3IR9A

C-terminal domain of peptide chain release factor from methanosarcina mazei.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
AYTDESGLSELVNAAGEKLQDLELMGQKNAVRDFFKELIADSGKVAYGESQVRANLEINSVDVLLLSEDLRAERVTTKCSVCGYENKWTRRWKPPAPAAGNCPKCGSSLEVTDVTDIVDEFSELADKSNAKVVFVSTDFDEGSQLMNAFGGIAAILRYNTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide chain release factor subunit 1
publication title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 48
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ir9A01
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ir9A02
1YIJF 1XBIA 5APTA 5APQA 1PXWA 1GZ0A 2P2UA 1DT9A 3CPWF 1KC8H 3NVKE 2W6AA 1IO4A 3LFOA 2Q3IA 1MV8A 2Z5IA 2QA4F 1Q82H 2XZRA 1YYCA 2KG4A 5GAPK 3G71F 3OBYA 5AW6B 3V5BA 3CXCF 1T2KC 2R5BA 2Q7CA 5AW4B 2E43A 1VQLF 3LWVC 2LBWA 2R3CA 5DCVA 3J7AR 2Q5UA 5IT9M 1NWQA 3VTPC 1K8AH 1JNMA 1VQKF 2W27A 5AW1B 3CCMF 1GO0A 5AW8B 3CCRF 2ZXEB 3O85A 4HYTB 1X7OA 5GANK 3CC4F 2R32A 1FAVA 5GINC 3PLAC 3M9BA 1A02F 3WXMB 2OTJF 4I2LC 2WWWA 1VQ8F 3HE5B 1SP4A 3CG6A 5A2QM 2OHWA 3FFMA 4JYBA 4C4WC 1CK2A 3CCSF 3VMXA 1M1KH 3M0DA 3MCAB 3CC7F 3TK1A 1GD2E 3NK7A 2N9BA 1G2CB 4KHXA 3V4QA 3HE5A 2VRSA 2ALEA 5APXA 1W40A 1MUUA 2QM7A 2H7HA 1K9MH 2WPSA 2WTYA 2WPRA 4LC1A 4EOTA 2XU6A 3NFQA 2JNBA 2FC3A 5AVQB 3E1YA 2BASA 5APWA 1CI6B 1CZQA 4AUWA 5EWRA 3SIVA 3JCMM 4BW0B 4XE5B 5APVA 3ON1A 3OW2F 4B86A 1Q7YH 3CCUF 4I6MC 3JAMM 1QVGF 3CPQA 1VQ6F 1X7PA 1RA4A 2QM8A 4GKGA 5AW0B 1YJ9F 1VQMF 3NTNA 1MFZA 1YHQF 5AW7B 2WPQA 3HAXD 3NVIB 1CN7A 3I55F 3I56F 2P7JA 1CI6A 3T97A 3CCEF 2I6DA 3CCJF 1GU4A 5AW9B 2KTVA 3P7KA 1QVFF 1GK4A 3LWPC 4RESB 3CMAF 3TYYA 3V7QA 2C9LY 5AVYB 3VYIA 1YITF 1GZLA 2CZWA 4LCKA 1OWAA 2VGNA 2XV5A 1KQSF 1NJIH 3SIUA 5AVRB 1NAFA 1VQ9F 3G4SF 1JUNA 3N4ZA 3CCLF 3B8EB 4AYCA 4AQRD 3LWQC 3L35A 3A7OA 3J80M 2IPPA 1VQOF 1VQNF 1DH3A 2WT7B 1FOSF 5APYA 2LBXA 3HTKA 3P32A 4TZZA 3L36A 4DZOA 2VGMA 1RLGA 3A3YB 1HWTC 1T0KB 1M90H 1CSBA 1GTWA 3NMDA 3VN0A 3LWOC 3M06A 3PAFA 2YNYA 3L37A 2YO2A 3A5TA 1HUCA 5AVZB 2OTLF 1E7KA 1K73H 5AVTB 2KP8A 1J2JB 2YO3A 5GIOC 5GIPC 3LIEA 1VQPF 1S72F 3VMZA 5AVVB 2OZBA 1JJ2F 3IR9A 3LWRC 5AW2B 1W2BF 1T2KD 1H89A 1ZWZA 5CMZA 3UIAA 3M0AA 3RA5A 2KTUA 1VQ7F 3SWFA 3VMFB 1VQ4F 5APSA 5APUA 1FOSE 3OBWA 2R5DA 1HJBA 2QI2A 2ZFCA 4M3LA 4X3MA 3MD0A 1YI2F 1KQLA 3OAKA 1H7MA 2AIFA 5AW3B 2P67A 3HE4B 1W3EX 1X52A 3RA6A 4GT1A 2WALA 4C46A 3CCVF 3NXSA 4JYCA 1H88A 1A02J 1X8YA 2HVYD 3NK6A 3KQGA 1GO1A 1OXZA 5AVUB 1SLQA 4C7NB 1S9KE 1Q81H 3KDPB 5FJ4C 5AVWB 3TNUB 5FLXM 2BO1A 5G4VC 1W42A 1GK6A 1S9KD 2E42A 3HE4A 3N4YA 3NMUC 5G4UC 1KD1H 3MGNA 2JJLA 3HJWC 1YJNF 1NMUB 4X3LA 3V7EA 2Z5HA 3CC2F 1HBWA 1N8RH 5EO3A 3M91A 3CCQF 4C7NA 4NUTA 3I5CA 1Q86H 5AVSB 2QEXF 2C9NY 3GYQA 3TNUA 3O8ZA 3E20B 1VQ5F 3V4WA 1GU5A 3A2AA 1H8AA 1YJWF 1IPAA 5AVXB 3CMEF 3VMYA 2WT7A 3P8MC 3LIDA 3VI6A 4BY9D 5AW5B 1SDSA 3G6EF 1W41A 3AGKA 3M9HA 3CD6F 3J81M
chains in the Genus database with same CATH superfamily
1PGPA 1FFXB 1S5LH 1KQFB 2XDJA 3U1AA 2P2UA 1HVVA 3CPWF 3NVKE 3L70J 4OGQD 3H1JD 5CCHD 3HD7B 1BSNA 4W7ZA 1IO4A 1QL1A 3SWYA 2CPBA 2KI7B 3LYBA 2Q3IA 1MV8A 2Z5IA 3JARA 4HH2A 1Q82H 1OVRA 3F0GA 2KG4A 5GAPK 3BCCE 1LTBC 4ZKPA 3AECC 1XV2A 2VAWA 1EDKA 3QWOC 3RK3D 1AA0A 1FFXA 2VXYA 1AFOA 4WWIA 2RKLA 4ZKUA 5KAFE 3H1IJ 4NPEA 2KGWA 3HD7A 3LWVC 4TV8B 4C81A 2NRGA 2R3CA 5KAFH 1RH5B 3J7AR 1KILC 1SQXJ 3CX5E 1IV4A 2ZXXA 1JNMA 2HLOA 2NPSB 3ZP7A 4X1IB 2FXPA 1SQVG 2DYYA 3CCRF 2VAMA 3CX5H 3O85A 5GANK 1PFIA 3CWBG 3D70A 2UYKA 5GINC 3L75D 2BTQB 4R4LA 3PLAC 1A02F 5JCOC 2RMZA 2N9YB 1SQVD 1VQ8F 3HE5B 5A2QM 4TV8A 3FFMA 5C8YB 4JQ0D 2KK7A 3CXHI 1N7SB 2CHTA 1QD9A 1VF5D 2OTLP 1NJIQ 3H6PA 4RJTA 2NPSA 3FXEA 3VTIC 3L70E 2LXBA 4X1IA 4I1LA 1LWUC 1EC5A 2HP3A 2OQQA 3VYSC 1M1KH 1RLUA 3CC7F 3TK1A 1GW4A 4PV1B 2R44A 3NK7A 3VOBA 4YXDC 1QU9A 2V9YA 4G4ZA 3K12A 1CLIA 2N1TB 1FZGA 1PPJE 3HE5A 1KFNA 2YXQB 1H47A 2ZYDA 4PD4D 2ZVYA 3W68A 3SSUA 1DBFA 5C8YA 1N7SA 3RBZA 1QGKB 1X0TA 2WTYA 3H1IE 1SQPG 2I6RA 1J1DC 1U40A 1K04A 2WSCJ 2BASA 1SQXE 2R6R1 3JCMM 5KJ7C 1USDA 4I50B 4G4VA 3ABVC 2N1TA 4I6MC 2ZYAA 1SQPD 2UZHA 5DJTB 3CPQA 1VQ6F 1NU1J 3SFDC 3JC22 4KWEA 1MZ9A 3AE1C 4BT4A 4UB6E 4H0LC 2WSEJ 1L4AC 3NTNA 4ZI7B 5AW7B 2ZJSE 4UB6H 3MQWA 1UIIA 3MUDA 2P7JA 3T97A 3LW5H 4I50A 3Q2YA 5BVZA 1GU4A 5EZYB 3Q1MA 4EI7A 2OTJP 1YQ3C 3FXDA 4G4WA 3LWPC 1SQQG 4RQOA 5GTIE 3B6NA 4XCQA 2YMKA 2C9LY 4N6JA 3FD5A 3SFEC 5EIBC 4ZI7A 1YITF 5GTIH 1GZLA 4H13C 1LJ2A 2JWAA 1W5BA 4I55B 3HTKB 1SQQD 1SQBG 3ERNA 3OJAB 3PLNA 4Z1MH 3VCZA 1NTZG 1NJIH 3KIZA 2IQQA 1SFCD 3FGAD 3C8LA 1FNJA 3HTNA 3WGKA 1YJWP 1SQBD 3CCLF 1OW7A 1NTZD 1PV3A 3B8EB 1FE6A 1S1CX 1JY8A 3A7OA 2ZVZA 3LMEA 1NU1E 1KB9I 4I55A 3HTKA 3P32A 1M7LA 5J2TB 4DZOA 1YTZI 1PF5A 3JAWB 5BU5A 3U0OA 2W6JH 1HWTC 2A06G 2OYIC 2WSEH 2OYHB 2IAFA 4EI2A 3QUWA 1KTMA 2Q9IA 4ZHVA 2P58A 3L75J 1VQVA 3F5HA 1M90Q 3A5TA 1P84E 1KFMA 5AVZB 2OTLF 2QTPA 2QJYB 1VPCA 2A06D 4TV9B 4BT3A 1AJYA 1H0TB 2G8YA 3GTZA 4ASWA 5J2TA 3VMZA 3EFFK 5AVVB 3JAWA 1YGYA 1KYOD 3HD7D 3C1LA 1L0LK 2HQSC 4HB1A 2OYHA 4IFFA 2PMPA 1NTKG 3A0BE 1SVFA 4R4MA 1ZR2A 3TSIA 3F6MA 2YMYA 2YKPA 2CHSA 1NTMD 4TV9A 1BGYJ 4L75A 2L26A 3A0BH 1H0TA 1FOSE 3OW2O 2R5DA 5KLVK 5EFWB 3MD0A 1PIXA 1ZV8A 1HGZA 2V7QJ 2AIFA 2V4HA 2G3AA 4ZHYB 3HE4B 1W5CE 2NPSD 1FC2C 3K0TA 4U3JB 4GT1A 1JY3N 2WALA 1IFMA 4C46A 2JP3A 3TD5A 1L0NG 3V2QA 1USEA 1EQ7A 3GMAA 1RF1B 3L75E 3L72G 4XA4A 1GO1A 3B5NC 1OXZA 1PGOA 3C8VA 4H44C 2ZT9D 1SLQA 2RH0A 1AVYA 1L0ND 1GL2C 2IFNA 3S4RA 1T6AA 2BO1A 2WPVB 3K2XA 5G4VC 1W42A 1N7SD 4GODA 5KKZC 3AE6C 2CPSA 3L72D 3HE4A 1IC2A 3N4YA 3GHGB 1RHZB 4DOJA 1LT9B 4U3JA 5HP7A 1FJKA 1KD1H 4YJ2B 2PAJA 3MGNA 2JJLA 2FFDB 1KQSO 3IKFA 2QG4A 4I4TB 4X1YB 3R2PA 1RF1A 1IZNB 3CC2F 4YXWH 3HUSC 2AXCA 1N8RH 1JCCA 3II6A 1Q8RA 5BMVB 2E75B 3VP8A 5LA6A 3VO8A 1BGYE 4PD4E 1RE4A 5KMGB 3O8ZA 2GZLA 1SA0B 2VAPA 3AE9C 4PD4H 1YJWF 1YJ9P 2KLUA 1VQMP 2WT7A 3VMYA 2FYUG 3GHGA 3LIDA 3VI6A 1LT9A 4YJ2A 1SDSA 5MN4A 4OWFA 3G6EF 2FFDA 2Q1YA 2LBTA 3RK2C 2YKQA 1W41A 4I4TA 4X1YA 1U3LA 1VQ4P 2V7QH 5BMVA 2QJKC 5APQA 2FYUD 1PXWA 1GZ0A 1FZBA 1IK9A 1DT9A 3UT5B 5KMGA 3RL0g 1SA0A 2W6AA 2FYZA 5K5GB 4GOFA 3N4XA 1OMIA 3CXHD 2XZRA 1YYCA 2LCAA 5LYJB 2ITAA 1ZOYC 4RHAA 3CCVP 3AE7C 2O01J 1Q82Q 