2OZBA

Structure of a human prp31-15.5k-u4 snrna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
126
structure length
126
Chain Sequence
EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA comprising the 5' Stem-Loop RNA of U4snRNA
publication title Binding of the human Prp31 Nop domain to a composite RNA-protein platform in U4 snRNP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 39
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ozbA00
4NUTA 1YJWF 1GO0A 3CCUF 3J7AR 3HJWC 3CC4F 3CCVF 1YJ9F 1KQSF 1W41A 2WALA 5G4VC 3WXMB 5EO3A 4TZZA 3CCLF 1W40A 3LWOC 3CC2F 1VQ6F 3CCEF 3CCSF 3HAXD 1Q81H 3OBYA 3CC7F 1NJIH 1IPAA 4BW0B 4BY9D 5IT9M 3CCRF 4C4WC 1GO1A 3VI6A 1CN7A 3PLAC 3CCQF 3G71F 3NVKE 1NMUB 3CCJF 1X7PA 3VMFB 1Q86H 3N4YA 3CD6F 3CCMF 1Q82H 2QI2A 4X3MA 5GIOC 5EWRA 3NK7A 3NVIB 3SIVA 3V7EA 5GAPK 3G4SF 1GZ0A 3OBWA 3LWQC 1XBIA 2JNBA 2VGNA 3JCMM 2OHWA 1PXWA 1JJ2F 2I6DA 3FFMA 1H7MA 1SDSA 4X3LA 1QVFF 3O85A 3RA5A 5G4UC 3IR9A 3NMUC 1KD1H 5GIPC 3NK6A 1W3EX 1K73H 3MCAB 1VQNF 1RA4A 3LWVC 3CPQA 2OTLF 2BO1A 1RLGA 1S72F 1W2BF 3AGKA 2VGMA 3E20B 2CZWA 4LCKA 2FC3A 1YITF 1VQPF 1VQLF 3V7QA 1YHQF 1T0KB 3GYQA 3N4ZA 2LBWA 2QEXF 3OW2F 1X52A 5GINC 1K9MH 3SIUA 1VQKF 3LFOA 5DCVA 5FJ4C 1VQOF 1N8RH 1YIJF 1VQ7F 2KG4A 1VQ5F 2HVYD 2KTVA 1KC8H 3CG6A 1QVGF 1YJNF 1VQ8F 3CXCF 1YI2F 3RA6A 1DT9A 1W42A 3I56F 1VQMF 5FLXM 1M90H 3JAMM 2QA4F 2ALEA 2AIFA 1ZWZA 3G6EF 2OZBA 3CMAF 5A2QM 3LWPC 2KTUA 1VQ9F 1M1KH 3LWRC 1CK2A 3CPWF 1K8AH 1VQ4F 2LBXA 3ON1A 1X7OA 3J81M 3CMEF 3J80M 1E7KA 2OTJF 5GANK 3PAFA 3E1YA 3I55F 1Q7YH
chains in the Genus database with same CATH superfamily
3ZO8A 1SA0B 1IV2A 5AVMA 2Z1UA 1W5EA 3WXMB 4TZZA 3LDTA 3LWOC 3CCEF 4RQOA 4XCQA 1UI9A 1Q8RA 3VYUC 1DBFA 1FFXB 3OBYA 5JCOC 5IJ9B 2H6LA 3FPIA 3E22B 3QTYA 3HKEA 1KNKA 5HP7A 2RHJA 4C4WC 3N2GB 3RYHB 5KMGB 2VAMA 5EB0A 3PLAC 3CCQF 2YXZA 3D00A 4HNAA 3NVKE 5LOVA 3CCJF 3C9SA 1X7PA 5JVDA 3N4YA 3CD6F 3VYSC 4BVTA 1NQ3A 4X3MA 4R40B 2ZVZA 2P6YA 4B46A 3V7EA 3ZP4A 4IHJA 1GZ0A 1H48A 2CWJA 1JJ2F 3HKCA 1TUBB 3FFMA 5CB4A 4X3LA 1QVFF 1W59A 3O85A 1ODEA 3KE1A 3V3TA 4O4LA 