2OZBA

Structure of a human prp31-15.5k-u4 snrna complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
126
structure length
126
Chain Sequence
EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA comprising the 5' Stem-Loop RNA of U4snRNA
publication title Binding of the human Prp31 Nop domain to a composite RNA-protein platform in U4 snRNP.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ozbA00
3LWVC 3CCJF 3G71F 3J7AR 1QVGF 3I56F 1K8AH 1E7KA 1KD1H 3NVKE 3IR9A 3RA5A 1GO1A 3JAMM 4BY9D 3E20B 1PXWA 5IT9M 3WXMB 1YIJF 2LBWA 3LWQC 5GIOC 3E1YA 2KTVA 1GO0A 3GYQA 2OHWA 4TZZA 1W2BF 1K9MH 5A2QM 2HVYD 3LFOA 3O85A 5GIPC 1KQSF 1VQOF 1XBIA 3VI6A 3HJWC 3J81M 3CCMF 3CCQF 4X3MA 1Q82H 4X3LA 1S72F 2QI2A 1W40A 3N4ZA 3CXCF 1VQKF 1T0KB 1YJWF 3CCEF 3CCVF 2QEXF 1VQPF 1YITF 3LWRC 1CN7A 2KTUA 2VGMA 1GZ0A 1VQ5F 3LWPC 4LCKA 3CPWF 3CMEF 1Q86H 3NK6A 1QVFF 1YI2F 3I55F 2KG4A 3G6EF 1M90H 5FJ4C 1YJNF 1VQNF 3J80M 3VMFB 2ALEA 1VQMF 3NMUC 1KC8H 4NUTA 2LBXA 3CCUF 3CCRF 1RLGA 3SIUA 1ZWZA 3JCMM 1CK2A 1W3EX 2OTLF 2BO1A 5EWRA 3CD6F 3PLAC 2WALA 1N8RH 3CC7F 1VQ8F 3PAFA 5GAPK 3MCAB 3OBYA 3CCSF 1VQLF 1NMUB 3LWOC 3CG6A 1M1KH 1RA4A 3RA6A 1X7PA 2JNBA 3OW2F 2CZWA 3OBWA 5GANK 1VQ4F 1VQ9F 1Q7YH 3CC2F 5GINC 1JJ2F 2OZBA 3SIVA 3V7QA 1IPAA 1W41A 1X7OA 5FLXM 2QA4F 1K73H 3CPQA 3CCLF 3ON1A 3NVIB 3NK7A 4BW0B 5EO3A 5G4VC 3V7EA 5G4UC 1YJ9F 1X52A 3N4YA 2AIFA 1VQ6F 2OTJF 3CMAF 3CC4F 1SDSA 5DCVA 1DT9A 1W42A 2FC3A 2VGNA 3FFMA 3G4SF 2I6DA 1YHQF 1NJIH 1VQ7F 1Q81H 3HAXD 1H7MA 3AGKA 4C4WC
chains in the Genus database with same CATH superfamily
5EZYB 1W5FA 2IG8A 2L26A 3LWVC 4X20B 1FSZA 3KE1A 5IJ9B 3J7AR 1QVGF 3FBAA 1FNKA 3C9RA 1U40A 2GVIA 3VYUC 1TVKA 2CW4A 2DT4A 3N2GA 1GX1A 2CHSA 4ZOLA 2HQSC 3KHNA 4O4JB 2NMUA 3KIZA 3WGLA 4BY9D 5IYZB 3K12A 5C8YB 1YIJF 5IT9M 2LBWA 5GIOC 4BT6A 1GO0A 3JATB 4FFBA 4TZZA 1W2BF 3HTNA 3JARB 1K9MH 5CA0A 1QAHA 5GIPC 3VYSC 3VI6A 5JCOA 4I55A 2LCAA 3CCQF 3P0ZA 5CA1B 3JAWA 3JAKA 2HRUA 1W5EA 1W40A 4X1IB 4O2AA 5J2TB 1T0KB 3F0DA 1VQPF 3LWRC 2RB9A 1GZ0A 1VQ5F 3IKFA 2Z1TA 2F9ZC 2Z1EA 1UI9A 5EZYA 3WPXA 3I55F 3CB2A 