2MQEA 1DEBA 3V5BA 4G88A 3VYUC 2R5BA 1KNKA 2KYVA 5AW4B 2E43A 3UT5A 3S03A 3P10A 2KXPB 2W83C 2H43A 2H6LA 3VMAA 2Z1UA 2Q5UA 1ONIA 1K8AH 2BCCJ 1BSHA 3OONA 4IHJB 4Y99B 5LYJA 4HYTB 1X7OA 5IJ9B 2J59M 4R40B 1GX1A 1M56D 3ZO8A 1SFCB 3M9BA 3WGNA 2HS0A 2JEEA 3WXMB 1HJ0A 1LWUB 1W581 1JY2O 3ITKA 1NTMJ 3V2PA 2ZF8A 4O9BA 5JCOA 4XFJA 3F0FA 3AE2C 3M9QA 3M0DC 4C4WC 2Y9ZA 1CK2A 2OARA 1Q90D 4IHJA 2WSFJ 3S0WA 3CCSF 1LTJC 4F6RB 2Z01A 3KHNA 5IJ9A 3CI9A 3BVHA 3MCAB 1COMA 1SFCA 2IX7C 1GD2E 4ERHA 4IFDK 1G2CB 3V3TA 1YIJP 1J1DB 1LWUA 3WJQA 4KHXA 5APXA 1MUUA 2QM7A 5E79E 3H1LG 2KSEA 2H7HA 1K9MH 1FU1A 2M3EA 3JAKA 3N2KB 5E79H 3CX5I 2IYPA 2O01H 2WPRA 2RB9A 2XU6A 3NFQA 5TJHA 1BE3D 4YJ3B 4F6RA 1SQXK 3AE3C 4DRXB 3H1LD 5AVQB 5AVMA 5APWA 4BVRA 1CI6B 4H0LB 4AUWA 3ESJA 2BCCE 1G2CA 5APVA 3MCQA 3ON1A 4O4IA 1BDCA 2D2CC 3OW2F 1LTGC 3I3FA 3L74J 3D6YA 3H1KJ 1QEXA 1JY2P 2ZAUA 1X7PA 3WGJA 2QM8A 3L73G 3N2KA 4D6TJ 3CL3D 5AW0B 3N7NA 1KN7A 1YJ9F 1IFNA 1VQMF 5HY0A 1NQ3A 1NTME 3R4YA 4YJ3A 1YHQF 4DRXA 2MJZA 2WPQA 3HAXD 3NVIB 3I55F 2QJPB 1CI6A 1KB9D 3L73D 2G9IA 1DD4A 2GM4A 3Q5SA 4H13B 3WJPA 2KTVA 1UFYA 3RBXA 2R751 2WSFH 1FNKA 1ZR4A 3K14A 1SS1A 2JKVA 3V7QA 2Q1XA 4WY4C 2LXCB 2KS1B 5GTHE 1KV4A 5DJUB 3MDOA 3JSVC 3G3ZA 3C9SA 5CA0B 4KT0J 2A45H 4IIJB 2OGUA 2GLZA 1NGMB 1FZEA 3AEGC 2ZT9B 1ZRTD 1OWAA 4RO0A 1YQNA 3R0PA 2VGNA 2FKWB 1KQSF 3SIUA 1Z5VA 3H1HG 5AVRB 5CCGD 4EIJA 3CWBD 3G4SF 4O2AB 2L91A 3RYCB 1T8ZA 1VK3A 1JMBA 1W5AA 1J1EB 2FYNB 4PWTA 2KS1A 3RE3A 4BVQA 3H1HD 1NU1K 2OYIB 3L74E 3L35A 3TD4A 2IPPA 5CA0A 5HWEA 3H1KE 4IIJA 1FOSF 4WBNB 1JEKA 1OZHA 2MKVA 3L36A 1RQ2A 2Y0CA 4D6TE 2RHLA 1RLGA 4IL6X 1JFFB 2E75D 1IFIA 1NYHA 4O2AA 5HY1A 3RYCA 2E74C 4BT2A 3DC2A 2BEZF 2RHOA 2GUVA 3LWOC 4TUYB 1AVOA 2YNYA 3L37A 1PP9J 5MN5A 3IF4A 5KLIC 1HUCA 2QA4P 2OYIA 3G71P 1LP1B 5GIOC 3M84A 4WBNA 1VH8A 1HH0A 3H25A 3L71G 3GLMA 5HXUA 3I56P 1JFFA 4LLHA 2SPZA 1L0LG 3CB2A 1IV2A 1OFUA 2OZBA 1PL5A 1R8EA 4U3FJ 3IR9A 3LWRC 5EYPB 4TUYA 1VQKP 3L71D 4N3YB 2Z1FA 2YXRB 3UIAA 1OVVA 1RF0A 3M0AA 3RA5A 1BCCG 1S2EA 1LP1A 5LOVB 2NZ2A 3CC4P 1KILD 3WJRA 4NWOB 1X25A 3OBWA 1U7JA 3WUUA 5KLVG 2Z1EA 1QVGO 2QI2A 3QHDA 1BCCD 2DW3A 1BE3J 4DJGA 5CB4B 1VL2A 5EYPA 3KE1A 4H44B 4OVNF 5KLVD 2P67A 4ZHWA 2B9BA 3H1JJ 1FDIA 1U3PA 3D71A 2P6YA 3E1IA 3P0ZA 3RA6A 4ZK7A 1GL2B 1P84I 2IZ1A 3LDTA 5LOVA 1FDOA 5KKZB 1H88A 1LGHB 1VQNP 3AEBC 1A02J 1X8YA 1N73C 1FDMA 5EAZA 1PP9E 5EZYA 1LNQA 1EXIA 1FS0E 4C8GA 4N78D 4BRYB 3V2NA 5FJ4C 2KOGA 3FD6A 5FLXM 5GONB 5CB4A 2IBZE 2E76C 1GK6A 4GOEA 1S9KD 2WSCH 3RGUA 1X22A 3E22B 1NHLA 3VYTC 3NMUC 1GL2A 1IK7A 2BTOA 1R5LA 3MHVA 4U3FE 2KB7P 1NMUB 3ZDMA 2AEJA 4X3LA 4IFMA 2H88C 3B4SA 2Z1TA 1KD1Q 2HRYA 3M91A 3C9TA 1JB0J 4ZNCA 1S72P 1Z56A 1EZVE 2Q3EA 2HG5D 3P8CE 3RK2B 5M1BA 3GYQA 5GONA 1N8RQ 2E5YA 2K1AA 3TGUG 3WGLA 3E20B 5KJ7D 2QJKB 3E22A 1GU5A 3A2AA 1HF9A 1SQVJ 2E5TA 2UYNB 1P84H 2YYEA 3C9UA 1BE3E 3CWBJ 4YPCA 3AE8C 4PV1C 3TGUD 4A7PA 3CCEP 2HPCB 4H0LD 3J81M 4B46A 3H1JE 1L4AD 2N1TC 3C9IA 3GG2A 3CCJP 3TF5A 3WMM0 4LGDE 3VP9A 1XRGA 1G1JA 4TT3H 3F89A 5HXZA 1S3JA 1KMIZ 1VDFA 1QL2A 3RL0C 2Y9YA 1Q2NA 3BCCG 2UYNA 3EORA 2QA4F 3RK3E 3G71F 2WMMA 3OBYA 2QSIA 3WGMA 4GIFA 1NTKD 4O4HB 2DT4A 1T3UA 4FFBB 1U43A 2HPCA 5MN6A 3BCCD 1T2KC 5EIBD 3CXCF 1VQ9P 4H13D 2Q7CA 1JY2N 3ELCA 2AMTA 4PD4I 3USSA 3JALB 2GUSA 4ZOLB 4BT5A 1VHAA 5IT9M 1SQPJ 1NWQA 2UYPA 1VQKF 1NOHA 3M1XA 1JD1A 1W5EA 1GO0A 3CX5D 4G4XA 2ZVNB 1LT1A 1S5LX 4O4HA 3KJJA 1K8AQ 1JN1A 4FFBA 3CC4F 3PRJA 3Q5RA 1SQVE 2B89A 1FAVA 1OVUA 2Q6QA 1NVOA 5EB1B 3CWBE 2OTJF 4I2LC 1LTJB 1XHOA 5ITZB 2ZVOB 3E1RA 2QEXP 3JALA 1RQVA 2AEFA 1E79H 4ZOLA 3L70G 2I1JA 2H8CA 3VIUA 2JWDA 3A0HE 1S4XA 2K88A 4BVSA 3C9RA 3GHZA 4DCKA 3A0HH 3M0DA 5CCGA 3L70D 2CW4A 2N9BA 5KTBA 1FZFA 2KIKA 1LTJA 1SQQJ 1TU3F 3V4QA 2ALEA 2K37A 5ITZA 3H1IG 2KZJA 2HP0B 5J2UB 2RHJA 1LTTC 1W55A 2D2CB 5CBOA 3AEAC 1VQ7P 5JQGB 4K35A 1IV3A 4EOTA 4LC1A 1SQBJ 1SQXG 1MKMA 3MIWA 2P10A 1URQC 2B87B 1K9MQ 1N2DC 1KORA 2JNBA 1NTZJ 2FC3A 4NPFX 4X1KB 3WUVA 1Y8AA 3H1ID 1SQPE 2WITA 1T0AA 3SIVA 4XE5B 3HKDB 1YI2P 4YTPC 4RKUJ 4NQ3A 1Q7YH 2O1JA 3TD3A 2OYHC 3JAMM 1SQXD 2ZAEB 1QVGF 5JH7B 3PHLA 3BATA 1NKNA 1W57A 1DX7A 2W6BA 3F0DA 3KPEA 2HP0A 5J2UA 1RA4A 4WB4A 2CVLA 1NTMK 3BRVB 5JQGA 4GKGA 1KILB 1MFZA 2J58A 2B87A 3S0YA 4HKZH 5CHXA 3KZIE 3WPWA 4OGQC 4X1KA 3CCRP 5CCHC 1CN7A 4WY4B 1M1JC 3CCEF 2O01N 3BYQA 2P1JA 5EB0A 3HKDA 3KZIH 2I6DA 3CCJF 5H2FE 4C7RA 3P7KA 2LKMA 1GK4A 2EWCA 5JH7A 3Q5PA 2HRUA 3B5ND 2M5AB 3JCUE 1EDJA 1M8OB 4H44D 3TYYA 5H2FH 5CJ4A 4K3AA 2HS4A 3VOPA 5LP6C 2CK3H 4ZMDA 3RK3C 1SQQE 1GL2D 3JCUH 5AVYB 1KILA 3VYIA 2K3RA 2CZWA 4X20B 4WY4A 5KX5B 3CCQP 4N78E 1SQBE 1QX8A 1VQ9F 1XTCC 2QIWA 1NTZE 4WVZA 1VQ5P 5HP8A 3KYQA 4W7YA 1NTKJ 1JUNA 5HY4A 2R3SA 3CMEP 1G1IA 2FXOA 4NPDA 1NU1G 4W80A 3LWQC 2KNCB 2E74B 3AE5C 1OAPA 3BASA 1DH3A 1FBMA 3TDKA 5APYA 2LBXA 1PZQA 2Z4EA 2FXMA 4I7ZC 3JATB 5KX5A 4TZZA 5KLIB 3RYIB 1D7MA 1NU1D 2OTMA 5CA1B 5B5EE 1VF5C 3A3YB 3RK2D 2FBWC 2QE7H 3IKEA 3NMDA 1ODEA 3VN0A 1X79B 4ASVA 5B5EH 2A06E 1IJDB 2YO2A 1L0NJ 2A45I 1X9VA 2FFDC 3CLQA 2KNCA 1K73H 5AVTB 2KP8A 3D00A 3KHUA 3ZOPA 1J2JB 3L72J 5CBNA 1L4AB 5GIPC 3JARB 3DDNA 2JO1A 3JATA 2M3BA 3L7QA 1KYOE 3RYIA 1BDDA 5CA1A 1VQLP 5KJ7A 1MFTA 1KYOH 3O6QB 5BU8B 3FX0A 1ZP0C 2JDIH 3PJSK 1H89A 1U7MA 3CCMP 2KSJA 1VQ7F 2UYJA 1KC8Q 3IFMA 1NTKE 4B5CA 3VMFB 1L4AA 1VQ4F 3AEEC 5APUA 3D6ZA 4OH8B 1YITP 2H89C 2WZ7A 1HJBA 1JY3P 3S06A 4X3MA 3VOAA 4MN4C 3JVHA 4QMAA 1YI2F 1KQLA 1N73B 3OAKA 3O6QA 3HKBB 2FYUJ 3M4SA 2PP6A 2KUBA 3IEQA 4B45A 2LR2A 3CCLP 5GTHH 1U57A 4L73A 3L75G 3CCVF 2E76B 3NXSA 2J5UA 2HVYD 3S02A 1L0NE 1QVFO 2B88A 1ZLLA 1AQTA 1PGJA 1Q81H 3L72E 1N73A 5AVWB 3HKBA 2YKOA 3HWUA 2POHA 3E7KA 1UI9A 1NKZB 2E42A 1FZCC 3LW5J 4Y99C 2YIUC 2ZYGA 3FWLA 3HJWC 5B8FA 3V7EA 1SFCC 3U1CA 2Z5HA 3FWNA 1SZQA 3FPIA 1BGYG 3D54A 4C82A 4JF7A 3CCUP 3CCQF 3PTZA 2HX0A 3I5CA 1GMJA 1Q86H 3CYQA 1OFCX 4BWNA 3RYFB 1VQ5F 1IFPA 3V4WA 1RE3C 2BTUA 3MZWB 1H8AA 1BGYD 1WRGA 2D2CD 3CMEF 1RQUA 5AW5B 1W59A 5HY2A 3RL0B 2FYUE 4TLFA 3PP5A 1NO4A 2XNXA 3F0EA 3WU2E 1NAYA 1YIJF 3FBAA 1XBIA 5APTA 3EFGA 3ZP4A 3V6IA 3T97B 3WU2H 1KC8H 2IDBA 3Q3DA 4GDOA 2HYNA 2RN0A 3CMAP 3CXHE 3RYFA 2IBZI 2Y0DA 1L0LD 3LFOA 3HRNA 2ZODA 2CWJA 1IV1A 2QRXA 3CXHH 