3G6EF

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3g6eF00
3J81M 2QI2A 5G4UC 3I56F 1YI2F 1X7OA 2OTLF 2QA4F 3CD6F 1W3EX 2OTJF 3CXCF 1M90H 1W41A 1K73H 3LWPC 3FFMA 3WXMB 3CCJF 1W42A 3CCUF 4BW0B 3I55F 1S72F 5GAPK 1YITF 3LWOC 4LCKA 3HAXD 3E20B 3CCMF 2WALA 3LFOA 1YHQF 3JAMM 1N8RH 1X52A 5EO3A 3GYQA 2QEXF 3G4SF 3CC2F 3N4YA 3NK7A 3CC4F 1Q7YH 2OZBA 2VGNA 3VI6A 3PLAC 3NVKE 3IR9A 2I6DA 1GO0A 5A2QM 1KQSF 1VQ8F 1X7PA 3CCQF 3CPWF 3LWRC 1VQOF 1VQ6F 3VMFB 1H7MA 3NK6A 1VQ7F 1VQ4F 1XBIA 5FJ4C 2CZWA 1Q82H 5EWRA 5GIPC 4BY9D 1NJIH 3V7EA 1Q86H 1VQ5F 3NMUC 1YJNF 3V7QA 1ZWZA 3MCAB 5GIOC 2LBXA 1SDSA 5FLXM 3CPQA 3CG6A 3OBYA 1M1KH 3HJWC 2KTUA 1DT9A 2KG4A 1RLGA 5IT9M 4X3LA 5G4VC 3G6EF 1VQNF 1E7KA 1NMUB 3CCEF 2FC3A 3AGKA 1W2BF 1YJWF 2JNBA 5GINC 3O85A 1PXWA 1K9MH 3LWQC 3CMEF 1QVGF 1W40A 2OHWA 3J80M 3PAFA 3LWVC 3CCLF 2BO1A 2HVYD 4NUTA 2LBWA 3J7AR 1VQKF 1CK2A 3CCVF 3ON1A 1T0KB 3CC7F 1YJ9F 1VQMF 3OW2F 3NVIB 1IPAA 1GO1A 1GZ0A 2VGMA 3RA5A 3CCRF 3SIUA 3G71F 3E1YA 1CN7A 3CCSF 2AIFA 3SIVA 3JCMM 3CMAF 1YIJF 1KC8H 3N4ZA 4TZZA 1KD1H 4C4WC 3OBWA 2ALEA 1VQLF 1RA4A 1Q81H 1VQ9F 5DCVA 3RA6A 5GANK 1VQPF 2KTVA 4X3MA 1K8AH 1QVFF 1JJ2F
chains in the Genus database with same CATH superfamily
3RYFA 5IJ0A 2QI2A 3RE3A 4BT6A 5IYZA 2OTLF 3KE1A 3CD6F 3IKFA 1M90H 3HKDA 2UYNB 1W41A 3WJQA 3FPIA 3LWPC 5JVDA 2V9YA 1QU9A 3F0FA 2FGYA 4C82A 3E22B 5LP6B 1XRGA 4BT2A 3WGJA 3JARA 2WALA 4TV8B 4EB6A 1YHQF 3CYQA 3G4SF 1IV2A 3RYIA 2Z1UA 4HNAB 1GX1A 2VAWA 1Q8RA 2G9IA 3IR9A 3DC2A 3CYPB 2CW4A 1VQ8F 3CCQF 3MDOA 5ITZA 3LWRC 1Z5WA 4X1KA 1H7MA 3VMFB 1H48A 2NMUA 3LDTA 2IAFA 5CA0A 1X25A 5GIPC 1NJIH 1TVKA 1FFXA 1W5BA 2PHNA 5KX5B 5CA1A 5GIOC 3JVHA 4M8IA 4O2AB 4F6RA 4G88A 3VTIC 5G4VC 3G6EF 1R1MA 1NMUB 3CCEF 2FC3A 2Z1FA 5IJ9B 1Z5VA 4C8IA 3N2GB 5KMGB 3LWQC 5HP8A 3RYCB 1QVGF 2OHWA 3KJKA 2BO1A 3OONA 1FNKA 3WGKA 4TUYA 5LP6A 2HVYD 1XV2A 4EI9A 1CK2A 3CCVF 3ON1A 1QD9A 3S0WA 3CC7F 4O4JB 5EIBC 5HXZA 4O4IB 3F0DA 4WBNB 2VGMA 4I55A 1RQ7A 3S03A 2CHSA 2AIFA 3FD6A 5LYJA 1YIJF 2ZODA 2GVIA 3IKEA 4TZZA 3OBWA 2DT4A 1RA4A 