3IR9A

C-terminal domain of peptide chain release factor from methanosarcina mazei.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
AYTDESGLSELVNAAGEKLQDLELMGQKNAVRDFFKELIADSGKVAYGESQVRANLEINSVDVLLLSEDLRAERVTTKCSVCGYENKWTRRWKPPAPAAGNCPKCGSSLEVTDVTDIVDEFSELADKSNAKVVFVSTDFDEGSQLMNAFGGIAAILRYNTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
molecule keywords Peptide chain release factor subunit 1
total genus 48
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ir9A01
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ir9A02
2AIFA 1HBWA 3HE4B 4LC1A 3CCMF 2Z5IA 1YJNF 1PXWA 5EO3A 1XBIA 3ON1A 3A7OA 1MV8A 4JYCA 3V7QA 5AVSB 1VQ4F 1Q86H 5GIOC 1VQKF 2JJLA 2P67A 3VMZA 2Q5UA 2VGMA 1X52A 3N4ZA 1K9MH 5AVUB 1KC8H 1X7OA 2R5BA 3HJWC 3CG6A 5EWRA 1YIJF 5AW2B 4I6MC 5G4VC 2WPQA 3I55F 1GO0A 3CPQA 3TYYA 3VMFB 3RA5A 1CN7A 3P8MC 5AW6B 1Q81H 3TNUA 3O8ZA 1CK2A 3KDPB 3P32A 3CCQF 3LWVC 2WWWA 3NMUC 5APSA 4GKGA 2WPSA 1Q7YH 3CC2F 3LFOA 5FLXM 2LBWA 3CCVF 2WPRA 3L37A 5APVA 3VMYA 5GIPC 5AVYB 3NVIB 2R5DA 3NK7A 2CZWA 1HWTC 5AW8B 1VQMF 2QI2A 1CI6B 1KQLA 3TK1A 1G2CB 1QVFF 1GZLA 1VQPF 1NJIH 2HVYD 1GD2E 3PAFA 2E42A 3KQGA 3OW2F 4GT1A 3N4YA 1HJBA 2Q3IA 1SDSA 1X7PA 5AW7B 2VRSA 3G6EF 3L36A 3V4QA 1GZ0A 1A02J 5DCVA 1DH3A 3G4SF 5IT9M 4C46A 3A3YB 3E1YA 3AGKA 3V5BA 2KTVA 1N8RH 2ZFCA 1E7KA 3NMDA 3T97A 4I2LC 2C9LY 2XZRA 3J80M 2FC3A 3M91A 1GTWA 5AW4B 2OHWA 3SIUA 2YNYA 5APQA 1VQ6F 2I6DA 1S72F 1K73H 4AQRD 3V4WA 2P2UA 3VYIA 3CCEF 1A02F 3UIAA 3B8EB 2QM7A 2H7HA 4BY9D 3NFQA 2C9NY 3CXCF 1GK6A 3SIVA 3CCRF 1X8YA 1M1KH 3J7AR 1KQSF 3CMEF 3LWQC 3WXMB 4M3LA 2OTJF 2XV5A 1CZQA 3HE5B 5AVWB 4AYCA 2LBXA 1KD1H 1VQOF 3I5CA 5GAPK 4XE5B 1K8AH 1FOSE 1ZWZA 4HYTB 5AVQB 5AW3B 3IR9A 3OBWA 3MGNA 5AVTB 3G71F 5AVZB 4DZOA 3A2AA 1RA4A 2OTLF 3MCAB 1QVGF 2R32A 3M9HA 5APUA 5AW9B 4X3MA 4JYBA 1T2KC 4C4WC 3VN0A 5APWA 5AVXB 2WTYA 3NTNA 2OZBA 2YO2A 3M0AA 2KG4A 5GINC 5APYA 3HAXD 4C7NA 1M90H 2WT7B 1VQNF 2ZXEB 3O85A 2BASA 1H8AA 1YJWF 1RLGA 3GYQA 1YI2F 5CMZA 2WALA 2KP8A 3HE5A 2IPPA 2ALEA 1H89A 4NUTA 2QA4F 2E43A 1VQ7F 2R3CA 1VQ5F 1GK4A 5G4UC 4RESB 3NK6A 3CMAF 3PLAC 1VQLF 1IO4A 5A2QM 3CD6F 1NMUB 5APXA 3SWFA 3M9BA 3CC7F 4X3LA 3P7KA 1W2BF 1T2KD 2Q7CA 3LWPC 3LWRC 3J81M 4EOTA 4B86A 1JNMA 1S9KD 1YYCA 1YJ9F 3M06A 3MD0A 1VQ9F 3LIEA 3CPWF 4LCKA 5APTA 2N9BA 1YHQF 3VMXA 1W3EX 2JNBA 1JUNA 1FAVA 1MFZA 1CI6A 3JAMM 4C7NB 1GO1A 2XU6A 2P7JA 5AW5B 2WT7A 1W40A 3CCUF 3RA6A 3A5TA 1VQ8F 1S9KE 4KHXA 2W27A 2QEXF 4AUWA 1Q82H 3OAKA 4TZZA 1W42A 3CCSF 4BW0B 1CSBA 2BO1A 2W6AA 1OWAA 3JCMM 5FJ4C 1W41A 1IPAA 5GANK 3NVKE 2KTUA 3HTKA 2QM8A 3E20B 1MUUA 3I56F 1YITF 3CC4F 1SP4A 1H7MA 5AVRB 1GU5A 1OXZA 1FOSF 1H88A 1GU4A 3OBYA 3LWOC 5AW1B 3FFMA 1J2JB 3CCLF 2YO3A 2Z5HA 3NXSA 3VI6A 5AVVB 2VGNA 1DT9A 1NAFA 3CCJF 5AW0B 3LIDA 3M0DA 3L35A 3VTPC 3HE4A 3TNUB 1SLQA 1JJ2F 1HUCA 1NWQA 1T0KB 3V7EA
chains in the Genus database with same CATH superfamily
3H32B 5CA1B 3QTYA 2E75B 3WGLA 5HP8A 1N7SD 2WSEH 3AEFC 1K04A 4XFJA 5EO3A 2H8PD 2ZT9D 3D54A 1QEXA 3PTZA 4H44D 1MV8A 3L71E 1SQQG 1W59A 2B87B 3CPWO 1VQKF 5B5EH 2ITAA 3V4DA 2HP0B 4NWOB 1K73Q 2EWCA 4BT7A 3CCRP 2O01J 1KC8H 5IJ0A 2R5BA 2L26A 1NU1G 1KNKA 1MZ9A 3DC2A 1YIJF 5AW2B 4DXDA 5IJ0B 2QJYB 4ZKPA 4TV8A 3PH0A 3JAKA 5MN5A 3L73E 4WBNA 2Q1KA 3AE5C 3RA5A 1IFNA 1NTKD 2I1JA 1FBMA 1HGZA 2OYOA 1CN7A 2XKMA 4YTPC 2I8DA 2WQYC 2JEEA 4TUYB 1L0ND 5LA6B 2Q1YA 2MKVA 3GTZA 1HGVA 4PD4D 3KDPB 3P32A 1FU1A 1TU3F 2WPSA 2D2CB 2K1AA 2K37A 3JASA 1S5LX 1NTZD 3VCZA 3VYUC 1LWUB 2IBZD 5LYJB 2NPSD 3RYHA 2W6JH 3GHGA 1H0TA 1QL1A 2H43A 2WZ7A 3F89A 3KZIE 2ZYDA 2UYNA 5AVYB 5KJ7C 1X22A 1GW4A 2R5DA 4NPEA 3NK7A 2CZWA 1JY3O 4U3FJ 3RL0B 1ZLLA 3F0DA 1PP9J 2UWJE 3QH9A 1Z56A 5AVMA 2QIWA 2HPCA 1RF1A 1VQPF 1NJIH 3QWOC 2OQQA 4EB6A 1PGOA 3FX0A 4H44C 2E42A 3FBAA 1NU1D 3K0TA 2FYUG 3H32A 4GOEA 1K05A 3JCUH 1W57A 3L70E 1HJBA 2A06G 2Q3IA 5TISH 1SDSA 5LXTB 2VRSA 3HUSA 1VHAA 2QJPC 2Q9IA 1JY2O 3SFEC 2HQSC 3Q2YA 2HODA 2OYHC 5DCVA 3L74J 1XHOA 4WVZA 3G4SF 4DRXB 5KLIC 5HP7A 2QTPA 1BGYD 3H1IG 2Z1UA 3E1YA 1RHZB 4W7YA 3AGKA 2VAPA 1N8RH 1KILC 2HODB 2O1JA 2IX7C 2AEJA 4N78D 4DRXA 4X1YA 2IQQA 3NMDA 4L76A 3SWYA 2HRYA 4I2LC 2JP3A 3AEBC 1EC5A 3FXEA 4R4MA 1NO4A 4X1YB 1GTWA 4C8EA 2OHWA 3SIUA 2OARA 2XNDH 1FZGA 4W80A 3GG2A 2E76B 2RHLA 1S72P 1QD9A 3TGUE 3CX5H 2KZJA 2P2UA 1K9MQ 3VYIA 1IFIA 1FZCC 3V2PA 2RKLA 1KILA 1RF1B 4BY9D 2C9NY 3GMAA 3JARB 5J2TA 1JCCA 2LCAA 3TGUJ 2KYVA 1DIPA 1UIIA 1ZRTD 1R1MA 3L72D 1M1KH 3J7AR 3P4EA 1KQSF 3G4SP 5B66E 3JASB 2QEXP 3WJPA 1IV4A 3ZP4A 3H25A 4BT4A 1CZQA 3HE5B 3KPEA 1KQFB 4ASWA 3LMEA 3A0BE 5KLVK 4AYCA 2LBXA 1AJYA 3I5CA 2Z1EA 1K8AH 1S5LE 1BE3D 5CCGD 1BCCD 3H1HJ 5AVQB 3IR9A 3TSIA 2OTMA 1VQPP 4DZOA 2JWAA 2NPSB 5CA0A 2HPCB 4I4TA 3HKEB 4YJ2B 2WSFJ 2OTLF 3G3ZA 1ZN5A 1Q8RA 3MCAB 4G4WA 2KOGA 4HKZH 1W55A 3CWBE 3N2GA 3U1CA 5AW9B 4C8IA 3VN0A 3VP9A 5KLVG 1L0LK 1W2BO 3CCVP 2H88C 2HFED 2W83C 1PP9E 2KG4A 3HKCA 1KC8Q 3EORA 5J2TB 3HAXD 4C7NA 1QX8A 1KNJA 1N8RQ 4PWTA 5LA6A 3W68A 2AXTH 1HJ0A 1VQNF 1L4AC 5KMGA 3CX5D 3O85A 1LT1A 5CJ4A 1SQPD 2GM4A 1YJWF 1YJWP 2K1SA 2KP8A 4L74A 2ALEA 2E43A 1VQ5F 5EIBD 1GK4A 1KILD 4YJ3B 3HWUA 3C8LA 3GHGC 1LTGC 1J1EB 3WU2H 3GF7A 2IFMA 2NRGA 3WU2E 5APXA 1RE3A 2P58A 4O4LB 1Q7YQ 1W2BF 1VQ8P 4R4LA 2Q3EA 1RQVA 1FZBA 1RH5B 3CXHE 2Q7CA 2OYIC 3LWPC 3LWRC 3J81M 1L4AB 3L73D 1Q2NA 4EOTA 5HY4A 2E75D 3JATB 1S9KD 2M5AB 3II6A 2KB7P 1SQXE 5KKZB 1NTMJ 1NTZK 3G71P 3V2RA 1U40A 2YMYA 1ZR2A 3VMXA 4PJ0E 2JNBA 4O4IB 2WSFH 4C7NB 1IK9A 2W6BA 4B45A 1EXIA 2XU6A 3V2NA 2P7JA 5HWEA 1KYOE 4D6TD 5BMVB 2KXPB 5AW5B 5CJ0A 3RK3C 1W40A 5KMGB 1J1DC 2H8CA 2FYUK 3RA6A 2JWDA 1IK7A 3EFFK 1LP1B 1PL5A 4N3YB 3L71J 3H1IJ 1WRGA 2ZYGA 3F6MA 3OAKA 4GDOA 4PD4H 5EB0A 2CW4A 2WSEJ 1AVOA 3N2GB 1OWAA 3JCMM 1VQ7P 3D00A 2OYHB 1NYHA 1SS1A 2KNCA 2AXTE 4LLHA 3B5ND 1R5SA 1SFCC 3RYCB 3MUDC 3HTKA 2QM8A 5KTBA 1MUUA 3P8CE 3I56P 1AQTA 1EXJA 1SP4A 2BEZF 2KLUA 1P84I 1FZAA 1FOSF 3PJSK 3MBMA 1URQD 1FZCA 3FFMA 1ZP0C 2RHOA 1RE3C 1J2JB 1NTME 3CCLF 4H13C 1SQXJ 3NXSA 5KLVJ 2GVIA 4KJMA 2VGNA 1LTJC 1NAFA 3H1LD 3LW5H 1PGJA 3LIDA 3M0DA 4G4YA 1LTBC 3VTPC 3K2XA 4EYYQ 2JDIH 4BVTA 5LP6A 3HKBA 3ZP7A 2B33A 2IYOA 1LJ2A 2P10A 4Y99B 4FFBB 3V7QA 2IDBA 1VQ4F 1Q86H 5GIOC 