2KLVA 1XTGB 2W8BC 4M8IA 3IMPA 3KJKA 5AW6B 1OW8A 4WY4D 3HD7C 1Y47A 3CYPB 4EYYQ 2WVRA 2ZOVA 3QH9A 3H1LJ 1H48A 3B5NB 1W2BO 1PGQA 5LXTB 2I8DA 1VQLF 1EZVI 4L74A 3HKEB 4ZHQB 2F9ZC 2LBWA 3OA7A 5DCVA 1R1MA 3VTPC 1VQOP 2W27A 5AW1B 1KNJA 4O2BB 3CCMF 5AW8B 4DXDA 2QJPC 2ZXEB 1SQVK 4C8EA 4BT6A 1DIPA 1DD3A 2R32A 2W8ZA 4DT0A 3CC2P 1WT6A 3B5NA 3HUSB 2WWWA 3S9OA 5LXTA 1SP4A 2IFMA 1YBKA 2NPSC 3CG6A 1WMKA 3HKEA 4ZHQA 4HJGH 3L73J 2K9JB 2OHWA 4JYBA 1N86A 2WQYC 5TISE 2E74D 4O2BA 1T3JA 3U59A 1YQ4C 2ZT9C 1VQPP 3VMXA 3G6EP 5TISH 4BRYA 1N7SC 4IOIH 1LTSC 1HGVA 3IN6A 1URQB 2K9YA 3HUSA 2VRSA 1W40A 1J1EC 2FYNC 1QAHA 2K9JA 2QVAA 1ZN5A 4JBZA 3JASB 2WPSA 2IZ0A 3H1LE 2C0WA 1RQ7A 1E5WA 4EDFA 1SQPK 2BCCG 2PGDA 2W90A 2WSSH 3H1HJ 2Q1KA 2GA1A 3E1YA 4C8IA 1CZQA 3D01A 5EWRA 4BW0B 2PFXA 2N48A 1EDIA 4U7JA 1URQA 4B86A 3EQ2A 3CCUF 4HNAB 1AQ5A 2AEMA 4Y28J 4OGQB 3AE4C 1N7LA 1M1JB 2BCCD 3IAOA 2HS3A 3JASA 1RF0C 1Q7YQ 1NTMG 3BRTB 3MUDC 1R5SA 1FJPA 3L4FA 3MBMA 1KB9E 3L73E 5CJ0A 2HODB 1JO5A 1FSZA 1JTHB 3I56F 5LP6B 3CPWO 3RK3B 3RYHB 3V4DA 4IL6E 1KB9H 1IFJA 4LNUB 4HNAA 5AW9B 1QVFF 1Y9BA 2A45G 3S1KA 1RY3A 5CCHA 4IL6H 1M1JA 4RESB 1OX3A 3CMAF 3H32B 4PJ0E 1SQQK 1ZMEC 2M8RA 2I1KA 3T80A 1OIPA 1ZRTE 3I7TA 4PJ0H 1YJNP 2E76D 3L71J 5KAIE 4UB8E 2HODA 3CCSP 1JTHA 2B33A 5LP6A 4LCKA 4WBAA 3RYHA 1SQBK 1M57D 1L0LJ 4KJMA 2XV5A 5KAIH 4UB8H 5IYZB 4LNUA 1NAFA 1NTZK 2XKMA 2IG8A 1QLED 2H8EA 2L5GB 1K05A 4I7ZB 3H1HE 4EI9A 5LA6B 3H32A 3L74G 1BCCJ 3N4ZA 2GVIA 1AV1A 3H1KG 4L76A 1VF5B 3KXDA 4AQRD 4AYCA 1Z5WA 3W67A 2Y0EA 3J80M 1VQOF 1VQNF 3GF7A 1PPJG 3G9RA 4D6TG 5KLVJ 2WT7B 2C0XA 3CD6P 3AEDC 3L74D 3K5BA 2VGMA 2O3JA 3H1KD 5IYZA 4PV1D 1T0KB 1M90H 1CSBA 1DEEG 2HR3A 1PPJD 4D6TD 1GTWA 1IFDA 3AEFC 3WPXA 2N1TD 1LTIC 5FNVB 1JMMA 2IYOA 3M06A 3PAFA 1OW6A 3N2GB 1W2EA 3MP7B 1E7KA 2JR8A 3IEWA 3RL0D 1HTLC 2YO3A 3LIEA 1VQPF 1YHQP 4BT7A 1S72F 1K73Q 3I55P 2O1KA 3HKCB 2FGYA 3GF3A 3L71E 4EI8A 4B62A 2AIZP 2QJYC 1JJ2F 4G4YA 2K1SA 5FNVA 1GDTA 5AW2B 1W2BF 4BVTA 1T2KD 1L0LE 1ZWZA 4U39A 5CMZA 5IJ0B 3N2GA 1TVKB 1KILE 2KTUA 1NTKK 3WUTA 3V2RA 2UWJE 3SWFA 1J7HA 3Q8HA 2H8PD 2HFED 5APSA 4O4JB 3P4EA 1BCCE 2M0BA 1NH4A 3HKCA 4EB6B 2ZFCA 4M3LA 2XNDH 1VQ8P 3TGUJ 2YXZA 2PRRA 5KLVE 2FY8A 1KQGB 1H7MA 5AW3B 3G4SP 5C39A 2CSLA 5IJ0A 1W3EX 1TVKA 1X52A 3B71A 1PP9G 4JYCA 4O4JA 3CC7P 1L0NK 1FZCB 3NK6A 2YIUB 3KQGA 5JVDB 4EB6A 1KYOI 1KZUB 1ZW0A 5AVUB 2IBZG 2M5AA 4C7NB 4CPGA 1S9KE 2PHNA 3S0HA 3KDPB 1PP9D 4E6EA 3TNUB 4BXLA 3BCCJ 3EWKA 1Q81Q 4U3FG 1JCDA 1RF1C 2NMUA 1UIXA 3PH0A 2IBZD 5G4UC 4O4LB 4X20A 5L8RJ 1JY3O 5CCGC 3JAKB 1YJNF 1TUBB 1RE4C 2KZIA 1FZCA 1EXJA 1EZVG 1W5FA 2RHHA 1FZAA 1HBWA 5JVDA 5EO3A 4U3FD 1URQD 4C7NA 4NUTA 3GHGC 5AVSB 2AXTE 2QEXF 1LT9C 2BEQD 2C9NY 1VQ6P 3TNUA 5B66E 1L2PA 4O4IB 1M1KQ 1ZXGA 1EDLA 1BE3G 1EZVD 3SWKA 3P8CD 1Q86Q 2AXTH 1IPAA 1LTAC 5AVXB 2OTKE 3MTUE 3P8MC 5B66H 3TGUE 1CW5A 4BY9D 3QTYA 2OYOA 1P84D 4O4LA 2FYUK 1YTZT 3H1JG 1S5LE 2E75C 1TUBA 1GW3A 1RE3A 4JPZB 1JM0A 3GW6A 3AGKA 3M9HA 3CD6F 1JOCA
chains in the Genus database with same CATH topology
1YIJF 1L4AD 2N1TC 3C9IA 1XBIA 5APTA 5APQA 3EFGA 2XDJA 3U1AA 1PXWA 1GZ0A 2P2UA 1FZBA 1HVVA 1IK9A 1DT9A 3CPWF 1KC8H 3NVKE 3WMM0 4LGDE 3VP9A 5CCHD 1G1JA 2HYNA 3HD7B 5HXZA 4W7ZA 1VDFA 1QL2A 3RL0C 2W6AA 1IO4A 2FYZA 1QL1A 3SWYA 2CPBA 3LFOA 3HRNA 3N4XA 2KLVA 2Q3IA 1MV8A 2Z5IA 4HH2A 2QA4F 1Q82H 1XTGB 2XZRA 1YYCA 2KG4A 5GAPK 3G71F 3OBYA 1LTBC 4GIFA 5AW6B 4ZKPA 1T3UA 4WY4D 3HD7C 2HPCA 3RK3D 1AFOA 1DEBA 3V5BA 3CXCF 1T2KC 2R5BA 4ZKUA 2KYVA 1JY2N 3B5NB 5AW4B 2Q7CA 2E43A 1VQLF 3HD7A 3LWVC 2F9ZC 2LBWA 3OA7A 2R3CA 2H43A 2GUSA 5DCVA 3J7AR 2Q5UA 5IT9M 1KILC 1NWQA 3VTPC 1K8AH 1JNMA 1VQKF 1NOHA 2W27A 5AW1B 2HLOA 2NPSB 3CCMF 1GO0A 5AW8B 4Y99B 3CCRF 2ZXEB 1SQVK 3O85A 4HYTB 1PFIA 1X7OA 5GANK 3CC4F 2J59M 2R32A 1FAVA 5GINC 1SFCB 3PLAC 3M9BA 1A02F 2JEEA 1WT6A 3WXMB 2OTJF 3B5NA 3HUSB 1LTJB 1LWUB 2WWWA 4I2LC 1VQ8F 1JY2O 3HE5B 1SP4A 2IFMA 2NPSC 3V2PA 3CG6A 5A2QM 2OHWA 3FFMA 4JYBA 4O9BA 1N86A 1N7SB 2I1JA 3M9QA 3M0DC 4C4WC 3H6PA 1CK2A 4BVSA 2NPSA 1T3JA 2OARA 3U59A 3CCSF 4I1LA 1LTJC 1LWUC 3VMXA 1M1KH 3M0DA 3CI9A 3BVHA 5CCGA 3MCAB 3CC7F 3TK1A 1GW4A 1SFCA 2IX7C 1GD2E 3NK7A 2N9BA 1N7SC 5KTBA 4IFDK 1G2CB 1LTSC 3V3TA 1FZFA 1HGVA 1URQB 1J1DB 1LTJA 1LWUA 2N1TB 3HUSA 4KHXA 1FZGA 3V4QA 3HE5A 2VRSA 1KFNA 5APXA 2ALEA 1W40A 1J1EC 1MUUA 2QM7A 1ZN5A 2H7HA 1N7SA 1K9MH 1FU1A 1LTTC 2WPSA 2C0WA 2WTYA 2O01H 2WPRA 4LC1A 4EOTA 2XU6A 3NFQA 1E5WA 3MIWA 1URQC 1J1DC 1N2DC 1SQPK 1SQXK 2JNBA 2FC3A 5AVQB 3E1YA 2BASA 5APWA 4BVRA 1CI6B 1CZQA 2WITA 4AUWA 5EWRA 3SIVA 3JCMM 5KJ7C 4BW0B 4XE5B 1G2CA 5APVA 3ON1A 1URQA 3OW2F 4B86A 1Q7YH 2N1TA 3EQ2A 4I6MC 1AQ5A 1LTGC 2O1JA 4NQ3A 3CCUF 2OYHC 3JAMM 1QVGF 1N7LA 1M1JB 3BATA 1NKNA 3CPQA 1VQ6F 1JY2P 1X7PA 1DX7A 1RF0C 2W6BA 3KPEA 1MZ9A 3BRTB 1RA4A 2QM8A 4WB4A 1NTMK 1FJPA 3BRVB 3CL3D 4GKGA 5AW0B 3N7NA 1YJ9F 1IFNA 1L4AC 1VQMF 3L4FA 1KILB 5HY0A 3NTNA 1MFZA 2J58A 1YHQF 5AW7B 5CJ0A 2MJZA 2HODB 5CHXA 2WPQA 3MUDA 3HAXD 3NVIB 5CCHC 1JO5A 4WY4B 3I55F 1JTHB 2P7JA 3I56F 1CN7A 1M1JC 1CI6A 3T97A 3CCEF 3RK3B 3LW5H 2P1JA 1IFJA 2I6DA 5BVZA 1GU4A 3CCJF 2GM4A 4C7RA 5AW9B 2KTVA 4EI7A 3P7KA 2LKMA 1QVFF 2A45G 1RY3A 1GK4A 5CCHA 1M1JA 3B5ND 3LWPC 4RESB 3CMAF 3TYYA 3H32B 2WSFH 1ZR4A 5CJ4A 1SQQK 3V7QA 4WY4C 2M8RA 3VOPA 2I1KA 4XCQA 2C9LY 3RK3C 1GL2D 5AVYB 1KILA 4N6JA 3G3ZA 3VYIA 2A45H 1YITF 1GZLA 2GLZA 2HODA 1FZEA 2CZWA 3HTKB 4WY4A 1JTHA 4LCKA 1OWAA 4WBAA 1SQBK 3OJAB 4N78E 2FKWB 2XV5A 2VGNA 1KQSF 1NJIH 3SIUA 5CCGD 5AVRB 1NAFA 1NTZK 2XKMA 4EIJA 1VQ9F 1SFCD 1XTCC 3G4SF 2L5GB 1T8ZA 3KYQA 4W7YA 1JUNA 5HY4A 4EI9A 3H32A 3N4ZA 3CCLF 1G1IA 1J1EB 4W80A 3J81M 3B8EB 4AYCA 4AQRD 4BVQA 1NU1K 2OYIB 3LWQC 3L35A 3A7OA 3J80M 2IPPA 1VQOF 3BASA 1VQNF 5HWEA 1DH3A 1FBMA 2WT7B 2C0XA 1FOSF 5APYA 2LBXA 3HTKA 3P32A 2Z4EA 2FXMA 4TZZA 3L36A 1M7LA 4DZOA 2VGMA 1YTZI 1RLGA 5BU5A 1IFIA 3A3YB 1HWTC 3RK2D 1T0KB 5HY1A 1CSBA 1M90H 2OYIC 1GTWA 2WSEH 1IFDA 2N1TD 1LTIC 3NMDA 1JMMA 3VN0A 2GUVA 2OYHB 3LWOC 1X79B 2Q9IA 3M06A 1IJDB 3PAFA 2YNYA 3L37A 2YO2A 3A5TA 1W2EA 2A45I 1HUCA 1KFMA 1X9VA 5AVZB 2FFDC 2OYIA 2OTLF 3CLQA 1E7KA 1K73H 1VPCA 5AVTB 2KP8A 3D00A 1J2JB 3RL0D 1HTLC 2YO3A 1L4AB 5GIOC 5GIPC 3LIEA 1VQPF 1HH0A 2M3BA 