1VH8A 4NQ3A 1VQNF 5IJ0A 3P10A 4BVQA 3CPQA 1RLGA 2BO1A 3ESJA 3HKBB 3E20B 4EI7A 3Q8HA 2FC3A 1U40A 1VQLF 1R1MA 3QHDA 4O4JA 3RYFB 1OAPA 3I3FA 3JVHA 5LP6B 4C82A 5FNVB 5CA1B 4X1IA 5EIBD 1K9MH 4O4HB 3LFOA 5DCVA 1YQNA 1VQOF 2UYKA 3S0HA 1YIJF 2EWCA 2GVIA 1VQVA 2HQSC 3MBMA 4O2AB 4ZHYB 3JAWB 3F0GA 2HVYD 5IYZB 3VCZA 2VAPA 1KC8H 1FNKA 3UT5A 4KWEA 4I55A 1YJNF 5CA0B 4O4IB 1DT9A 4ZHVA 3JAMM 2QA4F 2V9YA 4U3JA 4ZHQB 5J2TB 3WGLA 3JAKB 3CMAF 5KX5A 2DT4A 3QUWA 3MDOA 3P0ZA 1M1KH 3LWRC 3WPWA 2UYNB 1X7OA 2RHHA 3J81M 1COMA 5HXUA 3WGMA 3R0PA 3JASA 4EB6A 1GO0A 3CCUF 5B8FA 3CC4F 1YJ9F 1VHAA 1KQSF 5LXTB 4ZI7A 3JARA 3CCLF 4EI8A 3M4SA 5LA6B 3ZOPA 3M1XA 3CC2F 3VYTC 3CCSF 1W5FA 3HAXD 1JFFB 3CC7F 1IPAA 3CCRF 4X20B 5CB4B 3IMPA 4YJ2B 5ITZA 1CN7A 5J2UB 2GLZA 4F6RA 4X1KB 5LYJA 2UYPA 2HS0A 3CCMF 4G4XA 2QI2A 1VK3A 4BVRA 5HXZA 4I4TA 4EI9A 3NK7A 3NVIB 2VXYA 3TD4A 4O4JB 4ZOLA 4BT7A 5BMVA 5MN6A 3HKDA 3ERNA 1U3PA 2JNBA 2R6R1 2VGNA 3D54A 2Z1FA 4IIJB 4B45A 4TUYA 1SDSA 2HX0A 3JALA 5G4UC 1H47A 2K1SA 4LNUA 1KD1H 3NK6A 2DYYA 4G88A 1K73H 4X1YA 3MCAB 5EZYA 3K14A 1RA4A 3VO8A 3LWVC 3OONA 4DRXA 1IV1A 1FSZA 2HP0A 1S72F 3HTNA 3JATA 4G4VA 3F0DA 2CZWA 4C81A 4LCKA 3N2KB 1T0KB 1YHQF 2LBWA 1TVKA 4TV9A 4YJ3B 1QU9A 3CYQA 5KX5B 2HRYA 4BT6A 1J7HA 1VQKF 5EYPB 2CVLA 4FFBB 5FJ4C 3JASB 1VQ5F 3RYIA 2KTVA 3C8LA 4BT3A 1T0AA 5JH7A 4O2BB 1QVGF 2BTUA 1YI2F 3CYPB 5HP8A 2B33A 2UZHA 1W42A 2ZVYA 5GONA 1PF5A 3I56F 4BT5A 1QD9A 1U3LA 4WBNB 3WGNA 3G6EF 2OZBA 5A2QM 2KTUA 3RYCB 5JQGA 1XHOA 2HP3A 3CPWF 2HS4A 1K8AH 2CW4A 2LBXA 3ON1A 4U39A 5GANK 3C9RA 3K0TA 4NUTA 2Z01A 1SA0A 1YJWF 3KJJA 3IEQA 4C8IA 3HJWC 2IAFA 1W41A 2WALA 1X25A 5EO3A 4RHAA 4G4ZA 1IV4A 1FFXA 4ZOLB 3F0FA 3TD5A 1Q81H 5IJ9A 5MN5A 1KNJA 3E22A 1NJIH 2G9IA 4BW0B 4G4WA 3N2GA 3HKEB 3RYHA 5KMGA 2ZODA 3JALB 3EORA 3MQWA 4PWTA 2FGYA 3KJKA 5EB1B 3IEWA 3ELCA 4HNAB 5HWEA 4TV8A 1W57A 5LOVB 5JVDB 3C9TA 2HP0B 3JATB 2OTMA 3U0OA 3MCQA 2YYEA 2ZOVA 2Q1XA 1W5AA 3LWQC 4IHJB 1XBIA 3JCMM 2W8BC 1TUBA 1PXWA 1ONIA 2I6DA 3HKCB 1H7MA 1Z5WA 3RA5A 3GHZA 1RQ7A 3IR9A 3NMUC 5GIPC 1W3EX 1U43A 2UYJA 3LYBA 2NMUA 4O4LB 2HS3A 5JH7B 3HKBA 