3PRJA 1SFCD 1PGQA 1VL2A 3FPIA 1BE3G 3Q5RA 3CCJP 3VMZA 2VGMA 1T0AA 1K9MH 5AVUB 4GOFA 2Y0CA 2ZVYA 2LXCB 4PD4E 3CG6A 3M4SA 2Z01A 5TJHA 1N86A 4OGQC 5G4VC 1KORA 3R4YA 1OW7A 2LR2A 3MCQA 1BDDA 2WPQA 2GUSA 3CPQA 1M8OB 1HH0A 5J2UA 2RN0A 3L72J 3B5NA 2O3JA 4TV9B 3P8MC 1BCCE 3IF4A 3L71G 3O8ZA 4YPCA 1SQPG 4I55A 1W5CE 2H8EA 2O01N 3RYCA 3L70D 1OFUA 3CC2F 1VF5C 1FS0E 2E75C 2B89A 2WITA 2LBWA 5HY0A 2ZVOB 3C9RA 3G9RA 1LTTC 1L0LD 1JO5A 1N7LA 3CCVF 2YYEA 1NTZJ 4OVNF 3JATA 2FYUE 5APVA 1U3LA 1FZEA 5ITZA 4XCQA 1QVGO 1IV2A 3NVIB 2OYIA 1HWTC 5HY2A 2QI2A 5K5GB 1KQLA 3TK1A 3EFGA 1G2CB 3KJKA 2FYUJ 3RL0g 1QVFF 3LYBA 1P84D 1XTGB 1T3UA 4BT3A 1DD4A 2HVYD 4B5CA 4JF7A 1GD2E 5L8RJ 4HNAB 2FBWC 5KAFH 3AE9C 5KJ7A 1J1EC 4IFFA 3KQGA 4GT1A 4ZOLA 4PV1D 3L7QA 1PF5A 3G6EF 1M1JC 3L36A 2VXYA 4JPZB 1GL2A 3CC7P 3V4QA 1GZ0A 4IL6H 3RK2D 4O2BA 1FDIA 1SA0A 4C46A 2P6YA 1IV1A 3HD7A 3L72E 3E1RA 3VOPA 2SPZA 2ZFCA 1L0LG 1SQVK 1E7KA 2E5YA 4UB8E 2V9YA 2C0WA 3L74E 1KB9D 3J80M 2ZOVA 2FC3A 3JC22 1KMIZ 3CXHH 2H89C 1JD1A 2KLVA 5KAIE 1VQNP 1S72F 1TVKA 4AQRD 1JY3N 1IFDA 1H47A 5C8YA 2BCCJ 2CPSA 3I55P 1G2CA 1KYOI 1Y8AA 2YMKA 1A02F 3B5NC 3UIAA 2H7HA 1GW3A 2H6LA 2W8ZA 1AVYA 2BCCE 1K8AQ 3CWBD 1FNKA 3WPWA 2FYZA 1G1JA 3CCRF 1X8YA 3AE4C 1JOCA 2IZ0A 2IYPA 2D2CC 3VP8A 3ELCA 4ZNCA 3CXHI 3H1KG 5GONA 2XV5A 1NAYA 3TD4A 3B4SA 2R44A 2FFDB 2O1KA 3BCCD 3FXDA 4IHJA 1KB9H 3Q8HA 2A45H 1LTIC 5CHXA 1BE3J 1AQ5A 3RYFB 1U7JA 2NZ2A 3P8CD 2O01H 1N73C 3TGUG 4HYTB 5AW3B 3CB2A 3F0EA 1S5LH 3E7KA 3MGNA 5AVTB 2OTJP 3G71F 1SQQD 4OWFA 1Q90D 2A06E 2N1TD 5CB4B 2DT4A 1RQUA 1IFJA 1QVGF 1M1JB 1AFOA 5APUA 5APWA 4ZI7A 3L73J 5AVXB 3H1LE 3C1LA 3F0FA 3H1HD 2N9YB 1GL2B 2IFNA 1VQLP 3CXHD 3B6NA 1KTMA 1QU9A 3D71A 3CC4P 4RKUJ 2V7QH 1ZXGA 5JVDB 3AEEC 2PGDA 4B46A 3RYIB 4U3JA 1BSHA 1OVVA 3ZO8A 2VAMA 3MDOA 2BASA 4X20A 1FFXB 1H8AA 5JQGB 1YI2P 3RK3B 3HTNA 1LT9C 3GYQA 5JVDA 1RLGA 3S03A 2UZHA 3RYIA 5CCHC 5BVZA 1FFXA 2G8YA 1H89A 2LKMA 1Z5VA 2YXRB 2PP6A 4RESB 1SZQA 3NK6A 3CMAF 5H2FE 4PJ0H 3WGMA 3L75J 1IV3A 4O9BA 1OVRA 2PHNA 5ITZB 4R40B 2A45I 3M9BA 3P7KA 1SVFA 4I7ZC 3D70A 5CB4A 2FXOA 2XNXA 5LOVB 1PP9G 1LWUA 2NPSC 3DDNA 5LYJA 1ONIA 2ZXXA 4B86A 5CCHD 2HS0A 2IBZG 5LOVA 5MN4A 1OAPA 1JY3P 3M06A 1VQ9F 1OX3A 2B87A 1FDMA 3WUVA 4BVSA 5APTA 3E22B 4O4HB 1XV2A 1YHQF 1Y47A 4YXWH 1CI6A 2L5GB 4U3FG 4UB6H 3PP5A 2Z1FA 3E22A 1SQBG 3UT5B 4BT6A 3CCUF 3A5TA 3H1LG 4O2BB 1N7SA 1OFCX 1SQVJ 1SA0B 1NH4A 3HD7B 1JY2P 2QJKB 4U7JA 2KSEA 1NTMD 4WY4B 4C82A 5LXTA 2K9JB 3MZWB 3T97B 1RF1C 4BW0B 2N1TC 4RO0A 1NU1K 4Y99C 4ZHVA 2BO1A 3HD7C 2W6AA 3WUTA 1YTZI 1OVUA 3Q1MA 4DJGA 5KX5B 3CCEP 3AEDC 2CSLA 5C8YB 1W5EA 2KTUA 2CK3H 3IKFA 2PRRA 1GX1A 3E20B 5KX5A 3I56F 1IZNB 1EQ7A 3AE1C 3CWBJ 1BGYE 3CC4F 2POHA 4ZK7A 2IZ1A 4N78E 2M3EA 4EI9A 1GU5A 1OXZA 4OGQD 3OBYA 4X1IB 5IYZB 3L75E 3LWOC 5AW1B 2FGYA 1SQXG 4O4HA 4H0LD 3CWBG 1GL2D 1SQBE 1PPJG 1QGKB 4I7ZB 5AVVB 3GLMA 1DT9A 3JARA 3CCJF 5AW0B 2KSJA 1LGHB 2CVLA 3HE4A 4XA4A 3TNUB 1SLQA 1GDTA 1XRGA 1JJ2F 4H0LC 1HUCA 4KWEA 1SQQJ 2K9JA 3GHZA 1U57A 3HE4B 1HBWA 3KIZA 4LC1A 2VAWA 2V7QJ 2Z5IA 1YJNF 1IJDB 1YQ4C 1PXWA 1JMBA 1ZRTE 3ON1A 3A7OA 3L75G 4PD4I 4JYCA 3H1LJ 5GTIE 4IFDK 1SQVD 1JCDA 1DEBA 4NPDA 1YJ9P 1KQSO 3L74G 2KZIA 1X52A 5B5EE 3KYQA 3ERNA 3M84A 3HKEA 1H48A 1X7OA 5EWRA 1URQC 1KFNA 5IYZA 4I6MC 4PV1C 2FYUD 3FWNA 2I6RA 1KQGB 3VYTC 1S4XA 1AA0A 4JBZA 4BT2A 3TYYA 3VMFB 4I50A 4QMAA 3SWKA 1M57D 3K12A 2K88A 2KK7A 1DEEG 3TF5A 4ZHYB 3PLNA 3F0GA 5AW6B 3IFMA 2WSCH 3MUDA 3A0BH 1Q81H 3TNUA 4N6JA 1CK2A 1DD3A 1RF0C 3CCQF 5CA1A 2QJYC 1LTAC 1L0NJ 5EAZA 1URQA 2WWWA 2RMZA 4PV1B 1BGYG 3H1ID 3LFOA 1HTLC 3GHGB 1HF9A 1P84E 1H0TB 1URQB 1ZR4A 1RQ2A 5GTHH 3CYPB 3L73G 4NQ3A 3H1JE 3HKDB 1VF5D 3RK2B 5KAFE 4U3FE 3VMYA 1YTZT 3RYHB 3RK3D 4G4ZA 5GIPC 2K3RA 5AW8B 3TDKA 1VQMF 1CI6B 2UYNB 4OH8B 1J1DB 1GZLA 1NTKG 3S02A 3CI9A 2QSIA 4G4XA 3PAFA 1BDCA 1YJNP 4C81A 1WMKA 2N1TB 3N4YA 1N7SC 3D01A 3MIWA 2B9BA 3TD3A 4O4IA 4WY4A 1JTHB 1X7PA 3L74D 1NU1J 3U59A 1SQXK 3V6IA 3QHDA 1LT9A 3S9OA 1OMIA 4HH2A 4C8GA 3AECC 2ZYAA 4ERHA 5IT9M 2FXMA 3V2QA 2KI7B 3CMAP 2KTVA 3CC2P 2BTQB 3SSUA 1EDIA 1VQ5P 3H1KJ 3WJRA 1GL2C 1EZVG 1NOHA 5EZYA 3H1JG 2UYJA 4CPGA 1UI9A 4ZMDA 5CA0B 1W5AA 4I4TB 5AW4B 4BVQA 2YNYA 5APQA 1L4AD 2KUBA 3V3TA 2HLOA 1RE4C 4NPFX 5EYPA 1KB9I 1L0NG 2M0BA 1ZMEC 1R5LA 3CCEF 1HVVA 3Q5SA 1TUBB 1JFFA 5EB1B 3B8EB 3BCCE 3NFQA 1DBFA 3CXCF 3BATA 1GK6A 2PMPA 3KE1A 3JALA 2B88A 4EB6B 5E79H 1VQVA 3CLQA 4DT0A 2M8RA 1SQBK 2D2CD 3IN6A 3L71D 3BCCG 2GA1A 2MJZA 1FZCB 4W7ZA 2FY8A 3CMEF 2Q1XA 2XDJA 1SQQE 2OTLP 2QE7H 2A06D 1KZUB 5GTHE 3WXMB 1GMJA 1LT9B 2JKVA 2F9ZC 2DYYA 1VQ4P 3WMM0 3M1XA 5AVWB 5BMVA 3CX5I 2FYNC 1VQOF 1LTSC 2E5TA 3OONA 1FE6A 4XE5B 1YQ3C 2Z4EA 2E74C 3WPXA 1NTMG 3AE8C 3ZOPA 3L75D 4X1KB 1BCCJ 3CMEP 3EQ2A 1BGYJ 4D6TJ 1PV3A 4X1KA 4TT3H 3L70G 3P0ZA 2PFXA 1T2KC 1IFMA 5IJ9A 2GUVA 3R2PA 1JTHA 1TUBA 3RL0D 2NMUA 2Q6QA 1AV1A 4D6TG 1EZVD 1CW5A 3JALB 3S1KA 5APYA 4H44B 5GTIH 1KFMA 1M90H 4KT0J 2AEMA 2WT7B 2IBZI 1SQPJ 1J7HA 2ZXEB 3CCQP 1RE4A 2FXPA 3ZDMA 2GLZA 3H1KD 1YI2F 1FJKA 1S1CX 3HE5A 2IPPA 1SQVE 1BSNA 3B71A 2QA4F 1L2PA 5KLVE 2HYNA 5G4UC 3KHUA 3D6YA 1G1IA 3PHLA 2HRUA 5CBOA 4O4LA 3L4FA 1VQLF 5CBNA 2HG5D 1Q86Q 3CD6F 1PGPA 1NMUB 3WGNA 3LDTA 3AE6C 3FD5A 3CC7F 5MN6A 1KILB 1QLED 4YJ2A 2AEFA 4JQ0D 2OTKE 3M9QA 3CCUP 1N73A 1S3JA 3Q5PA 2ZJSE 4ASVA 1JNMA 1YYCA 5IJ9B 3S4RA 3VOBA 2YXQB 3LIEA 1N73B 3CPWF 2N1TA 3H1HG 1W3EX 1QVFO 1JUNA 1FAVA 1MFZA 3K5BA 3MHVA 5HY1A 1X79B 2WT7A 5DJTB 2G9IA 1NGMB 3H1IE 3RL0C 1E79H 4EIJA 2HP3A 2W27A 2QEXF 1NTKK 3H1JD 5E79E 1SQBD 4TZZA 3TGUD 5EZYB 3U1AA 2BTUA 3MQWA 1CSBA 3RBXA 3CCLP 3KJJA 5FJ4C 4FFBA 3CL3D 1W41A 3ITKA 5GANK 5BU8B 4HB1A 5EYPB 1FZFA 4DCKA 3TD5A 3KHNA 2KNCB 3Q3DA 4O4JB 1PPJE 3OJAB 4LNUB 3O6QA 2CHSA 4ZHWA 1T6AA 4O4JA 1SQBJ 1Q82Q 3P10A 2M5AA 2UYKA 3BASA 2QRXA 3S0YA 1ZW0A 5CCHA 2PAJA 3USSA 2YO3A 2M3BA 1BE3E 3VI6A 4IOIH 1YQNA 2WPVB 3F5HA 1W5BA 3BYQA 3RK2C 1Z5WA 2ZT9B 3BRVB 1ZV8A 3L35A 4H13D 4Z1MH 1VQKP 1W2EA 3HKBB 1LP1A 2P1JA 3G6EP 2K9YA 2ZAEB 1NWQA 1M1KQ 1RLUA 1KN7A 2HX0A 4MN4C 2AIFA 4ZOLB 3CCMF 2W8BC 2BCCD 5TISE 5GONB 4H13B 2NPSA 3CCMP 1L4AA 1T8ZA 2QVAA 2FFDA 1XBIA 1PP9D 2Y9ZA 2OYHA 5AVSB 3C8VA 3HUSC 2I1KA 4H0LB 2JJLA 2V4HA 1VQ9P 3N7NA 1VPCA 