4BVSA 3C8LA 4O4LB 1CLIA 3GTZA 4B46A 5DCVA 3RA6A 4X1IB 2F9ZC 1KNJA 1IV4A 1QVFF 3J81M 3IEQA 4ZK7A 1XHOA 1FSZA 5IJ9A 1UFYA 1YI2F 1X7OA 4U3JB 1COMA 4DXDA 2OTJF 5KMGA 2H6LA 3RYCA 1K73H 3UT5A 2I6RA 3FFMA 1W42A 1PF5A 4B62A 1JN1A 5AVMA 4BW0B 1S72F 2CSLA 4LCKA 1W57A 4X1YB 3JAMM 2RHHA 3HTNA 4IIJA 5EO3A 5BMVB 3GYQA 3JATA 4O4IA 1RQ2A 4WBNA 5J2UA 3VI6A 2QTPA 5A2QM 3HKCB 3VOAA 1KQSF 4I50B 4LNUA 3ERNA 4BT7A 3K12A 2R751 3P0ZA 3BYQA 1Q82H 1NQ3A 3MQWA 3V7EA 2DYYA 2IG8A 2CWJA 1VQ5F 4O4LA 1YJNF 3V7QA 1ZWZA 3MCAB 1IV3A 3ELCA 2AIZP 2HP3A 4NWOB 5MN6A 3CPQA 1VHAA 4ZHQB 2L26A 4NQ3A 2KTUA 2HS3A 3QUWA 1DT9A 2CHTA 1RLGA 3KIZA 5JH7B 5IT9M 4X3LA 4U3JA 1VQNF 2HX0A 2Q1YA 3RYHB 3TD3A 5J2TB 3F6MA 3C9RA 1K9MH 3CMEF 4IHJB 1J7HA 1H47A 1TUBA 3GHZA 3J7AR 1VQKF 1T0KB 2HP0B 1YJ9F 2HQSC 5EB1B 2ZOVA 1SA0B 3OW2F 4ZI7B 2Z1EA 3HKBB 1GO1A 2LBTA 3I3FA 3JAKB 3RA5A 4I50A 4O4HB 2ZVZA 1CN7A 3ZP7A 1YGYA 2UYNA 3K2XA 3N4ZA 5FNVB 3S02A 2H8CA 1KD1H 5GONB 3E22A 5HY1A 3JAWB 4EI8A 4TV8A 2YYEA 1VQ9F 4YJ2B 4ZHQA 2KGWA 2RB9A 2KTVA 4G4WA 3JALB 2N48A 4HNAA 1K8AH 5JH7A 3VYTC 3C9TA 1T0AA 1W5AA 2UYPA 4TV9B 2H8EA 4I4TB 3V3TA 2QA4F 5LP6C 1W3EX 3CXCF 4IHJA 3WGNA 2R6R1 3F0GA 5EB0A 3WXMB 4ZHVA 5LOVB 5HY2A 3DDNA 3S0HA 4YJ3B 1YITF 3LWOC 3WPWA 3KHNA 5KX5A 2UYKA 3LFOA 1X52A 2UZHA 4ZHYB 3D01A 4G4XA 1SZQA 2QEXF 2HS4A 2HS0A 2YXZA 3P10A 4O2AA 2ZVYA 5EZYB 5LXTB 1Q7YH 3CC4F 2VGNA 2OZBA 3RYFB 4O4HA 2RHJA 1RLUA 2I6DA 1GO0A 3VCZA 1VQOF 3JASB 1VQ6F 3N2GA 3NK6A 4FFBB 1VQ4F 1XBIA 5FJ4C 4BVRA 2CZWA 5GONA 5EWRA 3R0PA 4BVQA 2LCAA 2RHLA 1JY8A 5EAZA 4BVTA 5MN5A 3HWUA 1Q86H 1VQVA 4O4JA 3JARB 4YJ2A 1VH8A 3N2KB 4EB6B 2LBXA 1SDSA 5FLXM 3JALA 2UYJA 3CG6A 3OBYA 4DRXB 1IV1A 2KG4A 5LA6B 3T80A 1W5FA 5HXUA 3IEWA 1E7KA 3CB2A 1W2BF 1YJWF 1PXWA 1FNJA 4R40B 4X1KB 2IQQA 2BTUA 2ZAUA 3S0YA 1W40A 1OFUA 2RHOA 3ZOPA 5CA0B 4ZHWA 5HY0A 4NUTA 3TD5A 2LBWA 3V4DA 3U0OA 3WJRA 1VQMF 4X1IA 5LXTA 4E6EA 4B45A 3ZP4A 3MCQA 4C81A 3K0TA 1IPAA 4B5CA 4F6RB 1GZ0A 3CCRF 5EIBD 3SIUA 3JASA 3G71F 3E1YA 4U39A 4FFBA 4EI7A 3CMAF 1ODEA 5EYPB 3VO8A 2B33A 3LYBA 4ERHA 