1S72F 3VMZA 5HXUA 5AVVB 2O1KA 4LLHA 2FGYA 5KJ7A 2OZBA 3HD7D 4EI8A 1L0LK 1JJ2F 3IR9A 3LWRC 1GDTA 5AW2B 2OYHA 5BU8B 4IFFA 1W2BF 4BVTA 1T2KD 1H89A 1ZWZA 4N3YB 5CMZA 3UIAA 1RF0A 3M0AA 3RA5A 1SVFA 2KTUA 1NTKK 2KSJA 1ZR2A 1VQ7F 3V2RA 3TSIA 3SWFA 2YMYA 2YKPA 3IFMA 3VMFB 1L4AA 1VQ4F 2H8PD 2HFED 5APSA 1KILD 5APUA 1FOSE 4OH8B 3OBWA 2R5DA 2WZ7A 1HJBA 1NH4A 2QI2A 5KLVK 1JY3P 2ZFCA 4M3LA 4X3MA 3MD0A 1ZV8A 1HGZA 1YI2F 1KQLA 1N73B 3OAKA 1H7MA 2AIFA 5AW3B 2PP6A 2P67A 3HE4B 1W3EX 1X52A 3RA6A 2NPSD 3E1IA 1GL2B 4GT1A 1JY3N 2WALA 1IFMA 4C46A 3CCVF 3NXSA 4JYCA 1H88A 3V2QA 1LGHB 1L0NK 1A02J 1X8YA 1N73C 1FZCB 1EQ7A 1FDMA 2HVYD 1RF1B 3NK6A 3KQGA 4XA4A 3B5NC 1OXZA 1GO1A 1ZLLA 1KZUB 5AVUB 4N78D 1SLQA 4C7NB 1S9KE 1Q81H 3V2NA 3KDPB 5FJ4C 1N73A 1GL2C 2IFNA 2KOGA 5AVWB 3TNUB 5FLXM 2BO1A 2YKOA 5G4VC 1W42A 1GK6A 1N7SD 1S9KD 2WSCH 2POHA 2CPSA 1NKZB 2E42A 3HE4A 1IC2A 1FZCC 3N4YA 1JCDA 1RF1C 1NHLA 3GHGB 4Y99C 3NMUC 4DOJA 1LT9B 5G4UC 1FJKA 1GL2A 1KD1H 2PAJA 3MGNA 2JJLA 3HJWC 1JY3O 5CCGC 2KB7P 1YJNF 2FFDB 1NMUB 4X3LA 4IFMA 3V7EA 1SFCC 3U1CA 1RE4C 2Z5HA 1FZCA 3R2PA 1RF1A 3CC2F 1FZAA 3HUSC 1HBWA 1N8RH 5EO3A 1JCCA 3II6A 3M91A 4JF7A 3CCQF 1URQD 1Z56A 4C7NA 3VP8A 4NUTA 3I5CA 1Q86H 3GHGC 5AVSB 2HG5D 3P8CE 2QEXF 1RE4A 1LT9C 3RK2B 2C9NY 3GYQA 3TNUA 3O8ZA 3E20B 1VQ5F 5KJ7D 3V4WA 1RE3C 1GU5A 3A2AA 1WRGA 3P8CD 1H8AA 1YJWF 1IPAA 1LTAC 5AVXB 3CMEF 3VMYA 3GHGA 2WT7A 3MTUE 3LIDA 3P8MC 1CW5A 3VI6A 1LT9A 4BY9D 5AW5B 2FYUK 1SDSA 1YTZT 3G6EF 5HY2A 2FFDA 3RL0B 1GW3A 1RE3A 3RK2C 2YKQA 3PP5A 1NO4A 2XNXA 1W41A 3AGKA 3M9HA 3CD6F 2HPCB 1JOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ F;  1XBI A;  5APT A;  5APQ A;  1PXW A;  1GZ0 A;  2P2U A;  1DT9 A;  3CPW F;  1KC8 H;  3NVK E;  2W6A A;  1IO4 A;  3LFO A;  2Q3I A;  1MV8 A;  2Z5I A;  2QA4 F;  1Q82 H;  2XZR A;  1YYC A;  2KG4 A;  5GAP K;  3G71 F;  3OBY A;  5AW6 B;  3V5B A;  3CXC F;  1T2K C;  2R5B A;  2Q7C A;  5AW4 B;  2E43 A;  1VQL F;  3LWV C;  2LBW A;  2R3C A;  5DCV A;  3J7A R;  2Q5U A;  5IT9 M;  1NWQ A;  3VTP C;  1K8A H;  1JNM A;  1VQK F;  2W27 A;  5AW1 B;  3CCM F;  1GO0 A;  5AW8 B;  3CCR F;  2ZXE B;  3O85 A;  4HYT B;  1X7O A;  5GAN K;  3CC4 F;  2R32 A;  1FAV A;  5GIN C;  3PLA C;  3M9B A;  1A02 F;  3WXM B;  2OTJ F;  4I2L C;  2WWW A;  1VQ8 F;  3HE5 B;  1SP4 A;  3CG6 A;  5A2Q M;  2OHW A;  3FFM A;  4JYB A;  4C4W C;  1CK2 A;  3CCS F;  3VMX A;  1M1K H;  3M0D A;  3MCA B;  3CC7 F;  3TK1 A;  1GD2 E;  3NK7 A;  2N9B A;  1G2C B;  4KHX A;  3V4Q A;  3HE5 A;  2VRS A;  2ALE A;  5APX A;  1W40 A;  1MUU A;  2QM7 A;  2H7H A;  1K9M H;  2WPS A;  2WTY A;  2WPR A;  4LC1 A;  4EOT A;  2XU6 A;  3NFQ A;  2JNB A;  2FC3 A;  5AVQ B;  3E1Y A;  2BAS A;  5APW A;  1CI6 B;  1CZQ A;  4AUW A;  5EWR A;  3SIV A;  3JCM M;  4BW0 B;  4XE5 B;  5APV A;  3ON1 A;  3OW2 F;  4B86 A;  1Q7Y H;  3CCU F;  4I6M C;  3JAM M;  1QVG F;  3CPQ A;  1VQ6 F;  1X7P A;  1RA4 A;  2QM8 A;  4GKG A;  5AW0 B;  1YJ9 F;  1VQM F;  3NTN A;  1MFZ A;  1YHQ F;  5AW7 B;  2WPQ A;  3HAX D;  3NVI B;  1CN7 A;  3I55 F;  3I56 F;  2P7J A;  1CI6 A;  3T97 A;  3CCE F;  2I6D A;  3CCJ F;  1GU4 A;  5AW9 B;  2KTV A;  3P7K A;  1QVF F;  1GK4 A;  3LWP C;  4RES B;  3CMA F;  3TYY A;  3V7Q A;  2C9L Y;  5AVY B;  3VYI A;  1YIT F;  1GZL A;  2CZW A;  4LCK A;  1OWA A;  2VGN A;  2XV5 A;  1KQS F;  1NJI H;  3SIU A;  5AVR B;  1NAF A;  1VQ9 F;  3G4S F;  1JUN A;  3N4Z A;  3CCL F;  3B8E B;  4AYC A;  4AQR D;  3LWQ C;  3L35 A;  3A7O A;  3J80 M;  2IPP A;  1VQO F;  1VQN F;  1DH3 A;  2WT7 B;  1FOS F;  5APY A;  2LBX A;  3HTK A;  3P32 A;  4TZZ A;  3L36 A;  4DZO A;  2VGM A;  1RLG A;  3A3Y B;  1HWT C;  1T0K B;  1M90 H;  1CSB A;  1GTW A;  3NMD A;  3VN0 A;  3LWO C;  3M06 A;  3PAF A;  2YNY A;  3L37 A;  2YO2 A;  3A5T A;  1HUC A;  5AVZ B;  2OTL F;  1E7K A;  1K73 H;  5AVT B;  2KP8 A;  1J2J B;  2YO3 A;  5GIO C;  5GIP C;  3LIE A;  1VQP F;  1S72 F;  3VMZ A;  5AVV B;  2OZB A;  1JJ2 F;  3IR9 A;  3LWR C;  5AW2 B;  1W2B F;  1T2K D;  1H89 A;  1ZWZ A;  5CMZ A;  3UIA A;  3M0A A;  3RA5 A;  2KTU A;  1VQ7 F;  3SWF A;  3VMF B;  1VQ4 F;  5APS A;  5APU A;  1FOS E;  3OBW A;  2R5D A;  1HJB A;  2QI2 A;  2ZFC A;  4M3L A;  4X3M A;  3MD0 A;  1YI2 F;  1KQL A;  3OAK A;  1H7M A;  2AIF A;  5AW3 B;  2P67 A;  3HE4 B;  1W3E X;  1X52 A;  3RA6 A;  4GT1 A;  2WAL A;  4C46 A;  3CCV F;  3NXS A;  4JYC A;  1H88 A;  1A02 J;  1X8Y A;  2HVY D;  3NK6 A;  3KQG A;  1GO1 A;  1OXZ A;  5AVU B;  1SLQ A;  4C7N B;  1S9K E;  1Q81 H;  3KDP B;  5FJ4 C;  5AVW B;  3TNU B;  5FLX M;  2BO1 A;  5G4V C;  1W42 A;  1GK6 A;  1S9K D;  2E42 A;  3HE4 A;  3N4Y A;  3NMU C;  5G4U C;  1KD1 H;  3MGN A;  2JJL A;  3HJW C;  1YJN F;  1NMU B;  4X3L A;  3V7E A;  2Z5H A;  3CC2 F;  1HBW A;  1N8R H;  5EO3 A;  3M91 A;  3CCQ F;  4C7N A;  4NUT A;  3I5C A;  1Q86 H;  5AVS B;  2QEX F;  2C9N Y;  3GYQ A;  3TNU A;  3O8Z A;  3E20 B;  1VQ5 F;  3V4W A;  1GU5 A;  3A2A A;  1H8A A;  1YJW F;  1IPA A;  5AVX B;  3CME F;  3VMY A;  2WT7 A;  3P8M C;  3LID A;  3VI6 A;  4BY9 D;  5AW5 B;  1SDS A;  3G6E F;  1W41 A;  3AGK A;  3M9H A;  3CD6 F;  3J81 M; 
#chains in the Genus database with same CATH topology
 1PGP A;  1FFX B;  1S5L H;  1KQF B;  2XDJ A;  3U1A A;  2P2U A;  1HVV A;  3CPW F;  3NVK E;  3L70 J;  4OGQ D;  3H1J D;  5CCH D;  3HD7 B;  1BSN A;  4W7Z A;  1IO4 A;  1QL1 A;  3SWY A;  2CPB A;  2KI7 B;  3LYB A;  2Q3I A;  1MV8 A;  2Z5I A;  3JAR A;  4HH2 A;  1Q82 H;  1OVR A;  3F0G A;  2KG4 A;  5GAP K;  3BCC E;  1LTB C;  4ZKP A;  3AEC C;  1XV2 A;  2VAW A;  1EDK A;  3QWO C;  3RK3 D;  1AA0 A;  1FFX A;  2VXY A;  1AFO A;  4WWI A;  2RKL A;  4ZKU A;  5KAF E;  3H1I J;  4NPE A;  2KGW A;  3HD7 A;  3LWV C;  4TV8 B;  4C81 A;  2NRG A;  2R3C A;  5KAF H;  1RH5 B;  3J7A R;  1KIL C;  1SQX J;  3CX5 E;  1IV4 A;  2ZXX A;  1JNM A;  2HLO A;  2NPS B;  3ZP7 A;  4X1I B;  2FXP A;  1SQV G;  2DYY A;  3CCR F;  2VAM A;  3CX5 H;  3O85 A;  5GAN K;  1PFI A;  3CWB G;  3D70 A;  2UYK A;  5GIN C;  3L75 D;  2BTQ B;  4R4L A;  3PLA C;  1A02 F;  5JCO C;  2RMZ A;  2N9Y B;  1SQV D;  1VQ8 F;  3HE5 B;  5A2Q M;  4TV8 A;  3FFM A;  5C8Y B;  4JQ0 D;  2KK7 A;  3CXH I;  1N7S B;  2CHT A;  1QD9 A;  1VF5 D;  2OTL P;  1NJI Q;  3H6P A;  4RJT A;  2NPS A;  