5IJ0B 5MN4A 1W2BF 3AGKA 1JD1A 2VGMA 3WPXA 3K2XA 3B6NA 1YITF 1VQPF 3FD6A 3RYFA 3ZP7A 5HY2A 4I50A 5LP6A 5CA1A 5GINC 5JQGB 3SIUA 4X1IB 3GTZA 2QTPA 1N8RH 2R751 4O2AA 4C8EA 3S02A 3F6MA 4B62A 1VQ7F 5IYZA 4C8GA 1OFUA 5CA0A 3UT5B 5JCOA 3WGJA 3S03A 1VQ8F 3CXCF 4I55B 4O4IA 3WJQA 3RA6A 1VQMF 5HY1A 5FLXM 5C8YA 3FBAA 4ZHQA 4U3JB 5J2TA 3JAKA 2AIFA 1ZWZA 2H8CA 3KIZA 1VQ9F 2UYNA 1CK2A 3CMEF 2VAWA 3J80M 4M8IA 2OTJF 3RE3A 5EAZA 2BTOA 4BT2A 3PAFA 3E1YA 3I55F 1W55A 1Q7YH 4EB6B 2L26A 3D01A 3M84A 1GX1A 3K12A 3J7AR 4TV8B 2Z1TA 2RB9A 5LXTA 1XV2A 3CCVF 3FD5A 5G4VC 1W40A 3JARB 3KHNA 2N48A 5LA6A 4ZI7B 1VQ6F 3HWUA 2ZF8A 1JFFA 2LCAA 2CHSA 3IKEA 4BY9D 2PHNA 4X20A 5IT9M 4YJ2A 2RHLA 1GO1A 5J2UA 5ITZB 3VI6A 4X1KA 3I7TA 2PMPA 1QAHA 3G71F 4F6RB 2MQEA 5LYJB 4E6EA 1NMUB 2IQQA 4ZK7A 3VMFB 1Q86H 3IKFA 3BYQA 2Q1YA 5GIOC 5EWRA 4I4TB 3SIVA 5LP6C 4B5CA 5GAPK 3G4SF 4I50B 3TD3A 5BMVB 3OBWA 3HKDB 1Z5VA 2OHWA 4IIJA 3LMEA 2BTQB 1JY8A 1RLUA 4TUYB 1RQ2A 3VOAA 2H8EA 1JN1A 3S0YA 1SZQA 2F9ZC 4LNUB 3VTIC 4X1YB 5EZYB 3S06A 3WJRA 2OTLF 3DDNA 1XRGA 4DRXB 3N2KA 3C9UA 3L7QA 5C8YB 2IG8A 3V7QA 4BT4A 3GYQA 3N4ZA 4YJ3A 4BVSA 4ERHA 2QEXF 1X52A 3OW2F 1CLIA 1TVKB 4TV9B 1W581 2LBTA 3VIUA 5EYPA 4FFBA 2I6RA 1IV3A 5HY0A 2ZAUA 4G4YA 3S0WA 2CSLA 3P4EA 2KG4A 2KGWA 3CB2A 2AIZP 3WGKA 4O2BA 3RYIB 3CG6A 3VOBA 2CHTA 1UFYA 3V4DA 1M90H 5GONB 5HY4A 4WBNA 4ZHWA 2ALEA 3DC2A 1YGYA 4DXDA 3RYCA 2GZLA 3LWPC 4NWOB 5FNVA 5EIBC 2RHOA 3F0EA 3WJPA 2HRUA 1VQ4F 1E7KA 4O4HA 3T80A 2Z1EA 2AMTA 1Q82H 3JAWA 1FNJA 1W5BA
chains in the Genus database with same CATH topology
4NUTA 1YJWF 1GO0A 3CCUF 3J7AR 3HJWC 3CC4F 3CCVF 1YJ9F 1KQSF 1W41A 2WALA 5G4VC 3WXMB 5EO3A 4TZZA 3CCLF 1W40A 3LWOC 4EI8A 3CC2F 1VQ6F 3CCEF 3CCSF 4XCQA 3HAXD 1Q81H 3OBYA 3CC7F 1NJIH 1IPAA 4BW0B 4BY9D 5IT9M 3CCRF 4C4WC 1GO1A 3VI6A 1CN7A 2FGYA 2GLZA 3PLAC 3CCQF 3G71F 3D00A 3NVKE 1NMUB 3CCJF 5HWEA 1X7PA 3VMFB 1Q86H 3N4YA 3CD6F 3CCMF 4BVTA 1Q82H 2QI2A 4X3MA 5GIOC 4BVRA 5EWRA 5HXZA 4EI9A 3NK7A 3NVIB 3SIVA 3V7EA 5GAPK 3G4SF 1GZ0A 3OBWA 3LWQC 1XBIA 2JNBA 2VGNA 3JCMM 2OHWA 1PXWA 1JJ2F 2I6DA 3FFMA 1H7MA 1SDSA 4X3LA 