4X20A 5IJ9A 2YXZA 1VQNF 4O4IB 3VMFB 3ERNA 2ZVYA 1VQMF 2LBXA 2HS4A 3C8LA 1JD1A 2Z1FA 3CCRF 3SIUA 1W581 4C8EA 4O4JA 1CK2A 5IYZA 3PLAC 5EWRA 5C8YA 1SZQA 2HP3A 2WALA 1N8RH 3PAFA 5HP7A 3ZP4A 3JATA 3CG6A 1RQ7A 3JARA 2JNBA 4DXDA 3VOAA 2UYPA 4M8IA 1VQ9F 1JJ2F 5GINC 3SIVA 4G88A 1IV1A 1Q8RA 5CA1A 4ERHA 3S0YA 1W41A 4F6RB 5HY4A 1K73H 4X1IA 3VCZA 3CPQA 2VAMA 4G4ZA 4BT4A 4X1YB 5J2TA 4E6EA 3WGMA 1YJ9F 5EYPB 3K2XA 3N2GB 5JVDB 3HKEB 2OTJF 1SDSA 1W5AA 2Z1UA 5DCVA 3LDTA 1ONIA 2IQQA 4G4YA 5LP6C 3BYQA 1YHQF 3F6MA 1NJIH 2RHLA 1Q81H 1W57A 5HXUA 3JALB 4ZI7B 4EB6B 3G71F 1KNKA 2PMPA 1OAPA 3I56F 2UZHA 2MQEA 4LNUB 3IR9A 3S06A 1TUBB 2ZVZA 4HNAB 3S0WA 3IMPA 3WGNA 1GO1A 3VTIC 5JH7B 3WXMB 3K0TA 3MBMA 4C82A 2P6YA 2KGWA 3FPIA 5AVMA 5J2UB 2YYEA 4O4LB 3O85A 4F6RA 1U3LA 3J81M 4X1YA 3CCMF 4NWOB 4PWTA 1XRGA 1VH8A 1S72F 2QI2A 2QTPA 5EYPA 2N48A 3FD5A 3IEQA 2FGYA 5JVDA 5ITZB 3HKEA 4EI7A 5GONB 3CCEF 1KNJA 1JY8A 5EIBC 4BT5A 1CN7A 2VGMA 5FNVB 2ZF8A 3LWPC 4LCKA 2V9YA 2UYNB 1Q86H 3NK6A 1Z5WA 1YI2F 4IIJB 3S0HA 1W59A 3JALA 4YJ2B 3G6EF 4U39A 3LMEA 5HP8A 4EB6A 4ZI7A 3J80M 5HY2A 4NUTA 1IV4A 5LYJB 3CCUF 4IHJB 4EI8A 5LOVB 4LNUA 4WBNA 1TUBA 4HNAA 3JCMM 1Z5VA 1W3EX 5JH7A 2BO1A 2CWJA 1QD9A 1VQ8F 3CYQA 3OBYA 3CCSF 5J2UA 3VOBA 2RHJA 4BVSA 3RA6A 3HKBB 2VXYA 4O4LA 3ZP7A 2CZWA 3OW2F 1Q7YH 3CC2F 1QU9A 4NQ3A 4C8IA 2LBTA 2Z01A 4EI9A 1X7OA 4ZHWA 2HX0A 3TD5A 2QA4F 5ITZA 3WJPA 5GONA 3V7EA 1OFUA 1VK3A 1X52A 3N4YA 3N2KB 5FNVA 2HP0B 2UYNA 1XHOA 3M4SA 1DT9A 1U43A 1W42A 2RHHA 3GHZA 4IIJA 3C9UA 4ZK7A 4YJ2A 3VYTC 3G4SF 2ZODA 3D01A 1H7MA 1DBFA 3AGKA 2HS3A 3ESJA 5LYJA 4IHJA 1FFXB 5LOVA 3IKEA 5LP6B 2DYYA 3P4EA 2VAWA 3HKDB 4X1KB 2Q1YA 4I4TB 2W8BC 1K8AH 1KD1H 1E7KA 3NVKE 4U3JB 1CLIA 2IAFA 3KJKA 4RQOA 3E20B 3HKBA 3QHDA 3S02A 2R6R1 4C8GA 3CYPB 3LWQC 2AMTA 2KTVA 3E1YA 5EB0A 2OHWA 4C81A 2CSLA 5A2QM 3T80A 3ZO8A 3DC2A 4ZHQB 3HJWC 3JASB 1RLUA 4X3MA 3ELCA 1Q82H 4X3LA 3B6NA 3N2KA 3CXCF 1VQKF 2HP0A 1PF5A 4R40B 5CB4B 2QEXF 4WBNB 2BTQB 1YITF 2K1SA 3RYIB 2KTUA 3RYHB 2AIZP 5KX5B 4I50B 2VAPA 3VIUA 1W5BA 4TUYB 1FFXA 1UFYA 1FNJA 4B62A 5LP6A 1M90H 3V4DA 3M84A 3HKDA 