3S0WA 2P67A 2Q5UA 3IKEA 4LNUA 1NKZB 3N4ZA 1SQPE 3HKCB 1SQPK 2YKPA 3FGAD 3BVHA 1MFTA 3W67A 4EDFA 3HJWC 3T80A 4ZI7B 3RK3E 3I55F 3GF3A 1GO0A 3VTIC 1QAHA 2E74B 4TV9A 1NQ3A 4BRYA 3VOAA 2RH0A 4BWNA 4I55B 3VMAA 2KS1A 3B5NB 4YJ3A 1OIPA 4X20B 3CYQA 3HD7D 4L73A 3H1HE 2W90A 3LWVC 5LP6B 3LW5J 3JSVC 3NMUC 3HTKB 5APSA 4GKGA 1QL2A 1Q7YH 4HJGH 4RJTA 3JAWB 3RE3A 5FLXM 1NHLA 2Z1TA 3MTUE 3BCCJ 1NTKE 1PFIA 1IFPA 5KKZC 1VK3A 2WPRA 3L37A 1SFCA 1L0LJ 2YIUB 3FD6A 3OA7A 5B8FA 1DX7A 3OW2O 2A45G 4HNAA 1N2DC 5EIBC 5HXUA 4O2AA 1NTZE 4Y28J 2ZAUA 2AIZP 1UFYA 3H1KE 2CWJA 1M56D 4EI2A 1M90Q 1JN1A 2E76C 1NTKJ 2Y0EA 1ODEA 3E1IA 1RQ7A 3OW2F 3BRTB 5CCGA 4WWIA 5J2UB 4EI8A 1LTJA 2J59M 1D7MA 3RGUA 3WGJA 5AW7B 2R3SA 1U3PA 3VO8A 1LTJB 3D6ZA 1IC2A 3JVHA 1A02J 5M1BA 1EDKA 1DH3A 3WUUA 3A3YB 3V5BA 4IL6E 3JAWA 3WJQA 5FNVB 4B62A 1SQQK 1Y9BA 3T97A 4IL6X 2C9LY 2XZRA 3O6QB 1YGYA 3M91A 1FDOA 3R0PA 1VQ6F 2I6DA 4ZKUA 1NU1E 1UIXA 1NTMK 4BXLA 1K73H 4F6RB 3V4WA 3L70J 2L91A 4GODA 2OYIB 2AXCA 5JCOC 4YXDC 4ZHQA 2RHHA 2LBTA 3RBZA 4BRYB 1CLIA 4IIJA 5DJUB 3ABVC 2QM7A 1T3JA 2Y0DA 3C9SA 2ZODA 1YIJP 3AEAC 2UYPA 3SIVA 2WSSH 1JEKA 1OW8A 3AEGC 2R751 3VYSC 5KAIH 4U39A 2ZF8A 3LWQC 3C9TA 4DOJA 1OZHA 4UB6E 1EZVE 1R8EA 4M3LA 2HR3A 4L75A 2OTJF 3IAOA 3H1JJ 2OGUA 5JCOA 1NKNA 3L72G 5JH7B 1KD1H 3IEQA 1JB0J 2IG8A 3AE7C 5GAPK 4A7PA 2IAFA 1FOSE 1YBKA 1JMMA 1ZWZA 1L0NE 1L0NK 3N4XA 4K35A 1ZOYC 1YHQP 3OBWA 3RYFA 4WY4C 2BCCG 4LGDE 5AVZB 2CPBA 3A2AA 2QJKC 5B66H 1RA4A 1KD1Q 3QUWA 3H6PA 5KLVD 2GZLA 1VF5B 2HS3A 2R32A 3M9HA 1LNQA 3GW6A 1NVOA 2HS4A 4X3MA 4JYBA 4C4WC 4ZHQB 2KIKA 2IBZE 4WB4A 4IIJB 2J5UA 2WTYA 1FSZA 3NTNA 1X25A 2WSCJ 2YO2A 3M0AA 2OZBA 3CD6P 1NJIQ 5GINC 3K14A 3WGKA 3HRNA 1YITP 4U3JB 2KS1B 5JQGA 5KLIB 1L0LE 4E6EA 1W5FA 1EZVI 1P84H 1VQ6P 1KV4A 1E5WA 3A0HE 2Y9YA 4OGQB 5CMZA 2YIUC 2WALA 3AE3C 1EDLA 4BT5A 4NUTA 1X9VA 4TUYA 1USDA 1VQ7F 2QG4A 2R3CA 3I7TA 5JH7A 4IHJB 1KYOH 2JR8A 5BU5A 3C9UA 1Q81Q 2RHJA 3PLAC 1SFCB 5KJ7D 2FFDC 1IO4A 5A2QM 5EFWB 2R6R1 3CX5E 2LXBA 3SWFA 4X3LA 5LP6C 5H2FH 4BVRA 3I3FA 1T2KD 1SQVG 4IFMA 1W581 2JO1A 1PIXA 4O2AB 4RHAA 3C9IA 1VH8A 3M0DC 1XTCC 2E76D 1YJ9F 3MD0A 1X0TA 2FYNB 4LCKA 2N9BA 1LWUC 2G3AA 4TLFA 2E74D 3UT5A 2HP0A 3JCUE 1JY2N 5CCGC 2ZVZA 2C0XA 3EWKA 3JAMM 1RY3A 2BEQD 1VQMP 1GO1A 1VQOP 4RQOA 3KZIH 4U3FD 2BTOA 1EDJA 1KILE 2ZVNB 3IMPA 1PZQA 1S2EA 1KB9E 1WT6A 1U43A 1FC2C 3U0OA 1VQ8F 2CHTA 1S9KE 4KHXA 1MKMA 3FWLA 4TV8B 1PPJD 2QJPB 4AUWA 2YXZA 1Q82H 3S06A 5FNVA 1RF0A 1W42A 1BCCG 2FKWB 5HXZA 3HUSB 1JM0A 3CCSF 4I1LA 1OW6A 3A0HH 3VIUA 4C7RA 1M1JA 2QA4P 1KYOD 4WY4D 2YKQA 1SQXD 3KXDA 2AMTA 1TVKB 1IPAA 4F6RA 3NVKE 5C39A 1COMA 4GIFA 4G88A 4UB8H 1JY8A 1USEA 1FJPA 3S0HA 1FNJA 2ZT9C 4D6TE 4WBAA 2J58A 1YITF 2YKOA 2WMMA 1H7MA 3AE2C 5AVRB 3HKDA 1H88A 1GU4A 1M7LA 2DW3A 1U7MA 3IEWA 3N2KB 4K3AA 2KGWA 3JAKB 1NTZG 4X1IA 1JFFB 4WBNB 2Z5HA 3N2KA 3CCSP 4I50B 3MP7B 4EI7A 2MQEA 4M8IA 1N7SB 1VDFA 3SFDC 3ESJA 4G4VA 2N48A 2WVRA 2RB9A 1T0KB 3V7EA
chains in the Genus database with same CATH topology
3H32B 2AIFA 1HBWA 3HE4B 4LC1A 3CCMF 1N7SD 2WSEH 2Z5IA 1YJNF 1IJDB 2NPSA 1PXWA 5EO3A 1L4AA 2H8PD 1T8ZA 2FFDA 1XBIA 3ON1A 3A7OA 1MV8A 4Y99B 2OYHA 4JYCA 3V7QA 5AVSB 1VQ4F 1Q86H 5GIOC 4IFDK 1SFCD 1VQKF 3HUSC 1JCDA 2I1KA 2JJLA 1DEBA 1VPCA 3N7NA 2P67A 3VMZA 2Q5UA 2VGMA 1X52A 1NKZB 3N4ZA 3KYQA 1K9MH 5AVUB 1KC8H 1X7OA 1SQPK 2R5BA 2YKPA 3BVHA 3HJWC 3CG6A 5EWRA 1MZ9A 1URQC 1YIJF 1KFNA 1N86A 5AW2B 4I6MC 5G4VC 2WPQA 4ZKPA 3I55F 1GO0A 2GUSA 3CPQA 3TYYA 3VMFB 1HH0A 3RA5A 1IFNA 2I1JA 1FBMA 1HGZA 3B5NA 2XKMA 1CN7A 2JEEA 3P8MC 5AW6B 3IFMA 2WSCH 3MUDA 1Q81H 3B5NB 3TNUA 1HGVA 3O8ZA 4N6JA 1CK2A 3KDPB 1RF0C 3P32A 3CCQF 3HD7D 1FU1A 1LTAC 3LWVC 1URQA 2WWWA 3NMUC 3HTKB 5APSA 4GKGA 1QL2A 2WPSA 1Q7YH 3CC2F 3LFOA 1HTLC 3GHGB 5FLXM 2WITA 1NHLA 2LBWA 3MTUE 1URQB 1ZR4A 5HY0A 1LTTC 1LWUB 1PFIA 2NPSD 4NQ3A 1JO5A 1N7LA 3GHGA 3CCVF 2WPRA 3L37A 1QL1A 2H43A 3RK2B 1SFCA 2WZ7A 5APVA 3VMYA 1YTZT 1FZEA 3RK3D 3OA7A 4XCQA 5GIPC 1DX7A 5AVYB 5KJ7C 3NVIB 1GW4A 2R5DA 3NK7A 2CZWA 2OYIA 5AW8B 1HWTC 1VQMF 5HY2A 1JY3O 2QI2A 1CI6B 1KQLA 3RL0B 1ZLLA 1G2CB 2A45G 3EFGA 3TK1A 1N2DC 1Z56A 4OH8B 5HXUA 1QVFF 1J1DB 1GZLA 2HPCA 1RF1A 1XTGB 3CI9A 1VQPF 1T3UA 1NJIH 2HVYD 4JF7A 1GD2E 3PAFA 2E42A 5KJ7A 1J1EC 3E1IA 4IFFA 3H32A 3KQGA 3OW2F 4GT1A 3BRTB 5CCGA 2N1TB 3N4YA 1N7SC 3MIWA 1HJBA 2Q3IA 1LTJA 4EI8A 2J59M 1SDSA 4WY4A 1JTHB 1X7PA 3U59A 5AW7B 1SQXK 2VRSA 3HUSA 3G6EF 1M1JC 3L36A 2Q9IA 1JY2O 1GL2A 1LTJB 1LT9A 1IC2A 3V4QA 2HODA 4HH2A 2OYHC 1GZ0A 1A02J 5DCVA 1DH3A 3RK2D 3G4SF 5IT9M 2FXMA 3V2QA 4C46A 3A3YB 3E1YA 4W7YA 3HD7A 3AGKA 3V5BA 2KTVA 1N8RH 1KILC 2HODB 2O1JA 2IX7C 4N78D 3VOPA 2ZFCA 1SQVK 1SQQK 1GL2C 1E7KA 1NOHA 3NMDA 3SWYA 3T97A 4I2LC 2C9LY 2XZRA 1NO4A 2C0WA 3J80M 2FC3A 3M91A 1GTWA 5AW4B 2OHWA 3SIUA 4BVQA 2OARA 1FZGA 2YNYA 5APQA 1VQ6F 2I6DA 4W80A 1L4AD 4ZKUA 2KLVA 3V3TA 2HLOA 1NTMK 1S72F 1RE4C 1K73H 4AQRD 3V4WA 1JY3N 1IFDA 2OYIB 2P2UA 2CPSA 3VYIA 1G2CA 1IFIA 3CCEF 1FZCC 1A02F 1HVVA 3B5NC 3UIAA 3V2PA 1KILA 3B8EB 1RF1B 2QM7A 1T3JA 2H7HA 4BY9D 1GW3A 3NFQA 2C9NY 3CXCF 3BATA 1GK6A 1JCCA 3SIVA 2KYVA 3CLQA 2M8RA 1SQBK 2FYZA 1G1JA 3CCRF 1X8YA 1M1KH 2MJZA 1FZCB 1JOCA 3J7AR 4W7ZA 1KQSF 3CMEF 3LWQC 2XDJA 3VP8A 4DOJA 1KZUB 3WXMB 1LT9B 4M3LA 2F9ZC 2OTJF 2XV5A 1CZQA 3WMM0 3HE5B 3KPEA 1NKNA 2FFDB 5AVWB 2O1KA 5KLVK 4AYCA 2LBXA 1KD1H 2A45H 1LTIC 1VQOF 3I5CA 5CHXA 1AQ5A 1LTSC 5GAPK 3P8CD 4XE5B 1K8AH 1FOSE 1JMMA 2O01H 1N73C 1ZWZA 5CCGD 4HYTB 1L0NK 3N4XA 5AVQB 5AW3B 3IR9A 3TSIA 3OBWA 2Z4EA 4WY4C 3MGNA 5AVTB 3G71F 4LGDE 5AVZB 4DZOA 2CPBA 2NPSB 3A2AA 2HPCB 1RA4A 2N1TD 2OTLF 3G3ZA 3H6PA 1ZN5A 3MCAB 1IFJA 3EQ2A 2KOGA 1QVGF 2R32A 1M1JB 3M9HA 1AFOA 5APUA 3U1CA 5AW9B 4X3MA 4JYBA 1T2KC 4C4WC 3VN0A 5APWA 3VP9A 1L0LK 1IFMA 4WB4A 2GUVA 3R2PA 5AVXB 1JTHA 3RL0D 2HFED 2WTYA 3NTNA 2OZBA 2YO2A 3M0AA 1CW5A 1GL2B 2IFNA 2KG4A 5GINC 5APYA 3HAXD 4C7NA 3HRNA 1KFMA 1M90H 2WT7B 1VQNF 1L4AC 2ZXEB 3O85A 1RE4A 2BASA 5CJ4A 1H8AA 1E5WA 3RK3B 2GM4A 2GLZA 1YJWF 1LT9C 3GYQA 1RLGA 1YI2F 1FJKA 5CMZA 2WALA 2KP8A 5CCHC 3HE5A 5BVZA 2IPPA 2ALEA 1H89A 4NUTA 1X9VA 2QA4F 2E43A 1VQ7F 2R3CA 2LKMA 1VQ5F 1GK4A 2HYNA 2PP6A 5BU5A 5G4UC 1KILD 4RESB 1G1IA 3NK6A 3CMAF 3PLAC 3L4FA 