1QVFF 3O85A 3RA5A 5G4UC 3IR9A 3NMUC 1KD1H 5GIPC 3NK6A 2F9ZC 1W3EX 3V3TA 1K73H 3MCAB 4NQ3A 1VQNF 1RA4A 4BVQA 3LWVC 3CPQA 2OTLF 2BO1A 1RLGA 1S72F 1W2BF 3AGKA 2VGMA 3E20B 4EI7A 2CZWA 4LCKA 2FC3A 1YITF 1VQPF 1VQLF 3V7QA 1YHQF 1T0KB 3GYQA 3N4ZA 2LBWA 4BVSA 2QEXF 5HY2A 1X52A 3OW2F 5GINC 1K9MH 3SIUA 1VQKF 3LFOA 5DCVA 5FJ4C 5HY0A 1VQOF 1N8RH 1YIJF 1VQ7F 2KG4A 1VQ5F 2HVYD 2KTVA 1KC8H 3CG6A 1QVGF 1YJNF 1VQ8F 3CXCF 1YI2F 3RA6A 1DT9A 1W42A 3I56F 1VQMF 5HY1A 5FLXM 1M90H 5HY4A 3JAMM 2QA4F 2ALEA 2AIFA 1ZWZA 3G6EF 2OZBA 3CMAF 5A2QM 3LWPC 2KTUA 1VQ9F 1M1KH 3LWRC 1CK2A 3CPWF 1K8AH 1VQ4F 2LBXA 3ON1A 1X7OA 3J81M 3CMEF 3J80M 5HXUA 1E7KA 2OTJF 5GANK 3PAFA 3E1YA 3I55F 1Q7YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUT A;  1YJW F;  1GO0 A;  3CCU F;  3J7A R;  3HJW C;  3CC4 F;  3CCV F;  1YJ9 F;  1KQS F;  1W41 A;  2WAL A;  5G4V C;  3WXM B;  5EO3 A;  4TZZ A;  3CCL F;  1W40 A;  3LWO C;  3CC2 F;  1VQ6 F;  3CCE F;  3CCS F;  3HAX D;  1Q81 H;  3OBY A;  3CC7 F;  1NJI H;  1IPA A;  4BW0 B;  4BY9 D;  5IT9 M;  3CCR F;  4C4W C;  1GO1 A;  3VI6 A;  1CN7 A;  3PLA C;  3CCQ F;  3G71 F;  3NVK E;  1NMU B;  3CCJ F;  1X7P A;  3VMF B;  1Q86 H;  3N4Y A;  3CD6 F;  3CCM F;  1Q82 H;  2QI2 A;  4X3M A;  5GIO C;  5EWR A;  3NK7 A;  3NVI B;  3SIV A;  3V7E A;  5GAP K;  3G4S F;  1GZ0 A;  3OBW A;  3LWQ C;  1XBI A;  2JNB A;  2VGN A;  3JCM M;  2OHW A;  1PXW A;  1JJ2 F;  2I6D A;  3FFM A;  1H7M A;  1SDS A;  4X3L A;  1QVF F;  3O85 A;  3RA5 A;  5G4U C;  3IR9 A;  3NMU C;  1KD1 H;  5GIP C;  3NK6 A;  1W3E X;  1K73 H;  3MCA B;  1VQN F;  1RA4 A;  3LWV C;  3CPQ A;  2OTL F;  2BO1 A;  1RLG A;  1S72 F;  1W2B F;  3AGK A;  2VGM A;  3E20 B;  2CZW A;  4LCK A;  2FC3 A;  1YIT F;  1VQP F;  1VQL F;  3V7Q A;  1YHQ F;  1T0K B;  3GYQ A;  3N4Z A;  2LBW A;  2QEX F;  3OW2 F;  1X52 A;  5GIN C;  1K9M H;  3SIU A;  1VQK F;  3LFO A;  5DCV A;  5FJ4 C;  1VQO F;  1N8R H;  1YIJ F;  1VQ7 F;  2KG4 A;  1VQ5 F;  2HVY D;  2KTV A;  1KC8 H;  3CG6 A;  1QVG F;  1YJN F;  1VQ8 F;  3CXC F;  1YI2 F;  3RA6 A;  1DT9 A;  1W42 A;  3I56 F;  1VQM F;  5FLX M;  1M90 H;  3JAM M;  2QA4 F;  2ALE A;  2AIF A;  1ZWZ A;  3G6E F;  2OZB A;  3CMA F;  5A2Q M;  3LWP C;  2KTU A;  1VQ9 F;  1M1K H;  3LWR C;  1CK2 A;  3CPW F;  1K8A H;  1VQ4 F;  2LBX A;  3ON1 A;  1X7O A;  3J81 M;  3CME F;  3J80 M;  1E7K A;  2OTJ F;  5GAN K;  3PAF A;  3E1Y A;  3I55 F;  1Q7Y H; 