4TUYB 1ONIA 1VQLF 3KJJA 3N2KA 1W581 4X1YA 1Q81H 5BMVA 4DRXA 2BTQB 5LA6A 4X20B 3TD4A 4C8GA 3I7TA 2PMPA 4I55B 3HKCA 3I56F 5G4UC 2VAPA 3HKEB 5JQGB 1KNKA 3M84A 3FD5A 5LYJB 4RQOA 3CCJF 1W55A 3CCUF 4O2BB 5MN4A 2GLZA 3Q8HA 3I55F 3M4SA 5GAPK 1YQNA 3HAXD 3E20B 3CCMF 1U3PA 5JCOA 3K14A 1N8RH 2Q1XA 4RHAA 3CC2F 3N4YA 1U43A 5B8FA 3NK7A 4KWEA 1W5EA 3ESJA 3PLAC 3NVKE 2Z01A 4BT5A 4ZOLB 1X7PA 3RYHA 5J2TA 3CPWF 3F0EA 1VQ7F 5EYPA 3UT5B 5JCOC 1VK3A 3QTYA 3FBAA 4BY9D 5C8YB 3LMEA 2K1SA 2OTMA 2HP0A 3NMUC 1W59A 2GZLA 1SA0A 2EWCA 2P6YA 4IIJB 2ZF8A 3C9SA 4G4VA 2VAMA 1U40A 3HKBA 3JATB 4X20A 4C8EA 4ZI7A 1M1KH 3HJWC 1JFFB 2MQEA 4XCQA 5HY4A 5J2UB 3JAKA 5CB4B 1QAHA 5IJ0B 3M1XA 3AGKA 3HKEA 5JQGA 3L7QA 4G4ZA 5IYZB 3WPXA 2JNBA 5GINC 3IMPA 3O85A 3P4EA 1JD1A 4LNUB 3VYUC 3HKDB 3VIUA 5FNVA 3D54A 4O2BA 3PAFA 3J80M 3LWVC 5JVDB 3CCLF 4PWTA 5HWEA 3JAWA 3QHDA 4BT4A 3ZO8A 2Z1TA 3NVIB 3VOBA 3WJPA 3RYIB 1UI9A 3B6NA 3C9UA 2HRYA 4ZOLA 4TV9A 4I4TA 3CCSF 3SIVA 5ITZB 2HRUA 3JCMM 1KC8H 2W8BC 2BTOA 2VXYA 5LOVA 3WGMA 5C8YA 3EORA 1U3LA 1TUBB 4YJ3A 1OAPA 3VYSC 3MBMA 4C4WC 2ALEA 1TVKB 4G4YA 4BT3A 1FFXB 5HP7A 3WGLA 5GANK 3S06A 1VQPF 5CA1B 1JFFA 5EZYA 4X3MA 2CVLA 2AMTA 3D00A 1DBFA 1JJ2F 5CB4A
chains in the Genus database with same CATH topology
3J81M 2QI2A 5G4UC 3I56F 1YI2F 1X7OA 2OTLF 3V3TA 2QA4F 3CD6F 1W3EX 2OTJF 3CXCF 1M90H 1W41A 1K73H 3LWPC 3FFMA 3WXMB 3CCJF 1W42A 2FGYA 3CCUF 4BW0B 5HY2A 3I55F 2GLZA 1S72F 5GAPK 1YITF 3LWOC 4LCKA 3HAXD 3E20B 3CCMF 2WALA 3LFOA 1YHQF 3JAMM 1N8RH 1X52A 5EO3A 3GYQA 2QEXF 3G4SF 3CC2F 3N4YA 3NK7A 3CC4F 1Q7YH 2OZBA 2VGNA 3VI6A 3PLAC 3NVKE 3IR9A 2I6DA 1GO0A 5A2QM 1KQSF 1VQ8F 1X7PA 3CCQF 3CPWF 3LWRC 1VQOF 1VQ6F 3VMFB 1H7MA 3NK6A 1VQ7F 1VQ4F 1XBIA 5FJ4C 4BVRA 2CZWA 1Q82H 5EWRA 4BVQA 5GIPC 4BY9D 1NJIH 3V7EA 4BVTA 1Q86H 1VQ5F 3NMUC 1YJNF 3V7QA 1ZWZA 3MCAB 5GIOC 2LBXA 1SDSA 5FLXM 3CPQA 3CG6A 3OBYA 4NQ3A 1M1KH 3HJWC 4XCQA 2KTUA 1DT9A 2KG4A 5HY4A 5HXUA 1RLGA 5IT9M 4X3LA 5G4VC 3G6EF 1VQNF 1E7KA 1NMUB 3CCEF 2FC3A 3AGKA 1W2BF 1YJWF 2JNBA 5GINC 3O85A 1PXWA 1K9MH 3LWQC 