4X1KA 5EIBD 2ZOVA 4B5CA 3HKCB 4I4TA 3RE3A 1KC8H 3QTYA 1RLGA 3UT5B 1ZWZA 3WPWA 5MN6A 4U3JA 3WGKA 5EAZA 2OTLF 3CD6F 4BVRA 5BMVB 2RHOA 5GAPK 3MCAB 5JQGB 2Q1XA 3LWOC 4BT7A 4BT2A 3LYBA 5LA6B 5GANK 4ZHQA 1IV2A 3R0PA 2OZBA 1COMA 5JCOC 1RQ2A 3IEWA 5IJ0B 2PHNA 3JASA 4BT3A 1NQ3A 3V7QA 5FLXM 4YJ3A 1H48A 3CCLF 3ON1A 5B8FA 3NVIB 3NK7A 3D54A 4BW0B 5CB4A 2H8EA 4RHAA 2H6LA 4DRXB 3RYIA 3L7QA 3MCQA 2AIFA 2GLZA 3RYHA 2EWCA 3C9TA 1X25A 3HWUA 5KX5A 3CMAF 4I50A 4TV9B 1YQNA 4O2BB 3M1XA 4TUYA 3FFMA 5MN4A 3GTZA 2BTUA 3S03A 4G4XA 4G4WA 3TD3A 3MQWA 3HKCA 4C4WC 4O4HB 2OTMA 5LXTB 3UT5A 2BTOA 3VO8A 3CCJF 1H47A 4TV8B 3E22B 5BMVA 5JQGA 3RA5A 2ZAUA 1ODEA 1J7HA 3JAMM 3U0OA 1PXWA 5LA6A 5HXZA 1U3PA 4BVQA 3RYFB 4B46A 1JFFB 5IJ0A 1VQVA 3GYQA 1VHAA 3WJRA 4B45A 2HVYD 3LFOA 1W55A 1KQSF 2HRYA 1XBIA 3ZOPA 1VQOF 2UYKA 4XCQA 5HY0A 2R751 5KMGB 4DRXA 3N4ZA 3Q8HA 3F0GA 3K14A 4TV9A 1YJWF 4O2BA 3CCVF 1SA0B 2GZLA 3I3FA 2G9IA 3CPWF 3CMEF 3DDNA 1QVFF 1T0AA 4O4HA 5LXTA 2HS0A 2KG4A 3RYCB 3KJJA 3EORA 5FJ4C 1YJNF 2ALEA 4TV8A 3TD4A 3OONA 3QUWA 5MN5A 3NMUC 1IV3A 3E22A 2CHTA 2H8CA 3D00A 4KWEA 1XV2A 2CVLA 4YJ3B 1YGYA 1TVKB 3RYFA 3CC7F 1JFFA 1VQLF 4ZOLB 3MDOA 1NMUB 1M1KH 3I7TA 4ZHVA 5HY1A 1RA4A 3JVHA 1X7PA 2UYJA 3OBWA 4O4IA 3F0EA 1VQ4F 1JN1A 3V3TA 5KMGA 4FFBB 1IPAA 2B33A 3F0FA 5HWEA 5CA0B 3P10A 3WGJA 4ZHYB 4I55B 1R1MA 5EO3A 5G4VC 5G4UC 3JAWB 3JAKB 4G4VA 1SA0A 4BVTA 1VQ6F 4O2AB 3C9SA 3CC4F 5EB1B 2FC3A 2VGNA 3WJQA 3RYCA 3FD6A 2I6DA 1VQ7F 3HAXD 2I6RA
chains in the Genus database with same CATH topology
5HXUA 3LWVC 3CCJF 3G71F 3J7AR 1QVGF 3I56F 1K8AH 1E7KA 1KD1H 3NVKE 3IR9A 3RA5A 1GO1A 3JAMM 4BY9D 3E20B 1PXWA 5HXZA 5IT9M 3WXMB 1YIJF 4BVQA 2LBWA 3LWQC 5GIOC 3E1YA 2KTVA 1GO0A 3GYQA 2OHWA 4TZZA 1W2BF 1K9MH 5A2QM 2HVYD 3LFOA 3O85A 5GIPC 1KQSF 1VQOF 1XBIA 3VI6A 4XCQA 3HJWC 3J81M 5HY0A 3CCMF 3CCQF 4X3MA 1Q82H 4X3LA 1S72F 2QI2A 1W40A 3N4ZA 3CXCF 2FGYA 1VQKF 4EI7A 1T0KB 1YJWF 3CCEF 3CCVF 2QEXF 1VQPF 1YITF 3LWRC 1CN7A 2KTUA 2VGMA 1GZ0A 1VQ5F 3LWPC 4LCKA 3CPWF 2F9ZC 3CMEF 3NK6A 1Q86H 1QVFF 1YI2F 3I55F 2KG4A 3G6EF 1M90H 5FJ4C 1YJNF 1VQNF 3J80M 