#chains in the Genus database with same CATH topology
 3ZO8 A;  1SA0 B;  1IV2 A;  5AVM A;  2Z1U A;  1W5E A;  3WXM B;  4TZZ A;  3LDT A;  3LWO C;  3CCE F;  4RQO A;  4XCQ A;  1UI9 A;  1Q8R A;  3VYU C;  1DBF A;  1FFX B;  3OBY A;  5JCO C;  5IJ9 B;  2H6L A;  3FPI A;  3E22 B;  3QTY A;  3HKE A;  1KNK A;  5HP7 A;  2RHJ A;  4C4W C;  3N2G B;  3RYH B;  5KMG B;  2VAM A;  5EB0 A;  3PLA C;  3CCQ F;  2YXZ A;  3D00 A;  4HNA A;  3NVK E;  5LOV A;  3CCJ F;  3C9S A;  1X7P A;  5JVD A;  3N4Y A;  3CD6 F;  3VYS C;  4BVT A;  1NQ3 A;  4X3M A;  4R40 B;  2ZVZ A;  2P6Y A;  4B46 A;  3V7E A;  3ZP4 A;  4IHJ A;  1GZ0 A;  1H48 A;  2CWJ A;  1JJ2 F;  3HKC A;  1TUB B;  3FFM A;  5CB4 A;  4X3L A;  1QVF F;  1W59 A;  3O85 A;  1ODE A;  3KE1 A;  3V3T A;  4O4L A;  1VH8 A;  4NQ3 A;  1VQN F;  5IJ0 A;  3P10 A;  4BVQ A;  3CPQ A;  1RLG A;  2BO1 A;  3ESJ A;  3HKB B;  3E20 B;  4EI7 A;  3Q8H A;  2FC3 A;  1U40 A;  1VQL F;  1R1M A;  3QHD A;  4O4J A;  3RYF B;  1OAP A;  3I3F A;  3JVH A;  5LP6 B;  4C82 A;  5FNV B;  5CA1 B;  4X1I A;  5EIB D;  1K9M H;  4O4H B;  3LFO A;  5DCV A;  1YQN A;  1VQO F;  2UYK A;  3S0H A;  1YIJ F;  2EWC A;  2GVI A;  1VQV A;  2HQS C;  3MBM A;  4O2A B;  4ZHY B;  3JAW B;  3F0G A;  2HVY D;  5IYZ B;  3VCZ A;  2VAP A;  1KC8 H;  1FNK A;  3UT5 A;  4KWE A;  4I55 A;  1YJN F;  5CA0 B;  4O4I B;  1DT9 A;  4ZHV A;  3JAM M;  2QA4 F;  2V9Y A;  4U3J A;  4ZHQ B;  5J2T B;  3WGL A;  3JAK B;  3CMA F;  5KX5 A;  2DT4 A;  3QUW A;  3MDO A;  3P0Z A;  1M1K H;  3LWR C;  3WPW A;  2UYN B;  1X7O A;  2RHH A;  3J81 M;  1COM A;  5HXU A;  3WGM A;  3R0P A;  3JAS A;  4EB6 A;  1GO0 A;  3CCU F;  5B8F A;  3CC4 F;  1YJ9 F;  1VHA A;  1KQS F;  5LXT B;  4ZI7 A;  3JAR A;  3CCL F;  4EI8 A;  3M4S A;  5LA6 B;  3ZOP A;  3M1X A;  3CC2 F;  3VYT C;  3CCS F;  1W5F A;  3HAX D;  1JFF B;  3CC7 F;  1IPA