1VQLF 1SFCB 5KJ7D 2HG5D 2FFDC 1IO4A 5A2QM 3GHGC 1LTGC 1J1EB 3CD6F 1NMUB 2IFMA 4O9BA 5APXA 1RE3A 2A45I 3M9BA 3SWFA 3CC7F 4X3LA 1KILB 1SVFA 3P7KA 1W2BF 4BVRA 2XNXA 1LWUA 1FZBA 2NPSC 1T2KD 2Q7CA 2OYIC 4IFMA 3LWPC 3LWRC 3M9QA 3J81M 1L4AB 4EOTA 1N73A 3C9IA 4B86A 5CCHD 3M0DC 5HY4A 1S9KD 1XTCC 1YYCA 1JNMA 1YJ9F 1JY3P 3II6A 3M06A 2KB7P 3MD0A 1VQ9F 3LIEA 1N73B 3CPWF 1NTZK 1FDMA 4BVSA 4LCKA 5APTA 2N1TA 2N9BA 3V2RA 1LWUC 2YMYA 1YHQF 1ZR2A 3VMXA 1W3EX 2JNBA 1JY2N 1FAVA 1JUNA 1MFZA 5CCGC 1CI6A 2C0XA 2L5GB 2WSFH 4C7NB 3JAMM 1IK9A 1RY3A 2W6BA 1GO1A 3PP5A 2XU6A 3V2NA 2P7JA 5HWEA 5HY1A 1X79B 5AW5B 5CJ0A 2WT7A 3RK3C 1W40A 3CCUF 1J1DC 2FYUK 3RA6A 3A5TA 1WT6A 3RL0C 1N7SA 1VQ8F 1NH4A 3HD7B 1S9KE 1JY2P 4KHXA 4EIJA 2W27A 2QEXF 4N3YB 1NTKK 4AUWA 1WRGA 4WY4B 1Q82H 3OAKA 1RF0A 4TZZA 1W42A 2FKWB 5HXZA 3HUSB 3U1AA 3CCSF 1RF1C 4I1LA 4BW0B 2N1TC 1CSBA 1NU1K 4Y99C 2BO1A 4C7RA 3HD7C 1M1JA 1OWAA 2W6AA 3JCMM 3D00A 5FJ4C 4WY4D 2YKQA 2OYHB 3CL3D 1W41A 1YTZI 1IPAA 5BU8B 5GANK 3NVKE 4LLHA 1FZFA 3B5ND 4GIFA 1SFCC 2KTUA 3HTKA 2QM8A 3OJAB 3E20B 5KTBA 1MUUA 3I56F 3P8CE 1FJPA 1EQ7A 4WBAA 2J58A 1YITF 3CC4F 2YKOA 2POHA 1SP4A 4N78E 3BASA 1H7MA 5AVRB 4EI9A 1GU5A 1OXZA 5CCHA 1FZAA 1FOSF 1H88A 1GU4A 3OBYA 1M7LA 3LWOC 1URQD 2PAJA 5AW1B 2FGYA 1FZCA 3FFMA 1RE3C 1J2JB 3CCLF 1GL2D 2YO3A 2M3BA 2Z5HA 3NXSA 3VI6A 5AVVB 2VGNA 4EI7A 1LTJC 1DT9A 1NAFA 3CCJF 3LW5H 3RK2C 5AW0B 3LIDA 1N7SB 3M0DA 3BRVB 1ZV8A 1LTBC 2KSJA 1VDFA 3L35A 3VTPC 1LGHB 1W2EA 3HE4A 2P1JA 4XA4A 3TNUB 1SLQA 1GDTA 1JJ2F 4BVTA 1HUCA 1NWQA 1T0KB 3V7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIF A;  1HBW A;  3HE4 B;  4LC1 A;  3CCM F;  2Z5I A;  1YJN F;  1PXW A;  5EO3 A;  1XBI A;  3ON1 A;  3A7O A;  1MV8 A;  4JYC A;  3V7Q A;  5AVS B;  1VQ4 F;  1Q86 H;  5GIO C;  1VQK F;  2JJL A;  2P67 A;  3VMZ A;  2Q5U A;  2VGM A;  1X52 A;  3N4Z A;  1K9M H;  5AVU B;  1KC8 H;  1X7O A;  2R5B A;  3HJW C;  3CG6 A;  5EWR A;  1YIJ F;  5AW2 B;  4I6M C;  5G4V C;  2WPQ A;  3I55 F;  1GO0 A;  3CPQ A;  3TYY A;  3VMF B;  3RA5 A;  1CN7 A;  3P8M C;  5AW6 B;  1Q81 H;  3TNU A;  3O8Z A;  1CK2 A;  3KDP B;  3P32 A;  3CCQ F;  3LWV C;  2WWW A;  3NMU C;  5APS A;  4GKG A;  2WPS A;  1Q7Y H;  3CC2 F;  3LFO A;  5FLX M;  2LBW A;  3CCV F;  2WPR A;  3L37 A;  5APV A;  3VMY A;  5GIP C;  5AVY B;  3NVI B;  2R5D A;  3NK7 A;  2CZW A;  1HWT C;  5AW8 B;  1VQM F;  2QI2 A;  1CI6 B;  1KQL A;  3TK1 A;  1G2C B;  1QVF F;  1GZL A;  1VQP F;  1NJI H;  2HVY D;  1GD2 E;  3PAF A;  2E42 A;  3KQG A;  3OW2 F;  4GT1 A;  3N4Y A;  1HJB A;  2Q3I A;  1SDS A;  1X7P A;  5AW7 B;  2VRS A;  3G6E F;  3L36 A;  3V4Q A;  1GZ0 A;  1A02 J;  5DCV A;  1DH3 A;  3G4S F;  5IT9 M;  4C46 A;  3A3Y B;  3E1Y A;  3AGK A;  3V5B A;  2KTV A;  1N8R H;  2ZFC A;  1E7K A;  3NMD A;  3T97 A;  4I2L C;  2C9L Y;  2XZR A;  3J80 M;  2FC3 A;  3M91 A;  1GTW A;  5AW4 B;  2OHW A;  3SIU A;  2YNY A;  5APQ A;  1VQ6 F;  2I6D A;  1S72 F;  1K73 H;  4AQR D;  3V4W A;  2P2U A;  3VYI A;  3CCE F;  1A02 F;  3UIA A;  3B8E B;  2QM7 A;  2H7H A;  4BY9 D;  3NFQ A;  2C9N Y;  3CXC F;  1GK6 A;  3SIV A;  3CCR F;  1X8Y A;  1M1K H;  3J7A R;  1KQS F;  3CME F;  3LWQ C;  3WXM B;  4M3L A;  2OTJ F;  2XV5 A;  1CZQ A;  3HE5 B;  5AVW B;  4AYC A;  2LBX A;  1KD1 H;  1VQO F;  3I5C A;  5GAP K;  4XE5 B;  1K8A H;  1FOS E;  1ZWZ A;  4HYT B;  5AVQ B;  5AW3 B;  3IR9 A;  3OBW A;  3MGN A;  5AVT B;  3G71 F;  5AVZ B;  4DZO A;  3A2A A;  1RA4 A;  2OTL F;  3MCA B;  1QVG F;  2R32 A;  3M9H A;  5APU A;  5AW9 B;  4X3M A;  4JYB A;  1T2K C;  4C4W C;  3VN0 A;  5APW A;  5AVX B;  2WTY A;  3NTN A;  2OZB A;  2YO2 A;  3M0A A;  2KG4 A;  5GIN C;  5APY A;  3HAX D;  4C7N A;  1M90 H;  2WT7 B;  1VQN F;  2ZXE B;  3O85 A;  2BAS A;  1H8A A;  1YJW F;  1RLG A;  3GYQ A;  1YI2 F;  5CMZ A;  2WAL A;  2KP8 A;  3HE5 A;  2IPP A;  2ALE A;  1H89 A;  4NUT A;  2QA4 F;  2E43 A;  1VQ7 F;  2R3C A;  1VQ5 F;  1GK4 A;  5G4U C;  4RES B;  3NK6 A;  3CMA F;  3PLA C;  1VQL F;  1IO4 A;  5A2Q M;  3CD6 F;  1NMU B;  5APX A;  3SWF A;  3M9B A;  3CC7 F;  4X3L A;  3P7K A;  1W2B F;  1T2K D;  2Q7C A;  3LWP C;  3LWR C;  3J81 M;  4EOT A;  4B86 A;  1JNM A;  1S9K D;  1YYC A;  1YJ9 F;  3M06 A;  3MD0 A;  1VQ9 F;  3LIE A;  3CPW F;  4LCK A;  5APT A;  2N9B A;  1YHQ F;  3VMX A;  1W3E X;  2JNB A;  1JUN A;  1FAV A;  1MFZ A;  1CI6 A;  3JAM M;  4C7N B;  1GO1 A;  2XU6 A;  2P7J A;  5AW5 B;  2WT7 A;  1W40 A;  3CCU F;  3RA6 A;  3A5T A;  1VQ8 F;  1S9K E;  4KHX A;  2W27 A;  2QEX F;  4AUW A;  1Q82 H;  3OAK A;  4TZZ A;  1W42 A;  3CCS F;  4BW0 B;  1CSB A;  2BO1 A;  2W6A A;  1OWA A;  3JCM M;  5FJ4 C;  1W41 A;  1IPA A;  5GAN K;  3NVK E;  2KTU A;  3HTK A;  2QM8 A;  3E20 B;  1MUU A;  3I56 F;  1YIT F;  3CC4 F;  1SP4 A;  1H7M A;  5AVR B;  1GU5 A;  1OXZ A;  1FOS F;  1H88 A;  1GU4 A;  3OBY A;  3LWO C;  5AW1 B;  3FFM A;  1J2J B;  3CCL F;  2YO3 A;  2Z5H A;  3NXS A;  3VI6 A;  5AVV B;  2VGN A;  1DT9 A;  1NAF A;  3CCJ F;  5AW0 B;  3LID A;  3M0D A;  3L35 A;  3VTP C;  3HE4 A;  3TNU B;  1SLQ A;  1JJ2 F;  1HUC A;  1NWQ A;  1T0K B;  3V7E A; 
#chains in the Genus database with same CATH topology
 3H32 B;  5CA1 B;  3QTY A;  2E75 B;  3WGL A;  5HP8 A;  1N7S D;  2WSE H;  3AEF C;  1K04 A;  4XFJ A;  5EO3 A;  2H8P D;  2ZT9 D;  3D54 A;  1QEX A;  3PTZ A;  4H44 D;  1MV8 A;  3L71 E;  1SQQ G;  1W59 A;  2B87 B;  3CPW O;  1VQK F;  5B5E H;  2ITA A;  3V4D A;  2HP0 B;  4NWO B;  1K73 Q;  2EWC A;  4BT7 A;  3CCR P;  2O01 J;  1KC8 H;  5IJ0 A;  2R5B A;  2L26 A;  1NU1 G;  1KNK A;  1MZ9 A;  3DC2 A;  1YIJ F;  5AW2 B;  4DXD A;  5IJ0 B;  2QJY B;  4ZKP A;  4TV8 A;  3PH0 A;  3JAK A;  5MN5 A;  3L73 E;  4WBN A;  2Q1K A;  3AE5 C;  3RA5 A;  1IFN A;  1NTK D;  2I1J A;  1FBM A;  1HGZ A;  2OYO A;  1CN7 A;  2XKM A;  4YTP C;  2I8D A;  2WQY C;  2JEE A;  4TUY B;  1L0N D;  5LA6 B;  2Q1Y A;  2MKV A;  3GTZ A;  1HGV A;  4PD4 D;  3KDP B;  3P32 A;  1FU1 A;  1TU3 F;  2WPS A;  2D2C B;  2K1A A;  2K37 A;  3JAS A;  1S5L X;  1NTZ D;  3VCZ A;  3VYU C;  1LWU B;  2IBZ D;  5LYJ B;  2NPS D;  3RYH A;  2W6J H;  3GHG A;  1H0T A;  1QL1 A;  2H43 A;  2WZ7 A;  3F89 A;  3KZI E;  2ZYD A;  2UYN A;  5AVY B;  5KJ7 C;  1X22 A;  1GW4 A;  2R5D A;  4NPE A;  3NK7 A;  2CZW A;  