3FXE A;  3VTI C;  3L70 E;  2LXB A;  4X1I A;  4I1L A;  1LWU C;  1EC5 A;  2HP3 A;  2OQQ A;  3VYS C;  1M1K H;  1RLU A;  3CC7 F;  3TK1 A;  1GW4 A;  4PV1 B;  2R44 A;  3NK7 A;  3VOB A;  4YXD C;  1QU9 A;  2V9Y A;  4G4Z A;  3K12 A;  1CLI A;  2N1T B;  1FZG A;  1PPJ E;  3HE5 A;  1KFN A;  2YXQ B;  1H47 A;  2ZYD A;  4PD4 D;  2ZVY A;  3W68 A;  3SSU A;  1DBF A;  5C8Y A;  1N7S A;  3RBZ A;  1QGK B;  1X0T A;  2WTY A;  3H1I E;  1SQP G;  2I6R A;  1J1D C;  1U40 A;  1K04 A;  2WSC J;  2BAS A;  1SQX E;  2R6R 1;  3JCM M;  5KJ7 C;  1USD A;  4I50 B;  4G4V A;  3ABV C;  2N1T A;  4I6M C;  2ZYA A;  1SQP D;  2UZH A;  5DJT B;  3CPQ A;  1VQ6 F;  1NU1 J;  3SFD C;  3JC2 2;  4KWE A;  1MZ9 A;  3AE1 C;  4BT4 A;  4UB6 E;  4H0L C;  2WSE J;  1L4A C;  3NTN A;  4ZI7 B;  5AW7 B;  2ZJS E;  4UB6 H;  3MQW A;  1UII A;  3MUD A;  2P7J A;  3T97 A;  3LW5 H;  4I50 A;  3Q2Y A;  5BVZ A;  1GU4 A;  5EZY B;  3Q1M A;  4EI7 A;  2OTJ P;  1YQ3 C;  3FXD A;  4G4W A;  3LWP C;  1SQQ G;  4RQO A;  5GTI E;  3B6N A;  4XCQ A;  2YMK A;  2C9L Y;  4N6J A;  3FD5 A;  3SFE C;  5EIB C;  4ZI7 A;  1YIT F;  5GTI H;  1GZL A;  4H13 C;  1LJ2 A;  2JWA A;  1W5B A;  4I55 B;  3HTK B;  1SQQ D;  1SQB G;  3ERN A;  3OJA B;  3PLN A;  4Z1M H;  3VCZ A;  1NTZ G;  1NJI H;  3KIZ A;  2IQQ A;  1SFC D;  3FGA D;  3C8L A;  1FNJ A;  3HTN A;  3WGK A;  1YJW P;  1SQB D;  3CCL F;  1OW7 A;  1NTZ D;  1PV3 A;  3B8E B;  1FE6 A;  1S1C X;  1JY8 A;  3A7O A;  2ZVZ A;  3LME A;  1NU1 E;  1KB9 I;  4I55 A;  3HTK A;  3P32 A;  1M7L A;  5J2T B;  4DZO A;  1YTZ I;  1PF5 A;  3JAW B;  5BU5 A;  3U0O A;  2W6J H;  1HWT C;  2A06 G;  2OYI C;  2WSE H;  2OYH B;  2IAF A;  4EI2 A;  3QUW A;  1KTM A;  2Q9I A;  4ZHV A;  2P58 A;  3L75 J;  1VQV A;  3F5H A;  1M90 Q;  3A5T A;  1P84 E;  1KFM A;  5AVZ B;  2OTL F;  2QTP A;  2QJY B;  1VPC A;  2A06 D;  4TV9 B;  4BT3 A;  1AJY A;  1H0T B;  2G8Y A;  3GTZ A;  4ASW A;  5J2T A;  3VMZ A;  3EFF K;  5AVV B;  3JAW A;  1YGY A;  1KYO D;  3HD7 D;  3C1L A;  1L0L K;  2HQS C;  4HB1 A;  2OYH A;  4IFF A;  2PMP A;  1NTK G;  3A0B E;  1SVF A;  4R4M A;  1ZR2 A;  3TSI A;  3F6M A;  2YMY A;  2YKP A;  2CHS A;  1NTM D;  4TV9 A;  1BGY J;  4L75 A;  2L26 A;  3A0B H;  1H0T A;  1FOS E;  3OW2 O;  2R5D A;  5KLV K;  5EFW B;  3MD0 A;  1PIX A;  1ZV8 A;  1HGZ A;  2V7Q J;  2AIF A;  2V4H A;  2G3A A;  4ZHY B;  3HE4 B;  1W5C E;  2NPS D;  1FC2 C;  3K0T A;  4U3J B;  4GT1 A;  1JY3 N;  2WAL A;  1IFM A;  4C46 A;  2JP3 A;  3TD5 A;  1L0N G;  3V2Q A;  1USE A;  1EQ7 A;  3GMA A;  1RF1 B;  3L75 E;  3L72 G;  4XA4 A;  1GO1 A;  3B5N C;  1OXZ A;  1PGO A;  3C8V A;  4H44 C;  2ZT9 D;  1SLQ A;  2RH0 A;  1AVY A;  1L0N D;  1GL2 C;  2IFN A;  3S4R A;  1T6A A;  2BO1 A;  2WPV B;  3K2X A;  5G4V C;  1W42 A;  1N7S D;  4GOD A;  5KKZ C;  3AE6 C;  2CPS A;  3L72 D;  3HE4 A;  1IC2 A;  3N4Y A;  3GHG B;  1RHZ B;  4DOJ A;  1LT9 B;  4U3J A;  5HP7 A;  1FJK A;  1KD1 H;  4YJ2 B;  2PAJ A;  3MGN A;  2JJL A;  2FFD B;  1KQS O;  3IKF A;  2QG4 A;  4I4T B;  4X1Y B;  3R2P A;  1RF1 A;  1IZN B;  3CC2 F;  4YXW H;  3HUS C;  2AXC A;  1N8R H;  1JCC A;  3II6 A;  1Q8R A;  5BMV B;  2E75 B;  3VP8 A;  5LA6 A;  3VO8 A;  1BGY E;  4PD4 E;  1RE4 A;  5KMG B;  3O8Z A;  2GZL A;  1SA0 B;  2VAP A;  3AE9 C;  4PD4 H;  1YJW F;  1YJ9 P;  2KLU A;  1VQM P;  2WT7 A;  3VMY A;  2FYU G;  3GHG A;  3LID A;  3VI6 A;  1LT9 A;  4YJ2 A;  1SDS A;  5MN4 A;  4OWF A;  3G6E F;  2FFD A;  2Q1Y A;  2LBT A;  3RK2 C;  2YKQ A;  1W41 A;  4I4T A;  4X1Y A;  1U3L A;  1VQ4 P;  2V7Q H;  5BMV A;  2QJK C;  5APQ A;  2FYU D;  1PXW A;  1GZ0 A;  1FZB A;  1IK9 A;  1DT9 A;  3UT5 B;  5KMG A;  3RL0 g;  1SA0 A;  2W6A A;  2FYZ A;  5K5G B;  4GOF A;  3N4X A;  1OMI A;  3CXH D;  2XZR A;  1YYC A;  2LCA A;  5LYJ B;  2ITA A;  1ZOY C;  4RHA A;  3CCV P;  3AE7 C;  2O01 J;  1Q82 Q;  2MQE A;  1DEB A;  3V5B A;  4G88 A;  3VYU C;  2R5B A;  1KNK A;  2KYV A;  5AW4 B;  2E43 A;  3UT5 A;  3S03 A;  3P10 A;  2KXP B;  2W83 C;  2H43 A;  2H6L A;  3VMA A;  2Z1U A;  2Q5U A;  1ONI A;  1K8A H;  2BCC J;  1BSH A;  3OON A;  4IHJ B;  4Y99 B;  5LYJ A;  4HYT B;  1X7O A;  5IJ9 B;  2J59 M;  4R40 B;  1GX1 A;  1M56 D;  3ZO8 A;  1SFC B;  3M9B A;  3WGN A;  2HS0 A;  2JEE A;  3WXM B;  1HJ0 A;  1LWU B;  1W58 1;  1JY2 O;  3ITK A;  1NTM J;  3V2P A;  2ZF8 A;  4O9B A;  5JCO A;  4XFJ A;  3F0F A;  3AE2 C;  3M9Q A;  3M0D C;  4C4W C;  2Y9Z A;  1CK2 A;  2OAR A;  1Q90 D;  4IHJ A;  2WSF J;  3S0W A;  3CCS F;  1LTJ C;  4F6R B;  2Z01 A;  3KHN A;  5IJ9 A;  3CI9 A;  3BVH A;  3MCA B;  1COM A;  1SFC A;  2IX7 C;  1GD2 E;  4ERH A;  4IFD K;  1G2C B;  3V3T A;  1YIJ P;  1J1D B;  1LWU A;  3WJQ A;  4KHX A;  5APX A;  1MUU A;  2QM7 A;  5E79 E;  3H1L G;  2KSE A;  2H7H A;  1K9M H;  1FU1 A;  2M3E A;  3JAK A;  3N2K B;  5E79 H;  3CX5 I;  2IYP A;  2O01 H;  2WPR A;  2RB9 A;  2XU6 A;  3NFQ A;  5TJH A;  1BE3 D;  4YJ3 B;  4F6R A;  1SQX K;  3AE3 C;  4DRX B;  3H1L D;  5AVQ B;  5AVM A;  5APW A;  4BVR A;  1CI6 B;  4H0L B;  4AUW A;  3ESJ A;  2BCC E;  1G2C A;  5APV A;  3MCQ A;  3ON1 A;  4O4I A;  1BDC A;  2D2C C;  3OW2 F;  1LTG C;  3I3F A;  3L74 J;  3D6Y A;  3H1K J;  1QEX A;  1JY2 P;  2ZAU A;  1X7P A;  3WGJ A;  2QM8 A;  3L73 G;  3N2K A;  4D6T J;  3CL3 D;  5AW0 B;  3N7N A;  1KN7 A;  1YJ9 F;  1IFN A;  1VQM F;  5HY0 A;  1NQ3 A;  1NTM E;  3R4Y A;  4YJ3 A;  1YHQ F;  4DRX A;  2MJZ A;  2WPQ A;  3HAX D;  3NVI B;  3I55 F;  2QJP B;  1CI6 A;  1KB9 D;  3L73 D;  2G9I A;  1DD4 A;  2GM4 A;  3Q5S A;  4H13 B;  3WJP A;  2KTV A;  1UFY A;  3RBX A;  2R75 1;  2WSF H;  1FNK A;  1ZR4 A;  3K14 A;  1SS1 A;  2JKV A;  3V7Q A;  2Q1X A;  4WY4 C;  2LXC B;  2KS1 B;  5GTH E;  1KV4 A;  5DJU B;  3MDO A;  3JSV C;  3G3Z A;  3C9S A;  5CA0 B;  4KT0 J;  2A45 H;  4IIJ B;  2OGU A;  2GLZ A;  1NGM B;  1FZE A;  3AEG C;  2ZT9 B;  1ZRT D;  1OWA A;  4RO0 A;  1YQN A;  3R0P A;  2VGN A;  2FKW B;  1KQS F;  3SIU A;  1Z5V A;  3H1H G;  5AVR B;  5CCG D;  4EIJ A;  3CWB D;  3G4S F;  4O2A B;  2L91 A;  3RYC B;  1T8Z A;  1VK3 A;  1JMB A;  1W5A A;  1J1E B;  2FYN B;  4PWT A;  2KS1 A;  3RE3 A;  4BVQ A;  3H1H D;  1NU1 K;  2OYI B;  3L74 E;  3L35 A;  3TD4 A;  2IPP A;  5CA0 A;  5HWE A;  3H1K E;  4IIJ A;  1FOS F;  4WBN B;  1JEK A;  1OZH A;  2MKV A;  3L36 A;  1RQ2 A;  