A;  3CCR F;  4X20 B;  5CB4 B;  3IMP A;  4YJ2 B;  5ITZ A;  1CN7 A;  5J2U B;  2GLZ A;  4F6R A;  4X1K B;  5LYJ A;  2UYP A;  2HS0 A;  3CCM F;  4G4X A;  2QI2 A;  1VK3 A;  4BVR A;  5HXZ A;  4I4T A;  4EI9 A;  3NK7 A;  3NVI B;  2VXY A;  3TD4 A;  4O4J B;  4ZOL A;  4BT7 A;  5BMV A;  5MN6 A;  3HKD A;  3ERN A;  1U3P A;  2JNB A;  2R6R 1;  2VGN A;  3D54 A;  2Z1F A;  4IIJ B;  4B45 A;  4TUY A;  1SDS A;  2HX0 A;  3JAL A;  5G4U C;  1H47 A;  2K1S A;  4LNU A;  1KD1 H;  3NK6 A;  2DYY A;  4G88 A;  1K73 H;  4X1Y A;  3MCA B;  5EZY A;  3K14 A;  1RA4 A;  3VO8 A;  3LWV C;  3OON A;  4DRX A;  1IV1 A;  1FSZ A;  2HP0 A;  1S72 F;  3HTN A;  3JAT A;  4G4V A;  3F0D A;  2CZW A;  4C81 A;  4LCK A;  3N2K B;  1T0K B;  1YHQ F;  2LBW A;  1TVK A;  4TV9 A;  4YJ3 B;  1QU9 A;  3CYQ A;  5KX5 B;  2HRY A;  4BT6 A;  1J7H A;  1VQK F;  5EYP B;  2CVL A;  4FFB B;  5FJ4 C;  3JAS B;  1VQ5 F;  3RYI A;  2KTV A;  3C8L A;  4BT3 A;  1T0A A;  5JH7 A;  4O2B B;  1QVG F;  2BTU A;  1YI2 F;  3CYP B;  5HP8 A;  2B33 A;  2UZH A;  1W42 A;  2ZVY A;  5GON A;  1PF5 A;  3I56 F;  4BT5 A;  1QD9 A;  1U3L A;  4WBN B;  3WGN A;  3G6E F;  2OZB A;  5A2Q M;  2KTU A;  3RYC B;  5JQG A;  1XHO A;  2HP3 A;  3CPW F;  2HS4 A;  1K8A H;  2CW4 A;  2LBX A;  3ON1 A;  4U39 A;  5GAN K;  3C9R A;  3K0T A;  4NUT A;  2Z01 A;  1SA0 A;  1YJW F;  3KJJ A;  3IEQ A;  4C8I A;  3HJW C;  2IAF A;  1W41 A;  2WAL A;  1X25 A;  5EO3 A;  4RHA A;  4G4Z A;  1IV4 A;  1FFX A;  4ZOL B;  3F0F A;  3TD5 A;  1Q81 H;  5IJ9 A;  5MN5 A;  1KNJ A;  3E22 A;  1NJI H;  2G9I A;  4BW0 B;  4G4W A;  3N2G A;  3HKE B;  3RYH A;  5KMG A;  2ZOD A;  3JAL B;  3EOR A;  3MQW A;  4PWT A;  2FGY A;  3KJK A;  5EB1 B;  3IEW A;  3ELC A;  4HNA B;  5HWE A;  4TV8 A;  1W57 A;  5LOV B;  5JVD B;  3C9T A;  2HP0 B;  3JAT B;  2OTM A;  3U0O A;  3MCQ A;  2YYE A;  2ZOV A;  2Q1X A;  1W5A A;  3LWQ C;  4IHJ B;  1XBI A;  3JCM M;  2W8B C;  1TUB A;  1PXW A;  1ONI A;  2I6D A;  3HKC B;  1H7M A;  1Z5W A;  3RA5 A;  3GHZ A;  1RQ7 A;  3IR9 A;  3NMU C;  5GIP C;  1W3E X;  1U43 A;  2UYJ A;  3LYB A;  2NMU A;  4O4L B;  2HS3 A;  5JH7 B;  3HKB A;  5IJ0 B;  