1JY3 O;  4U3F J;  3RL0 B;  1ZLL A;  3F0D A;  1PP9 J;  2UWJ E;  3QH9 A;  1Z56 A;  5AVM A;  2QIW A;  2HPC A;  1RF1 A;  1VQP F;  1NJI H;  3QWO C;  2OQQ A;  4EB6 A;  1PGO A;  3FX0 A;  4H44 C;  2E42 A;  3FBA A;  1NU1 D;  3K0T A;  2FYU G;  3H32 A;  4GOE A;  1K05 A;  3JCU H;  1W57 A;  3L70 E;  1HJB A;  2A06 G;  2Q3I A;  5TIS H;  1SDS A;  5LXT B;  2VRS A;  3HUS A;  1VHA A;  2QJP C;  2Q9I A;  1JY2 O;  3SFE C;  2HQS C;  3Q2Y A;  2HOD A;  2OYH C;  5DCV A;  3L74 J;  1XHO A;  4WVZ A;  3G4S F;  4DRX B;  5KLI C;  5HP7 A;  2QTP A;  1BGY D;  3H1I G;  2Z1U A;  3E1Y A;  1RHZ B;  4W7Y A;  3AGK A;  2VAP A;  1N8R H;  1KIL C;  2HOD B;  2O1J A;  2IX7 C;  2AEJ A;  4N78 D;  4DRX A;  4X1Y A;  2IQQ A;  3NMD A;  4L76 A;  3SWY A;  2HRY A;  4I2L C;  2JP3 A;  3AEB C;  1EC5 A;  3FXE A;  4R4M A;  1NO4 A;  4X1Y B;  1GTW A;  4C8E A;  2OHW A;  3SIU A;  2OAR A;  2XND H;  1FZG A;  4W80 A;  3GG2 A;  2E76 B;  2RHL A;  1S72 P;  1QD9 A;  3TGU E;  3CX5 H;  2KZJ A;  2P2U A;  1K9M Q;  3VYI A;  1IFI A;  1FZC C;  3V2P A;  2RKL A;  1KIL A;  1RF1 B;  4BY9 D;  2C9N Y;  3GMA A;  3JAR B;  5J2T A;  1JCC A;  2LCA A;  3TGU J;  2KYV A;  1DIP A;  1UII A;  1ZRT D;  1R1M A;  3L72 D;  1M1K H;  3J7A R;  3P4E A;  1KQS F;  3G4S P;  5B66 E;  3JAS B;  2QEX P;  3WJP A;  1IV4 A;  3ZP4 A;  3H25 A;  4BT4 A;  1CZQ A;  3HE5 B;  3KPE A;  1KQF B;  4ASW A;  3LME A;  3A0B E;  5KLV K;  4AYC A;  2LBX A;  1AJY A;  3I5C A;  2Z1E A;  1K8A H;  1S5L E;  1BE3 D;  5CCG D;  1BCC D;  3H1H J;  5AVQ B;  3IR9 A;  3TSI A;  2OTM A;  1VQP P;  4DZO A;  2JWA A;  2NPS B;  5CA0 A;  2HPC B;  4I4T A;  3HKE B;  4YJ2 B;  2WSF J;  2OTL F;  3G3Z A;  1ZN5 A;  1Q8R A;  3MCA B;  4G4W A;  2KOG A;  4HKZ H;  1W55 A;  3CWB E;  3N2G A;  3U1C A;  5AW9 B;  4C8I A;  3VN0 A;  3VP9 A;  5KLV G;  1L0L K;  1W2B O;  3CCV P;  2H88 C;  2HFE D;  2W83 C;  1PP9 E;  2KG4 A;  3HKC A;  1KC8 Q;  3EOR A;  5J2T B;  3HAX D;  4C7N A;  1QX8 A;  1KNJ A;  1N8R Q;  4PWT A;  5LA6 A;  3W68 A;  2AXT H;  1HJ0 A;  1VQN F;  1L4A C;  5KMG A;  3CX5 D;  3O85 A;  1LT1 A;  5CJ4 A;  1SQP D;  2GM4 A;  1YJW F;  1YJW P;  2K1S A;  2KP8 A;  4L74 A;  2ALE A;  2E43 A;  1VQ5 F;  5EIB D;  1GK4 A;  1KIL D;  4YJ3 B;  3HWU A;  3C8L A;  3GHG C;  1LTG C;  1J1E B;  3WU2 H;  3GF7 A;  2IFM A;  2NRG A;  3WU2 E;  5APX A;  1RE3 A;  2P58 A;  4O4L B;  1Q7Y Q;  1W2B F;  1VQ8 P;  4R4L A;  2Q3E A;  1RQV A;  1FZB A;  1RH5 B;  3CXH E;  2Q7C A;  2OYI C;  3LWP C;  3LWR C;  3J81 M;  1L4A B;  3L73 D;  1Q2N A;  4EOT A;  5HY4 A;  2E75 D;  3JAT B;  1S9K D;  2M5A B;  3II6 A;  2KB7 P;  1SQX E;  5KKZ B;  1NTM J;  1NTZ K;  3G71 P;  3V2R A;  1U40 A;  2YMY A;  1ZR2 A;  3VMX A;  4PJ0 E;  2JNB A;  4O4I B;  2WSF H;  4C7N B;  1IK9 A;  2W6B A;  4B45 A;  1EXI A;  2XU6 A;  3V2N A;  2P7J A;  5HWE A;  1KYO E;  4D6T D;  5BMV B;  2KXP B;  5AW5 B;  5CJ0 A;  3RK3 C;  1W40 A;  5KMG B;  1J1D C;  2H8C A;  2FYU K;  3RA6 A;  2JWD A;  1IK7 A;  3EFF K;  1LP1 B;  1PL5 A;  4N3Y B;  3L71 J;  3H1I J;  1WRG A;  2ZYG A;  3F6M A;  3OAK A;  4GDO A;  4PD4 H;  5EB0 A;  2CW4 A;  2WSE J;  1AVO A;  3N2G B;  1OWA A;  3JCM M;  1VQ7 P;  3D00 A;  2OYH B;  1NYH A;  1SS1 A;  2KNC A;  2AXT E;  4LLH A;  3B5N D;  1R5S A;  1SFC C;  3RYC B;  3MUD C;  3HTK A;  2QM8 A;  5KTB A;  1MUU A;  3P8C E;  3I56 P;  1AQT A;  1EXJ A;  1SP4 A;  2BEZ F;  2KLU A;  1P84 I;  1FZA A;  1FOS F;  3PJS K;  3MBM A;  1URQ D;  1FZC A;  3FFM A;  1ZP0 C;  2RHO A;  1RE3 C;  1J2J B;  1NTM E;  3CCL F;  4H13 C;  1SQX J;  3NXS A;  5KLV J;  2GVI A;  4KJM A;  2VGN A;  1LTJ C;  1NAF A;  3H1L D;  3LW5 H;  1PGJ A;  3LID A;  3M0D A;  4G4Y A;  1LTB C;  3VTP C;  3K2X A;  4EYY Q;  2JDI H;  4BVT A;  5LP6 A;  3HKB A;  3ZP7 A;  2B33 A;  2IYO A;  1LJ2 A;  2P10 A;  4Y99 B;  4FFB B;  3V7Q A;  2IDB A;  1VQ4 F;  1Q86 H;  5GIO C;  3PRJ A;  1SFC D;  1PGQ A;  1VL2 A;  3FPI A;  1BE3 G;  3Q5R A;  3CCJ P;  3VMZ A;  2VGM A;  1T0A A;  1K9M H;  5AVU B;  4GOF A;  2Y0C A;  2ZVY A;  2LXC B;  4PD4 E;  3CG6 A;  3M4S A;  2Z01 A;  5TJH A;  1N86 A;  4OGQ C;  5G4V C;  1KOR A;  3R4Y A;  1OW7 A;  2LR2 A;  3MCQ A;  1BDD A;  2WPQ A;  2GUS A;  3CPQ A;  1M8O B;  1HH0 A;  5J2U A;  2RN0 A;  3L72 J;  3B5N A;  2O3J A;  4TV9 B;  3P8M C;  1BCC E;  3IF4 A;  3L71 G;  3O8Z A;  4YPC A;  1SQP G;  4I55 A;  1W5C E;  2H8E A;  2O01 N;  3RYC A;  3L70 D;  1OFU A;  3CC2 F;  1VF5 C;  1FS0 E;  2E75 C;  2B89 A;  2WIT A;  2LBW A;  5HY0 A;  2ZVO B;  3C9R A;  3G9R A;  1LTT C;  1L0L D;  1JO5 A;  1N7L A;  3CCV F;  2YYE A;  1NTZ J;  4OVN F;  3JAT A;  2FYU E;  5APV A;  1U3L A;  1FZE A;  5ITZ A;  4XCQ A;  1QVG O;  1IV2 A;  3NVI B;  2OYI A;  1HWT C;  5HY2 A;  2QI2 A;  5K5G B;  1KQL A;  3TK1 A;  3EFG A;  1G2C B;  3KJK A;  2FYU J;  3RL0 g;  1QVF F;  3LYB A;  1P84 D;  1XTG B;  1T3U A;  4BT3 A;  1DD4 A;  2HVY D;  4B5C A;  4JF7 A;  1GD2 E;  5L8R J;  4HNA B;  2FBW C;  5KAF H;  3AE9 C;  5KJ7 A;  1J1E C;  4IFF A;  3KQG A;  4GT1 A;  4ZOL A;  4PV1 D;  3L7Q A;  1PF5 A;  3G6E F;  1M1J C;  3L36 A;  2VXY A;  4JPZ B;  1GL2 A;  3CC7 P;  3V4Q A;  1GZ0 A;  4IL6 H;  3RK2 D;  4O2B A;  1FDI A;  1SA0 A;  4C46 A;  2P6Y A;  1IV1 A;  3HD7 A;  3L72 E;  3E1R A;  3VOP A;  2SPZ A;  2ZFC A;  1L0L G;  1SQV K;  1E7K A;  2E5Y A;  4UB8 E;  2V9Y A;  2C0W A;  3L74 E;  1KB9 D;  3J80 M;  2ZOV A;  2FC3 A;  3JC2 2;  1KMI Z;  3CXH H;  2H89 C;  1JD1 A;  2KLV A;  5KAI E;  1VQN P;  1S72 F;  1TVK A;  4AQR D;  1JY3 N;  1IFD A;  1H47 A;  5C8Y A;  2BCC J;  2CPS A;  3I55 P;  1G2C A;  1KYO I;  1Y8A A;  2YMK A;  1A02 F;  3B5N C;  3UIA A;  2H7H A;  1GW3 A;  2H6L A;  2W8Z A;  1AVY A;  2BCC E;  1K8A Q;  3CWB D;  1FNK A;  3WPW A;  2FYZ A;  1G1J A;  3CCR F;  1X8Y A;  3AE4 C;  1JOC A;  2IZ0 A;  2IYP A;  2D2C C;  3VP8 A;  3ELC A;  4ZNC A;  3CXH I;  3H1K G;  5GON A;  2XV5 A;  1NAY A;  3TD4 A;  3B4S A;  2R44 A;  2FFD B;  2O1K A;  3BCC D;  3FXD A;  4IHJ A;  1KB9 H;  3Q8H A;  2A45 H;  1LTI C;  5CHX A;  1BE3 J;  1AQ5 A;  3RYF B;  1U7J A;  2NZ2 A;  3P8C D;  2O01 H;  1N73 C;  3TGU G;  4HYT B;  5AW3 B;  3CB2 A;  3F0E A;  1S5L H;  3E7K A;  3MGN A;  5AVT B;  2OTJ P;  3G71 F;  1SQQ D;  4OWF A;  1Q90 D;  2A06 E;  2N1T D;  5CB4 B;  2DT4 A;  1RQU A;  1IFJ A;  