3VMFB 2ALEA 1VQMF 5HY2A 3NMUC 1KC8H 4NUTA 2LBXA 3CCUF 3CCRF 1RLGA 3SIUA 1ZWZA 4EI8A 3D00A 3JCMM 1CK2A 1W3EX 2OTLF 2BO1A 5EWRA 3CD6F 3PLAC 2WALA 1N8RH 4BVRA 3CC7F 1VQ8F 3PAFA 5GAPK 3MCAB 3OBYA 3CCSF 1VQLF 1NMUB 3LWOC 3CG6A 4BVSA 5HY1A 1RA4A 3RA6A 1M1KH 1X7PA 2JNBA 3OW2F 2CZWA 3OBWA 5GANK 1VQ4F 1VQ9F 1Q7YH 3CC2F 3V3TA 5GINC 1JJ2F 2OZBA 3SIVA 3V7QA 4NQ3A 1IPAA 4EI9A 1W41A 1X7OA 5FLXM 5HWEA 2QA4F 5HY4A 1K73H 3CPQA 3CCLF 3ON1A 3NVIB 3NK7A 4BW0B 5EO3A 5G4VC 3V7EA 5G4UC 1YJ9F 1X52A 3N4YA 4BVTA 2AIFA 2GLZA 1VQ6F 2OTJF 3CMAF 3CC4F 1SDSA 5DCVA 1DT9A 1W42A 2FC3A 2VGNA 3FFMA 3G4SF 2I6DA 1YHQF 1NJIH 1VQ7F 1Q81H 3HAXD 1H7MA 3AGKA 4C4WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV C;  3CCJ F;  3G71 F;  3J7A R;  1QVG F;  3I56 F;  1K8A H;  1E7K A;  1KD1 H;  3NVK E;  3IR9 A;  3RA5 A;  1GO1 A;  3JAM M;  4BY9 D;  3E20 B;  1PXW A;  5IT9 M;  3WXM B;  1YIJ F;  2LBW A;  3LWQ C;  5GIO C;  3E1Y A;  2KTV A;  1GO0 A;  3GYQ A;  2OHW A;  4TZZ A;  1W2B F;  1K9M H;  5A2Q M;  2HVY D;  3LFO A;  3O85 A;  5GIP C;  1KQS F;  1VQO F;  1XBI A;  3VI6 A;  3HJW C;  3J81 M;  3CCM F;  3CCQ F;  4X3M A;  1Q82 H;  4X3L A;  1S72 F;  2QI2 A;  1W40 A;  3N4Z A;  3CXC F;  1VQK F;  1T0K B;  1YJW F;  3CCE F;  3CCV F;  2QEX F;  1VQP F;  1YIT F;  3LWR C;  1CN7 A;  2KTU A;  2VGM A;  1GZ0 A;  1VQ5 F;  3LWP C;  4LCK A;  3CPW F;  3CME F;  1Q86 H;  3NK6 A;  1QVF F;  1YI2 F;  3I55 F;  2KG4 A;  3G6E F;  1M90 H;  5FJ4 C;  1YJN F;  1VQN F;  3J80 M;  3VMF B;  2ALE A;  1VQM F;  3NMU C;  1KC8 H;  4NUT A;  2LBX A;  3CCU F;  3CCR F;  1RLG A;  3SIU A;  1ZWZ A;  3JCM M;  1CK2 A;  1W3E X;  2OTL F;  2BO1 A;  5EWR A;  3CD6 F;  3PLA C;  2WAL A;  1N8R H;  3CC7 F;  1VQ8 F;  3PAF A;  5GAP K;  3MCA B;  3OBY A;  3CCS F;  1VQL F;  1NMU B;  3LWO C;  3CG6 A;  1M1K H;  1RA4 A;  3RA6 A;  1X7P A;  2JNB A;  3OW2 F;  2CZW A;  3OBW A;  5GAN K;  1VQ4 F;  1VQ9 F;  1Q7Y H;  3CC2 F;  5GIN C;  1JJ2 F;  2OZB A;  3SIV A;  3V7Q A;  1IPA A;  1W41 A;  1X7O A;  5FLX M;  2QA4 F;  1K73 H;  3CPQ A;  3CCL F;  3ON1 A;  3NVI B;  3NK7 A;  4BW0 B;  5EO3 A;  5G4V C;  3V7E A;  5G4U C;  1YJ9 F;  1X52 A;  3N4Y A;  2AIF A;  1VQ6 F;  2OTJ F;  3CMA F;  3CC4 F;  1SDS A;  5DCV A;  1DT9 A;  1W42 A;  2FC3 A;  2VGN A;  3FFM A;  3G4S F;  2I6D A;  1YHQ F;  1NJI H;  1VQ7 F;  1Q81 H;  3HAX D;  1H7M A;  3AGK A;  4C4W C; 