5MN4 A;  1W2B F;  3AGK A;  1JD1 A;  2VGM A;  3WPX A;  3K2X A;  3B6N A;  1YIT F;  1VQP F;  3FD6 A;  3RYF A;  3ZP7 A;  5HY2 A;  4I50 A;  5LP6 A;  5CA1 A;  5GIN C;  5JQG B;  3SIU A;  4X1I B;  3GTZ A;  2QTP A;  1N8R H;  2R75 1;  4O2A A;  4C8E A;  3S02 A;  3F6M A;  4B62 A;  1VQ7 F;  5IYZ A;  4C8G A;  1OFU A;  5CA0 A;  3UT5 B;  5JCO A;  3WGJ A;  3S03 A;  1VQ8 F;  3CXC F;  4I55 B;  4O4I A;  3WJQ A;  3RA6 A;  1VQM F;  5HY1 A;  5FLX M;  5C8Y A;  3FBA A;  4ZHQ A;  4U3J B;  5J2T A;  3JAK A;  2AIF A;  1ZWZ A;  2H8C A;  3KIZ A;  1VQ9 F;  2UYN A;  1CK2 A;  3CME F;  2VAW A;  3J80 M;  4M8I A;  2OTJ F;  3RE3 A;  5EAZ A;  2BTO A;  4BT2 A;  3PAF A;  3E1Y A;  3I55 F;  1W55 A;  1Q7Y H;  4EB6 B;  2L26 A;  3D01 A;  3M84 A;  1GX1 A;  3K12 A;  3J7A R;  4TV8 B;  2Z1T A;  2RB9 A;  5LXT A;  1XV2 A;  3CCV F;  3FD5 A;  5G4V C;  1W40 A;  3JAR B;  3KHN A;  2N48 A;  5LA6 A;  4ZI7 B;  1VQ6 F;  3HWU A;  2ZF8 A;  1JFF A;  2LCA A;  2CHS A;  3IKE A;  4BY9 D;  2PHN A;  4X20 A;  5IT9 M;  4YJ2 A;  2RHL A;  1GO1 A;  5J2U A;  5ITZ B;  3VI6 A;  4X1K A;  3I7T A;  2PMP A;  1QAH A;  3G71 F;  4F6R B;  2MQE A;  5LYJ B;  4E6E A;  1NMU B;  2IQQ A;  4ZK7 A;  3VMF B;  1Q86 H;  3IKF A;  3BYQ A;  2Q1Y A;  5GIO C;  5EWR A;  4I4T B;  3SIV A;  5LP6 C;  4B5C A;  5GAP K;  3G4S F;  4I50 B;  3TD3 A;  5BMV B;  3OBW A;  3HKD B;  1Z5V A;  2OHW A;  4IIJ A;  3LME A;  2BTQ B;  1JY8 A;  1RLU A;  4TUY B;  1RQ2 A;  3VOA A;  2H8E A;  1JN1 A;  3S0Y A;  1SZQ A;  2F9Z C;  4LNU B;  3VTI C;  4X1Y B;  5EZY B;  3S06 A;  3WJR A;  2OTL F;  3DDN A;  1XRG A;  4DRX B;  3N2K A;  3C9U A;  3L7Q A;  5C8Y B;  2IG8 A;  3V7Q A;  4BT4 A;  3GYQ A;  3N4Z A;  4YJ3 A;  4BVS A;  4ERH A;  2QEX F;  1X52 A;  3OW2 F;  1CLI A;  1TVK B;  4TV9 B;  1W58 1;  2LBT A;  3VIU A;  5EYP A;  4FFB A;  2I6R A;  1IV3 A;  5HY0 A;  2ZAU A;  4G4Y A;  3S0W A;  2CSL A;  3P4E A;  2KG4 A;  2KGW A;  3CB2 A;  2AIZ P;  3WGK A;  4O2B A;  3RYI B;  3CG6 A;  3VOB A;  2CHT A;  1UFY A;  3V4D A;  1M90 H;  5GON B;  5HY4 A;  4WBN A;  4ZHW A;  2ALE A;  3DC2 A;  1YGY A;  4DXD A;  3RYC A;  2GZL A;  3LWP C;  4NWO B;  5FNV A;  5EIB C;  2RHO A;  3F0E A;  3WJP A;  2HRU A;  1VQ4 F;  1E7K A;  4O4H A;  3T80 A;  2Z1E A;  2AMT A;  1Q82 H;  3JAW A;  1FNJ A;  1W5B A; 
