3IR9A

C-terminal domain of peptide chain release factor from methanosarcina mazei.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
AYTDESGLSELVNAAGEKLQDLELMGQKNAVRDFFKELIADSGKVAYGESQVRANLEINSVDVLLLSEDLRAERVTTKCSVCGYENKWTRRWKPPAPAAGNCPKCGSSLEVTDVTDIVDEFSELADKSNAKVVFVSTDFDEGSQLMNAFGGIAAILRYNTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide chain release factor subunit 1
publication title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 48
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ir9A01
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ir9A02
3J7AR 3CPQA 3HAXD 4M3LA 3M9HA 3VMYA 3CC7F 1GO0A 3M0AA 5APSA 1H7MA 1QVGF 1H88A 2Q3IA 2H7HA 3FFMA 3MGNA 5AW0B 2KTUA 3PLAC 2WPQA 2Z5IA 2QA4F 1GZLA 3M9BA 1OXZA 1Q81H 1IO4A 1MFZA 1NWQA 1T2KC 2Z5HA 5APYA 4AQRD 1KQLA 1FOSF 1M90H 5IT9M 3SWFA 2WT7B 1ZWZA 3V4WA 2YNYA 3OBWA 2R3CA 1DH3A 3CCEF 1VQ9F 4DZOA 1NJIH 1GU5A 4JYCA 1RA4A 1HUCA 1CSBA 3HE5B 1YJWF 4LC1A 2W6AA 4I6MC 3VYIA 1YJ9F 2WT7A 3NMUC 1G2CB 3LWVC 2R5BA 3J81M 3HE4B 3LIDA 5APXA 3N4YA 1Q7YH 5FLXM 2WPSA 3RA6A 2ZFCA 2QM7A 4X3MA 3E20B 3CD6F 3HE5A 3RA5A 1K73H 4X3LA 3NXSA 5AW8B 1Q86H 5EWRA 3M0DA 1PXWA 3M91A 3G4SF 2IPPA 2ALEA 3HE4A 1H8AA 3LWPC 1GK6A 2P2UA 5AW7B 1KQSF 3CPWF 1IPAA 4RESB 3UIAA 3WXMB 1NMUB 3G6EF 5EO3A 2R32A 1VQOF 3L35A 2YO2A 3M06A 4XE5B 3P8MC 4GT1A 2XV5A 2CZWA 1OWAA 1X8YA 1GD2E 4EOTA 1A02F 3TK1A 3NFQA 3CCUF 1JJ2F 1HWTC 1W2BF 5AVYB 1HJBA 1NAFA 4B86A 3OW2F 5AVUB 3J80M 1GO1A 3HJWC 1VQMF 1GK4A 1JUNA 3OAKA 1KC8H 5APWA 1VQPF 3TYYA 2OTLF 1K8AH 2HVYD 2WWWA 5AW2B 1YI2F 1SP4A 2BASA 1A02J 3CCQF 3CCVF 2KTVA 2ZXEB 1JNMA 1MV8A 1QVFF 2R5DA 5APVA 3MCAB 4I2LC 3SIVA 2XZRA 3AGKA 3ON1A 3VMXA 5APTA 1S72F 2KP8A 3V7QA 3O85A 5GANK 3NTNA 1W40A 3I56F 2BO1A 4C46A 1RLGA 5AW9B 3G71F 3V5BA 1KD1H 3A2AA 1T0KB 2JNBA 4C4WC 3CCLF 3P7KA 3CCMF 1FAVA 1J2JB 3I5CA 1GZ0A 2Q7CA 1E7KA 1GTWA 3LWQC 5GIOC 5AVTB 3CC2F 2QI2A 3VTPC 3HTKA 2VGNA 5A2QM 5AVVB 3V4QA 5G4UC 4C7NB 2VRSA 3IR9A 1FOSE 3NK7A 3V7EA 5AVSB 3VMFB 3T97A 3CXCF 1YJNF 1YHQF 5AW6B 3NK6A 3TNUB 3VN0A 1MUUA 1CN7A 4LCKA 4C7NA 3LIEA 2JJLA 3KDPB 2VGMA 1VQ4F 5GAPK 3SIUA 3A7OA 3OBYA 3P32A 5FJ4C 5G4VC 2E42A 3TNUA 2C9LY 1X52A 1S9KE 1DT9A 1SLQA 3LWRC 3JAMM 3LWOC 3MD0A 4BW0B 3KQGA 1SDSA 2FC3A 5AW4B 2OTJF 5AVZB 5APQA 5AVQB 5AVRB 3E1YA 3O8ZA 1HBWA 2XU6A 5GIPC 1VQNF 1X7PA 1S9KD 5AW5B 4GKGA 1VQKF 4KHXA 4NUTA 3A3YB 2WTYA 3CC4F 1W3EX 2LBXA 4AYCA 3N4ZA 1GU4A 1XBIA 3I55F 3GYQA 5AVWB 1CI6B 1YITF 1YIJF 2I6DA 4BY9D 1VQ6F 1VQLF 1H89A 2WPRA 2N9BA 2LBWA 2OHWA 3PAFA 3CCSF 2C9NY 2QM8A 4TZZA 1VQ7F 5APUA 3L37A 1VQ5F 2E43A 2P67A 1N8RH 1CI6A 3JCMM 3CCRF 4JYBA 1CZQA 3VI6A 3CCJF 3NVIB 2AIFA 1K9MH 2YO3A 1Q82H 2WALA 3NMDA 1YYCA 3L36A 2OZBA 1T2KD 1X7OA 4AUWA 5AW1B 3A5TA 3CMAF 3CG6A 2Q5UA 3LFOA 5DCVA 2QEXF 3VMZA 1W42A 2P7JA 1VQ8F 2W27A 4HYTB 5CMZA 1W41A 5AVXB 2KG4A 5AW3B 1CK2A 1M1KH 5GINC 3NVKE 3B8EB 3CMEF
chains in the Genus database with same CATH superfamily
1LGHB 3USSA 1KYOH 3H6PA 3HAXD 3L74D 1BDDA 3CMAP 1HGZA 1U43A 3LMEA 2E75C 2Z1EA 1FU1A 3F0DA 3N2GA 4TV8B 1JY3P 1NU1J 1PP9D 1DEEG 3F89A 2KLVA 1SQXK 2W6JH 4ZHWA 1QVGF 4D6TG 1JY3N 1NTZG 4U3FE 4YJ3B 5KLVD 1H0TB 5AW0B 2KTUA 3HKEB 2Z1FA 3MUDC 2M3BA 1Q86Q 4O4IA 3JATA 1MFZA 1NO4A 5IYZA 1NTKD 5APYA 1SQXJ 3GLMA 3AE8C 4WY4B 1NU1G 2KIKA 1KV4A 5MN4A 1YTZT 3ZOPA 3CB2A 1GDTA 3EWKA 1EXIA 3HD7C 1DH3A 1KQGB 3AE5C 4ZOLA 2Z01A 2MKVA 1H47A 3S0HA 3WPXA 4JYCA 1YI2P 1SQXG 3WUUA 2KGWA 1CSBA 5CCGA 3K14A 1LJ2A 4WY4C 4I6MC 3VYIA 2IBZE 1N73A 2UYNA 1IFMA 3LWVC 2R5BA 2E74D 1KMIZ 5JQGB 3CCEP 4BT4A 1SQVJ 3HWUA 1FZEA 1VL2A 2UZHA 3L74J 5KLVK 1Q7YH 3RK2D 2K1AA 2QM7A 1YJWP 1PPJD 3E20B 3BYQA 4R4LA 3HE5A 1NTKK 2YXZA 1N7SB 2AEJA 2ZAEB 3M0DC 3PTZA 3P4EA 3P10A 1BDCA 1G2CA 5EAZA 1PXWA 2HYNA 1SQVG 5BMVA 4PD4I 3B4SA 1EQ7A 3IF4A 2FYNB 4TV9A 3Q3DA 3L74G 2YIUC 1IFDA 1Q90D 2FYUJ 1YBKA 3L72D 4DRXB 2Q1XA 2JEEA 1NMUB 3MDOA 3G6EF 4C82A 3WJPA 1RE3C 2YO2A 3TGUJ 4IFMA 2KK7A 4GT1A 2CWJA 3L71D 2IX7C 3D01A 2QJKC 3AEGC 1L0NE 3GHZA 1BCCD 1GX1A 2FYNC 3NFQA 2R3SA 1J1DC 3CCUF 2YKQA 1JJ2F 1JY2P 3H1ID 2FYUG 4ASVA 1Z56A 3EFFK 1KILD 2O01J 2Q3EA 5E79H 2KS1A 1JY2N 3L70D 5LYJA 5LP6C 2R6R1 1LTJB 2UYJA 1SQQD 5AVUB 2ZF8A 3OW2F 2J5UA 3HJWC 3TGUG 1TU3F 4D6TE 1NTZE 1U57A 2WZ7A 3GHGB 2GUSA 1KC8H 5J2UB 4ZKUA 1QGKB 5APWA 1USEA 2PAJA 2IQQA 4I1LA 3LYBA 4IL6H 1Q8RA 1K8AH 3C8LA 1NQ3A 2M5AA 1AQTA 4GIFA 4C8GA 4C8IA 3CCVF 1NU1E 2ZXEB 1JNMA 1JB0J 1K05A 3IKEA 5BU5A 4UB8H 5CBNA 3BRVB 3ON1A 3GHGC 2D2CB 2UYKA 3VMXA 3WGNA 4G88A 1S72F 4U39A 3H1JD 1KB9D 1FNJA 1W40A 5EYPB 3WUTA 3HTKB 1NGMB 1SQXE 4A7PA 2BO1A 2OTMA 2B88A 3JASB 1RLGA 3JAWA 2L91A 3HTNA 3Q5PA 1L2PA 3A2AA 4I4TA 2QIWA 5GTIH 5CA1A 1SQQK 4YJ2A 5KJ7D 3P7KA 4RO0A 1P84E 3SSUA 3U0OA 2CPSA 3AEEC 2KOGA 1WRGA 1KTMA 1GZ0A 1GTWA 4MN4C 1LP1B 5AVTB 2GM4A 2QE7H 2QI2A 1JTHB 3N2KA 1RF1A 1EZVG 4O4JB 2KUBA 5A2QM 5AVVB 3V4QA 4PD4H 1LT9B 1YITP 1IV2A 1L4AC 5LA6A 1W5BA 1VQ6P 3RYHB 5AVSB 2Y0EA 5IJ0A 1SQVE 5GTHE 3D70A 1Q81Q 3L74E 3T97A 2XNXA 5CCHC 3HUSB 1YHQF 2RMZA 5AW6B 5C8YB 1JY8A 1OFUA 2WSFJ 1MUUA 2CHTA 1VQ5P 3K0TA 1SFCC 3AE6C 2VGMA 3A0HH 1VQ4F 3H1JJ 5MN6A 1OZHA 2Z1TA 5CB4A 1YJNP 1ZV8A 2L26A 2FYUE 3RYIB 3QUWA 3AE7C 3IEWA 1X52A 3TNUA 2C9LY 2FXOA 4H13D 1S5LH 1NOHA 2L5GB 3TGUE 1KQSO 1UFYA 2IYOA 3CXHD 3JAMM 5H2FE 1KYOD 2P1JA 2OARA 4K3AA 2K9JA 1M56D 1Y9BA 1SDSA 3L75D 1LTSC 4UB6H 4HNAA 5AVZB 2OTJF 1JFFA 2B87B 2NZ2A 1K73Q 2N48A 5MN5A 1X22A 3H1KJ 4ZHYB 1HBWA 2XU6A 5IJ9B 1VQNF 4OH8B 2V4HA 4TV8A 4DOJA 3CYQA 2MJZA 5B5EH 3GF7A 2NPSD 5EB1B 4KHXA 1X25A 2RHOA 3A3YB 3FGAD 2IAFA 1XTCC 4EDFA 2KLUA 2NRGA 3O6QB 4BXLA 3CC4F 2WQYC 4O2BB 1NKNA 3H1KG 3HKEA 1KILA 1CW5A 4BY9D 1LTAC 2GLZA 3EFGA 4KWEA 2WPRA 3H32B 2BCCJ 5KAFE 5EZYA 3EQ2A 1QVFO 3F0FA 3V2NA 3AEBC 4TZZA 1DX7A 3JALB 2PFXA 1EZVE 3JAKA 2P58A 1TVKB 4NPFX 3L37A 3KXDA 3JCUE 1VQ9P 3ZDMA 1RY3A 1ZRTD 1LWUA 5HXUA 3H1LJ 5B8FA 4N6JA 2BCCG 1GL2B 2Q6QA 1OFCX 4O2AB 3KJKA 4LGDE 1IFNA 3B5ND 1FZGA 2WSEH 5TISE 2WSCH 2ZYAA 1LTBC 1FNKA 2RHLA 4AUWA 4O4HB 3WPWA 3CMAF 3V4DA 1VK3A 5DCVA 2RKLA 3H1LG 1W42A 3PRJA 3F6MA 4I50A 2V9YA 3CD6P 1VF5B 2W8BC 