3CMEF 1QVGF 1W40A 2OHWA 3J80M 3PAFA 3LWVC 3CCLF 2BO1A 2HVYD 5HY0A 4NUTA 5HWEA 2LBWA 4EI9A 1VQKF 3J7AR 1CK2A 3CCVF 3ON1A 1T0KB 3CC7F 1YJ9F 1VQMF 3OW2F 3NVIB 1IPAA 1GO1A 5HXZA 1GZ0A 2VGMA 3RA5A 3CCRF 3SIUA 3G71F 3E1YA 1CN7A 3CCSF 2AIFA 3SIVA 4EI7A 3JCMM 3CMAF 1YIJF 1KC8H 3N4ZA 4TZZA 1KD1H 4C4WC 3OBWA 2ALEA 1VQLF 5HY1A 4EI8A 1RA4A 4BVSA 1Q81H 1VQ9F 5DCVA 3RA6A 5GANK 1VQPF 2KTVA 2F9ZC 4X3MA 3D00A 1K8AH 1QVFF 1JJ2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 M;  2QI2 A;  5G4U C;  3I56 F;  1YI2 F;  1X7O A;  2OTL F;  2QA4 F;  3CD6 F;  1W3E X;  2OTJ F;  3CXC F;  1M90 H;  1W41 A;  1K73 H;  3LWP C;  3FFM A;  3WXM B;  3CCJ F;  1W42 A;  3CCU F;  4BW0 B;  3I55 F;  1S72 F;  5GAP K;  1YIT F;  3LWO C;  4LCK A;  3HAX D;  3E20 B;  3CCM F;  2WAL A;  3LFO A;  1YHQ F;  3JAM M;  1N8R H;  1X52 A;  5EO3 A;  3GYQ A;  2QEX F;  3G4S F;  3CC2 F;  3N4Y A;  3NK7 A;  3CC4 F;  1Q7Y H;  2OZB A;  2VGN A;  3VI6 A;  3PLA C;  3NVK E;  3IR9 A;  2I6D A;  1GO0 A;  5A2Q M;  1KQS F;  1VQ8 F;  1X7P A;  3CCQ F;  3CPW F;  3LWR C;  1VQO F;  1VQ6 F;  3VMF B;  1H7M A;  3NK6 A;  1VQ7 F;  1VQ4 F;  1XBI A;  5FJ4 C;  2CZW A;  1Q82 H;  5EWR A;  5GIP C;  4BY9 D;  1NJI H;  3V7E A;  1Q86 H;  1VQ5 F;  3NMU C;  1YJN F;  3V7Q A;  1ZWZ A;  3MCA B;  5GIO C;  2LBX A;  1SDS A;  5FLX M;  3CPQ A;  3CG6 A;  3OBY A;  1M1K H;  3HJW C;  2KTU A;  1DT9 A;  2KG4 A;  1RLG A;  5IT9 M;  4X3L A;  5G4V C;  3G6E F;  1VQN F;  1E7K A;  1NMU B;  3CCE F;  2FC3 A;  3AGK A;  1W2B F;  1YJW F;  2JNB A;  5GIN C;  3O85 A;  1PXW A;  1K9M H;  3LWQ C;  3CME F;  1QVG F;  1W40 A;  2OHW A;  3J80 M;  3PAF A;  3LWV C;  3CCL F;  2BO1 A;  2HVY D;  4NUT A;  2LBW A;  3J7A R;  1VQK F;  1CK2 A;  3CCV F;  3ON1 A;  1T0K B;  3CC7 F;  1YJ9 F;  1VQM F;  3OW2 F;  3NVI B;  1IPA A;  1GO1 A;  1GZ0 A;  2VGM A;  3RA5 A;  3CCR F;  3SIU A;  3G71 F;  3E1Y A;  1CN7 A;  3CCS F;  2AIF A;  3SIV A;  3JCM M;  3CMA F;  1YIJ F;  1KC8 H;  3N4Z A;  4TZZ A;  1KD1 H;  4C4W C;  3OBW A;  2ALE A;  1VQL F;  1RA4 A;  1Q81 H;  1VQ9 F;  5DCV A;  3RA6 A;  5GAN K;  1VQP F;  2KTV A;  4X3M A;  1K8A H;  1QVF F;  1JJ2 F; 