#chains in the Genus database with same CATH homology
 4NUT A;  1YJW F;  1GO0 A;  3CCU F;  3J7A R;  3HJW C;  3CC4 F;  3CCV F;  1YJ9 F;  1KQS F;  1W41 A;  2WAL A;  5G4V C;  3WXM B;  5EO3 A;  4TZZ A;  3CCL F;  1W40 A;  3LWO C;  4EI8 A;  3CC2 F;  1VQ6 F;  3CCE F;  3CCS F;  4XCQ A;  3HAX D;  1Q81 H;  3OBY A;  3CC7 F;  1NJI H;  1IPA A;  4BW0 B;  4BY9 D;  5IT9 M;  3CCR F;  4C4W C;  1GO1 A;  3VI6 A;  1CN7 A;  2FGY A;  2GLZ A;  3PLA C;  3CCQ F;  3G71 F;  3D00 A;  3NVK E;  1NMU B;  3CCJ F;  5HWE A;  1X7P A;  3VMF B;  1Q86 H;  3N4Y A;  3CD6 F;  3CCM F;  4BVT A;  1Q82 H;  2QI2 A;  4X3M A;  5GIO C;  4BVR A;  5EWR A;  5HXZ A;  4EI9 A;  3NK7 A;  3NVI B;  3SIV A;  3V7E A;  5GAP K;  3G4S F;  1GZ0 A;  3OBW A;  3LWQ C;  1XBI A;  2JNB A;  2VGN A;  3JCM M;  2OHW A;  1PXW A;  1JJ2 F;  2I6D A;  3FFM A;  1H7M A;  1SDS A;  4X3L A;  1QVF F;  3O85 A;  3RA5 A;  5G4U C;  3IR9 A;  3NMU C;  1KD1 H;  5GIP C;  3NK6 A;  2F9Z C;  1W3E X;  3V3T A;  1K73 H;  3MCA B;  4NQ3 A;  1VQN F;  1RA4 A;  4BVQ A;  3LWV C;  3CPQ A;  2OTL F;  2BO1 A;  1RLG A;  1S72 F;  1W2B F;  3AGK A;  2VGM A;  3E20 B;  4EI7 A;  2CZW A;  4LCK A;  2FC3 A;  1YIT F;  1VQP F;  1VQL F;  3V7Q A;  1YHQ F;  1T0K B;  3GYQ A;  3N4Z A;  2LBW A;  4BVS A;  2QEX F;  5HY2 A;  1X52 A;  3OW2 F;  5GIN C;  1K9M H;  3SIU A;  1VQK F;  3LFO A;  5DCV A;  5FJ4 C;  5HY0 A;  1VQO F;  1N8R H;  1YIJ F;  1VQ7 F;  2KG4 A;  1VQ5 F;  2HVY D;  2KTV A;  1KC8 H;  3CG6 A;  1QVG F;  1YJN F;  1VQ8 F;  3CXC F;  1YI2 F;  3RA6 A;  1DT9 A;  1W42 A;  3I56 F;  1VQM F;  5HY1 A;  5FLX M;  1M90 H;  5HY4 A;  3JAM M;  2QA4 F;  2ALE A;  2AIF A;  1ZWZ A;  3G6E F;  2OZB A;  3CMA F;  5A2Q M;  3LWP C;  2KTU A;  1VQ9 F;  1M1K H;  3LWR C;  1CK2 A;  3CPW F;  1K8A H;  1VQ4 F;  2LBX A;  3ON1 A;  1X7O A;  3J81 M;  3CME F;  3J80 M;  5HXU A;  1E7K A;  2OTJ F;  5GAN K;  3PAF A;  3E1Y A;  3I55 F;  1Q7Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...