2Y0C A;  4D6T E;  2RHL A;  1RLG A;  4IL6 X;  1JFF B;  2E75 D;  1IFI A;  1NYH A;  4O2A A;  5HY1 A;  3RYC A;  2E74 C;  4BT2 A;  3DC2 A;  2BEZ F;  2RHO A;  2GUV A;  3LWO C;  4TUY B;  1AVO A;  2YNY A;  3L37 A;  1PP9 J;  5MN5 A;  3IF4 A;  5KLI C;  1HUC A;  2QA4 P;  2OYI A;  3G71 P;  1LP1 B;  5GIO C;  3M84 A;  4WBN A;  1VH8 A;  1HH0 A;  3H25 A;  3L71 G;  3GLM A;  5HXU A;  3I56 P;  1JFF A;  4LLH A;  2SPZ A;  1L0L G;  3CB2 A;  1IV2 A;  1OFU A;  2OZB A;  1PL5 A;  1R8E A;  4U3F J;  3IR9 A;  3LWR C;  5EYP B;  4TUY A;  1VQK P;  3L71 D;  4N3Y B;  2Z1F A;  2YXR B;  3UIA A;  1OVV A;  1RF0 A;  3M0A A;  3RA5 A;  1BCC G;  1S2E A;  1LP1 A;  5LOV B;  2NZ2 A;  3CC4 P;  1KIL D;  3WJR A;  4NWO B;  1X25 A;  3OBW A;  1U7J A;  3WUU A;  5KLV G;  2Z1E A;  1QVG O;  2QI2 A;  3QHD A;  1BCC D;  2DW3 A;  1BE3 J;  4DJG A;  5CB4 B;  1VL2 A;  5EYP A;  3KE1 A;  4H44 B;  4OVN F;  5KLV D;  2P67 A;  4ZHW A;  2B9B A;  3H1J J;  1FDI A;  1U3P A;  3D71 A;  2P6Y A;  3E1I A;  3P0Z A;  3RA6 A;  4ZK7 A;  1GL2 B;  1P84 I;  2IZ1 A;  3LDT A;  5LOV A;  1FDO A;  5KKZ B;  1H88 A;  1LGH B;  1VQN P;  3AEB C;  1A02 J;  1X8Y A;  1N73 C;  1FDM A;  5EAZ A;  1PP9 E;  5EZY A;  1LNQ A;  1EXI A;  1FS0 E;  4C8G A;  4N78 D;  4BRY B;  3V2N A;  5FJ4 C;  2KOG A;  3FD6 A;  5FLX M;  5GON B;  5CB4 A;  2IBZ E;  2E76 C;  1GK6 A;  4GOE A;  1S9K D;  2WSC H;  3RGU A;  1X22 A;  3E22 B;  1NHL A;  3VYT C;  3NMU C;  1GL2 A;  1IK7 A;  2BTO A;  1R5L A;  3MHV A;  4U3F E;  2KB7 P;  1NMU B;  3ZDM A;  2AEJ A;  4X3L A;  4IFM A;  2H88 C;  3B4S A;  2Z1T A;  1KD1 Q;  2HRY A;  3M91 A;  3C9T A;  1JB0 J;  4ZNC A;  1S72 P;  1Z56 A;  1EZV E;  2Q3E A;  2HG5 D;  3P8C E;  3RK2 B;  5M1B A;  3GYQ A;  5GON A;  1N8R Q;  2E5Y A;  2K1A A;  3TGU G;  3WGL A;  3E20 B;  5KJ7 D;  2QJK B;  3E22 A;  1GU5 A;  3A2A A;  1HF9 A;  1SQV J;  2E5T A;  2UYN B;  1P84 H;  2YYE A;  3C9U A;  1BE3 E;  3CWB J;  4YPC A;  3AE8 C;  4PV1 C;  3TGU D;  4A7P A;  3CCE P;  2HPC B;  4H0L D;  3J81 M;  4B46 A;  3H1J E;  1L4A D;  2N1T C;  3C9I A;  3GG2 A;  3CCJ P;  3TF5 A;  3WMM 0;  4LGD E;  3VP9 A;  1XRG A;  1G1J A;  4TT3 H;  3F89 A;  5HXZ A;  1S3J A;  1KMI Z;  1VDF A;  1QL2 A;  3RL0 C;  2Y9Y A;  1Q2N A;  3BCC G;  2UYN A;  3EOR A;  2QA4 F;  3RK3 E;  3G71 F;  2WMM A;  3OBY A;  2QSI A;  3WGM A;  4GIF A;  1NTK D;  4O4H B;  2DT4 A;  1T3U A;  4FFB B;  1U43 A;  2HPC A;  5MN6 A;  3BCC D;  1T2K C;  5EIB D;  3CXC F;  1VQ9 P;  4H13 D;  2Q7C A;  1JY2 N;  3ELC A;  2AMT A;  4PD4 I;  3USS A;  3JAL B;  2GUS A;  4ZOL B;  4BT5 A;  1VHA A;  5IT9 M;  1SQP J;  1NWQ A;  2UYP A;  1VQK F;  1NOH A;  3M1X A;  1JD1 A;  1W5E A;  1GO0 A;  3CX5 D;  4G4X A;  2ZVN B;  1LT1 A;  1S5L X;  4O4H A;  3KJJ A;  1K8A Q;  1JN1 A;  4FFB A;  3CC4 F;  3PRJ A;  3Q5R A;  1SQV E;  2B89 A;  1FAV A;  1OVU A;  2Q6Q A;  1NVO A;  5EB1 B;  3CWB E;  2OTJ F;  4I2L C;  1LTJ B;  1XHO A;  5ITZ B;  2ZVO B;  3E1R A;  2QEX P;  3JAL A;  1RQV A;  2AEF A;  1E79 H;  4ZOL A;  3L70 G;  2I1J A;  2H8C A;  3VIU A;  2JWD A;  3A0H E;  1S4X A;  2K88 A;  4BVS A;  3C9R A;  3GHZ A;  4DCK A;  3A0H H;  3M0D A;  5CCG A;  3L70 D;  2CW4 A;  2N9B A;  5KTB A;  1FZF A;  2KIK A;  1LTJ A;  1SQQ J;  1TU3 F;  3V4Q A;  2ALE A;  2K37 A;  5ITZ A;  3H1I G;  2KZJ A;  2HP0 B;  5J2U B;  2RHJ A;  1LTT C;  1W55 A;  2D2C B;  5CBO A;  3AEA C;  1VQ7 P;  5JQG B;  4K35 A;  1IV3 A;  4EOT A;  4LC1 A;  1SQB J;  1SQX G;  1MKM A;  3MIW A;  2P10 A;  1URQ C;  2B87 B;  1K9M Q;  1N2D C;  1KOR A;  2JNB A;  1NTZ J;  2FC3 A;  4NPF X;  4X1K B;  3WUV A;  1Y8A A;  3H1I D;  1SQP E;  2WIT A;  1T0A A;  3SIV A;  4XE5 B;  3HKD B;  1YI2 P;  4YTP C;  4RKU J;  4NQ3 A;  1Q7Y H;  2O1J A;  3TD3 A;  2OYH C;  3JAM M;  1SQX D;  2ZAE B;  1QVG F;  5JH7 B;  3PHL A;  3BAT A;  1NKN A;  1W57 A;  1DX7 A;  2W6B A;  3F0D A;  3KPE A;  2HP0 A;  5J2U A;  1RA4 A;  4WB4 A;  2CVL A;  1NTM K;  3BRV B;  5JQG A;  4GKG A;  1KIL B;  1MFZ A;  2J58 A;  2B87 A;  3S0Y A;  4HKZ H;  5CHX A;  3KZI E;  3WPW A;  4OGQ C;  4X1K A;  3CCR P;  5CCH C;  1CN7 A;  4WY4 B;  1M1J C;  3CCE F;  2O01 N;  3BYQ A;  2P1J A;  5EB0 A;  3HKD A;  3KZI H;  2I6D A;  3CCJ F;  5H2F E;  4C7R A;  3P7K A;  2LKM A;  1GK4 A;  2EWC A;  5JH7 A;  3Q5P A;  2HRU A;  3B5N D;  2M5A B;  3JCU E;  1EDJ A;  1M8O B;  4H44 D;  3TYY A;  5H2F H;  5CJ4 A;  4K3A A;  2HS4 A;  3VOP A;  5LP6 C;  2CK3 H;  4ZMD A;  3RK3 C;  1SQQ E;  1GL2 D;  3JCU H;  5AVY B;  1KIL A;  3VYI A;  2K3R A;  2CZW A;  4X20 B;  4WY4 A;  5KX5 B;  3CCQ P;  4N78 E;  1SQB E;  1QX8 A;  1VQ9 F;  1XTC C;  2QIW A;  1NTZ E;  4WVZ A;  1VQ5 P;  5HP8 A;  3KYQ A;  4W7Y A;  1NTK J;  1JUN A;  5HY4 A;  2R3S A;  3CME P;  1G1I A;  2FXO A;  4NPD A;  1NU1 G;  4W80 A;  3LWQ C;  2KNC B;  2E74 B;  3AE5 C;  1OAP A;  3BAS A;  1DH3 A;  1FBM A;  3TDK A;  5APY A;  2LBX A;  1PZQ A;  2Z4E A;  2FXM A;  4I7Z C;  3JAT B;  5KX5 A;  4TZZ A;  5KLI B;  3RYI B;  1D7M A;  1NU1 D;  2OTM A;  5CA1 B;  5B5E E;  1VF5 C;  3A3Y B;  3RK2 D;  2FBW C;  2QE7 H;  3IKE A;  3NMD A;  1ODE A;  3VN0 A;  1X79 B;  4ASV A;  5B5E H;  2A06 E;  1IJD B;  2YO2 A;  1L0N J;  2A45 I;  1X9V A;  2FFD C;  3CLQ A;  2KNC A;  1K73 H;  5AVT B;  2KP8 A;  3D00 A;  3KHU A;  3ZOP A;  1J2J B;  3L72 J;  5CBN A;  1L4A B;  5GIP C;  3JAR B;  3DDN A;  2JO1 A;  3JAT A;  2M3B A;  3L7Q A;  1KYO E;  3RYI A;  1BDD A;  5CA1 A;  1VQL P;  5KJ7 A;  1MFT A;  1KYO H;  3O6Q B;  5BU8 B;  3FX0 A;  1ZP0 C;  2JDI H;  3PJS K;  1H89 A;  1U7M A;  3CCM P;  2KSJ A;  1VQ7 F;  2UYJ A;  1KC8 Q;  3IFM A;  1NTK E;  4B5C A;  3VMF B;  1L4A A;  1VQ4 F;  3AEE C;  5APU A;  3D6Z A;  4OH8 B;  1YIT P;  2H89 C;  2WZ7 A;  1HJB A;  1JY3 P;  3S06 A;  4X3M A;  3VOA A;  4MN4 C;  3JVH A;  4QMA A;  1YI2 F;  1KQL A;  1N73 B;  3OAK A;  3O6Q A;  3HKB B;  2FYU J;  3M4S A;  2PP6 A;  2KUB A;  3IEQ A;  4B45 A;  2LR2 A;  3CCL P;  5GTH H;  1U57 A;  4L73 A;  3L75 G;  3CCV F;  2E76 B;  3NXS A;  2J5U A;  2HVY D;  3S02 A;  1L0N E;  1QVF O;  2B88 A;  1ZLL A;  1AQT A;  1PGJ A;  1Q81 H;  3L72 E;  1N73 A;  5AVW B;  3HKB A;  2YKO A;  3HWU A;  2POH A;  3E7K A;  1UI9 A;  1NKZ B;  2E42 A;  1FZC C;  3LW5 J;  4Y99 C;  2YIU C;  2ZYG A;  3FWL A;  3HJW C;  5B8F A;  3V7E A;  1SFC