#chains in the Genus database with same CATH topology
 5EZY B;  1W5F A;  2IG8 A;  2L26 A;  3LWV C;  4X20 B;  1FSZ A;  3KE1 A;  5IJ9 B;  3J7A R;  1QVG F;  3FBA A;  1FNK A;  3C9R A;  1U40 A;  2GVI A;  3VYU C;  1TVK A;  2CW4 A;  2DT4 A;  3N2G A;  1GX1 A;  2CHS A;  4ZOL A;  2HQS C;  3KHN A;  4O4J B;  2NMU A;  3KIZ A;  3WGL A;  4BY9 D;  5IYZ B;  3K12 A;  5C8Y B;  1YIJ F;  5IT9 M;  2LBW A;  5GIO C;  4BT6 A;  1GO0 A;  3JAT B;  4FFB A;  4TZZ A;  1W2B F;  3HTN A;  3JAR B;  1K9M H;  5CA0 A;  1QAH A;  5GIP C;  3VYS C;  3VI6 A;  5JCO A;  4I55 A;  2LCA A;  3CCQ F;  3P0Z A;  5CA1 B;  3JAW A;  3JAK A;  2HRU A;  1W5E A;  1W40 A;  4X1I B;  4O2A A;  5J2T B;  1T0K B;  3F0D A;  1VQP F;  3LWR C;  2RB9 A;  1GZ0 A;  1VQ5 F;  3IKF A;  2Z1T A;  2F9Z C;  2Z1E A;  1UI9 A;  5EZY A;  3WPX A;  3I55 F;  3CB2 A;  4X20 A;  5IJ9 A;  2YXZ A;  1VQN F;  4O4I B;  3VMF B;  3ERN A;  2ZVY A;  1VQM F;  2LBX A;  2HS4 A;  3C8L A;  1JD1 A;  2Z1F A;  3CCR F;  3SIU A;  1W58 1;  4C8E A;  4O4J A;  1CK2 A;  5IYZ A;  3PLA C;  5EWR A;  5C8Y A;  1SZQ A;  2HP3 A;  2WAL A;  1N8R H;  3PAF A;  5HP7 A;  3ZP4 A;  3JAT A;  3CG6 A;  1RQ7 A;  3JAR A;  2JNB A;  4DXD A;  3VOA A;  2UYP A;  4M8I A;  1VQ9 F;  1JJ2 F;  5GIN C;  3SIV A;  4G88 A;  1IV1 A;  1Q8R A;  5CA1 A;  4ERH A;  3S0Y A;  1W41 A;  4F6R B;  5HY4 A;  1K73 H;  4X1I A;  3VCZ A;  3CPQ A;  2VAM A;  4G4Z A;  4BT4 A;  4X1Y B;  5J2T A;  4E6E A;  3WGM A;  1YJ9 F;  5EYP B;  3K2X A;  3N2G B;  5JVD B;  3HKE B;  2OTJ F;  1SDS A;  1W5A A;  2Z1U A;  5DCV A;  3LDT A;  1ONI A;  2IQQ A;  4G4Y A;  5LP6 C;  3BYQ A;  1YHQ F;  3F6M A;  1NJI H;  2RHL A;  1Q81 H;  1W57 A;  5HXU A;  3JAL B;  4ZI7 B;  4EB6 B;  3G71 F;  1KNK A;  2PMP A;  1OAP A;  3I56 F;  2UZH A;  2MQE A;  4LNU B;  3IR9 A;  3S06 A;  1TUB B;  2ZVZ A;  4HNA B;  3S0W A;  3IMP A;  3WGN A;  1GO1 A;  