5AVXB 2WVRA 2KG4A 5J2TB 2Y9ZA 1FZFA 1KNJA 5BVZA 3VYTC 3BRTB 1M8OB 3GMAA 4M3LA 3VMYA 4O9BA 2QEXP 1EXJA 3M84A 4NPEA 3P0ZA 1GO0A 4OWFA 3D54A 1Q7YQ 1NAYA 1PIXA 1KB9E 3C8VA 1VF5C 1H88A 3H1HG 1U7MA 3S1KA 3FFMA 2OGUA 2A06G 4TUYA 1M1JB 3CX5I 1PZQA 2ZVNB 2Z5IA 3WGKA 3CL3D 1OXZA 3IMPA 1Q81H 4JF7A 2FFDB 1WMKA 1T2KC 2Z5HA 3IFMA 3S06A 2RH0A 1AJYA 3FXEA 1N2DC 3SWFA 2WT7B 1ZWZA 1U40A 1ZR2A 3OBWA 3QWOC 3V2PA 4PV1D 1W5FA 3CCEF 2V7QH 4B62A 3H1KE 2H8EA 4WBAA 1OAPA 3Q5RA 1R8EA 2OTLP 1GU5A 4O4LB 1RA4A 3II6A 4Z1MH 1YJWF 3Q5SA 1Z5VA 4LC1A 1N7LA 5DJUB 3FD6A 4N78D 1FS0E 3OA7A 3L73J 1LTIC 3HE4B 4U3JB 2R751 1J1EC 4BT5A 3I3FA 4BRYB 5FLXM 1DBFA 2W83C 3MZWB 4ASWA 4U7JA 2BCCE 1URQB 1K73H 1BGYD 1USDA 3G71P 3JASA 1NTMG 3NXSA 2QJYB 5KLIB 3L73G 2CVLA 5EWRA 3WMM0 4JBZA 3CLQA 3LWPC 3C9UA 2OYIC 1KZUB 2ZVYA 2NPSA 2E75B 1FJKA 1K04A 2IBZI 3CPWF 2IFMA 1CLIA 2M8RA 4KT0J 1KYOE 3H1LE 3UIAA 3RK3E 4PWTA 3WXMB 4L76A 1W2EA 3VO8A 2R32A 1L0LK 3RL0g 2N1TD 3P8MC 5KLIC 2UWJE 3G4SP 1SA0B 3C9TA 3TK1A 4X20B 2E74C 4PJ0E 1S2EA 1HWTC 1W2BF 1VDFA 2HG5D 1ZMEC 4TLFA 3TD3A 5M1BA 1FFXB 3SWKA 3C9IA 1VQOP 3CX5H 2VAMA 3RK2C 1GO1A 3H1HE 4IIJB 3AE4C 3CPWO 3HD7B 2A06E 2QJPC 1ZR4A 4BT6A 1M7LA 3B5NA 1ZW0A 3GW6A 2WWWA 5AW2B 1SP4A 3AE1C 2AXTE 3RYIA 3ITKA 2HPCB 1GW3A 2R5DA 1VQMP 3SFDC 1JM0A 2I1JA 2Y0CA 4I2LC 4JQ0D 5CA0A 5JH7A 3LDTA 5APTA 1VQPP 1Z5WA 3CWBD 5EIBC 3AE2C 3O85A 1QVGO 4OVNF 1IFIA 3NTNA 3AE3C 4ZI7A 3F5HA 4C46A 3WGJA 4WWIA 5AW9B 3V5BA 2HX0A 4B46A 1S3JA 1VPCA 5JVDB 4BT7A 2FBWC 1KILC 1RF0A 2A45G 3CCMF 2LKMA 1FAVA 1J2JB 5HY4A 1WT6A 2YIUB 1G1IA 1RE4A 3RL0D 2BTOA 3UT5B 2Q7CA 2AXCA 4Y99C 1AFOA 1M57D 3I56P 4IHJB 1VQKP 2F9ZC 3CC2F 1PP9J 2VGNA 5G4UC 4C7NB 3L7QA 1JCDA 5KMGA 1NTME 3WU2E 1W57A 3CCLP 5KLVJ 3L73E 3IR9A 1LWUC 2QJKB 3FX0A 1Q2NA 1J1DB 4GOFA 1UIIA 3S0YA 3CXCF 1EDIA 1NTKJ 1YJNF 3MIWA 2Q9IA 3NK6A 4R40B 1JMMA 5LP6B 2G3AA 1M90Q 3WGLA 1PP9G 3WGMA 1VQ7P 1P84I 3WJQA 4F6RB 1CN7A 3BCCD 5E79E 3W68A 5KLVG 3KDPB 3E1RA 2H88C 3CCJP 1TUBB 3SWYA 5JCOA 1NJIQ 3RYFA 5GAPK 2AIZP 1NTKG 4DCKA 3U1CA 3OBYA 3P32A 1FSZA 4X1KB 5G4VC 1S9KE 2DT4A 1IFPA 1XRGA 2E76B 4WY4D 1W5AA 2WSSH 3JARB 2WPVB 2HODA 1FZCB 5EFWB 2MQEA 3HKBA 4BW0B 2POHA 2CSLA 2FC3A 4LNUA 3H25A 4EYYQ 4K35A 3V3TA 1FE6A 2FY8A 2HS0A 4NWOB 1GMJA 5APQA 4I55B 4EIJA 2E76C 2HP0A 3MCQA 1X0TA 4ZHQB 2KSEA 2SPZA 1FZCC 1S1CX 1IK9A 4BVQA 4C8EA 4Y28J 3OW2O 2N1TA 4WBNA 3TDKA 2BEQD 1OW8A 4GKGA 3RK3B 3L72J 1PPJG 4X1IA 3D71A 4BVRA 1M1JA 2LBXA 3N4ZA 3I55F 3GYQA 5AVWB 1CI6B 2WSEJ 1L4AB 4RHAA 2KNCA 2WSCJ 3BCCJ 3L71J 4EB6B 2BTQB 1N7SD 4H13C 1BCCJ 3N7NA 1W5CE 4PD4E 2LBWA 2OHWA 2W90A 3H1IJ 1PGPA 1HTLC 1FJPA 2C0XA 3RK3C 2WITA 2C9NY 3L72G 3L70J 2KXPB 1SQQJ 5BU8B 5APUA 4EI2A 5ITZB 2PRRA 5LOVA 1SFCB 3HKDA 1YIJP 3BCCG 3GTZA 3L71G 3U1AA 1OIPA 1VQLP 1CZQA 1PFIA 1IJDB 3HKCA 1BCCG 2AIFA 2YO3A 4M8IA 3H1IG 2OYHB 1BE3D 1P84H 3L70G 1X7OA 1PP9E 1SQQG 5AW1B 3VP8A 3FD5A 3RGUA 4OGQC 3CCRP 2QEXF 2PP6A 5KLVE 1E79H 4BRYA 2DYYA 4IFDK 1EZVI 1RQUA 1T3JA 2W27A 5CMZA 2OYHC 1NTKE 5GTHH 1CK2A 5GINC 3NVKE 4H44B 2VAWA 3CMEF 3J7AR 2K3RA 2GUVA 4UB6E 3M9HA 5IYZB 3D6YA 1ONIA 1QD9A 2V7QJ 3C9SA 2FXPA 5TJHA 1YQ3C 3H1JG 1H7MA 1SQBD 5FNVA 2D2CD 2KSJA 4W80A 3GF3A 3E22A 4H44C 3MGNA 3FWNA 1HGVA 3CX5D 1NYHA 2WPQA 3AE9C 2IDBA 3KE1A 4ZOLB 1J7HA 1YTZI 2AEMA 1D7MA 1NH4A 2ZT9C 3MUDA 1IO4A 3CCUP 3CC7P 2HQSC 1NWQA 3V2RA 3VIUA 4RJTA 1KQLA 2IFNA 2RN0A 1FOSF 1RLUA 1M90H 3VTIC 1AA0A 4WVZA 5IT9M 1IK7A 4W7ZA 1N73B 3V4WA 2UYNB 1BSNA 3TSIA 2YNYA 1W5EA 4YJ3A 2R3CA 1PPJE 1H0TA 2QA4P 3ESJA 4XCQA 1NHLA 3V6IA 4DZOA 3F0GA 4DJGA 1NJIH 2O01H 4C81A 3BATA 1SS1A 2DW3A 5CCGC 2RHHA 2KZIA 3HE5B 1YQ4C 3QTYA 4WY4A 1T3UA 1OW7A 1N73C 3VOPA 2N9YB 4H0LB 3M1XA 3S9OA 1G2CB 2YXQB 3L72E 2B9BA 1SQBK 1RF0C 3LIDA 2C0WA 3R0PA 3G9RA 3KZIH 5APXA 5BMVB 4B45A 3N4YA 5HP7A 4TV9B 1MKMA 3K12A 3L71E 3RA6A 4ZNCA 4HB1A 2ZFCA 4X3MA 1BCCE 3RA5A 2ZOVA 1JOCA 1YJ9P 3H1IE 3L75J 4X3LA 4H0LC 5AW8B 5KAFH 4BT2A 3M0DA 1KILE 3G4SF 2LR2A 2ALEA 3L70E 4NQ3A 1KFNA 1H8AA 1SZQA 5JQGA 1GK6A 1SQQE 4I7ZB 1YGYA 5HY1A 5HY2A 4IFFA 5AW7B 2IBZD 4RKUJ 2CW4A 2Y9YA 4EI8A 5B66H 2KS1B 3JCUH 4RESB 5LYJB 4G4VA 5EO3A 1VQOF 5KJ7A 3L35A 2JR8A 1RE3A 1PGJA 1N7SA 3L75G 3M06A 3U59A 4XE5B 1OWAA 2W8ZA 3IEQA 1GD2E 2JP3A 1A02F 4I7ZC 5JCOC 3N4XA 5TISH 5HXZA 5HWEA 2H8CA 2M5AB 1IZNB 4X1YB 2B89A 2ZXXA 1YHQP 1HJBA 4DRXA 1NAFA 3H1JE 2OQQA 2JWAA 3S02A 1E5WA 1OVUA 3J80M 1W581 1OX3A 1VQMF 1GK4A 4F6RA 2VAPA 3PH0A 2XDJA 1T8ZA 1JY3O 2O3JA 1VQPF 3MBMA 2Q1KA 3TYYA 2HVYD 1YI2F 3JC22 2BASA 1A02J 5HP8A 3S0WA 1L0ND 1R5SA 2KTVA 3JAWB 4L74A 1Q82Q 1LTJA 4I4TB 3FXDA 3QHDA 5CA1B 4ZMDA 4YJ2B 2XZRA 1J1EB 3R4YA 3AGKA 3SIVA 3A0BH 2ZVZA 2CPBA 3GHGA 2P10A 5J2UA 2KP8A 3V7QA 1IFJA 2N1TC 4E6EA 1L0LD 1MZ9A 4D6TD 1NTZD 3I56F 3ELCA 1RF1B 3CCQP 4TT3H 5AVMA 3ZO8A 3MQWA 1GL2D 1T0KB 5LA6B 4C4WC 1AVYA 1DD3A 3CCLF 5IJ0B 2YKPA 2OYIB 2PGDA 1VQNP 2KYVA 3T97B 1NU1D 1ZLLA 2G8YA 3LWQC 5EYPA 4LLHA 5KTBA 1RF1C 2RB9A 3VTPC 3HTKA 3KHUA 2I8DA 1JCCA 1PL5A 1L0NK 1FOSE 1VF5D 2OYOA 3V7EA 4CPGA 4ZKPA 5KAIE 2OTKE 1COMA 2E74B 3CXHE 2ZJSE 4RQOA 2ZYDA 1LP1A 1SQPD 3TNUB 1JTHA 3VN0A 2ZODA 1X79B 1P84D 3RK2B 1NTZK 4O4JA 1PF5A 1NVOA 3L75E 4LCKA 1LT9A 2ZVOB 3LIEA 2QJPB 2K9JB 1LTTC 3RYHA 2YMYA 2HS3A 3SIUA 2BEZF 3A7OA 1L0LJ 2XNDH 3HUSA 1UI9A 1NTZJ 1NU1K 5FJ4C 1JFFB 4YTPC 5C8YA 1SQVD 2JO1A 1PV3A 3VYSC 1SLQA 1JY2O 2YXRB 3LWRC 1QL2A 3P8CD 3LWOC 1JN1A 3D00A 1S4XA 2Q1YA 2W6BA 1RHZB 4YXWH 2FKWB 1W59A 1NKZB 3MD0A 5EB0A 1BSHA 1OW6A 1L0LG 1G1JA 5AW4B 3E1IA 5KX5B 3VOBA 1HH0A 4PJ0H 3TD4A 4HKZH 1BGYJ 1SQPK 3O8ZA 4G4YA 3D6ZA 1KILB 2FXMA 1W2BO 1FDOA 4BVTA 5GIPC 2FYUD 3AEDC 1VHAA 2WMMA 5EZYB 3MHVA 1KN7A 1EDKA 4Y99B 5AW5B 2G9IA 2Y0DA 2JWDA 1ZRTE 2HP3A 3TGUD 2KB7P 4NUTA 1SQPJ 2WTYA 3JAKB 1JO5A 1GU4A 1BGYG 1XBIA 2B87A 3VOAA 2AXTH 1YITF 3PP5A 1URQD 1LWUB 3FWLA 1IV4A 2I6DA 1SQVK 3G3ZA 1YIJF 1U3LA 1LT1A 1VQ6F 1VQLF 2LXCB 5IJ9A 2HR3A 3JVHA 3PLNA 3I7TA 3BVHA 4L75A 3VMAA 2E75D 1SQPG 4QMAA 3O6QA 2AEFA 2IZ1A 1VQ5F 3CYPB 4O2BA 2E43A 2P67A 3CCRF 1JD1A 4JYBA 4I50B 4G4WA 3NVIB 2KZJA 4ZK7A 3H32A 3VP9A 3C9RA 1Q82H 2FYUK 2Z4EA 2WALA 3CCSP 3HRNA 2H8PD 