1QVG F;  1M1J B;  1AFO A;  5APU A;  5APW A;  4ZI7 A;  3L73 J;  5AVX B;  3H1L E;  3C1L A;  3F0F A;  3H1H D;  2N9Y B;  1GL2 B;  2IFN A;  1VQL P;  3CXH D;  3B6N A;  1KTM A;  1QU9 A;  3D71 A;  3CC4 P;  4RKU J;  2V7Q H;  1ZXG A;  5JVD B;  3AEE C;  2PGD A;  4B46 A;  3RYI B;  4U3J A;  1BSH A;  1OVV A;  3ZO8 A;  2VAM A;  3MDO A;  2BAS A;  4X20 A;  1FFX B;  1H8A A;  5JQG B;  1YI2 P;  3RK3 B;  3HTN A;  1LT9 C;  3GYQ A;  5JVD A;  1RLG A;  3S03 A;  2UZH A;  3RYI A;  5CCH C;  5BVZ A;  1FFX A;  2G8Y A;  1H89 A;  2LKM A;  1Z5V A;  2YXR B;  2PP6 A;  4RES B;  1SZQ A;  3NK6 A;  3CMA F;  5H2F E;  4PJ0 H;  3WGM A;  3L75 J;  1IV3 A;  4O9B A;  1OVR A;  2PHN A;  5ITZ B;  4R40 B;  2A45 I;  3M9B A;  3P7K A;  1SVF A;  4I7Z C;  3D70 A;  5CB4 A;  2FXO A;  2XNX A;  5LOV B;  1PP9 G;  1LWU A;  2NPS C;  3DDN A;  5LYJ A;  1ONI A;  2ZXX A;  4B86 A;  5CCH D;  2HS0 A;  2IBZ G;  5LOV A;  5MN4 A;  1OAP A;  1JY3 P;  3M06 A;  1VQ9 F;  1OX3 A;  2B87 A;  1FDM A;  3WUV A;  4BVS A;  5APT A;  3E22 B;  4O4H B;  1XV2 A;  1YHQ F;  1Y47 A;  4YXW H;  1CI6 A;  2L5G B;  4U3F G;  4UB6 H;  3PP5 A;  2Z1F A;  3E22 A;  1SQB G;  3UT5 B;  4BT6 A;  3CCU F;  3A5T A;  3H1L G;  4O2B B;  1N7S A;  1OFC X;  1SQV J;  1SA0 B;  1NH4 A;  3HD7 B;  1JY2 P;  2QJK B;  4U7J A;  2KSE A;  1NTM D;  4WY4 B;  4C82 A;  5LXT A;  2K9J B;  3MZW B;  3T97 B;  1RF1 C;  4BW0 B;  2N1T C;  4RO0 A;  1NU1 K;  4Y99 C;  4ZHV A;  2BO1 A;  3HD7 C;  2W6A A;  3WUT A;  1YTZ I;  1OVU A;  3Q1M A;  4DJG A;  5KX5 B;  3CCE P;  3AED C;  2CSL A;  5C8Y B;  1W5E A;  2KTU A;  2CK3 H;  3IKF A;  2PRR A;  1GX1 A;  3E20 B;  5KX5 A;  3I56 F;  1IZN B;  1EQ7 A;  3AE1 C;  3CWB J;  1BGY E;  3CC4 F;  2POH A;  4ZK7 A;  2IZ1 A;  4N78 E;  2M3E A;  4EI9 A;  1GU5 A;  1OXZ A;  4OGQ D;  3OBY A;  4X1I B;  5IYZ B;  3L75 E;  3LWO C;  5AW1 B;  2FGY A;  1SQX G;  4O4H A;  4H0L D;  3CWB G;  1GL2 D;  1SQB E;  1PPJ G;  1QGK B;  4I7Z B;  5AVV B;  3GLM A;  1DT9 A;  3JAR A;  3CCJ F;  5AW0 B;  2KSJ A;  1LGH B;  2CVL A;  3HE4 A;  4XA4 A;  3TNU B;  1SLQ A;  1GDT A;  1XRG A;  1JJ2 F;  4H0L C;  1HUC A;  4KWE A;  1SQQ J;  2K9J A;  3GHZ A;  1U57 A;  3HE4 B;  1HBW A;  3KIZ A;  4LC1 A;  2VAW A;  2V7Q J;  2Z5I A;  1YJN F;  1IJD B;  1YQ4 C;  1PXW A;  1JMB A;  1ZRT E;  3ON1 A;  3A7O A;  3L75 G;  4PD4 I;  4JYC A;  3H1L J;  5GTI E;  4IFD K;  1SQV D;  1JCD A;  1DEB A;  4NPD A;  1YJ9 P;  1KQS O;  3L74 G;  2KZI A;  1X52 A;  5B5E E;  3KYQ A;  3ERN A;  3M84 A;  3HKE A;  1H48 A;  1X7O A;  5EWR A;  1URQ C;  1KFN A;  5IYZ A;  4I6M C;  4PV1 C;  2FYU D;  3FWN A;  2I6R A;  1KQG B;  3VYT C;  1S4X A;  1AA0 A;  4JBZ A;  4BT2 A;  3TYY A;  3VMF B;  4I50 A;  4QMA A;  3SWK A;  1M57 D;  3K12 A;  2K88 A;  2KK7 A;  1DEE G;  3TF5 A;  4ZHY B;  3PLN A;  3F0G A;  5AW6 B;  3IFM A;  2WSC H;  3MUD A;  3A0B H;  1Q81 H;  3TNU A;  4N6J A;  1CK2 A;  1DD3 A;  1RF0 C;  3CCQ F;  5CA1 A;  2QJY C;  1LTA C;  1L0N J;  5EAZ A;  1URQ A;  2WWW A;  2RMZ A;  4PV1 B;  1BGY G;  3H1I D;  3LFO A;  1HTL C;  3GHG B;  1HF9 A;  1P84 E;  1H0T B;  1URQ B;  1ZR4 A;  1RQ2 A;  5GTH H;  3CYP B;  3L73 G;  4NQ3 A;  3H1J E;  3HKD B;  1VF5 D;  3RK2 B;  5KAF E;  4U3F E;  3VMY A;  1YTZ T;  3RYH B;  3RK3 D;  4G4Z A;  5GIP C;  2K3R A;  5AW8 B;  3TDK A;  1VQM F;  1CI6 B;  2UYN B;  4OH8 B;  1J1D B;  1GZL A;  1NTK G;  3S02 A;  3CI9 A;  2QSI A;  4G4X A;  3PAF A;  1BDC A;  1YJN P;  4C81 A;  1WMK A;  2N1T B;  3N4Y A;  1N7S C;  3D01 A;  3MIW A;  2B9B A;  3TD3 A;  4O4I A;  4WY4 A;  1JTH B;  1X7P A;  3L74 D;  1NU1 J;  3U59 A;  1SQX K;  3V6I A;  3QHD A;  1LT9 A;  3S9O A;  1OMI A;  4HH2 A;  4C8G A;  3AEC C;  2ZYA A;  4ERH A;  5IT9 M;  2FXM A;  3V2Q A;  2KI7 B;  3CMA P;  2KTV A;  3CC2 P;  2BTQ B;  3SSU A;  1EDI A;  1VQ5 P;  3H1K J;  3WJR A;  1GL2 C;  1EZV G;  1NOH A;  5EZY A;  3H1J G;  2UYJ A;  4CPG A;  1UI9 A;  4ZMD A;  5CA0 B;  1W5A A;  4I4T B;  5AW4 B;  4BVQ A;  2YNY A;  5APQ A;  1L4A D;  2KUB A;  3V3T A;  2HLO A;  1RE4 C;  4NPF X;  5EYP A;  1KB9 I;  1L0N G;  2M0B A;  1ZME C;  1R5L A;  3CCE F;  1HVV A;  3Q5S A;  1TUB B;  1JFF A;  5EB1 B;  3B8E B;  3BCC E;  3NFQ A;  1DBF A;  3CXC F;  3BAT A;  1GK6 A;  2PMP A;  3KE1 A;  3JAL A;  2B88 A;  4EB6 B;  5E79 H;  1VQV A;  3CLQ A;  4DT0 A;  2M8R A;  1SQB K;  2D2C D;  3IN6 A;  3L71 D;  3BCC G;  2GA1 A;  2MJZ A;  1FZC B;  4W7Z A;  2FY8 A;  3CME F;  2Q1X A;  2XDJ A;  1SQQ E;  2OTL P;  2QE7 H;  2A06 D;  1KZU B;  5GTH E;  3WXM B;  1GMJ A;  1LT9 B;  2JKV A;  2F9Z C;  2DYY A;  1VQ4 P;  3WMM 0;  3M1X A;  5AVW B;  5BMV A;  3CX5 I;  2FYN C;  1VQO F;  1LTS C;  2E5T A;  3OON A;  1FE6 A;  4XE5 B;  1YQ3 C;  2Z4E A;  2E74 C;  3WPX A;  1NTM G;  3AE8 C;  3ZOP A;  3L75 D;  4X1K B;  1BCC J;  3CME P;  3EQ2 A;  1BGY J;  4D6T J;  1PV3 A;  4X1K A;  4TT3 H;  3L70 G;  3P0Z A;  2PFX A;  1T2K C;  1IFM A;  5IJ9 A;  2GUV A;  3R2P A;  1JTH A;  1TUB A;  3RL0 D;  2NMU A;  2Q6Q A;  1AV1 A;  4D6T G;  1EZV D;  1CW5 A;  3JAL B;  3S1K A;  5APY A;  4H44 B;  5GTI H;  1KFM A;  1M90 H;  4KT0 J;  2AEM A;  2WT7 B;  2IBZ I;  1SQP J;  1J7H A;  2ZXE B;  3CCQ P;  1RE4 A;  2FXP A;  3ZDM A;  2GLZ A;  3H1K D;  1YI2 F;  1FJK A;  1S1C X;  3HE5 A;  2IPP A;  1SQV E;  1BSN A;  3B71 A;  2QA4 F;  1L2P A;  5KLV E;  2HYN A;  5G4U C;  3KHU A;  3D6Y A;  1G1I A;  3PHL A;  2HRU A;  5CBO A;  4O4L A;  3L4F A;  1VQL F;  5CBN A;  2HG5 D;  1Q86 Q;  3CD6 F;  1PGP A;  1NMU B;  3WGN A;  3LDT A;  3AE6 C;  3FD5 A;  3CC7 F;  5MN6 A;  1KIL B;  1QLE D;  4YJ2 A;  2AEF A;  4JQ0 D;  2OTK E;  3M9Q A;  3CCU P;  1N73 A;  1S3J A;  3Q5P A;  2ZJS E;  4ASV A;  1JNM A;  1YYC A;  5IJ9 B;  3S4R A;  3VOB A;  2YXQ B;  3LIE A;  1N73 B;  3CPW F;  2N1T A;  3H1H G;  1W3E X;  1QVF O;  1JUN A;  1FAV A;  1MFZ A;  3K5B A;  3MHV A;  5HY1 A;  1X79 B;  2WT7 A;  5DJT B;  2G9I A;  1NGM B;  3H1I E;  3RL0 C;  1E79 H;  4EIJ A;  2HP3 A;  2W27 A;  2QEX F;  1NTK K;  3H1J D;  5E79 E;  1SQB D;  4TZZ A;  3TGU D;  5EZY B;  3U1A A;  2BTU A;  3MQW A;  1CSB A;  3RBX A;  3CCL P;  3KJJ A;  5FJ4 C;  4FFB A;  3CL3 D;  1W41 A;  3ITK A;  5GAN K;  5BU8 B;  4HB1 A;  5EYP B;  1FZF A;  4DCK A;  3TD5 A;  3KHN A;  2KNC B;  3Q3D A;  4O4J B;  1PPJ E;  3OJA B;  4LNU B;  3O6Q