#chains in the Genus database with same CATH topology
 3RYF A;  5IJ0 A;  2QI2 A;  3RE3 A;  4BT6 A;  5IYZ A;  2OTL F;  3KE1 A;  3CD6 F;  3IKF A;  1M90 H;  3HKD A;  2UYN B;  1W41 A;  3WJQ A;  3FPI A;  3LWP C;  5JVD A;  2V9Y A;  1QU9 A;  3F0F A;  2FGY A;  4C82 A;  3E22 B;  5LP6 B;  1XRG A;  4BT2 A;  3WGJ A;  3JAR A;  2WAL A;  4TV8 B;  4EB6 A;  1YHQ F;  3CYQ A;  3G4S F;  1IV2 A;  3RYI A;  2Z1U A;  4HNA B;  1GX1 A;  2VAW A;  1Q8R A;  2G9I A;  3IR9 A;  3DC2 A;  3CYP B;  2CW4 A;  1VQ8 F;  3CCQ F;  3MDO A;  5ITZ A;  3LWR C;  1Z5W A;  4X1K A;  1H7M A;  3VMF B;  1H48 A;  2NMU A;  3LDT A;  2IAF A;  5CA0 A;  1X25 A;  5GIP C;  1NJI H;  1TVK A;  1FFX A;  1W5B A;  2PHN A;  5KX5 B;  5CA1 A;  5GIO C;  3JVH A;  4M8I A;  4O2A B;  4F6R A;  4G88 A;  3VTI C;  5G4V C;  3G6E F;  1R1M A;  1NMU B;  3CCE F;  2FC3 A;  2Z1F A;  5IJ9 B;  1Z5V A;  4C8I A;  3N2G B;  5KMG B;  3LWQ C;  5HP8 A;  3RYC B;  1QVG F;  2OHW A;  3KJK A;  2BO1 A;  3OON A;  1FNK A;  3WGK A;  4TUY A;  5LP6 A;  2HVY D;  1XV2 A;  4EI9 A;  1CK2 A;  3CCV F;  3ON1 A;  1QD9 A;  3S0W A;  3CC7 F;  4O4J B;  5EIB C;  5HXZ A;  4O4I B;  3F0D A;  4WBN B;  2VGM A;  4I55 A;  1RQ7 A;  3S03 A;  2CHS A;  2AIF A;  3FD6 A;  5LYJ A;  1YIJ F;  2ZOD A;  2GVI A;  3IKE A;  4TZZ A;  3OBW A;  2DT4 A;  1RA4 A;  4BVS A;  3C8L A;  4O4L B;  1CLI A;  3GTZ A;  4B46 A;  5DCV A;  3RA6 A;  4X1I B;  2F9Z C;  1KNJ A;  1IV4 A;  1QVF F;  3J81 M;  3IEQ A;  4ZK7 A;  1XHO A;  1FSZ A;  5IJ9 A;  1UFY A;  1YI2 F;  1X7O A;  4U3J B;  1COM A;  4DXD A;  2OTJ F;  5KMG A;  2H6L A;  3RYC A;  1K73 H;  3UT5 A;  2I6R A;  3FFM A;  1W42 A;  1PF5 A;  4B62 A;  1JN1 A;  5AVM A;  4BW0 B;  1S72 F;  2CSL A;  4LCK A;  1W57 A;  4X1Y B;  3JAM M;  2RHH A;  3HTN A;  4IIJ A;  5EO3 A;  5BMV B;  3GYQ A;  3JAT A;  4O4I A;  1RQ2 A;  4WBN A;  5J2U A;  3VI6 A;  2QTP A;  5A2Q M;  3HKC B;  3VOA A;  1KQS F;  4I50 B;  4LNU A;  3ERN A;  4BT7 A;  3K12 A;  2R75 1;  3P0Z A;  3BYQ A;  1Q82 H;  1NQ3 A;  