C;  3U1C A;  2Z5H A;  3FWN A;  1SZQ A;  3FPI A;  1BGY G;  3D54 A;  4C82 A;  4JF7 A;  3CCU P;  3CCQ F;  3PTZ A;  2HX0 A;  3I5C A;  1GMJ A;  1Q86 H;  3CYQ A;  1OFC X;  4BWN A;  3RYF B;  1VQ5 F;  1IFP A;  3V4W A;  1RE3 C;  2BTU A;  3MZW B;  1H8A A;  1BGY D;  1WRG A;  2D2C D;  3CME F;  1RQU A;  5AW5 B;  1W59 A;  5HY2 A;  3RL0 B;  2FYU E;  4TLF A;  3PP5 A;  1NO4 A;  2XNX A;  3F0E A;  3WU2 E;  1NAY A;  1YIJ F;  3FBA A;  1XBI A;  5APT A;  3EFG A;  3ZP4 A;  3V6I A;  3T97 B;  3WU2 H;  1KC8 H;  2IDB A;  3Q3D A;  4GDO A;  2HYN A;  2RN0 A;  3CMA P;  3CXH E;  3RYF A;  2IBZ I;  2Y0D A;  1L0L D;  3LFO A;  3HRN A;  2ZOD A;  2CWJ A;  1IV1 A;  2QRX A;  3CXH H;  2KLV A;  1XTG B;  2W8B C;  4M8I A;  3IMP A;  3KJK A;  5AW6 B;  1OW8 A;  4WY4 D;  3HD7 C;  1Y47 A;  3CYP B;  4EYY Q;  2WVR A;  2ZOV A;  3QH9 A;  3H1L J;  1H48 A;  3B5N B;  1W2B O;  1PGQ A;  5LXT B;  2I8D A;  1VQL F;  1EZV I;  4L74 A;  3HKE B;  4ZHQ B;  2F9Z C;  2LBW A;  3OA7 A;  5DCV A;  1R1M A;  3VTP C;  1VQO P;  2W27 A;  5AW1 B;  1KNJ A;  4O2B B;  3CCM F;  5AW8 B;  4DXD A;  2QJP C;  2ZXE B;  1SQV K;  4C8E A;  4BT6 A;  1DIP A;  1DD3 A;  2R32 A;  2W8Z A;  4DT0 A;  3CC2 P;  1WT6 A;  3B5N A;  3HUS B;  2WWW A;  3S9O A;  5LXT A;  1SP4 A;  2IFM A;  1YBK A;  2NPS C;  3CG6 A;  1WMK A;  3HKE A;  4ZHQ A;  4HJG H;  3L73 J;  2K9J B;  2OHW A;  4JYB A;  1N86 A;  2WQY C;  5TIS E;  2E74 D;  4O2B A;  1T3J A;  3U59 A;  1YQ4 C;  2ZT9 C;  1VQP P;  3VMX A;  3G6E P;  5TIS H;  4BRY A;  1N7S C;  4IOI H;  1LTS C;  1HGV A;  3IN6 A;  1URQ B;  2K9Y A;  3HUS A;  2VRS A;  1W40 A;  1J1E C;  2FYN C;  1QAH A;  2K9J A;  2QVA A;  1ZN5 A;  4JBZ A;  3JAS B;  2WPS A;  2IZ0 A;  3H1L E;  2C0W A;  1RQ7 A;  1E5W A;  4EDF A;  1SQP K;  2BCC G;  2PGD A;  2W90 A;  2WSS H;  3H1H J;  2Q1K A;  2GA1 A;  3E1Y A;  4C8I A;  1CZQ A;  3D01 A;  5EWR A;  4BW0 B;  2PFX A;  2N48 A;  1EDI A;  4U7J A;  1URQ A;  4B86 A;  3EQ2 A;  3CCU F;  4HNA B;  1AQ5 A;  2AEM A;  4Y28 J;  4OGQ B;  3AE4 C;  1N7L A;  1M1J B;  2BCC D;  3IAO A;  2HS3 A;  3JAS A;  1RF0 C;  1Q7Y Q;  1NTM G;  3BRT B;  3MUD C;  1R5S A;  1FJP A;  3L4F A;  3MBM A;  1KB9 E;  3L73 E;  5CJ0 A;  2HOD B;  1JO5 A;  1FSZ A;  1JTH B;  3I56 F;  5LP6 B;  3CPW O;  3RK3 B;  3RYH B;  3V4D A;  4IL6 E;  1KB9 H;  1IFJ A;  4LNU B;  4HNA A;  5AW9 B;  1QVF F;  1Y9B A;  2A45 G;  3S1K A;  1RY3 A;  5CCH A;  4IL6 H;  1M1J A;  4RES B;  1OX3 A;  3CMA F;  3H32 B;  4PJ0 E;  1SQQ K;  1ZME C;  2M8R A;  2I1K A;  3T80 A;  1OIP A;  1ZRT E;  3I7T A;  4PJ0 H;  1YJN P;  2E76 D;  3L71 J;  5KAI E;  4UB8 E;  2HOD A;  3CCS P;  1JTH A;  2B33 A;  5LP6 A;  4LCK A;  4WBA A;  3RYH A;  1SQB K;  1M57 D;  1L0L J;  4KJM A;  2XV5 A;  5KAI H;  4UB8 H;  5IYZ B;  4LNU A;  1NAF A;  1NTZ K;  2XKM A;  2IG8 A;  1QLE D;  2H8E A;  2L5G B;  1K05 A;  4I7Z B;  3H1H E;  4EI9 A;  5LA6 B;  3H32 A;  3L74 G;  1BCC J;  3N4Z A;  2GVI A;  1AV1 A;  3H1K G;  4L76 A;  1VF5 B;  3KXD A;  4AQR D;  4AYC A;  1Z5W A;  3W67 A;  2Y0E A;  3J80 M;  1VQO F;  1VQN F;  3GF7 A;  1PPJ G;  3G9R A;  4D6T G;  5KLV J;  2WT7 B;  2C0X A;  3CD6 P;  3AED C;  3L74 D;  3K5B A;  2VGM A;  2O3J A;  3H1K D;  5IYZ A;  4PV1 D;  1T0K B;  1M90 H;  1CSB A;  1DEE G;  2HR3 A;  1PPJ D;  4D6T D;  1GTW A;  1IFD A;  3AEF C;  3WPX A;  2N1T D;  1LTI C;  5FNV B;  1JMM A;  2IYO A;  3M06 A;  3PAF A;  1OW6 A;  3N2G B;  1W2E A;  3MP7 B;  1E7K A;  2JR8 A;  3IEW A;  3RL0 D;  1HTL C;  2YO3 A;  3LIE A;  1VQP F;  1YHQ P;  4BT7 A;  1S72 F;  1K73 Q;  3I55 P;  2O1K A;  3HKC B;  2FGY A;  3GF3 A;  3L71 E;  4EI8 A;  4B62 A;  2AIZ P;  2QJY C;  1JJ2 F;  4G4Y A;  2K1S A;  5FNV A;  1GDT A;  5AW2 B;  1W2B F;  4BVT A;  1T2K D;  1L0L E;  1ZWZ A;  4U39 A;  5CMZ A;  5IJ0 B;  3N2G A;  1TVK B;  1KIL E;  2KTU A;  1NTK K;  3WUT A;  3V2R A;  2UWJ E;  3SWF A;  1J7H A;  3Q8H A;  2H8P D;  2HFE D;  5APS A;  4O4J B;  3P4E A;  1BCC E;  2M0B A;  1NH4 A;  3HKC A;  4EB6 B;  2ZFC A;  4M3L A;  2XND H;  1VQ8 P;  3TGU J;  2YXZ A;  2PRR A;  5KLV E;  2FY8 A;  1KQG B;  1H7M A;  5AW3 B;  3G4S P;  5C39 A;  2CSL A;  5IJ0 A;  1W3E X;  1TVK A;  1X52 A;  3B71 A;  1PP9 G;  4JYC A;  4O4J A;  3CC7 P;  1L0N K;  1FZC B;  3NK6 A;  2YIU B;  3KQG A;  5JVD B;  4EB6 A;  1KYO I;  1KZU B;  1ZW0 A;  5AVU B;  2IBZ G;  2M5A A;  4C7N B;  4CPG A;  1S9K E;  2PHN A;  3S0H A;  3KDP B;  1PP9 D;  4E6E A;  3TNU B;  4BXL A;  3BCC J;  3EWK A;  1Q81 Q;  4U3F G;  1JCD A;  1RF1 C;  2NMU A;  1UIX A;  3PH0 A;  2IBZ D;  5G4U C;  4O4L B;  4X20 A;  5L8R J;  1JY3 O;  5CCG C;  3JAK B;  1YJN F;  1TUB B;  1RE4 C;  2KZI A;  1FZC A;  1EXJ A;  1EZV G;  1W5F A;  2RHH A;  1FZA A;  1HBW A;  5JVD A;  5EO3 A;  4U3F D;  1URQ D;  4C7N A;  4NUT A;  3GHG C;  5AVS B;  2AXT E;  2QEX F;  1LT9 C;  2BEQ D;  2C9N Y;  1VQ6 P;  3TNU A;  5B66 E;  1L2P A;  4O4I B;  1M1K Q;  1ZXG A;  1EDL A;  1BE3 G;  1EZV D;  3SWK A;  3P8C D;  1Q86 Q;  2AXT H;  1IPA A;  1LTA C;  5AVX B;  2OTK E;  3MTU E;  3P8M C;  5B66 H;  3TGU E;  1CW5 A;  4BY9 D;  3QTY A;  2OYO A;  1P84 D;  4O4L A;  2FYU K;  1YTZ T;  3H1J G;  1S5L E;  2E75 C;  1TUB A;  1GW3 A;  1RE3 A;  4JPZ B;  1JM0 A;  3GW6 A;  3AGK A;  3M9H A;  3CD6 F;  1JOC A; 
#chains in the Genus database with same CATH homology
 1YIJ F;  1L4A D;  2N1T C;  3C9I A;  1XBI A;  5APT A;  5APQ A;  3EFG A;  2XDJ A;  3U1A A;  1PXW A;  1GZ0 A;  2P2U A;  1FZB A;  1HVV A;  1IK9 A;  1DT9 A;  3CPW F;  1KC8 H;  3NVK E;  3WMM 0;  4LGD E;  3VP9 A;  5CCH D;  1G1J A;  2HYN A;  3HD7 B;  5HXZ A;  4W7Z A;  1VDF A;  1QL2 A;  3RL0 C;  2W6A A;  1IO4 A;  2FYZ A;  1QL1 A;  3SWY A;  2CPB A;  3LFO A;  3HRN A;  3N4X A;  2KLV A;  2Q3I A;  1MV8 A;  2Z5I A;  4HH2 A;  2QA4 F;  1Q82 H;  1XTG B;  2XZR A;  1YYC A;  2KG4 A;  5GAP K;  3G71 F;  3OBY A;  1LTB C;  4GIF A;  5AW6 B;  4ZKP A;  1T3U A;  4WY4 D;  3HD7 C;  2HPC A;  3RK3 D;  1AFO A;  1DEB A;  3V5B A;  3CXC F;  1T2K C;  2R5B A;  4ZKU A;  2KYV A;  1JY2 N;  3B5N B;  5AW4 B;  2Q7C A;  2E43 A;  1VQL F;  3HD7 A;  3LWV C;  2F9Z C;  2LBW A;  3OA7 A;  2R3C A;  2H43 A;  2GUS A;  5DCV A;  3J7A R;  2Q5U A;  5IT9 M;  1KIL C;  1NWQ A;  3VTP C;  1K8A H;  1JNM A;  1VQK F;  1NOH A;  2W27 A;  5AW1 B;  2HLO A;  2NPS B;  