A;  2CHS A;  4ZHW A;  1T6A A;  4O4J A;  1SQB J;  1Q82 Q;  3P10 A;  2M5A A;  2UYK A;  3BAS A;  2QRX A;  3S0Y A;  1ZW0 A;  5CCH A;  2PAJ A;  3USS A;  2YO3 A;  2M3B A;  1BE3 E;  3VI6 A;  4IOI H;  1YQN A;  2WPV B;  3F5H A;  1W5B A;  3BYQ A;  3RK2 C;  1Z5W A;  2ZT9 B;  3BRV B;  1ZV8 A;  3L35 A;  4H13 D;  4Z1M H;  1VQK P;  1W2E A;  3HKB B;  1LP1 A;  2P1J A;  3G6E P;  2K9Y A;  2ZAE B;  1NWQ A;  1M1K Q;  1RLU A;  1KN7 A;  2HX0 A;  4MN4 C;  2AIF A;  4ZOL B;  3CCM F;  2W8B C;  2BCC D;  5TIS E;  5GON B;  4H13 B;  2NPS A;  3CCM P;  1L4A A;  1T8Z A;  2QVA A;  2FFD A;  1XBI A;  1PP9 D;  2Y9Z A;  2OYH A;  5AVS B;  3C8V A;  3HUS C;  2I1K A;  4H0L B;  2JJL A;  2V4H A;  1VQ9 P;  3N7N A;  1VPC A;  3S0W A;  2P67 A;  2Q5U A;  3IKE A;  4LNU A;  1NKZ B;  3N4Z A;  1SQP E;  3HKC B;  1SQP K;  2YKP A;  3FGA D;  3BVH A;  1MFT A;  3W67 A;  4EDF A;  3HJW C;  3T80 A;  4ZI7 B;  3RK3 E;  3I55 F;  3GF3 A;  1GO0 A;  3VTI C;  1QAH A;  2E74 B;  4TV9 A;  1NQ3 A;  4BRY A;  3VOA A;  2RH0 A;  4BWN A;  4I55 B;  3VMA A;  2KS1 A;  3B5N B;  4YJ3 A;  1OIP A;  4X20 B;  3CYQ A;  3HD7 D;  4L73 A;  3H1H E;  2W90 A;  3LWV C;  5LP6 B;  3LW5 J;  3JSV C;  3NMU C;  3HTK B;  5APS A;  4GKG A;  1QL2 A;  1Q7Y H;  4HJG H;  4RJT A;  3JAW B;  3RE3 A;  5FLX M;  1NHL A;  2Z1T A;  3MTU E;  3BCC J;  1NTK E;  1PFI A;  1IFP A;  5KKZ C;  1VK3 A;  2WPR A;  3L37 A;  1SFC A;  1L0L J;  2YIU B;  3FD6 A;  3OA7 A;  5B8F A;  1DX7 A;  3OW2 O;  2A45 G;  4HNA A;  1N2D C;  5EIB C;  5HXU A;  4O2A A;  1NTZ E;  4Y28 J;  2ZAU A;  2AIZ P;  1UFY A;  3H1K E;  2CWJ A;  1M56 D;  4EI2 A;  1M90 Q;  1JN1 A;  2E76 C;  1NTK J;  2Y0E A;  1ODE A;  3E1I A;  1RQ7 A;  3OW2 F;  3BRT B;  5CCG A;  4WWI A;  5J2U B;  4EI8 A;  1LTJ A;  2J59 M;  1D7M A;  3RGU A;  3WGJ A;  5AW7 B;  2R3S A;  1U3P A;  3VO8 A;  1LTJ B;  3D6Z A;  1IC2 A;  3JVH A;  1A02 J;  5M1B A;  1EDK A;  1DH3 A;  3WUU A;  3A3Y B;  3V5B A;  4IL6 E;  3JAW A;  3WJQ A;  5FNV B;  4B62 A;  1SQQ K;  1Y9B A;  3T97 A;  4IL6 X;  2C9L Y;  2XZR A;  3O6Q B;  1YGY A;  3M91 A;  1FDO A;  3R0P A;  1VQ6 F;  2I6D A;  4ZKU A;  1NU1 E;  1UIX A;  1NTM K;  4BXL A;  1K73 H;  4F6R B;  3V4W A;  3L70 J;  2L91 A;  4GOD A;  2OYI B;  2AXC A;  5JCO C;  4YXD C;  4ZHQ A;  2RHH A;  2LBT A;  3RBZ A;  4BRY B;  1CLI A;  4IIJ A;  5DJU B;  3ABV C;  2QM7 A;  1T3J A;  2Y0D A;  3C9S A;  2ZOD A;  1YIJ P;  3AEA C;  2UYP A;  3SIV A;  2WSS H;  1JEK A;  1OW8 A;  3AEG C;  2R75 1;  3VYS C;  5KAI H;  4U39 A;  2ZF8 A;  3LWQ C;  3C9T A;  4DOJ A;  1OZH A;  4UB6 E;  1EZV E;  1R8E A;  4M3L A;  2HR3 A;  4L75 A;  2OTJ F;  3IAO A;  3H1J J;  2OGU A;  5JCO A;  1NKN A;  3L72 G;  5JH7 B;  1KD1 H;  3IEQ A;  1JB0 J;  2IG8 A;  3AE7 C;  5GAP K;  4A7P A;  2IAF A;  1FOS E;  1YBK A;  1JMM A;  1ZWZ A;  1L0N E;  1L0N K;  3N4X A;  4K35 A;  1ZOY C;  1YHQ P;  3OBW A;  3RYF A;  4WY4 C;  2BCC G;  4LGD E;  5AVZ B;  2CPB A;  3A2A A;  2QJK C;  5B66 H;  1RA4 A;  1KD1 Q;  3QUW A;  3H6P A;  5KLV D;  2GZL A;  1VF5 B;  2HS3 A;  2R32 A;  3M9H A;  1LNQ A;  3GW6 A;  1NVO A;  2HS4 A;  4X3M A;  4JYB A;  4C4W C;  4ZHQ B;  2KIK A;  2IBZ E;  4WB4 A;  4IIJ B;  2J5U A;  2WTY A;  1FSZ A;  3NTN A;  1X25 A;  2WSC J;  2YO2 A;  3M0A A;  2OZB A;  3CD6 P;  1NJI Q;  5GIN C;  3K14 A;  3WGK A;  3HRN A;  1YIT P;  4U3J B;  2KS1 B;  5JQG A;  5KLI B;  1L0L E;  4E6E A;  1W5F A;  1EZV I;  1P84 H;  1VQ6 P;  1KV4 A;  1E5W A;  3A0H E;  2Y9Y A;  4OGQ B;  5CMZ A;  2YIU C;  2WAL A;  3AE3 C;  1EDL A;  4BT5 A;  4NUT A;  1X9V A;  4TUY A;  1USD A;  1VQ7 F;  2QG4 A;  2R3C A;  3I7T A;  5JH7 A;  4IHJ B;  1KYO H;  2JR8 A;  5BU5 A;  3C9U A;  1Q81 Q;  2RHJ A;  3PLA C;  1SFC B;  5KJ7 D;  2FFD C;  1IO4 A;  5A2Q M;  5EFW B;  2R6R 1;  3CX5 E;  2LXB A;  3SWF A;  4X3L A;  5LP6 C;  5H2F H;  4BVR A;  3I3F A;  1T2K D;  1SQV G;  4IFM A;  1W58 1;  2JO1 A;  1PIX A;  4O2A B;  4RHA A;  3C9I A;  1VH8 A;  3M0D C;  1XTC C;  2E76 D;  1YJ9 F;  3MD0 A;  1X0T A;  2FYN B;  4LCK A;  2N9B A;  1LWU C;  2G3A A;  4TLF A;  2E74 D;  3UT5 A;  2HP0 A;  3JCU E;  1JY2 N;  5CCG C;  2ZVZ A;  2C0X A;  3EWK A;  3JAM M;  1RY3 A;  2BEQ D;  1VQM P;  1GO1 A;  1VQO P;  4RQO A;  3KZI H;  4U3F D;  2BTO A;  1EDJ A;  1KIL E;  2ZVN B;  3IMP A;  1PZQ A;  1S2E A;  1KB9 E;  1WT6 A;  1U43 A;  1FC2 C;  3U0O A;  1VQ8 F;  2CHT A;  1S9K E;  4KHX A;  1MKM A;  3FWL A;  4TV8 B;  1PPJ D;  2QJP B;  4AUW A;  2YXZ A;  1Q82 H;  3S06 A;  5FNV A;  1RF0 A;  1W42 A;  1BCC G;  2FKW B;  5HXZ A;  3HUS B;  1JM0 A;  3CCS F;  4I1L A;  1OW6 A;  3A0H H;  3VIU A;  4C7R A;  1M1J A;  2QA4 P;  1KYO D;  4WY4 D;  2YKQ A;  1SQX D;  3KXD A;  2AMT A;  1TVK B;  1IPA A;  4F6R A;  3NVK E;  5C39 A;  1COM A;  4GIF A;  4G88 A;  4UB8 H;  1JY8 A;  1USE A;  1FJP A;  3S0H A;  1FNJ A;  2ZT9 C;  4D6T E;  4WBA A;  2J58 A;  1YIT F;  2YKO A;  2WMM A;  1H7M A;  3AE2 C;  5AVR B;  3HKD A;  1H88 A;  1GU4 A;  1M7L A;  2DW3 A;  1U7M A;  3IEW A;  3N2K B;  4K3A A;  2KGW A;  3JAK B;  1NTZ G;  4X1I A;  1JFF B;  4WBN B;  2Z5H A;  3N2K A;  3CCS P;  4I50 B;  3MP7 B;  4EI7 A;  2MQE A;  4M8I A;  1N7S B;  1VDF A;  3SFD C;  3ESJ A;  4G4V A;  2N48 A;  2WVR A;  2RB9 A;  1T0K B;  3V7E A; 
#chains in the Genus database with same CATH homology
 3H32 B;  2AIF A;  1HBW A;  3HE4 B;  4LC1 A;  3CCM F;  1N7S D;  2WSE H;  2Z5I A;  1YJN F;  1IJD B;  2NPS A;  1PXW A;  5EO3 A;  1L4A A;  2H8P D;  1T8Z A;  2FFD A;  1XBI A;  3ON1 A;  3A7O A;  1MV8 A;  4Y99 B;  2OYH A;  4JYC A;  3V7Q A;  5AVS B;  1VQ4 F;  1Q86 H;  5GIO C;  4IFD K;  1SFC D;  1VQK F;  3HUS C;  1JCD A;  2I1K A;  2JJL A;  1DEB A;  1VPC A;  3N7N A;  2P67 A;  3VMZ A;  2Q5U A;  2VGM A;  1X52 A;  1NKZ B;  3N4Z A;  3KYQ A;  1K9M H;  5AVU B;  1KC8 H;  1X7O A;  1SQP K;  2R5B A;  2YKP A;  3BVH A;  3HJW C;  3CG6 A;  5EWR A;  1MZ9 A;  1URQ C;  1YIJ F;  1KFN A;  1N86 A;  5AW2 B;  4I6M C;  5G4V C;  2WPQ A;  4ZKP A;  3I55 F;  1GO0 A;  2GUS A;  3CPQ A;  3TYY A;  3VMF B;  1HH0 A;  3RA5 A;  1IFN A;  2I1J A;  1FBM A;  1HGZ A;  3B5N A;  2XKM A;  1CN7 A;  2JEE A;  3P8M C;  5AW6 B;  3IFM A;  2WSC H;  3MUD A;  1Q81 H;  3B5N B;  3TNU A;  1HGV A;  3O8Z A;  4N6J A;  1CK2 A;  3KDP B;  1RF0 C;  3P32 A;  3CCQ F;  3HD7 