3MQW A;  3V7E A;  2DYY A;  2IG8 A;  2CWJ A;  1VQ5 F;  4O4L A;  1YJN F;  3V7Q A;  1ZWZ A;  3MCA B;  1IV3 A;  3ELC A;  2AIZ P;  2HP3 A;  4NWO B;  5MN6 A;  3CPQ A;  1VHA A;  4ZHQ B;  2L26 A;  4NQ3 A;  2KTU A;  2HS3 A;  3QUW A;  1DT9 A;  2CHT A;  1RLG A;  3KIZ A;  5JH7 B;  5IT9 M;  4X3L A;  4U3J A;  1VQN F;  2HX0 A;  2Q1Y A;  3RYH B;  3TD3 A;  5J2T B;  3F6M A;  3C9R A;  1K9M H;  3CME F;  4IHJ B;  1J7H A;  1H47 A;  1TUB A;  3GHZ A;  3J7A R;  1VQK F;  1T0K B;  2HP0 B;  1YJ9 F;  2HQS C;  5EB1 B;  2ZOV A;  1SA0 B;  3OW2 F;  4ZI7 B;  2Z1E A;  3HKB B;  1GO1 A;  2LBT A;  3I3F A;  3JAK B;  3RA5 A;  4I50 A;  4O4H B;  2ZVZ A;  1CN7 A;  3ZP7 A;  1YGY A;  2UYN A;  3K2X A;  3N4Z A;  5FNV B;  3S02 A;  2H8C A;  1KD1 H;  5GON B;  3E22 A;  5HY1 A;  3JAW B;  4EI8 A;  4TV8 A;  2YYE A;  1VQ9 F;  4YJ2 B;  4ZHQ A;  2KGW A;  2RB9 A;  2KTV A;  4G4W A;  3JAL B;  2N48 A;  4HNA A;  1K8A H;  5JH7 A;  3VYT C;  3C9T A;  1T0A A;  1W5A A;  2UYP A;  4TV9 B;  2H8E A;  4I4T B;  3V3T A;  2QA4 F;  5LP6 C;  1W3E X;  3CXC F;  4IHJ A;  3WGN A;  2R6R 1;  3F0G A;  5EB0 A;  3WXM B;  4ZHV A;  5LOV B;  5HY2 A;  3DDN A;  3S0H A;  4YJ3 B;  1YIT F;  3LWO C;  3WPW A;  3KHN A;  5KX5 A;  2UYK A;  3LFO A;  1X52 A;  2UZH A;  4ZHY B;  3D01 A;  4G4X A;  1SZQ A;  2QEX F;  2HS4 A;  2HS0 A;  2YXZ A;  3P10 A;  4O2A A;  2ZVY A;  5EZY B;  5LXT B;  1Q7Y H;  3CC4 F;  2VGN A;  2OZB A;  3RYF B;  4O4H A;  2RHJ A;  1RLU A;  2I6D A;  1GO0 A;  3VCZ A;  1VQO F;  3JAS B;  1VQ6 F;  3N2G A;  3NK6 A;  4FFB B;  1VQ4 F;  1XBI A;  5FJ4 C;  4BVR A;  2CZW A;  5GON A;  5EWR A;  3R0P A;  4BVQ A;  2LCA A;  2RHL A;  1JY8 A;  5EAZ A;  4BVT A;  5MN5 A;  3HWU A;  1Q86 H;  1VQV A;  4O4J A;  3JAR B;  4YJ2 A;  1VH8 A;  3N2K B;  4EB6 B;  2LBX A;  1SDS A;  5FLX M;  3JAL A;  2UYJ A;  3CG6 A;  3OBY A;  4DRX B;  1IV1 A;  2KG4 A;  5LA6 B;  3T80 A;  1W5F A;  5HXU A;  3IEW A;  1E7K A;  3CB2 A;  1W2B F;  1YJW F;  1PXW A;  1FNJ A;  4R40 B;  4X1K B;  2IQQ A;  2BTU A;  2ZAU A;  3S0Y A;  1W40 A;  1OFU A;  2RHO A;  3ZOP A;  5CA0 B;  