A;  1VQ7 F;  1X7O A;  2OTJ F;  4X3L A;  1S72 F;  1NJI H;  3V3T A;  1M1K H;  3CCU F;  5GAN K;  5FLX M;  3CC2 F;  5HWE A;  1W41 A;  3E20 B;  3V7E A;  3N4Z A;  2AIF A;  4EI8 A;  5DCV A;  3J7A R;  3RA6 A;  1DT9 A;  1XBI A;  1VQ6 F;  5EO3 A;  3OW2 F;  3SIV A;  1CK2 A;  1ZWZ A;  1X7P A;  2KTU A;  1W40 A;  3CC7 F;  2FGY A;  1YJN F;  1VQO F;  3CCQ F;  1X52 A;  1K8A H;  2FC3 A;  3J81 M;  5EWR A;  1VQ5 F;  1W2B F;  1VQL F;  2OTL F;  5GAP K;  3CCV F;  2BO1 A;  2I6D A;  2HVY D;  1YI2 F;  3LWQ C;  2OZB A;  5GIO C;  2JNB A;  3HJW C;  3G71 F;  3NK6 A;  3RA5 A;  3PLA C;  1SDS A;  3V7Q A;  1Q7Y H;  3G4S F;  4C4W C;  5HXZ A;  3CPQ A;  1QVG F;  3LWV C;  1Q81 H;  3VI6 A;  1KQS F;  4LCK A;  1W42 A;  1YHQ F;  1CN7 A;  1YJW F;  2QI2 A;  3ON1 A;  1GO0 A;  5FJ4 C;  1QVF F;  5HY1 A;  5G4V C;  2QEX F;  4BVQ A;  3N4Y A;  2WAL A;  4TZZ A;  3CMA F;  1Q86 H;  5IT9 M;  3G6E F;  1JJ2 F;  3CG6 A;  4BVS A;  4EI9 A;  5GIP C;  3CCE F;  3GYQ A;  1RA4 A;  3CCL F;  3IR9 A;  3LFO A;  4NUT A;  3CPW F;  3NMU C;  3HAX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...