1YYCA 3L36A 4KJMA 1UIXA 3AECC 2UYPA 5C39A 2OZBA 1DEBA 3JSVC 2A45I 3LW5H 3JALA 3S4RA 1QU9A 2K9YA 1TVKA 3A5TA 2Q5UA 4R4MA 3WUVA 5K5GB 5LXTB 3TD5A 3CWBJ 3WU2H 3OONA 1EZVD 3HD7D 4GDOA 1GL2A 1QEXA 5KJ7C 4O2AA 1W41A 2FGYA 1N7SC 4IOIH 4DT0A 4TUYB 5EIBD 4HJGH 3E7KA 2O1JA 4G4XA 4IL6E 2XKMA 2QVAA 1QLED 3CPQA 4O4HA 2K88A 1KD1Q 5DJTB 5CHXA 2M0BA 3CC7F 1AVOA 3M0AA 5APSA 3CWBG 2JDIH 4BVSA 2IG8A 3IKFA 3K5BA 4UB8E 4FFBB 1ZN5A 1VQ8P 1ODEA 2Q3IA 1RQVA 2JKVA 2H7HA 1VQVA 1GW4A 1L0LE 5J2TA 4YPCA 3PLAC 2HLOA 2QA4F 1GZLA 3ZP7A 3M9BA 4GODA 4N78E 5GONB 2CHSA 4H13B 4AQRD 3MP7B 4X1YA 4IL6X 5GTIE 4ERHA 2HRYA 1T0AA 1LTJC 2J58A 1IV1A 1L0NG 3RYCB 4N3YB 2YYEA 3ABVC 1LTGC 3B71A 1VQ9F 1JEKA 2PHNA 1BGYE 3K2XA 2FFDA 3W67A 1EC5A 3KPEA 2B33A 1HUCA 1HVVA 1QX8A 3L4FA 3MTUE 2W6AA 1YJ9F 2WT7A 3NMUC 3J81M 2AMTA 1RQ2A 1SQPE 1KQFB 3R2PA 2D2CC 1FZAA 2NPSB 1ZXGA 1HJ0A 4OGQB 2LCAA 2QTPA 4W7YA 4YXDC 2WPSA 4O4LA 4WB4A 3CD6F 2I1KA 1ZP0C 3A0HE 2A45H 2YKOA 3H1KD 1QL1A 1FZBA 1Q86H 3M91A 2IPPA 3M4SA 3WJRA 3HE4A 4U3JA 1KORA 3GG2A 2NPSC 3CCMP 2NMUA 2OYIA 1XHOA 3QH9A 1T6AA 2P2UA 1KQSF 3N2GB 4HH2A 1IPAA 3P8CE 1S5LE 2BTUA 4EI7A 3FBAA 1DD4A 1PGOA 2E76D 3CC2P 2VXYA 1AV1A 1URQA 5KKZB 1SVFA 2I6RA 1U7JA 1LT9C 2K1SA 2XV5A 2CZWA 1FDMA 1X8YA 4C7RA 4EOTA 4O4IB 3JATB 2ZT9B 2BCCD 3B5NB 2QRXA 1IC2A 5CBOA 3IN6A 2E5YA 5HY0A 1H48A 2O01N 2ZAUA 5AVYB 3RBZA 1RH5B 3HUSC 3M9QA 1JMBA 3G6EP 3CWBE 3F0EA 3KYQA 4B86A 5KKZC 4NPDA 5CA0B 5JH7B 3V2QA 1JUNA 3OAKA 1S5LX 1SA0A 1FC2C 2GA1A 2H43A 3H1LD 5B5EE 3RK3D 1W55A 3B5NC 3ERNA 2O1KA 3RE3A 2OTLF 1N8RQ 3KJJA 4X20A 4ZI7B 1EDLA 3AEAC 1YQNA 5H2FH 1L4AD 3CI9A 3IAOA 3DDNA 3CCQF 2GVIA 1K9MQ 1FFXA 1MV8A 4GOEA 1QVFF 1BE3J 1R1MA 5APVA 3OJAB 3MCAB 1OVRA 5CCHD 4IIJA 3T80A 3HD7A 3Q1MA 2LBTA 1KB9I 4B5CA 4XA4A 2RHJA 5GANK 4U3FD 3KZIE 3H1HD 2HRUA 1SFCD 2ITAA 2IYPA 2A06D 4OGQD 3CCVP 1X9VA 3AEFC 4DXDA 5KX5A 3G71F 1BE3G 5KMGB 2HPCA 1KD1H 1M1KQ 2JNBA 4G4ZA 3PJSK 1S72P 1RE4C 3I5CA 3ZP4A 3BCCE 1E7KA 4PV1B 2H89C 5GIOC 2CK3H 1SQBJ 4XFJA 3I55P 2M3EA 5B66E 2VRSA 5JVDA 1OVVA 2PMPA 3NK7A 1OMIA 2LXBA 1Y8AA 3VMFB 3RYFB 4BT3A 4H44D 1U3PA 3UT5A 4PV1C 5CJ4A 2K37A 1EDJA 2ZT9D 4IHJA 3PHLA 1SQBG 2EWCA 4C7NA 1KFMA 2JJLA 2HODB 2HFED 3HKBB 3B6NA 1GL2C 2FYZA 4LNUB 2QG4A 2J59M 1NTMD 4U3FJ 3H1HJ 3L73D 5LP6A 2E42A 1DT9A 2HP0B 4BWNA 5CCGD 1ZOYC 1AQ5A 3CXHI 1KYOI 5CJ0A 2QSIA 1VQ4P 3Q8HA 1TUBA 2N1TB 4WBNB 5LXTA 3KQGA 2WSFH 1R5LA 3A0BE 4U3FG 4X1IB 1FBMA 4X1KA 3CMEP 5AVRB 3DC2A 3E1YA 3BASA 2KNCB 1N86A 1KB9H 1DIPA 3JARA 4H0LD 1MFTA 1FZCA 2Z1UA 2HS4A 1X7PA 1S9KD 1HF9A 4ZHVA 1FDIA 5L8RJ 1RQ7A 4FFBA 3N2KB 1VQKF 2OTJP 3EORA 2H6LA 1M1JC 3RBXA 1W3EX 1NTMK 5LOVB 4AYCA 3Q2YA 4I55A 3HKDB 1BE3E 1XV2A 3KHNA 3KIZA 2FFDC 3S03A 3LW5J 1VH8A 4ZHQA 1H89A 3HKCB 5GONA 2N9BA 1PGQA 3PAFA 2IBZG 3CCSF 1Y47A 1NTMJ 3RYCA 2QM8A 1VQ7F 3CC4P 3VYUC 3SFEC 2KI7B 2GZLA 2ZYGA 3FPIA 1KNKA 1N8RH 1CI6A 3JCMM 1L4AA 4EB6A 1SQXD 3VI6A 2R44A 1KC8Q 3CCJF 2IZ0A 1K9MH 5CB4B 1QAHA 5CCHA 3NMDA 1K8AQ 2YMKA 3RL0B 1XTGB 1T2KD 1L0NJ 1LNQA 4JPZB 1SQBE 4L73A 4PD4D 5ITZA 3CG6A 1SFCA 3TF5A 3LFOA 4EI9A 2P6YA 1IV3A 3CX5E 3VMZA 2P7JA 3VCZA 5FNVB 1URQC 1VQ8F 3C1LA 4HYTB 4HNAB 2E5TA 5KAIH 4D6TJ 2OYHA 3E22B 1M1KH 5AW3B 3RL0C 2QJYC 3CXHH 3B8EB 5AVQB
chains in the Genus database with same CATH topology
2XKMA 3J7AR 1LGHB 3H6PA 3CPQA 3HAXD 3BRTB 2GUVA 4M3LA 1HGZA 3M9HA 3VMYA 4O9BA 5CHXA 1FU1A 3CC7F 1GO0A 3M0AA 5APSA 1JY3P 1H7MA 4BVSA 1ZN5A 2KLVA 2KSJA 1SQXK 4W80A 1QVGF 1H88A 2Q3IA 1JY3N 2H7HA 1GW4A 3FFMA 3MGNA 1M1JB 5AW0B 2KTUA 3PLAC 1HGVA 2HLOA 2WPQA 2Z5IA 2QA4F 1GZLA 3CL3D 1YTZI 3M9BA 1OXZA 2M3BA 1NH4A 1Q81H 4JF7A 3MUDA 2FFDB 1IO4A 4N78E 1MFZA 1NO4A 1NWQA 1T2KC 3V2RA 2Z5HA 5APYA 3IFMA 4AQRD 1KQLA 2IFNA 1FOSF 1M90H 4WY4B 1N2DC 5IT9M 4W7ZA 3SWFA 1LTJC 1YTZT 2J58A 2WT7B 1N73B 1ZWZA 3V4WA 3TSIA 1GDTA 4N3YB 2YNYA 1ZR2A 3OBWA 2R3CA 3HD7C 3V2PA 1LTGC 1DH3A 4XCQA 3CCEF 1NHLA 1VQ9F 4DZOA 1NJIH 2O01H 4WBAA 2FFDA 3BATA 1GU5A 4JYCA 3KPEA 1RA4A 1HUCA 3II6A 1CSBA 5CCGC 1HVVA 3L4FA 5CCGA 3HE5B 1YJWF 4WY4C 4LC1A 3MTUE 1N7LA 1T3UA 2W6AA 4WY4A 4I6MC 3VYIA 1N73C 1YJ9F 3VOPA 1N73A 2WT7A 4N78D 3NMUC 1G2CB 3OA7A 1IFMA 3LWVC 2R5BA 1SQBK 1LTIC 1RF0C 3J81M 3HE4B 3LIDA 2C0WA 1J1EC 5APXA 3R2PA 1FZAA 3N4YA 1FZEA 2NPSB 5KLVK 1Q7YH 3RK2D 5FLXM 4W7YA 2WPSA 3RA6A 2ZFCA 2QM7A 4X3MA 3E20B 4WB4A 1URQB 3CD6F 3HE5A 1NTKK 3RA5A 1K73H 2I1KA 1JOCA 1N7SB 2A45H 2YKOA 4X3LA 3NXSA 5AW8B 1QL1A 3M0DC 1FZBA 1Q86H 5EWRA 3M0DA 1G2CA 1PXWA 3M91A 3G4SF 2IPPA 3WMM0 2ALEA 2HYNA 4NQ3A 3CLQA 3HE4A 1KFNA 1H8AA 3LWPC 2OYIC 1GK6A 1EQ7A 2NPSC 1KZUB 2OYIA 2NPSA 5HY1A 1FJKA 5HY2A 1IFDA 2P2UA 4IFFA 5AW7B 1KQSF 3CPWF 2IFMA 4HH2A 1IPAA 3P8CE 4EI8A 2M8RA 4RESB 4EI7A 3UIAA 3WXMB 2JEEA 1NMUB 3G6EF 1W2EA 5EO3A 2R32A 1RE3C 1URQA 1VQOF 5KJ7A 3L35A 1L0LK 1RE3A 1SVFA 2YO2A 1N7SA 3M06A 3U59A 4XE5B 4IFMA 2N1TD 3P8MC 4GT1A 1LT9C 2XV5A 2CZWA 1FDMA 1OWAA 1X8YA 4C7RA 2IX7C 1GD2E 4EOTA 1A02F 3TK1A 3B5NB 3N4XA 1J1DC 3NFQA 5HXZA 1IC2A 2YKQA 5HWEA 3CCUF 1JY2P 1JJ2F 5HY0A 1HWTC 1W2BF 1VDFA 2HG5D 5AVYB 3HUSC 3M9QA 1Z56A 1KILD 1HJBA 1NAFA 1JY2N 1E5WA 3C9IA 3KYQA 1LTJB 4B86A 3OW2F 5AVUB 3J80M 3RK2C 1GO1A 3HJWC 1VQMF 1GK4A 3V2QA 1JUNA 3HD7B 2WZ7A 3GHGB 3OAKA 2XDJA 2GUSA 2H43A 1KC8H 1T8ZA 1ZR4A 4ZKUA 3RK3D 1JY3O 5APWA 1VQPF 3B5NC 2PAJA 4I1LA 1M7LA 3B5NA 2O1KA 3TYYA 2OTLF 5BVZA 1K8AH 2HVYD 2WWWA 5AW2B 1YI2F 1SP4A 4GIFA 2BASA 1A02J 1L4AD 3CI9A 3CCQF 3CCVF 2KTVA 2ZXEB 1JNMA 2HPCB 1GW3A 1MV8A 1QVFF 1LTJA 2R5DA 5BU5A 5APVA 3OJAB 3MCAB 2I1JA 4I2LC 5CCHD 2XZRA 1J1EB 3BRVB 3AGKA 3ON1A 3SIVA 3GHGC 3VMXA 3HD7A 2CPBA 3GHGA 5APTA 1S72F 2KP8A 3V7QA 1IFJA 3O85A 2N1TC 4XA4A 5GANK 1IFIA 3NTNA 1W40A 1MZ9A 3I56F 1SFCD 3HTKB 1RF1B 2BO1A 4C46A 1RLGA 1X9VA 5AW9B 3G71F 3V5BA 2HPCA 1VPCA 1KD1H 3A2AA 1KILC 1GL2D 1T0KB 2JNBA 4C4WC 1RF0A 3CCLF 1SQQK 5KJ7D 2YKPA 2A45G 2OYIB 3P7KA 3CCMF 1RE4C 2LKMA 1FAVA 1J2JB 2CPSA 3I5CA 5HY4A 1WT6A 2KYVA 1G1IA 1RE4A 3RL0D 2KOGA 1ZLLA 1WRGA 1GZ0A 2Q7CA 1E7KA 1GTWA 4Y99C 3LWQC 1AFOA 5GIOC 5AVTB 2GM4A 2F9ZC 3CC2F 4LLHA 5KTBA 1RF1C 2QI2A 1JTHB 3VTPC 3HTKA 1RF1A 2VGNA 1JCCA 5A2QM 