4ZHW A;  5HY0 A;  4NUT A;  3TD5 A;  2LBW A;  3V4D A;  3U0O A;  3WJR A;  1VQM F;  4X1I A;  5LXT A;  4E6E A;  4B45 A;  3ZP4 A;  3MCQ A;  4C81 A;  3K0T A;  1IPA A;  4B5C A;  4F6R B;  1GZ0 A;  3CCR F;  5EIB D;  3SIU A;  3JAS A;  3G71 F;  3E1Y A;  4U39 A;  4FFB A;  4EI7 A;  3CMA F;  1ODE A;  5EYP B;  3VO8 A;  2B33 A;  3LYB A;  4ERH A;  4TUY B;  1ONI A;  1VQL F;  3KJJ A;  3N2K A;  1W58 1;  4X1Y A;  1Q81 H;  5BMV A;  4DRX A;  2BTQ B;  5LA6 A;  4X20 B;  3TD4 A;  4C8G A;  3I7T A;  2PMP A;  4I55 B;  3HKC A;  3I56 F;  5G4U C;  2VAP A;  3HKE B;  5JQG B;  1KNK A;  3M84 A;  3FD5 A;  5LYJ B;  4RQO A;  3CCJ F;  1W55 A;  3CCU F;  4O2B B;  5MN4 A;  2GLZ A;  3Q8H A;  3I55 F;  3M4S A;  5GAP K;  1YQN A;  3HAX D;  3E20 B;  3CCM F;  1U3P A;  5JCO A;  3K14 A;  1N8R H;  2Q1X A;  4RHA A;  3CC2 F;  3N4Y A;  1U43 A;  5B8F A;  3NK7 A;  4KWE A;  1W5E A;  3ESJ A;  3PLA C;  3NVK E;  2Z01 A;  4BT5 A;  4ZOL B;  1X7P A;  3RYH A;  5J2T A;  3CPW F;  3F0E A;  1VQ7 F;  5EYP A;  3UT5 B;  5JCO C;  1VK3 A;  3QTY A;  3FBA A;  4BY9 D;  5C8Y B;  3LME A;  2K1S A;  2OTM A;  2HP0 A;  3NMU C;  1W59 A;  2GZL A;  1SA0 A;  2EWC A;  2P6Y A;  4IIJ B;  2ZF8 A;  3C9S A;  4G4V A;  2VAM A;  1U40 A;  3HKB A;  3JAT B;  4X20 A;  4C8E A;  4ZI7 A;  1M1K H;  3HJW C;  1JFF B;  2MQE A;  4XCQ A;  5HY4 A;  5J2U B;  3JAK A;  5CB4 B;  1QAH A;  5IJ0 B;  3M1X A;  3AGK A;  3HKE A;  5JQG A;  3L7Q A;  4G4Z A;  5IYZ B;  3WPX A;  2JNB A;  5GIN C;  3IMP A;  3O85 A;  3P4E A;  1JD1 A;  4LNU B;  3VYU C;  3HKD B;  3VIU A;  5FNV A;  3D54 A;  4O2B A;  3PAF A;  3J80 M;  3LWV C;  5JVD B;  3CCL F;  4PWT A;  5HWE A;  3JAW A;  3QHD A;  4BT4 A;  3ZO8 A;  2Z1T A;  3NVI B;  3VOB A;  3WJP A;  3RYI B;  1UI9 A;  3B6N A;  3C9U A;  2HRY A;  4ZOL A;  4TV9 A;  4I4T A;  3CCS F;  3SIV A;  5ITZ B;  2HRU A;  3JCM M;  1KC8 H;  2W8B C;  2BTO A;  2VXY A;  5LOV A;  3WGM A;  5C8Y A;  3EOR A;  1U3L A;  1TUB B;  4YJ3 A;  1OAP A;  3VYS C;  3MBM A;  4C4W C;  2ALE A;  1TVK B;  4G4Y A;  4BT3 A;  1FFX B;  5HP7 A;  3WGL A;  5GAN K;  3S06 A;  1VQP F;  5CA1 B;  1JFF A;  5EZY A;  4X3M A;  2CVL A;  2AMT A;  3D00 A;  1DBF A;  1JJ2 F;  5CB4 A; 