3CCM F;  1GO0 A;  5AW8 B;  4Y99 B;  3CCR F;  2ZXE B;  1SQV K;  3O85 A;  4HYT B;  1PFI A;  1X7O A;  5GAN K;  3CC4 F;  2J59 M;  2R32 A;  1FAV A;  5GIN C;  1SFC B;  3PLA C;  3M9B A;  1A02 F;  2JEE A;  1WT6 A;  3WXM B;  2OTJ F;  3B5N A;  3HUS B;  1LTJ B;  1LWU B;  2WWW A;  4I2L C;  1VQ8 F;  1JY2 O;  3HE5 B;  1SP4 A;  2IFM A;  2NPS C;  3V2P A;  3CG6 A;  5A2Q M;  2OHW A;  3FFM A;  4JYB A;  4O9B A;  1N86 A;  1N7S B;  2I1J A;  3M9Q A;  3M0D C;  4C4W C;  3H6P A;  1CK2 A;  4BVS A;  2NPS A;  1T3J A;  2OAR A;  3U59 A;  3CCS F;  4I1L A;  1LTJ C;  1LWU C;  3VMX A;  1M1K H;  3M0D A;  3CI9 A;  3BVH A;  5CCG A;  3MCA B;  3CC7 F;  3TK1 A;  1GW4 A;  1SFC A;  2IX7 C;  1GD2 E;  3NK7 A;  2N9B A;  1N7S C;  5KTB A;  4IFD K;  1G2C B;  1LTS C;  3V3T A;  1FZF A;  1HGV A;  1URQ B;  1J1D B;  1LTJ A;  1LWU A;  2N1T B;  3HUS A;  4KHX A;  1FZG A;  3V4Q A;  3HE5 A;  2VRS A;  1KFN A;  5APX A;  2ALE A;  1W40 A;  1J1E C;  1MUU A;  2QM7 A;  1ZN5 A;  2H7H A;  1N7S A;  1K9M H;  1FU1 A;  1LTT C;  2WPS A;  2C0W A;  2WTY A;  2O01 H;  2WPR A;  4LC1 A;  4EOT A;  2XU6 A;  3NFQ A;  1E5W A;  3MIW A;  1URQ C;  1J1D C;  1N2D C;  1SQP K;  1SQX K;  2JNB A;  2FC3 A;  5AVQ B;  3E1Y A;  2BAS A;  5APW A;  4BVR A;  1CI6 B;  1CZQ A;  2WIT A;  4AUW A;  5EWR A;  3SIV A;  3JCM M;  5KJ7 C;  4BW0 B;  4XE5 B;  1G2C A;  5APV A;  3ON1 A;  1URQ A;  3OW2 F;  4B86 A;  1Q7Y H;  2N1T A;  3EQ2 A;  4I6M C;  1AQ5 A;  1LTG C;  2O1J A;  4NQ3 A;  3CCU F;  2OYH C;  3JAM M;  1QVG F;  1N7L A;  1M1J B;  3BAT A;  1NKN A;  3CPQ A;  1VQ6 F;  1JY2 P;  1X7P A;  1DX7 A;  1RF0 C;  2W6B A;  3KPE A;  1MZ9 A;  3BRT B;  1RA4 A;  2QM8 A;  4WB4 A;  1NTM K;  1FJP A;  3BRV B;  3CL3 D;  4GKG A;  5AW0 B;  3N7N A;  1YJ9 F;  1IFN A;  1L4A C;  1VQM F;  3L4F A;  1KIL B;  5HY0 A;  3NTN A;  1MFZ A;  2J58 A;  1YHQ F;  5AW7 B;  5CJ0 A;  2MJZ A;  2HOD B;  5CHX A;  2WPQ A;  3MUD A;  3HAX D;  3NVI B;  5CCH C;  1JO5 A;  4WY4 B;  3I55 F;  1JTH B;  2P7J A;  3I56 F;  1CN7 A;  1M1J C;  1CI6 A;  3T97 A;  3CCE F;  3RK3 B;  3LW5 H;  2P1J A;  1IFJ A;  2I6D A;  5BVZ A;  1GU4 A;  3CCJ F;  2GM4 A;  4C7R A;  5AW9 B;  2KTV A;  4EI7 A;  3P7K A;  2LKM A;  1QVF F;  2A45 G;  1RY3 A;  1GK4 A;  5CCH A;  1M1J A;  3B5N D;  3LWP C;  4RES B;  3CMA F;  3TYY A;  3H32 B;  2WSF H;  1ZR4 A;  5CJ4 A;  1SQQ K;  3V7Q A;  4WY4 C;  2M8R A;  3VOP A;  2I1K A;  4XCQ A;  2C9L Y;  3RK3 C;  1GL2 D;  5AVY B;  1KIL A;  4N6J A;  3G3Z A;  3VYI A;  2A45 H;  1YIT F;  1GZL A;  2GLZ A;  2HOD A;  1FZE A;  2CZW A;  3HTK B;  4WY4 A;  1JTH A;  4LCK A;  1OWA A;  4WBA A;  1SQB K;  3OJA B;  4N78 E;  2FKW B;  2XV5 A;  2VGN A;  1KQS F;  1NJI H;  3SIU A;  5CCG D;  5AVR B;  1NAF A;  1NTZ K;  2XKM A;  4EIJ A;  1VQ9 F;  1SFC D;  1XTC C;  3G4S F;  2L5G B;  1T8Z A;  3KYQ A;  4W7Y A;  1JUN A;  5HY4 A;  4EI9 A;  3H32 A;  3N4Z A;  3CCL F;  1G1I A;  1J1E B;  4W80 A;  3J81 M;  3B8E B;  4AYC A;  4AQR D;  4BVQ A;  1NU1 K;  2OYI B;  3LWQ C;  3L35 A;  3A7O A;  3J80 M;  2IPP A;  1VQO F;  3BAS A;  1VQN F;  5HWE A;  1DH3 A;  1FBM A;  2WT7 B;  2C0X A;  1FOS F;  5APY A;  2LBX A;  3HTK A;  3P32 A;  2Z4E A;  2FXM A;  4TZZ A;  3L36 A;  1M7L A;  4DZO A;  2VGM A;  1YTZ I;  1RLG A;  5BU5 A;  1IFI A;  3A3Y B;  1HWT C;  3RK2 D;  1T0K B;  5HY1 A;  1CSB A;  1M90 H;  2OYI C;  1GTW A;  2WSE H;  1IFD A;  2N1T D;  1LTI C;  3NMD A;  1JMM A;  3VN0 A;  2GUV A;  2OYH B;  3LWO C;  1X79 B;  2Q9I A;  3M06 A;  1IJD B;  3PAF A;  2YNY A;  3L37 A;  2YO2 A;  3A5T A;  1W2E A;  2A45 I;  1HUC A;  1KFM A;  1X9V A;  5AVZ B;  2FFD C;  2OYI A;  2OTL F;  3CLQ A;  1E7K A;  1K73 H;  1VPC A;  5AVT B;  2KP8 A;  3D00 A;  1J2J B;  3RL0 D;  1HTL C;  2YO3 A;  1L4A B;  5GIO C;  5GIP C;  3LIE A;  1VQP F;  1HH0 A;  2M3B A;  1S72 F;  3VMZ A;  5HXU A;  5AVV B;  2O1K A;  4LLH A;  2FGY A;  5KJ7 A;  2OZB A;  3HD7 D;  4EI8 A;  1L0L K;  1JJ2 F;  3IR9 A;  3LWR C;  1GDT A;  5AW2 B;  2OYH A;  5BU8 B;  4IFF A;  1W2B F;  4BVT A;  1T2K D;  1H89 A;  1ZWZ A;  4N3Y B;  5CMZ A;  3UIA A;  1RF0 A;  3M0A A;  3RA5 A;  1SVF A;  2KTU A;  1NTK K;  2KSJ A;  1ZR2 A;  1VQ7 F;  3V2R A;  3TSI A;  3SWF A;  2YMY A;  2YKP A;  3IFM A;  3VMF B;  1L4A A;  1VQ4 F;  2H8P D;  2HFE D;  5APS A;  1KIL D;  5APU A;  1FOS E;  4OH8 B;  3OBW A;  2R5D A;  2WZ7 A;  1HJB A;  1NH4 A;  2QI2 A;  5KLV K;  1JY3 P;  2ZFC A;  4M3L A;  4X3M A;  3MD0 A;  1ZV8 A;  1HGZ A;  1YI2 F;  1KQL A;  1N73 B;  3OAK A;  1H7M A;  2AIF A;  5AW3 B;  2PP6 A;  2P67 A;  3HE4 B;  1W3E X;  1X52 A;  3RA6 A;  2NPS D;  3E1I A;  1GL2 B;  4GT1 A;  1JY3 N;  2WAL A;  1IFM A;  4C46 A;  3CCV F;  3NXS A;  4JYC A;  1H88 A;  3V2Q A;  1LGH B;  1L0N K;  1A02 J;  1X8Y A;  1N73 C;  1FZC B;  1EQ7 A;  1FDM A;  2HVY D;  1RF1 B;  3NK6 A;  3KQG A;  4XA4 A;  3B5N C;  1OXZ A;  1GO1 A;  1ZLL A;  1KZU B;  5AVU B;  4N78 D;  1SLQ A;  4C7N B;  1S9K E;  1Q81 H;  3V2N A;  3KDP B;  5FJ4 C;  1N73 A;  1GL2 C;  2IFN A;  2KOG A;  5AVW B;  3TNU B;  5FLX M;  2BO1 A;  2YKO A;  5G4V C;  1W42 A;  1GK6 A;  1N7S D;  1S9K D;  2WSC H;  2POH A;  2CPS A;  1NKZ B;  2E42 A;  3HE4 A;  1IC2 A;  1FZC C;  3N4Y A;  1JCD A;  1RF1 C;  1NHL A;  3GHG B;  4Y99 C;  3NMU C;  4DOJ A;  1LT9 B;  5G4U C;  1FJK A;  1GL2 A;  1KD1 H;  2PAJ A;  3MGN A;  2JJL A;  3HJW C;  1JY3 O;  5CCG C;  2KB7 P;  1YJN F;  2FFD B;  1NMU B;  4X3L A;  4IFM A;  3V7E A;  1SFC C;  3U1C A;  1RE4 C;  2Z5H A;  1FZC A;  3R2P A;  1RF1 A;  3CC2 F;  1FZA A;  3HUS C;  1HBW A;  1N8R H;  5EO3 A;  1JCC A;  3II6 A;  3M91 A;  4JF7 A;  3CCQ F;  1URQ D;  1Z56 A;  4C7N A;  3VP8 A;  4NUT A;  3I5C A;  1Q86 H;  3GHG C;  5AVS B;  2HG5 D;  3P8C E;  2QEX F;  1RE4 A;  1LT9 C;  3RK2 B;  2C9N Y;  3GYQ A;  3TNU A;  3O8Z A;  3E20 B;  1VQ5 F;  5KJ7 D;  3V4W A;  1RE3 C;  1GU5 A;  3A2A A;  1WRG A;  3P8C D;  1H8A A;  1YJW F;  1IPA A;  1LTA C;  5AVX B;  3CME F;  3VMY A;  3GHG A;  2WT7 A;  3MTU E;  3LID A;  3P8M C;  1CW5 A;  3VI6 A;  1LT9 A;  4BY9 D;  5AW5 B;  2FYU K;  1SDS A;  1YTZ T;  3G6E F;  5HY2 A;  2FFD A;  3RL0 B;  1GW3 A;  1RE3 A;  3RK2 C;  2YKQ A;  3PP5 A;  1NO4 A;  2XNX A;  1W41 A;  3AGK A;  3M9H A;  3CD6 F;  2HPC B;  1JOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...