5AVVB 3V4QA 5G4UC 4C7NB 1JCDA 2VRSA 1LT9B 1L0NK 1L4AC 3IR9A 1LWUC 1FOSE 3NK7A 3V7EA 5AVSB 4ZKPA 1J1DB 3VMFB 3T97A 3CXCF 2XNXA 5CCHC 3HUSB 5CJ4A 1YJNF 1YHQF 3MIWA 5AW6B 2Q9IA 3NK6A 1JMMA 3TNUB 1JTHA 3VN0A 1X79B 3RK2B 1NTZK 1MUUA 1CN7A 4LCKA 4C7NA 1SFCC 1KFMA 1LT9A 3LIEA 2JJLA 3KDPB 2HODB 2VGMA 2HFED 1LTTC 2YMYA 1VQ4F 3SWYA 5GAPK 1GL2C 2FYZA 3SIUA 2J59M 3U1CA 1ZV8A 3A7OA 3OBYA 3HUSA 3P32A 1NU1K 5FJ4C 5G4VC 2E42A 3TNUA 2C9LY 1X52A 1S9KE 1DT9A 1SLQA 5CCGD 1NOHA 1JY2O 2L5GB 1AQ5A 3LWRC 1QL2A 4WY4D 3P8CD 3JAMM 3LWOC 5CJ0A 2P1JA 2OARA 3D00A 2HODA 1FZCB 2W6BA 2N1TB 2FKWB 1NKZB 3MD0A 4BW0B 2POHA 3KQGA 1SDSA 2WSFH 2FC3A 1LTSC 1G1JA 3V3TA 5AW4B 1FBMA 2OTJF 3E1IA 5AVZB 1HH0A 5APQA 5AVRB 3E1YA 1SQPK 3O8ZA 1KILB 3BASA 4EIJA 2FXMA 4BVTA 1HBWA 1N86A 2XU6A 5GIPC 1FZCC 1IK9A 4BVQA 1VQNF 1FZCA 1X7PA 1S9KD 4OH8B 2N1TA 4Y99B 5AW5B 4DOJA 2MJZA 4GKGA 1VQKF 2NPSD 3RK3B 2KB7P 4KHXA 4NUTA 3A3YB 1XTCC 2WTYA 1M1JC 3CC4F 4BVRA 1W3EX 3CMEF 1NTMK 1M1JA 1NKNA 4AYCA 1GU4A 1JO5A 1XBIA 2LBXA 3GYQA 3N4ZA 3I55F 5AVWB 1CI6B 1YITF 1KILA 1L4AB 1URQD 1LWUB 3PP5A 2FFDC 1CW5A 2I6DA 1SQVK 3G3ZA 1YIJF 4BY9D 1LTAC 1N7SD 3EFGA 2GLZA 1VQLF 1VQ6F 1H89A 2WPRA 3H32B 3N7NA 2N9BA 2LBWA 3EQ2A 2OHWA 3PAFA 1HTLC 3BVHA 1FJPA 2C0XA 3V2NA 3CCSF 3RK3C 2WITA 2C9NY 2QM8A 4TZZA 1VQ7F 1DX7A 5BU8B 5APUA 3L37A 1VQ5F 2E43A 1SFCB 2P67A 1RY3A 1N8RH 1CI6A 3JCMM 3CCRF 1L4AA 1LWUA 3U1AA 4JYBA 5HXUA 1CZQA 1PFIA 3VI6A 1IJDB 3CCJF 4N6JA 3NVIB 3H32A 2AIFA 3VP9A 1K9MH 1GL2B 2YO3A 1Q82H 2FYUK 5CCHA 2Z4EA 2WALA 2OYHB 3NMDA 4LGDE 3HRNA 1IFNA 2H8PD 1YYCA 3L36A 3B5ND 3RL0B 1XTGB 1FZGA 2WSEH 2OZBA 1T2KD 2WSCH 1DEBA 1LTBC 2A45I 3LW5H 1X7OA 4AUWA 5AW1B 3VP8A 3A5TA 3CMAF 3CG6A 1SFCA 2Q5UA 3LFOA 4EI9A 5DCVA 2QEXF 2PP6A 3VMZA 1W42A 4IFDK 2P7JA 3HD7D 1GL2A 1URQC 1T3JA 5KJ7C 1VQ8F 2W27A 4HYTB 5CMZA 2OYHC 1W41A 1N7SC 2FGYA 5AVXB 2OYHA 2KG4A 5AW3B 1CK2A 1M1KH 5GINC 3RL0C 3NVKE 1FZFA 2O1JA 3B8EB 5AVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A R;  3CPQ A;  3HAX D;  4M3L A;  3M9H A;  3VMY A;  3CC7 F;  1GO0 A;  3M0A A;  5APS A;  1H7M A;  1QVG F;  1H88 A;  2Q3I A;  2H7H A;  3FFM A;  3MGN A;  5AW0 B;  2KTU A;  3PLA C;  2WPQ A;  2Z5I A;  2QA4 F;  1GZL A;  3M9B A;  1OXZ A;  1Q81 H;  1IO4 A;  1MFZ A;  1NWQ A;  1T2K C;  2Z5H A;  5APY A;  4AQR D;  1KQL A;  1FOS F;  1M90 H;  5IT9 M;  3SWF A;  2WT7 B;  1ZWZ A;  3V4W A;  2YNY A;  3OBW A;  2R3C A;  1DH3 A;  3CCE F;  1VQ9 F;  4DZO A;  1NJI H;  1GU5 A;  4JYC A;  1RA4 A;  1HUC A;  1CSB A;  3HE5 B;  1YJW F;  4LC1 A;  2W6A A;  4I6M C;  3VYI A;  1YJ9 F;  2WT7 A;  3NMU C;  1G2C B;  3LWV C;  2R5B A;  3J81 M;  3HE4 B;  3LID A;  5APX A;  3N4Y A;  1Q7Y H;  5FLX M;  2WPS A;  3RA6 A;  2ZFC A;  2QM7 A;  4X3M A;  3E20 B;  3CD6 F;  3HE5 A;  3RA5 A;  1K73 H;  4X3L A;  3NXS A;  5AW8 B;  1Q86 H;  5EWR A;  3M0D A;  1PXW A;  3M91 A;  3G4S F;  2IPP A;  2ALE A;  3HE4 A;  1H8A A;  3LWP C;  1GK6 A;  2P2U A;  5AW7 B;  1KQS F;  3CPW F;  1IPA A;  4RES B;  3UIA A;  3WXM B;  1NMU B;  3G6E F;  5EO3 A;  2R32 A;  1VQO F;  3L35 A;  2YO2 A;  3M06 A;  4XE5 B;  3P8M C;  4GT1 A;  2XV5 A;  2CZW A;  1OWA A;  1X8Y A;  1GD2 E;  4EOT A;  1A02 F;  3TK1 A;  3NFQ A;  3CCU F;  1JJ2 F;  1HWT C;  1W2B F;  5AVY B;  1HJB A;  1NAF A;  4B86 A;  3OW2 F;  5AVU B;  3J80 M;  1GO1 A;  3HJW C;  1VQM F;  1GK4 A;  1JUN A;  3OAK A;  1KC8 H;  5APW A;  1VQP F;  3TYY A;  2OTL F;  1K8A H;  2HVY D;  2WWW A;  5AW2 B;  1YI2 F;  1SP4 A;  2BAS A;  1A02 J;  3CCQ F;  3CCV F;  2KTV A;  2ZXE B;  1JNM A;  1MV8 A;  1QVF F;  2R5D A;  5APV A;  3MCA B;  4I2L C;  3SIV A;  2XZR A;  3AGK A;  3ON1 A;  3VMX A;  5APT A;  1S72 F;  2KP8 A;  3V7Q A;  3O85 A;  5GAN K;  3NTN A;  1W40 A;  3I56 F;  2BO1 A;  4C46 A;  1RLG A;  5AW9 B;  3G71 F;  3V5B A;  1KD1 H;  3A2A A;  1T0K B;  2JNB A;  4C4W C;  3CCL F;  3P7K A;  3CCM F;  1FAV A;  1J2J B;  3I5C A;  1GZ0 A;  2Q7C A;  1E7K A;  1GTW A;  3LWQ C;  5GIO C;  5AVT B;  3CC2 F;  2QI2 A;  3VTP C;  3HTK A;  2VGN A;  5A2Q M;  5AVV B;  3V4Q A;  5G4U C;  4C7N B;  2VRS A;  3IR9 A;  1FOS E;  3NK7 A;  3V7E A;  5AVS B;  3VMF B;  3T97 A;  3CXC F;  1YJN F;  1YHQ F;  5AW6 B;  3NK6 A;  3TNU B;  3VN0 A;  1MUU A;  1CN7 A;  4LCK A;  4C7N A;  3LIE A;  2JJL A;  3KDP B;  2VGM A;  1VQ4 F;  5GAP K;  3SIU A;  3A7O A;  3OBY A;  3P32 A;  5FJ4 C;  5G4V C;  2E42 A;  3TNU A;  2C9L Y;  1X52 A;  1S9K E;  1DT9 A;  1SLQ A;  3LWR C;  3JAM M;  3LWO C;  3MD0 A;  4BW0 B;  3KQG A;  1SDS A;  2FC3 A;  5AW4 B;  2OTJ F;  5AVZ B;  5APQ A;  5AVQ B;  5AVR B;  3E1Y A;  3O8Z A;  1HBW A;  2XU6 A;  5GIP C;  1VQN F;  1X7P A;  1S9K D;  5AW5 B;  4GKG A;  1VQK F;  4KHX A;  4NUT A;  3A3Y B;  2WTY A;  3CC4 F;  1W3E X;  2LBX A;  4AYC A;  3N4Z A;  1GU4 A;  1XBI A;  3I55 F;  3GYQ A;  5AVW B;  1CI6 B;  1YIT F;  1YIJ F;  2I6D A;  4BY9 D;  1VQ6 F;  1VQL F;  1H89 A;  2WPR A;  2N9B A;  2LBW A;  2OHW A;  3PAF A;  3CCS F;  2C9N Y;  2QM8 A;  4TZZ A;  1VQ7 F;  5APU A;  3L37 A;  1VQ5 F;  2E43 A;  2P67 A;  1N8R H;  1CI6 A;  3JCM M;  3CCR F;  4JYB A;  1CZQ A;  3VI6 A;  3CCJ F;  3NVI B;  2AIF A;  1K9M H;  2YO3 A;  1Q82 H;  2WAL A;  3NMD A;  1YYC A;  3L36 A;  2OZB A;  1T2K D;  1X7O A;  4AUW A;  5AW1 B;  3A5T A;  3CMA F;  3CG6 A;  2Q5U A;  3LFO A;  5DCV A;  2QEX F;  3VMZ A;  1W42 A;  2P7J A;  1VQ8 F;  2W27 A;  4HYT B;  5CMZ A;  1W41 A;  5AVX B;  2KG4 A;  5AW3 B;  1CK2 A;  1M1K H;  5GIN C;  3NVK E;  3B8E B;  3CME F; 
#chains in the Genus database with same CATH topology