3VTI C;  5JH7 B;  3WXM B;  3K0T A;  3MBM A;  4C82 A;  2P6Y A;  2KGW A;  3FPI A;  5AVM A;  5J2U B;  2YYE A;  4O4L B;  3O85 A;  4F6R A;  1U3L A;  3J81 M;  4X1Y A;  3CCM F;  4NWO B;  4PWT A;  1XRG A;  1VH8 A;  1S72 F;  2QI2 A;  2QTP A;  5EYP A;  2N48 A;  3FD5 A;  3IEQ A;  2FGY A;  5JVD A;  5ITZ B;  3HKE A;  4EI7 A;  5GON B;  3CCE F;  1KNJ A;  1JY8 A;  5EIB C;  4BT5 A;  1CN7 A;  2VGM A;  5FNV B;  2ZF8 A;  3LWP C;  4LCK A;  2V9Y A;  2UYN B;  1Q86 H;  3NK6 A;  1Z5W A;  1YI2 F;  4IIJ B;  3S0H A;  1W59 A;  3JAL A;  4YJ2 B;  3G6E F;  4U39 A;  3LME A;  5HP8 A;  4EB6 A;  4ZI7 A;  3J80 M;  5HY2 A;  4NUT A;  1IV4 A;  5LYJ B;  3CCU F;  4IHJ B;  4EI8 A;  5LOV B;  4LNU A;  4WBN A;  1TUB A;  4HNA A;  3JCM M;  1Z5V A;  1W3E X;  5JH7 A;  2BO1 A;  2CWJ A;  1QD9 A;  1VQ8 F;  3CYQ A;  3OBY A;  3CCS F;  5J2U A;  3VOB A;  2RHJ A;  4BVS A;  3RA6 A;  3HKB B;  2VXY A;  4O4L A;  3ZP7 A;  2CZW A;  3OW2 F;  1Q7Y H;  3CC2 F;  1QU9 A;  4NQ3 A;  4C8I A;  2LBT A;  2Z01 A;  4EI9 A;  1X7O A;  4ZHW A;  2HX0 A;  3TD5 A;  2QA4 F;  5ITZ A;  3WJP A;  5GON A;  3V7E A;  1OFU A;  1VK3 A;  1X52 A;  3N4Y A;  3N2K B;  5FNV A;  2HP0 B;  2UYN A;  1XHO A;  3M4S A;  1DT9 A;  1U43 A;  1W42 A;  2RHH A;  3GHZ A;  4IIJ A;  3C9U A;  4ZK7 A;  4YJ2 A;  3VYT C;  3G4S F;  2ZOD A;  3D01 A;  1H7M A;  1DBF A;  3AGK A;  2HS3 A;  3ESJ A;  5LYJ A;  4IHJ A;  1FFX B;  5LOV A;  3IKE A;  5LP6 B;  2DYY A;  3P4E A;  2VAW A;  3HKD B;  4X1K B;  2Q1Y A;  4I4T B;  2W8B C;  1K8A H;  1KD1 H;  1E7K A;  3NVK E;  4U3J B;  1CLI A;  2IAF A;  3KJK A;  4RQO A;  3E20 B;  3HKB A;  3QHD A;  3S02 A;  2R6R 1;  4C8G A;  3CYP B;  3LWQ C;  2AMT A;  2KTV A;  3E1Y A;  5EB0 A;  2OHW A;  4C81 A;  2CSL A;  5A2Q M;  3T80 A;  3ZO8 A;  3DC2 A;  4ZHQ B;  3HJW C;  3JAS B;  1RLU A;  4X3M A;  3ELC A;  1Q82 H;  4X3L A;  3B6N A;  3N2K A;  3CXC F;  1VQK F;  2HP0 A;  1PF5 A;  4R40 B;  5CB4 B;  2QEX F;  4WBN B;  2BTQ B;  1YIT F;  2K1S A;  3RYI B;  2KTU A;  3RYH B;  2AIZ P;  5KX5 B;  4I50 B;  2VAP A;  3VIU A;  1W5B A;  4TUY B;  1FFX A;  1UFY A;  1FNJ A;  4B62 A;  5LP6 A;  1M90 