#chains in the Genus database with same CATH homology
 3J81 M;  2QI2 A;  5G4U C;  3I56 F;  1YI2 F;  1X7O A;  2OTL F;  3V3T A;  2QA4 F;  3CD6 F;  1W3E X;  2OTJ F;  3CXC F;  1M90 H;  1W41 A;  1K73 H;  3LWP C;  3FFM A;  3WXM B;  3CCJ F;  1W42 A;  2FGY A;  3CCU F;  4BW0 B;  5HY2 A;  3I55 F;  2GLZ A;  1S72 F;  5GAP K;  1YIT F;  3LWO C;  4LCK A;  3HAX D;  3E20 B;  3CCM F;  2WAL A;  3LFO A;  1YHQ F;  3JAM M;  1N8R H;  1X52 A;  5EO3 A;  3GYQ A;  2QEX F;  3G4S F;  3CC2 F;  3N4Y A;  3NK7 A;  3CC4 F;  1Q7Y H;  2OZB A;  2VGN A;  3VI6 A;  3PLA C;  3NVK E;  3IR9 A;  2I6D A;  1GO0 A;  5A2Q M;  1KQS F;  1VQ8 F;  1X7P A;  3CCQ F;  3CPW F;  3LWR C;  1VQO F;  1VQ6 F;  3VMF B;  1H7M A;  3NK6 A;  1VQ7 F;  1VQ4 F;  1XBI A;  5FJ4 C;  4BVR A;  2CZW A;  1Q82 H;  5EWR A;  4BVQ A;  5GIP C;  4BY9 D;  1NJI H;  3V7E A;  4BVT A;  1Q86 H;  1VQ5 F;  3NMU C;  1YJN F;  3V7Q A;  1ZWZ A;  3MCA B;  5GIO C;  2LBX A;  1SDS A;  5FLX M;  3CPQ A;  3CG6 A;  3OBY A;  4NQ3 A;  1M1K H;  3HJW C;  4XCQ A;  2KTU A;  1DT9 A;  2KG4 A;  5HY4 A;  5HXU A;  1RLG A;  5IT9 M;  4X3L A;  5G4V C;  3G6E F;  1VQN F;  1E7K A;  1NMU B;  3CCE F;  2FC3 A;  3AGK A;  1W2B F;  1YJW F;  2JNB A;  5GIN C;  3O85 A;  1PXW A;  1K9M H;  3LWQ C;  3CME F;  1QVG F;  1W40 A;  2OHW A;  3J80 M;  3PAF A;  3LWV C;  3CCL F;  2BO1 A;  2HVY D;  5HY0 A;  4NUT A;  5HWE A;  2LBW A;  4EI9 A;  1VQK F;  3J7A R;  1CK2 A;  3CCV F;  3ON1 A;  1T0K B;  3CC7 F;  1YJ9 F;  1VQM F;  3OW2 F;  3NVI B;  1IPA A;  1GO1 A;  5HXZ A;  1GZ0 A;  2VGM A;  3RA5 A;  3CCR F;  3SIU A;  3G71 F;  3E1Y A;  1CN7 A;  3CCS F;  2AIF A;  3SIV A;  4EI7 A;  3JCM M;  3CMA F;  1YIJ F;  1KC8 H;  3N4Z A;  4TZZ A;  1KD1 H;  4C4W C;  3OBW A;  2ALE A;  1VQL F;  5HY1 A;  4EI8 A;  1RA4 A;  4BVS A;  1Q81 H;  1VQ9 F;  5DCV A;  3RA6 A;  5GAN K;  1VQP F;  2KTV A;  2F9Z C;  4X3M A;  3D00 A;  1K8A H;  1QVF F;  1JJ2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...