 1LGH B;  3USS A;  1KYO H;  3H6P A;  3HAX D;  3L74 D;  1BDD A;  3CMA P;  1HGZ A;  1U43 A;  3LME A;  2E75 C;  2Z1E A;  1FU1 A;  3F0D A;  3N2G A;  4TV8 B;  1JY3 P;  1NU1 J;  1PP9 D;  1DEE G;  3F89 A;  2KLV A;  1SQX K;  2W6J H;  4ZHW A;  1QVG F;  4D6T G;  1JY3 N;  1NTZ G;  4U3F E;  4YJ3 B;  5KLV D;  1H0T B;  5AW0 B;  2KTU A;  3HKE B;  2Z1F A;  3MUD C;  2M3B A;  1Q86 Q;  4O4I A;  3JAT A;  1MFZ A;  1NO4 A;  5IYZ A;  1NTK D;  5APY A;  1SQX J;  3GLM A;  3AE8 C;  4WY4 B;  1NU1 G;  2KIK A;  1KV4 A;  5MN4 A;  1YTZ T;  3ZOP A;  3CB2 A;  1GDT A;  3EWK A;  1EXI A;  3HD7 C;  1DH3 A;  1KQG B;  3AE5 C;  4ZOL A;  2Z01 A;  2MKV A;  1H47 A;  3S0H A;  3WPX A;  4JYC A;  1YI2 P;  1SQX G;  3WUU A;  2KGW A;  1CSB A;  5CCG A;  3K14 A;  1LJ2 A;  4WY4 C;  4I6M C;  3VYI A;  2IBZ E;  1N73 A;  2UYN A;  1IFM A;  3LWV C;  2R5B A;  2E74 D;  1KMI Z;  5JQG B;  3CCE P;  4BT4 A;  1SQV J;  3HWU A;  1FZE A;  1VL2 A;  2UZH A;  3L74 J;  5KLV K;  1Q7Y H;  3RK2 D;  2K1A A;  2QM7 A;  1YJW P;  1PPJ D;  3E20 B;  3BYQ A;  4R4L A;  3HE5 A;  1NTK K;  2YXZ A;  1N7S B;  2AEJ A;  2ZAE B;  3M0D C;  3PTZ A;  3P4E A;  3P10 A;  1BDC A;  1G2C A;  5EAZ A;  1PXW A;  2HYN A;  1SQV G;  5BMV A;  4PD4 I;  3B4S A;  1EQ7 A;  3IF4 A;  2FYN B;  4TV9 A;  3Q3D A;  3L74 G;  2YIU C;  1IFD A;  1Q90 D;  2FYU J;  1YBK A;  3L72 D;  4DRX B;  2Q1X A;  2JEE A;  1NMU B;  3MDO A;  3G6E F;  4C82 A;  3WJP A;  1RE3 C;  2YO2 A;  3TGU J;  4IFM A;  2KK7 A;  4GT1 A;  2CWJ A;  3L71 D;  2IX7 C;  3D01 A;  2QJK C;  3AEG C;  1L0N E;  3GHZ A;  1BCC D;  1GX1 A;  2FYN C;  3NFQ A;  2R3S A;  1J1D C;  3CCU F;  2YKQ A;  1JJ2 F;  1JY2 P;  3H1I D;  2FYU G;  4ASV A;  1Z56 A;  3EFF K;  1KIL D;  2O01 J;  2Q3E A;  5E79 H;  2KS1 A;  1JY2 N;  3L70 D;  5LYJ A;  5LP6 C;  2R6R 1;  1LTJ B;  2UYJ A;  1SQQ D;  5AVU B;  2ZF8 A;  3OW2 F;  2J5U A;  3HJW C;  3TGU G;  1TU3 F;  4D6T E;  1NTZ E;  1U57 A;  2WZ7 A;  3GHG B;  2GUS A;  1KC8 H;  5J2U B;  4ZKU A;  1QGK B;  5APW A;  1USE A;  2PAJ A;  2IQQ A;  4I1L A;  3LYB A;  4IL6 H;  1Q8R A;  1K8A H;  3C8L A;  1NQ3 A;  2M5A A;  1AQT A;  4GIF A;  4C8G A;  4C8I A;  3CCV F;  1NU1 E;  2ZXE B;  1JNM A;  1JB0 J;  1K05 A;  3IKE A;  5BU5 A;  4UB8 H;  5CBN A;  3BRV B;  3ON1 A;  3GHG C;  2D2C B;  2UYK A;  3VMX A;  3WGN A;  4G88 A;  1S72 F;  4U39 A;  3H1J D;  1KB9 D;  1FNJ A;  1W40 A;  5EYP B;  3WUT A;  3HTK B;  1NGM B;  1SQX E;  4A7P A;  2BO1 A;  2OTM A;  2B88 A;  3JAS B;  1RLG A;  3JAW A;  2L91 A;  3HTN A;  3Q5P A;  1L2P A;  3A2A A;  4I4T A;  2QIW A;  5GTI H;  5CA1 A;  1SQQ K;  4YJ2 A;  5KJ7 D;  3P7K A;  4RO0 A;  1P84 E;  3SSU A;  3U0O A;  2CPS A;  3AEE C;  2KOG A;  1WRG A;  1KTM A;  1GZ0 A;  1GTW A;  4MN4 C;  1LP1 B;  5AVT B;  2GM4 A;  2QE7 H;  2QI2 A;  1JTH B;  3N2K A;  1RF1 A;  1EZV G;  4O4J B;  2KUB A;  5A2Q M;  5AVV B;  3V4Q A;  4PD4 H;  1LT9 B;  1YIT P;  1IV2 A;  1L4A C;  5LA6 A;  1W5B A;  1VQ6 P;  3RYH B;  5AVS B;  2Y0E A;  5IJ0 A;  1SQV E;  5GTH E;  3D70 A;  1Q81 Q;  3L74 E;  3T97 A;  2XNX A;  5CCH C;  3HUS B;  1YHQ F;  2RMZ A;  5AW6 B;  5C8Y B;  1JY8 A;  1OFU A;  2WSF J;  1MUU A;  2CHT A;  1VQ5 P;  3K0T A;  1SFC C;  3AE6 C;  2VGM A;  3A0H H;  1VQ4 F;  3H1J J;  5MN6 A;  1OZH A;  2Z1T A;  5CB4 A;  1YJN P;  1ZV8 A;  2L26 A;  2FYU E;  3RYI B;  3QUW A;  3AE7 C;  3IEW A;  1X52 A;  3TNU A;  2C9L Y;  2FXO A;  4H13 D;  1S5L H;  1NOH A;  2L5G B;  3TGU E;  1KQS O;  1UFY A;  2IYO A;  3CXH D;  3JAM M;  5H2F E;  1KYO D;  2P1J A;  2OAR A;  4K3A A;  2K9J A;  1M56 D;  1Y9B A;  1SDS A;  3L75 D;  1LTS C;  4UB6 H;  4HNA A;  5AVZ B;  2OTJ F;  1JFF A;  2B87 B;  2NZ2 A;  1K73 Q;  2N48 A;  5MN5 A;  1X22 A;  3H1K J;  4ZHY B;  1HBW A;  2XU6 A;  5IJ9 B;  1VQN F;  4OH8 B;  2V4H A;  4TV8 A;  4DOJ A;  3CYQ A;  2MJZ A;  5B5E H;  3GF7 A;  2NPS D;  5EB1 B;  4KHX A;  1X25 A;  2RHO A;  3A3Y B;  3FGA D;  2IAF A;  1XTC C;  4EDF A;  2KLU A;  2NRG A;  3O6Q B;  4BXL A;  3CC4 F;  2WQY C;  4O2B B;  1NKN A;  3H1K G;  3HKE A;  1KIL A;  1CW5 A;  4BY9 D;  1LTA C;  2GLZ A;  3EFG A;  4KWE A;  2WPR A;  3H32 B;  2BCC J;  5KAF E;  5EZY A;  3EQ2 A;  1QVF O;  3F0F A;  3V2N A;  3AEB C;  4TZZ A;  1DX7 A;  3JAL B;  2PFX A;  1EZV E;  3JAK A;  2P58 A;  1TVK B;  4NPF X;  3L37 A;  3KXD A;  3JCU E;  1VQ9 P;  3ZDM A;  1RY3 A;  1ZRT D;  1LWU A;  5HXU A;  3H1L J;  5B8F A;  4N6J A;  2BCC G;  1GL2 B;  2Q6Q A;  1OFC X;  4O2A B;  3KJK A;  4LGD E;  1IFN A;  3B5N D;  1FZG A;  2WSE H;  5TIS E;  2WSC H;  2ZYA A;  1LTB C;  1FNK A;  2RHL A;  4AUW A;  4O4H B;  3WPW A;  3CMA F;  3V4D A;  1VK3 A;  5DCV A;  2RKL A;  3H1L G;  1W42 A;  3PRJ A;  3F6M A;  4I50 A;  2V9Y A;  3CD6 P;  1VF5 B;  2W8B C;  5AVX B;  2WVR A;  2KG4 A;  5J2T B;  2Y9Z A;  1FZF A;  1KNJ A;  5BVZ A;  3VYT C;  3BRT B;  1M8O B;  3GMA A;  4M3L A;  3VMY A;  4O9B A;  2QEX P;  1EXJ A;  3M84 A;  4NPE A;  3P0Z A;  1GO0 A;  4OWF A;  3D54 A;  1Q7Y Q;  1NAY A;  1PIX A;  1KB9 E;  3C8V A;  1VF5 C;  1H88 A;  3H1H G;  1U7M A;  3S1K A;  3FFM A;  2OGU A;  2A06 G;  4TUY A;  1M1J B;  3CX5 I;  1PZQ A;  2ZVN B;  2Z5I A;  3WGK A;  3CL3 D;  1OXZ A;  3IMP A;  1Q81 H;  4JF7 A;  2FFD B;  1WMK A;  1T2K C;  2Z5H A;  3IFM A;  3S06 A;  2RH0 A;  1AJY A;  3FXE A;  1N2D C;  3SWF A;  2WT7 B;  1ZWZ A;  1U40 A;  1ZR2 A;  3OBW A;  3QWO C;  3V2P A;  4PV1 D;  1W5F A;  3CCE F;  2V7Q H;  4B62 A;  3H1K E;  2H8E A;  4WBA A;  1OAP A;  3Q5R A;  1R8E A;  2OTL P;  1GU5 A;  4O4L B;  1RA4 A;  3II6 A;  4Z1M H;  1YJW F;  3Q5S A;  1Z5V A;  4LC1 A;  1N7L A;  5DJU B;  3FD6 A;  4N78 D;  1FS0 E;  3OA7 A;  3L73 J;  1LTI C;  3HE4 B;  4U3J B;  2R75 1;  1J1E C;  4BT5 A;  3I3F A;  4BRY B;  5FLX M;  1DBF A;  2W83 C;  3MZW B;  4ASW A;  4U7J A;  2BCC E;  1URQ B;  1K73 H;  1BGY D;  1USD A;  3G71 P;  3JAS A;  1NTM G;  3NXS A;  2QJY B;  5KLI B;  3L73 G;  2CVL A;  5EWR A;  3WMM 0;  4JBZ A;  3CLQ A;  3LWP C;  3C9U A;  2OYI C;  1KZU B;  2ZVY A;  2NPS A;  2E75 B;  1FJK A;  1K04 A;  2IBZ I;  3CPW F;  2IFM A;  1CLI A;  2M8R A;  4KT0 J;  1KYO E;  3H1L E;  3UIA A;  3RK3 E;  4PWT A;  3WXM B;  4L76 A;  1W2E A;  3VO8 A;  2R32 A;  1L0L K;  3RL0 g;  2N1T D;  3P8M C;  5KLI C;  2UWJ E;  3G4S P;  1SA0 B;  3C9T A;  3TK1 A;  4X20 B;  2E74 C;  4PJ0 E;  1S2E A;  1HWT C;  1W2B F;  1VDF A;  2HG5 D;  1ZME C;  4TLF A;  3TD3 A;  5M1B A;  1FFX B;  3SWK A;  3C9I A;  1VQO P;  3CX5 H;  2VAM A;  3RK2 C;  1GO1 A;  3H1H E;  4IIJ B;  3AE4 C;  3CPW O;  3HD7 B;  2A06 E;  2QJP C;  1ZR4 A;  4BT6 A;  1M7L A;  3B5N A;  1ZW0 A;  3GW6 A;  2WWW A;  5AW2 B;  1SP4 A;  3AE1 C;  2AXT E;  3RYI A;  3ITK A;  2HPC B;  1GW3 A;  2R5D A;  1VQM P;  3SFD C;  1JM0 A;  2I1J A;  2Y0C A;  4I2L C;  4JQ0 D;  