H;  3V4D A;  3M84 A;  3HKD A;  4X1K A;  5EIB D;  2ZOV A;  4B5C A;  3HKC B;  4I4T A;  3RE3 A;  1KC8 H;  3QTY A;  1RLG A;  3UT5 B;  1ZWZ A;  3WPW A;  5MN6 A;  4U3J A;  3WGK A;  5EAZ A;  2OTL F;  3CD6 F;  4BVR A;  5BMV B;  2RHO A;  5GAP K;  3MCA B;  5JQG B;  2Q1X A;  3LWO C;  4BT7 A;  4BT2 A;  3LYB A;  5LA6 B;  5GAN K;  4ZHQ A;  1IV2 A;  3R0P A;  2OZB A;  1COM A;  5JCO C;  1RQ2 A;  3IEW A;  5IJ0 B;  2PHN A;  3JAS A;  4BT3 A;  1NQ3 A;  3V7Q A;  5FLX M;  4YJ3 A;  1H48 A;  3CCL F;  3ON1 A;  5B8F A;  3NVI B;  3NK7 A;  3D54 A;  4BW0 B;  5CB4 A;  2H8E A;  4RHA A;  2H6L A;  4DRX B;  3RYI A;  3L7Q A;  3MCQ A;  2AIF A;  2GLZ A;  3RYH A;  2EWC A;  3C9T A;  1X25 A;  3HWU A;  5KX5 A;  3CMA F;  4I50 A;  4TV9 B;  1YQN A;  4O2B B;  3M1X A;  4TUY A;  3FFM A;  5MN4 A;  3GTZ A;  2BTU A;  3S03 A;  4G4X A;  4G4W A;  3TD3 A;  3MQW A;  3HKC A;  4C4W C;  4O4H B;  2OTM A;  5LXT B;  3UT5 A;  2BTO A;  3VO8 A;  3CCJ F;  1H47 A;  4TV8 B;  3E22 B;  5BMV A;  5JQG A;  3RA5 A;  2ZAU A;  1ODE A;  1J7H A;  3JAM M;  3U0O A;  1PXW A;  5LA6 A;  5HXZ A;  1U3P A;  4BVQ A;  3RYF B;  4B46 A;  1JFF B;  5IJ0 A;  1VQV A;  3GYQ A;  1VHA A;  3WJR A;  4B45 A;  2HVY D;  3LFO A;  1W55 A;  1KQS F;  2HRY A;  1XBI A;  3ZOP A;  1VQO F;  2UYK A;  4XCQ A;  5HY0 A;  2R75 1;  5KMG B;  4DRX A;  3N4Z A;  3Q8H A;  3F0G A;  3K14 A;  4TV9 A;  1YJW F;  4O2B A;  3CCV F;  1SA0 B;  2GZL A;  3I3F A;  2G9I A;  3CPW F;  3CME F;  3DDN A;  1QVF F;  1T0A A;  4O4H A;  5LXT A;  2HS0 A;  2KG4 A;  3RYC B;  3KJJ A;  3EOR A;  5FJ4 C;  1YJN F;  2ALE A;  4TV8 A;  3TD4 A;  3OON A;  3QUW A;  5MN5 A;  3NMU C;  1IV3 A;  3E22 A;  2CHT A;  2H8C A;  3D00 A;  4KWE A;  1XV2 A;  2CVL A;  4YJ3 B;  1YGY A;  1TVK B;  3RYF A;  3CC7 F;  1JFF A;  1VQL F;  4ZOL B;  3MDO A;  1NMU B;  1M1K H;  3I7T A;  4ZHV A;  5HY1 A;  1RA4 A;  3JVH A;  1X7P A;  2UYJ A;  3OBW A;  4O4I A;  3F0E A;  1VQ4 F;  1JN1 A;  3V3T A;  5KMG A;  4FFB B;  1IPA A;  2B33 A;  3F0F A;  5HWE A;  5CA0 B;  3P10 A;  3WGJ A;  4ZHY B;  4I55 B;  1R1M A;  5EO3 A;  5G4V C;  5G4U C;  3JAW B;  3JAK B;  4G4V A;  1SA0 A;  4BVT A;  1VQ6 F;  4O2A B;  3C9S A;  3CC4 F;  5EB1 B;  2FC3 A;  2VGN A;  3WJQ A;  3RYC A;  3FD6 A;  2I6D A;  1VQ7 F;  3HAX D;  2I6R A; 