D;  1FU1 A;  1LTA C;  3LWV C;  1URQ A;  2WWW A;  3NMU C;  3HTK B;  5APS A;  4GKG A;  1QL2 A;  2WPS A;  1Q7Y H;  3CC2 F;  3LFO A;  1HTL C;  3GHG B;  5FLX M;  2WIT A;  1NHL A;  2LBW A;  3MTU E;  1URQ B;  1ZR4 A;  5HY0 A;  1LTT C;  1LWU B;  1PFI A;  2NPS D;  4NQ3 A;  1JO5 A;  1N7L A;  3GHG A;  3CCV F;  2WPR A;  3L37 A;  1QL1 A;  2H43 A;  3RK2 B;  1SFC A;  2WZ7 A;  5APV A;  3VMY A;  1YTZ T;  1FZE A;  3RK3 D;  3OA7 A;  4XCQ A;  5GIP C;  1DX7 A;  5AVY B;  5KJ7 C;  3NVI B;  1GW4 A;  2R5D A;  3NK7 A;  2CZW A;  2OYI A;  5AW8 B;  1HWT C;  1VQM F;  5HY2 A;  1JY3 O;  2QI2 A;  1CI6 B;  1KQL A;  3RL0 B;  1ZLL A;  1G2C B;  2A45 G;  3EFG A;  3TK1 A;  1N2D C;  1Z56 A;  4OH8 B;  5HXU A;  1QVF F;  1J1D B;  1GZL A;  2HPC A;  1RF1 A;  1XTG B;  3CI9 A;  1VQP F;  1T3U A;  1NJI H;  2HVY D;  4JF7 A;  1GD2 E;  3PAF A;  2E42 A;  5KJ7 A;  1J1E C;  3E1I A;  4IFF A;  3H32 A;  3KQG A;  3OW2 F;  4GT1 A;  3BRT B;  5CCG A;  2N1T B;  3N4Y A;  1N7S C;  3MIW A;  1HJB A;  2Q3I A;  1LTJ A;  4EI8 A;  2J59 M;  1SDS A;  4WY4 A;  1JTH B;  1X7P A;  3U59 A;  5AW7 B;  1SQX K;  2VRS A;  3HUS A;  3G6E F;  1M1J C;  3L36 A;  2Q9I A;  1JY2 O;  1GL2 A;  1LTJ B;  1LT9 A;  1IC2 A;  3V4Q A;  2HOD A;  4HH2 A;  2OYH C;  1GZ0 A;  1A02 J;  5DCV A;  1DH3 A;  3RK2 D;  3G4S F;  5IT9 M;  2FXM A;  3V2Q A;  4C46 A;  3A3Y B;  3E1Y A;  4W7Y A;  3HD7 A;  3AGK A;  3V5B A;  2KTV A;  1N8R H;  1KIL C;  2HOD B;  2O1J A;  2IX7 C;  4N78 D;  3VOP A;  2ZFC A;  1SQV K;  1SQQ K;  1GL2 C;  1E7K A;  1NOH A;  3NMD A;  3SWY A;  3T97 A;  4I2L C;  2C9L Y;  2XZR A;  1NO4 A;  2C0W A;  3J80 M;  2FC3 A;  3M91 A;  1GTW A;  5AW4 B;  2OHW A;  3SIU A;  4BVQ A;  2OAR A;  1FZG A;  2YNY A;  5APQ A;  1VQ6 F;  2I6D A;  4W80 A;  1L4A D;  4ZKU A;  2KLV A;  3V3T A;  2HLO A;  1NTM K;  1S72 F;  1RE4 C;  1K73 H;  4AQR D;  3V4W A;  1JY3 N;  1IFD A;  2OYI B;  2P2U A;  2CPS A;  3VYI A;  1G2C A;  1IFI A;  3CCE F;  1FZC C;  1A02 F;  1HVV A;  3B5N C;  3UIA A;  3V2P A;  1KIL A;  3B8E B;  1RF1 B;  2QM7 A;  1T3J A;  2H7H A;  4BY9 D;  1GW3 A;  3NFQ A;  2C9N Y;  3CXC F;  3BAT A;  1GK6 A;  1JCC A;  3SIV A;  2KYV A;  3CLQ A;  2M8R A;  1SQB K;  2FYZ A;  1G1J A;  3CCR F;  1X8Y A;  1M1K H;  2MJZ A;  1FZC B;  1JOC A;  3J7A R;  4W7Z A;  1KQS F;  3CME F;  3LWQ C;  2XDJ A;  3VP8 A;  4DOJ A;  1KZU B;  3WXM B;  1LT9 B;  4M3L A;  2F9Z C;  2OTJ F;  2XV5 A;  1CZQ A;  3WMM 0;  3HE5 B;  3KPE A;  1NKN A;  2FFD B;  5AVW B;  2O1K A;  5KLV K;  4AYC A;  2LBX A;  1KD1 H;  2A45 H;  1LTI C;  1VQO F;  3I5C A;  5CHX A;  1AQ5 A;  1LTS C;  5GAP K;  3P8C D;  4XE5 B;  1K8A H;  1FOS E;  1JMM A;  2O01 H;  1N73 C;  1ZWZ A;  5CCG D;  4HYT B;  1L0N K;  3N4X A;  5AVQ B;  5AW3 B;  3IR9 A;  3TSI A;  3OBW A;  2Z4E A;  4WY4 C;  3MGN A;  5AVT B;  3G71 F;  4LGD E;  5AVZ B;  4DZO A;  2CPB A;  2NPS B;  3A2A A;  2HPC B;  1RA4 A;  2N1T D;  2OTL F;  3G3Z A;  3H6P A;  1ZN5 A;  3MCA B;  1IFJ A;  3EQ2 A;  2KOG A;  1QVG F;  2R32 A;  1M1J B;  3M9H A;  1AFO A;  5APU A;  3U1C A;  5AW9 B;  4X3M A;  4JYB A;  1T2K C;  4C4W C;  3VN0 A;  5APW A;  3VP9 A;  1L0L K;  1IFM A;  4WB4 A;  2GUV A;  3R2P A;  5AVX B;  1JTH A;  3RL0 D;  2HFE D;  2WTY A;  3NTN A;  2OZB A;  2YO2 A;  3M0A A;  1CW5 A;  1GL2 B;  2IFN A;  2KG4 A;  5GIN C;  5APY A;  3HAX D;  4C7N A;  3HRN A;  1KFM A;  1M90 H;  2WT7 B;  1VQN F;  1L4A C;  2ZXE B;  3O85 A;  1RE4 A;  2BAS A;  5CJ4 A;  1H8A A;  1E5W A;  3RK3 B;  2GM4 A;  2GLZ A;  1YJW F;  1LT9 C;  3GYQ A;  1RLG A;  1YI2 F;  1FJK A;  5CMZ A;  2WAL A;  2KP8 A;  5CCH C;  3HE5 A;  5BVZ A;  2IPP A;  2ALE A;  1H89 A;  4NUT A;  1X9V A;  2QA4 F;  2E43 A;  1VQ7 F;  2R3C A;  2LKM A;  1VQ5 F;  1GK4 A;  2HYN A;  2PP6 A;  5BU5 A;  5G4U C;  1KIL D;  4RES B;  1G1I A;  3NK6 A;  3CMA F;  3PLA C;  3L4F A;  1VQL F;  1SFC B;  5KJ7 D;  2HG5 D;  2FFD C;  1IO4 A;  5A2Q M;  3GHG C;  1LTG C;  1J1E B;  3CD6 F;  1NMU B;  2IFM A;  4O9B A;  5APX A;  1RE3 A;  2A45 I;  3M9B A;  3SWF A;  3CC7 F;  4X3L A;  1KIL B;  1SVF A;  3P7K A;  1W2B F;  4BVR A;  2XNX A;  1LWU A;  1FZB A;  2NPS C;  1T2K D;  2Q7C A;  2OYI C;  4IFM A;  3LWP C;  3LWR C;  3M9Q A;  3J81 M;  1L4A B;  4EOT A;  1N73 A;  3C9I A;  4B86 A;  5CCH D;  3M0D C;  5HY4 A;  1S9K D;  1XTC C;  1YYC A;  1JNM A;  1YJ9 F;  1JY3 P;  3II6 A;  3M06 A;  2KB7 P;  3MD0 A;  1VQ9 F;  3LIE A;  1N73 B;  3CPW F;  1NTZ K;  1FDM A;  4BVS A;  4LCK A;  5APT A;  2N1T A;  2N9B A;  3V2R A;  1LWU C;  2YMY A;  1YHQ F;  1ZR2 A;  3VMX A;  1W3E X;  2JNB A;  1JY2 N;  1FAV A;  1JUN A;  1MFZ A;  5CCG C;  1CI6 A;  2C0X A;  2L5G B;  2WSF H;  4C7N B;  3JAM M;  1IK9 A;  1RY3 A;  2W6B A;  1GO1 A;  3PP5 A;  2XU6 A;  3V2N A;  2P7J A;  5HWE A;  5HY1 A;  1X79 B;  5AW5 B;  5CJ0 A;  2WT7 A;  3RK3 C;  1W40 A;  3CCU F;  1J1D C;  2FYU K;  3RA6 A;  3A5T A;  1WT6 A;  3RL0 C;  1N7S A;  1VQ8 F;  1NH4 A;  3HD7 B;  1S9K E;  1JY2 P;  4KHX A;  4EIJ A;  2W27 A;  2QEX F;  4N3Y B;  1NTK K;  4AUW A;  1WRG A;  4WY4 B;  1Q82 H;  3OAK A;  1RF0 A;  4TZZ A;  1W42 A;  2FKW B;  5HXZ A;  3HUS B;  3U1A A;  3CCS F;  1RF1 C;  4I1L A;  4BW0 B;  2N1T C;  1CSB A;  1NU1 K;  4Y99 C;  2BO1 A;  4C7R A;  3HD7 C;  1M1J A;  1OWA A;  2W6A A;  3JCM M;  3D00 A;  5FJ4 C;  4WY4 D;  2YKQ A;  2OYH B;  3CL3 D;  1W41 A;  1YTZ I;  1IPA A;  5BU8 B;  5GAN K;  3NVK E;  4LLH A;  1FZF A;  3B5N D;  4GIF A;  1SFC C;  2KTU A;  3HTK A;  2QM8 A;  3OJA B;  3E20 B;  5KTB A;  1MUU A;  3I56 F;  3P8C E;  1FJP A;  1EQ7 A;  4WBA A;  2J58 A;  1YIT F;  3CC4 F;  2YKO A;  2POH A;  1SP4 A;  4N78 E;  3BAS A;  1H7M A;  5AVR B;  4EI9 A;  1GU5 A;  1OXZ A;  5CCH A;  1FZA A;  1FOS F;  1H88 A;  1GU4 A;  3OBY A;  1M7L A;  3LWO C;  1URQ D;  2PAJ A;  5AW1 B;  2FGY A;  1FZC A;  3FFM A;  1RE3 C;  1J2J B;  3CCL F;  1GL2 D;  2YO3 A;  2M3B A;  2Z5H A;  3NXS A;  3VI6 A;  5AVV B;  2VGN A;  4EI7 A;  1LTJ C;  1DT9 A;  1NAF A;  3CCJ F;  3LW5 H;  3RK2 C;  5AW0 B;  3LID A;  1N7S B;  3M0D A;  3BRV B;  1ZV8 A;  1LTB C;  2KSJ A;  1VDF A;  3L35 A;  3VTP C;  1LGH B;  1W2E A;  3HE4 A;  2P1J A;  4XA4 A;  3TNU B;  1SLQ A;  1GDT A;  1JJ2 F;  4BVT A;  1HUC A;  1NWQ A;  1T0K B;  3V7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...