5CA0 A;  5JH7 A;  3LDT A;  5APT A;  1VQP P;  1Z5W A;  3CWB D;  5EIB C;  3AE2 C;  3O85 A;  1QVG O;  4OVN F;  1IFI A;  3NTN A;  3AE3 C;  4ZI7 A;  3F5H A;  4C46 A;  3WGJ A;  4WWI A;  5AW9 B;  3V5B A;  2HX0 A;  4B46 A;  1S3J A;  1VPC A;  5JVD B;  4BT7 A;  2FBW C;  1KIL C;  1RF0 A;  2A45 G;  3CCM F;  2LKM A;  1FAV A;  1J2J B;  5HY4 A;  1WT6 A;  2YIU B;  1G1I A;  1RE4 A;  3RL0 D;  2BTO A;  3UT5 B;  2Q7C A;  2AXC A;  4Y99 C;  1AFO A;  1M57 D;  3I56 P;  4IHJ B;  1VQK P;  2F9Z C;  3CC2 F;  1PP9 J;  2VGN A;  5G4U C;  4C7N B;  3L7Q A;  1JCD A;  5KMG A;  1NTM E;  3WU2 E;  1W57 A;  3CCL P;  5KLV J;  3L73 E;  3IR9 A;  1LWU C;  2QJK B;  3FX0 A;  1Q2N A;  1J1D B;  4GOF A;  1UII A;  3S0Y A;  3CXC F;  1EDI A;  1NTK J;  1YJN F;  3MIW A;  2Q9I A;  3NK6 A;  4R40 B;  1JMM A;  5LP6 B;  2G3A A;  1M90 Q;  3WGL A;  1PP9 G;  3WGM A;  1VQ7 P;  1P84 I;  3WJQ A;  4F6R B;  1CN7 A;  3BCC D;  5E79 E;  3W68 A;  5KLV G;  3KDP B;  3E1R A;  2H88 C;  3CCJ P;  1TUB B;  3SWY A;  5JCO A;  1NJI Q;  3RYF A;  5GAP K;  2AIZ P;  1NTK G;  4DCK A;  3U1C A;  3OBY A;  3P32 A;  1FSZ A;  4X1K B;  5G4V C;  1S9K E;  2DT4 A;  1IFP A;  1XRG A;  2E76 B;  4WY4 D;  1W5A A;  2WSS H;  3JAR B;  2WPV B;  2HOD A;  1FZC B;  5EFW B;  2MQE A;  3HKB A;  4BW0 B;  2POH A;  2CSL A;  2FC3 A;  4LNU A;  3H25 A;  4EYY Q;  4K35 A;  3V3T A;  1FE6 A;  2FY8 A;  2HS0 A;  4NWO B;  1GMJ A;  5APQ A;  4I55 B;  4EIJ A;  2E76 C;  2HP0 A;  3MCQ A;  1X0T A;  4ZHQ B;  2KSE A;  2SPZ A;  1FZC C;  1S1C X;  1IK9 A;  4BVQ A;  4C8E A;  4Y28 J;  3OW2 O;  2N1T A;  4WBN A;  3TDK A;  2BEQ D;  1OW8 A;  4GKG A;  3RK3 B;  3L72 J;  1PPJ G;  4X1I A;  3D71 A;  4BVR A;  1M1J A;  2LBX A;  3N4Z A;  3I55 F;  3GYQ A;  5AVW B;  1CI6 B;  2WSE J;  1L4A B;  4RHA A;  2KNC A;  2WSC J;  3BCC J;  3L71 J;  4EB6 B;  2BTQ B;  1N7S D;  4H13 C;  1BCC J;  3N7N A;  1W5C E;  4PD4 E;  2LBW A;  2OHW A;  2W90 A;  3H1I J;  1PGP A;  1HTL C;  1FJP A;  2C0X A;  3RK3 C;  2WIT A;  2C9N Y;  3L72 G;  3L70 J;  2KXP B;  1SQQ J;  5BU8 B;  5APU A;  4EI2 A;  5ITZ B;  2PRR A;  5LOV A;  1SFC B;  3HKD A;  1YIJ P;  3BCC G;  3GTZ A;  3L71 G;  3U1A A;  1OIP A;  1VQL P;  1CZQ A;  1PFI A;  1IJD B;  3HKC A;  1BCC G;  2AIF A;  2YO3 A;  4M8I A;  3H1I G;  2OYH B;  1BE3 D;  1P84 H;  3L70 G;  1X7O A;  1PP9 E;  1SQQ G;  5AW1 B;  3VP8 A;  3FD5 A;  3RGU A;  4OGQ C;  3CCR P;  2QEX F;  2PP6 A;  5KLV E;  1E79 H;  4BRY A;  2DYY A;  4IFD K;  1EZV I;  1RQU A;  1T3J A;  2W27 A;  5CMZ A;  2OYH C;  1NTK E;  5GTH H;  1CK2 A;  5GIN C;  3NVK E;  4H44 B;  2VAW A;  3CME F;  3J7A R;  2K3R A;  2GUV A;  4UB6 E;  3M9H A;  5IYZ B;  3D6Y A;  1ONI A;  1QD9 A;  2V7Q J;  3C9S A;  2FXP A;  5TJH A;  1YQ3 C;  3H1J G;  1H7M A;  1SQB D;  5FNV A;  2D2C D;  2KSJ A;  4W80 A;  3GF3 A;  3E22 A;  4H44 C;  3MGN A;  3FWN A;  1HGV A;  3CX5 D;  1NYH A;  2WPQ A;  3AE9 C;  2IDB A;  3KE1 A;  4ZOL B;  1J7H A;  1YTZ I;  2AEM A;  1D7M A;  1NH4 A;  2ZT9 C;  3MUD A;  1IO4 A;  3CCU P;  3CC7 P;  2HQS C;  1NWQ A;  3V2R A;  3VIU A;  4RJT A;  1KQL A;  2IFN A;  2RN0 A;  1FOS F;  1RLU A;  1M90 H;  3VTI C;  1AA0 A;  4WVZ A;  5IT9 M;  1IK7 A;  4W7Z A;  1N73 B;  3V4W A;  2UYN B;  1BSN A;  3TSI A;  2YNY A;  1W5E A;  4YJ3 A;  2R3C A;  1PPJ E;  1H0T A;  2QA4 P;  3ESJ A;  4XCQ A;  1NHL A;  3V6I A;  4DZO A;  3F0G A;  4DJG A;  1NJI H;  2O01 H;  4C81 A;  3BAT A;  1SS1 A;  2DW3 A;  5CCG C;  2RHH A;  2KZI A;  3HE5 B;  1YQ4 C;  3QTY A;  4WY4 A;  1T3U A;  1OW7 A;  1N73 C;  3VOP A;  2N9Y B;  4H0L B;  3M1X A;  3S9O A;  1G2C B;  2YXQ B;  3L72 E;  2B9B A;  1SQB K;  1RF0 C;  3LID A;  2C0W A;  3R0P A;  3G9R A;  3KZI H;  5APX A;  5BMV B;  4B45 A;  3N4Y A;  5HP7 A;  4TV9 B;  1MKM A;  3K12 A;  3L71 E;  3RA6 A;  4ZNC A;  4HB1 A;  2ZFC A;  4X3M A;  1BCC E;  3RA5 A;  2ZOV A;  1JOC A;  1YJ9 P;  3H1I E;  3L75 J;  4X3L A;  4H0L C;  5AW8 B;  5KAF H;  4BT2 A;  3M0D A;  1KIL E;  3G4S F;  2LR2 A;  2ALE A;  3L70 E;  4NQ3 A;  1KFN A;  1H8A A;  1SZQ A;  5JQG A;  1GK6 A;  1SQQ E;  4I7Z B;  1YGY A;  5HY1 A;  5HY2 A;  4IFF A;  5AW7 B;  2IBZ D;  4RKU J;  2CW4 A;  2Y9Y A;  4EI8 A;  5B66 H;  2KS1 B;  3JCU H;  4RES B;  5LYJ B;  4G4V A;  5EO3 A;  1VQO F;  5KJ7 A;  3L35 A;  2JR8 A;  1RE3 A;  1PGJ A;  1N7S A;  3L75 G;  3M06 A;  3U59 A;  4XE5 B;  1OWA A;  2W8Z A;  3IEQ A;  1GD2 E;  2JP3 A;  1A02 F;  4I7Z C;  5JCO C;  3N4X A;  5TIS H;  5HXZ A;  5HWE A;  2H8C A;  2M5A B;  1IZN B;  4X1Y B;  2B89 A;  2ZXX A;  1YHQ P;  1HJB A;  4DRX A;  1NAF A;  3H1J E;  2OQQ A;  2JWA A;  3S02 A;  1E5W A;  1OVU A;  3J80 M;  1W58 1;  1OX3 A;  1VQM F;  1GK4 A;  4F6R A;  2VAP A;  3PH0 A;  2XDJ A;  1T8Z A;  1JY3 O;  2O3J A;  1VQP F;  3MBM A;  2Q1K A;  3TYY A;  2HVY D;  1YI2 F;  3JC2 2;  2BAS A;  1A02 J;  5HP8 A;  3S0W A;  1L0N D;  1R5S A;  2KTV A;  3JAW B;  4L74 A;  1Q82 Q;  1LTJ A;  4I4T B;  3FXD A;  3QHD A;  5CA1 B;  4ZMD A;  4YJ2 B;  2XZR A;  1J1E B;  3R4Y A;  3AGK A;  3SIV A;  3A0B H;  2ZVZ A;  2CPB A;  3GHG A;  2P10 A;  5J2U A;  2KP8 A;  3V7Q A;  1IFJ A;  2N1T C;  4E6E A;  1L0L D;  1MZ9 A;  4D6T D;  1NTZ D;  3I56 F;  3ELC A;  1RF1 B;  3CCQ P;  4TT3 H;  5AVM A;  3ZO8 A;  3MQW A;  1GL2 D;  1T0K B;  5LA6 B;  4C4W C;  1AVY A;  1DD3 A;  3CCL F;  5IJ0 B;  2YKP A;  2OYI B;  2PGD A;  1VQN P;  2KYV A;  3T97 B;  1NU1 D;  1ZLL A;  2G8Y A;  3LWQ C;  5EYP A;  4LLH A;  5KTB A;  1RF1 C;  2RB9 A;  3VTP C;  3HTK A;  3KHU A;  2I8D A;  1JCC A;  1PL5 A;  1L0N K;  1FOS E;  1VF5 D;  2OYO A;  3V7E A;  4CPG A;  4ZKP A;  5KAI E;  2OTK E;  1COM A;  2E74 B;  3CXH E;  2ZJS E;  4RQO A;  2ZYD A;  1LP1 A;  1SQP D;  3TNU B;  1JTH A;  3VN0 A;  2ZOD A;  1X79 B;  1P84 D;  3RK2 B;  1NTZ K;  4O4J A;  1PF5 A;  1NVO A;  3L75 E;  4LCK A;  1LT9 A;  2ZVO B;  3LIE A;  2QJP B;  2K9J B;  1LTT C;  3RYH A;  2YMY A;  2HS3 A;  3SIU A;  2BEZ F;  3A7O A;  1L0L J;  2XND H;  3HUS A;  1UI9 A;  1NTZ J;  1NU1 K;  5FJ4 C;  1JFF B;  4YTP C;  5C8Y A;  1SQV D;  2JO1 A;  1PV3 A;  3VYS C;  1SLQ A;  1JY2 O;  2YXR B;  3LWR C;  1QL2 A;  3P8C D;  3LWO C;  1JN1 A;  3D00 A;  1S4X A;  2Q1Y A;  2W6B