#chains in the Genus database with same CATH homology
 5HXU A;  3LWV C;  3CCJ F;  3G71 F;  3J7A R;  1QVG F;  3I56 F;  1K8A H;  1E7K A;  1KD1 H;  3NVK E;  3IR9 A;  3RA5 A;  1GO1 A;  3JAM M;  4BY9 D;  3E20 B;  1PXW A;  5HXZ A;  5IT9 M;  3WXM B;  1YIJ F;  4BVQ A;  2LBW A;  3LWQ C;  5GIO C;  3E1Y A;  2KTV A;  1GO0 A;  3GYQ A;  2OHW A;  4TZZ A;  1W2B F;  1K9M H;  5A2Q M;  2HVY D;  3LFO A;  3O85 A;  5GIP C;  1KQS F;  1VQO F;  1XBI A;  3VI6 A;  4XCQ A;  3HJW C;  3J81 M;  5HY0 A;  3CCM F;  3CCQ F;  4X3M A;  1Q82 H;  4X3L A;  1S72 F;  2QI2 A;  1W40 A;  3N4Z A;  3CXC F;  2FGY A;  1VQK F;  4EI7 A;  1T0K B;  1YJW F;  3CCE F;  3CCV F;  2QEX F;  1VQP F;  1YIT F;  3LWR C;  1CN7 A;  2KTU A;  2VGM A;  1GZ0 A;  1VQ5 F;  3LWP C;  4LCK A;  3CPW F;  2F9Z C;  3CME F;  3NK6 A;  1Q86 H;  1QVF F;  1YI2 F;  3I55 F;  2KG4 A;  3G6E F;  1M90 H;  5FJ4 C;  1YJN F;  1VQN F;  3J80 M;  3VMF B;  2ALE A;  1VQM F;  5HY2 A;  3NMU C;  1KC8 H;  4NUT A;  2LBX A;  3CCU F;  3CCR F;  1RLG A;  3SIU A;  1ZWZ A;  4EI8 A;  3D00 A;  3JCM M;  1CK2 A;  1W3E X;  2OTL F;  2BO1 A;  5EWR A;  3CD6 F;  3PLA C;  2WAL A;  1N8R H;  4BVR A;  3CC7 F;  1VQ8 F;  3PAF A;  5GAP K;  3MCA B;  3OBY A;  3CCS F;  1VQL F;  1NMU B;  3LWO C;  3CG6 A;  4BVS A;  5HY1 A;  1RA4 A;  3RA6 A;  1M1K H;  1X7P A;  2JNB A;  3OW2 F;  2CZW A;  3OBW A;  5GAN K;  1VQ4 F;  1VQ9 F;  1Q7Y H;  3CC2 F;  3V3T A;  5GIN C;  1JJ2 F;  2OZB A;  3SIV A;  3V7Q A;  4NQ3 A;  1IPA A;  4EI9 A;  1W41 A;  1X7O A;  5FLX M;  5HWE A;  2QA4 F;  5HY4 A;  1K73 H;  3CPQ A;  3CCL F;  3ON1 A;  3NVI B;  3NK7 A;  4BW0 B;  5EO3 A;  5G4V C;  3V7E A;  5G4U C;  1YJ9 F;  1X52 A;  3N4Y A;  4BVT A;  2AIF A;  2GLZ A;  1VQ6 F;  2OTJ F;  3CMA F;  3CC4 F;  1SDS A;  5DCV A;  1DT9 A;  1W42 A;  2FC3 A;  2VGN A;  3FFM A;  3G4S F;  2I6D A;  1YHQ F;  1NJI H;  1VQ7 F;  1Q81 H;  3HAX D;  1H7M A;  3AGK A;  4C4W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...