A;  1RHZ B;  4YXW H;  2FKW B;  1W59 A;  1NKZ B;  3MD0 A;  5EB0 A;  1BSH A;  1OW6 A;  1L0L G;  1G1J A;  5AW4 B;  3E1I A;  5KX5 B;  3VOB A;  1HH0 A;  4PJ0 H;  3TD4 A;  4HKZ H;  1BGY J;  1SQP K;  3O8Z A;  4G4Y A;  3D6Z A;  1KIL B;  2FXM A;  1W2B O;  1FDO A;  4BVT A;  5GIP C;  2FYU D;  3AED C;  1VHA A;  2WMM A;  5EZY B;  3MHV A;  1KN7 A;  1EDK A;  4Y99 B;  5AW5 B;  2G9I A;  2Y0D A;  2JWD A;  1ZRT E;  2HP3 A;  3TGU D;  2KB7 P;  4NUT A;  1SQP J;  2WTY A;  3JAK B;  1JO5 A;  1GU4 A;  1BGY G;  1XBI A;  2B87 A;  3VOA A;  2AXT H;  1YIT F;  3PP5 A;  1URQ D;  1LWU B;  3FWL A;  1IV4 A;  2I6D A;  1SQV K;  3G3Z A;  1YIJ F;  1U3L A;  1LT1 A;  1VQ6 F;  1VQL F;  2LXC B;  5IJ9 A;  2HR3 A;  3JVH A;  3PLN A;  3I7T A;  3BVH A;  4L75 A;  3VMA A;  2E75 D;  1SQP G;  4QMA A;  3O6Q A;  2AEF A;  2IZ1 A;  1VQ5 F;  3CYP B;  4O2B A;  2E43 A;  2P67 A;  3CCR F;  1JD1 A;  4JYB A;  4I50 B;  4G4W A;  3NVI B;  2KZJ A;  4ZK7 A;  3H32 A;  3VP9 A;  3C9R A;  1Q82 H;  2FYU K;  2Z4E A;  2WAL A;  3CCS P;  3HRN A;  2H8P D;  1YYC A;  3L36 A;  4KJM A;  1UIX A;  3AEC C;  2UYP A;  5C39 A;  2OZB A;  1DEB A;  3JSV C;  2A45 I;  3LW5 H;  3JAL A;  3S4R A;  1QU9 A;  2K9Y A;  1TVK A;  3A5T A;  2Q5U A;  4R4M A;  3WUV A;  5K5G B;  5LXT B;  3TD5 A;  3CWB J;  3WU2 H;  3OON A;  1EZV D;  3HD7 D;  4GDO A;  1GL2 A;  1QEX A;  5KJ7 C;  4O2A A;  1W41 A;  2FGY A;  1N7S C;  4IOI H;  4DT0 A;  4TUY B;  5EIB D;  4HJG H;  3E7K A;  2O1J A;  4G4X A;  4IL6 E;  2XKM A;  2QVA A;  1QLE D;  3CPQ A;  4O4H A;  2K88 A;  1KD1 Q;  5DJT B;  5CHX A;  2M0B A;  3CC7 F;  1AVO A;  3M0A A;  5APS A;  3CWB G;  2JDI H;  4BVS A;  2IG8 A;  3IKF A;  3K5B A;  4UB8 E;  4FFB B;  1ZN5 A;  1VQ8 P;  1ODE A;  2Q3I A;  1RQV A;  2JKV A;  2H7H A;  1VQV A;  1GW4 A;  1L0L E;  5J2T A;  4YPC A;  3PLA C;  2HLO A;  2QA4 F;  1GZL A;  3ZP7 A;  3M9B A;  4GOD A;  4N78 E;  5GON B;  2CHS A;  4H13 B;  4AQR D;  3MP7 B;  4X1Y A;  4IL6 X;  5GTI E;  4ERH A;  2HRY A;  1T0A A;  1LTJ C;  2J58 A;  1IV1 A;  1L0N G;  3RYC B;  4N3Y B;  2YYE A;  3ABV C;  1LTG C;  3B71 A;  1VQ9 F;  1JEK A;  2PHN A;  1BGY E;  3K2X A;  2FFD A;  3W67 A;  1EC5 A;  3KPE A;  2B33 A;  1HUC A;  1HVV A;  1QX8 A;  3L4F A;  3MTU E;  2W6A A;  1YJ9 F;  2WT7 A;  3NMU C;  3J81 M;  2AMT A;  1RQ2 A;  1SQP E;  1KQF B;  3R2P A;  2D2C C;  1FZA A;  2NPS B;  1ZXG A;  1HJ0 A;  4OGQ B;  2LCA A;  2QTP A;  4W7Y A;  4YXD C;  2WPS A;  4O4L A;  4WB4 A;  3CD6 F;  2I1K A;  1ZP0 C;  3A0H E;  2A45 H;  2YKO A;  3H1K D;  1QL1 A;  1FZB A;  1Q86 H;  3M91 A;  2IPP A;  3M4S A;  3WJR A;  3HE4 A;  4U3J A;  1KOR A;  3GG2 A;  2NPS C;  3CCM P;  2NMU A;  2OYI A;  1XHO A;  3QH9 A;  1T6A A;  2P2U A;  1KQS F;  3N2G B;  4HH2 A;  1IPA A;  3P8C E;  1S5L E;  2BTU A;  4EI7 A;  3FBA A;  1DD4 A;  1PGO A;  2E76 D;  3CC2 P;  2VXY A;  1AV1 A;  1URQ A;  5KKZ B;  1SVF A;  2I6R A;  1U7J A;  1LT9 C;  2K1S A;  2XV5 A;  2CZW A;  1FDM A;  1X8Y A;  4C7R A;  4EOT A;  4O4I B;  3JAT B;  2ZT9 B;  2BCC D;  3B5N B;  2QRX A;  1IC2 A;  5CBO A;  3IN6 A;  2E5Y A;  5HY0 A;  1H48 A;  2O01 N;  2ZAU A;  5AVY B;  3RBZ A;  1RH5 B;  3HUS C;  3M9Q A;  1JMB A;  3G6E P;  3CWB E;  3F0E A;  3KYQ A;  4B86 A;  5KKZ C;  4NPD A;  5CA0 B;  5JH7 B;  3V2Q A;  1JUN A;  3OAK A;  1S5L X;  1SA0 A;  1FC2 C;  2GA1 A;  2H43 A;  3H1L D;  5B5E E;  3RK3 D;  1W55 A;  3B5N C;  3ERN A;  2O1K A;  3RE3 A;  2OTL F;  1N8R Q;  3KJJ A;  4X20 A;  4ZI7 B;  1EDL A;  3AEA C;  1YQN A;  5H2F H;  1L4A D;  3CI9 A;  3IAO A;  3DDN A;  3CCQ F;  2GVI A;  1K9M Q;  1FFX A;  1MV8 A;  4GOE A;  1QVF F;  1BE3 J;  1R1M A;  5APV A;  3OJA B;  3MCA B;  1OVR A;  5CCH D;  4IIJ A;  3T80 A;  3HD7 A;  3Q1M A;  2LBT A;  1KB9 I;  4B5C A;  4XA4 A;  2RHJ A;  5GAN K;  4U3F D;  3KZI E;  3H1H D;  2HRU A;  1SFC D;  2ITA A;  2IYP A;  2A06 D;  4OGQ D;  3CCV P;  1X9V A;  3AEF C;  4DXD A;  5KX5 A;  3G71 F;  1BE3 G;  5KMG B;  2HPC A;  1KD1 H;  1M1K Q;  2JNB A;  4G4Z A;  3PJS K;  1S72 P;  1RE4 C;  3I5C A;  3ZP4 A;  3BCC E;  1E7K A;  4PV1 B;  2H89 C;  5GIO C;  2CK3 H;  1SQB J;  4XFJ A;  3I55 P;  2M3E A;  5B66 E;  2VRS A;  5JVD A;  1OVV A;  2PMP A;  3NK7 A;  1OMI A;  2LXB A;  1Y8A A;  3VMF B;  3RYF B;  4BT3 A;  4H44 D;  1U3P A;  3UT5 A;  4PV1 C;  5CJ4 A;  2K37 A;  1EDJ A;  2ZT9 D;  4IHJ A;  3PHL A;  1SQB G;  2EWC A;  4C7N A;  1KFM A;  2JJL A;  2HOD B;  2HFE D;  3HKB B;  3B6N A;  1GL2 C;  2FYZ A;  4LNU B;  2QG4 A;  2J59 M;  1NTM D;  4U3F J;  3H1H J;  3L73 D;  5LP6 A;  2E42 A;  1DT9 A;  2HP0 B;  4BWN A;  5CCG D;  1ZOY C;  1AQ5 A;  3CXH I;  1KYO I;  5CJ0 A;  2QSI A;  1VQ4 P;  3Q8H A;  1TUB A;  2N1T B;  4WBN B;  5LXT A;  3KQG A;  2WSF H;  1R5L A;  3A0B E;  4U3F G;  4X1I B;  1FBM A;  4X1K A;  3CME P;  5AVR B;  3DC2 A;  3E1Y A;  3BAS A;  2KNC B;  1N86 A;  1KB9 H;  1DIP A;  3JAR A;  4H0L D;  1MFT A;  1FZC A;  2Z1U A;  2HS4 A;  1X7P A;  1S9K D;  1HF9 A;  4ZHV A;  1FDI A;  5L8R J;  1RQ7 A;  4FFB A;  3N2K B;  1VQK F;  2OTJ P;  3EOR A;  2H6L A;  1M1J C;  3RBX A;  1W3E X;  1NTM K;  5LOV B;  4AYC A;  3Q2Y A;  4I55 A;  3HKD B;  1BE3 E;  1XV2 A;  3KHN A;  3KIZ A;  2FFD C;  3S03 A;  3LW5 J;  1VH8 A;  4ZHQ A;  1H89 A;  3HKC B;  5GON A;  2N9B A;  1PGQ A;  3PAF A;  2IBZ G;  3CCS F;  1Y47 A;  1NTM J;  3RYC A;  2QM8 A;  1VQ7 F;  3CC4 P;  3VYU C;  3SFE C;  2KI7 B;  2GZL A;  2ZYG A;  3FPI A;  1KNK A;  1N8R H;  1CI6 A;  3JCM M;  1L4A A;  4EB6 A;  1SQX D;  3VI6 A;  2R44 A;  1KC8 Q;  3CCJ F;  2IZ0 A;  1K9M H;  5CB4 B;  1QAH A;  5CCH A;  3NMD A;  1K8A Q;  2YMK A;  3RL0 B;  1XTG B;  1T2K D;  1L0N J;  1LNQ A;  4JPZ B;  1SQB E;  4L73 A;  4PD4 D;  5ITZ A;  3CG6 A;  1SFC A;  3TF5 A;  3LFO A;  4EI9 A;  2P6Y A;  1IV3 A;  3CX5 E;  3VMZ A;  2P7J A;  3VCZ A;  5FNV B;  1URQ C;  1VQ8 F;  3C1L A;  4HYT B;  4HNA B;  2E5T A;  5KAI H;  4D6T J;  2OYH A;  3E22 B;  1M1K H;  5AW3 B;  3RL0 C;  2QJY C;  3CXH H;  3B8E B;  5AVQ B; 
#chains in the Genus database with same CATH homology
 2XKM A;  3J7A R;  1LGH B;  3H6P A;  3CPQ A;  3HAX D;  3BRT B;  2GUV A;  4M3L A;  1HGZ A;  3M9H A;  3VMY A;  4O9B A;  5CHX A;  1FU1 A;  3CC7 F;  1GO0 A;  3M0A A;  5APS A;  1JY3 P;  1H7M A;  4BVS A;  1ZN5 A;  2KLV A;  2KSJ A;  1SQX K;  4W80 A;  1QVG F;  1H88 A;  2Q3I A;  1JY3 N;  2H7H A;  1GW4 A;  3FFM A;  3MGN A;  1M1J B;  5AW0 B;  2KTU A;  3PLA C;  1HGV A;  2HLO A;  2WPQ A;  2Z5I A;  2QA4 F;  1GZL A;  3CL3 D;  1YTZ I;  3M9B A;  1OXZ A;  2M3B A;  1NH4 A;  1Q81 H;  4JF7 A;  3MUD A;  2FFD B;  1IO4 A;  4N78 E;  1MFZ A;  1NO4 A;  1NWQ A;  1T2K C;  3V2R A;  2Z5H A;  5APY A;  3IFM A;  4AQR D;  1KQL A;  2IFN A;  1FOS F;  1M90 H;  4WY4 B;  1N2D C;  5IT9 M;  4W7Z A;  3SWF A;  1LTJ C;  1YTZ T;  2J58 A;  2WT7 B;  1N73 B;  1ZWZ A;  3V4W A;  3TSI A;  1GDT A;  4N3Y B;  2YNY A;  1ZR2 A;  3OBW A;  2R3C A;  3HD7 C;  3V2P A;  1LTG C;  1DH3 A;  4XCQ A;  3CCE F;  1NHL A;  1VQ9 F;  4DZO A;  1NJI H;  2O01 H;  4WBA A;  2FFD A;  3BAT A;  1GU5 A;  4JYC A;  3KPE A;  1RA4 A;  1HUC A;  3II6 A;  1CSB A;  5CCG C;  1HVV A;  3L4F A;  5CCG A;  3HE5 B;  1YJW F;  4WY4 C;  4LC1 A;  3MTU E;  1N7L A;  1T3U A;  2W6A A;  4WY4 A;  4I6M C;  3VYI A;  1N73 C;  1YJ9 F;  3VOP A;  1N73 A;  2WT7 A;  4N78 D;  3NMU C;  1G2C B;  3OA7 A;  1IFM A;  3LWV C;  2R5B A;  1SQB K;  1LTI C;  1RF0 C;  3J81 M;  3HE4 B;  3LID A;  2C0W A;  1J1E C;  5APX A;  3R2P A;  1FZA A;  3N4Y A;  1FZE A;  2NPS B;  5KLV K;  1Q7Y H;  3RK2 D;  5FLX M;  4W7Y A;  2WPS A;  3RA6 A;  2ZFC A;  2QM7 A;  4X3M A;  3E20 B;  4WB4 A;  1URQ B;  3CD6 F;  3HE5 A;  1NTK K;  3RA5 A;  1K73 H;  2I1K A;  1JOC A;  1N7S B;  2A45 H;  2YKO A;  4X3L A;  3NXS A;  5AW8 B;  1QL1 A;  3M0D C;  1FZB A;  1Q86 H;  5EWR A;  3M0D A;  1G2C A;  1PXW A;  3M91 A;  3G4S F;  2IPP A;  3WMM 0;  2ALE A;  2HYN A;  4NQ3 A;  3CLQ A;  3HE4 A;  1KFN A;  1H8A A;  3LWP C;  2OYI C;  1GK6 A;  1EQ7 A;  2NPS C;  1KZU B;  2OYI A;  2NPS A;  5HY1 A;  1FJK A;  5HY2 A;  1IFD A;  2P2U A;  4IFF A;  5AW7 B;  1KQS F;  3CPW F;  2IFM A;  4HH2 A;  1IPA A;  3P8C E;  4EI8 A;  2M8R A;  4RES B;  4EI7 A;  3UIA A;  3WXM B;  2JEE A;  1NMU B;  3G6E F;  1W2E A;  5EO3 A;  2R32 A;  1RE3 C;  1URQ A;  1VQO F;  5KJ7 A;  3L35 A;  1L0L K;  1RE3 A;  1SVF A;  2YO2 A;  1N7S A;  3M06 A;  3U59 A;  4XE5 B;  4IFM A;  2N1T D;  3P8M C;  4GT1 A;  1LT9 C;  2XV5 A;  2CZW A;  1FDM A;  1OWA A;  1X8Y A;  4C7R A;  2IX7 C;  1GD2 E;  4EOT A;  1A02 F;  3TK1 A;  3B5N B;  3N4X A;  1J1D C;  3NFQ A;  5HXZ A;  1IC2 A;  2YKQ A;  5HWE A;  3CCU F;  1JY2 P;  1JJ2 F;  5HY0 A;  1HWT C;  1W2B F;  1VDF A;  2HG5 D;  5AVY B;  3HUS C;  3M9Q A;  1Z56 A;  1KIL D;  1HJB A;  1NAF A;  1JY2 N;  1E5W A;  3C9I A;  3KYQ A;  1LTJ B;  4B86 A;  3OW2 F;  5AVU B;  3J80 M;  3RK2 C;  1GO1 A;  3HJW C;  1VQM F;  1GK4 A;  3V2Q A;  1JUN A;  3HD7 B;  2WZ7 A;  3GHG B;  3OAK A;  2XDJ A;  2GUS A;  2H43 A;  1KC8 H;  1T8Z A;  1ZR4 A;  4ZKU A;  3RK3 D;  1JY3 O;  5APW A;  1VQP F;  3B5N C;  2PAJ A;  4I1L A;  1M7L A;  3B5N A;  2O1K A;  3TYY A;  2OTL F;  5BVZ A;  1K8A H;  2HVY D;  2WWW A;  5AW2 B;  1YI2 F;  1SP4 A;  4GIF A;  2BAS A;  1A02 J;  1L4A D;  3CI9 A;  3CCQ F;  3CCV F;  2KTV A;  2ZXE B;  1JNM A;  2HPC B;  1GW3 A;  1MV8 A;  1QVF F;  1LTJ A;  2R5D A;  5BU5 A;  5APV A;  3OJA B;  3MCA B;  2I1J A;  4I2L C;  5CCH D;  2XZR A;  1J1E B;  3BRV B;  3AGK A;  3ON1 A;  3SIV A;  3GHG C;  3VMX A;  3HD7 A;  2CPB A;  3GHG A;  5APT A;  1S72 F;  2KP8 A;  3V7Q A;  1IFJ A;  3O85 A;  2N1T C;  4XA4 A;  5GAN K;  1IFI A;  3NTN A;  1W40 A;  1MZ9 A;  3I56 F;  1SFC D;  3HTK B;  1RF1 B;  2BO1 A;  4C46 A;  1RLG A;  1X9V A;  5AW9 B;  3G71 F;  3V5B A;  2HPC A;  1VPC A;  1KD1 H;  3A2A A;  1KIL C;  1GL2 D;  1T0K B;  2JNB A;  4C4W C;  1RF0 A;  3CCL F;  1SQQ K;  5KJ7 D;  2YKP A;  2A45 G;  2OYI B;  3P7K A;  3CCM F;  1RE4 C;  2LKM A;  1FAV A;  1J2J B;  2CPS A;  3I5C A;  5HY4 A;  1WT6 A;  2KYV A;  1G1I A;  1RE4 A;  3RL0 D;  2KOG A;  1ZLL A;  1WRG A;  1GZ0 A;  2Q7C A;  1E7K A;  1GTW A;  4Y99 C;  3LWQ C;  1AFO A;  5GIO C;  5AVT B;  2GM4 A;  2F9Z C;  3CC2 F;  4LLH A;  5KTB A;  1RF1 C;  2QI2 A;  1JTH B;  3VTP C;  3HTK A;  1RF1 A;  2VGN A;  1JCC A;  5A2Q M;  5AVV B;  3V4Q A;  5G4U C;  4C7N B;  1JCD A;  2VRS A;  1LT9 B;  1L0N K;  1L4A C;  3IR9 A;  1LWU C;  1FOS E;  3NK7 A;  3V7E A;  5AVS B;  4ZKP A;  1J1D B;  3VMF B;  3T97 A;  3CXC F;  2XNX A;  5CCH C;  3HUS B;  5CJ4 A;  1YJN F;  1YHQ F;  3MIW A;  5AW6 B;  2Q9I A;  3NK6 A;  1JMM A;  3TNU B;  1JTH A;  3VN0 A;  1X79 B;  3RK2 B;  1NTZ K;  1MUU A;  1CN7 A;  4LCK A;  4C7N A;  1SFC C;  1KFM A;  1LT9 A;  3LIE A;  2JJL A;  3KDP B;  2HOD B;  2VGM A;  2HFE D;  1LTT C;  2YMY A;  1VQ4 F;  3SWY A;  5GAP K;  1GL2 C;  2FYZ A;  3SIU A;  2J59 M;  3U1C A;  1ZV8 A;  3A7O A;  3OBY A;  3HUS A;  3P32 A;  1NU1 K;  5FJ4 C;  5G4V C;  2E42 A;  3TNU A;  2C9L Y;  1X52 A;  1S9K E;  1DT9 A;  1SLQ A;  5CCG D;  1NOH A;  1JY2 O;  2L5G B;  1AQ5 A;  3LWR C;  1QL2 A;  4WY4 D;  3P8C D;  3JAM M;  3LWO C;  5CJ0 A;  2P1J A;  2OAR A;  3D00 A;  2HOD A;  1FZC B;  2W6B A;  2N1T B;  2FKW B;  1NKZ B;  3MD0 A;  4BW0 B;  2POH A;  3KQG A;  1SDS A;  2WSF H;  2FC3 A;  1LTS C;  1G1J A;  3V3T A;  5AW4 B;  1FBM A;  2OTJ F;  3E1I A;  5AVZ B;  1HH0 A;  5APQ A;  5AVR B;  3E1Y A;  1SQP K;  3O8Z A;  1KIL B;  3BAS A;  4EIJ A;  2FXM A;  4BVT A;  1HBW A;  1N86 A;  2XU6 A;  5GIP C;  1FZC C;  1IK9 A;  4BVQ A;  1VQN F;  1FZC A;  1X7P A;  1S9K D;  4OH8 B;  2N1T A;  4Y99 B;  5AW5 B;  4DOJ A;  2MJZ A;  4GKG A;  1VQK F;  2NPS D;  3RK3 B;  2KB7 P;  4KHX A;  4NUT A;  3A3Y B;  1XTC C;  2WTY A;  1M1J C;  3CC4 F;  4BVR A;  1W3E X;  3CME F;  1NTM K;  1M1J A;  1NKN A;  4AYC A;  1GU4 A;  1JO5 A;  1XBI A;  2LBX A;  3GYQ A;  3N4Z A;  3I55 F;  5AVW B;  1CI6 B;  1YIT F;  1KIL A;  1L4A B;  1URQ D;  1LWU B;  3PP5 A;  2FFD C;  1CW5 A;  2I6D A;  1SQV K;  3G3Z A;  1YIJ F;  4BY9 D;  1LTA C;  1N7S D;  3EFG A;  2GLZ A;  1VQL F;  1VQ6 F;  1H89 A;  2WPR A;  3H32 B;  3N7N A;  2N9B A;  2LBW A;  3EQ2 A;  2OHW A;  3PAF A;  1HTL C;  3BVH A;  1FJP A;  2C0X A;  3V2N A;  3CCS F;  3RK3 C;  2WIT A;  2C9N Y;  2QM8 A;  4TZZ A;  1VQ7 F;  1DX7 A;  5BU8 B;  5APU A;  3L37 A;  1VQ5 F;  2E43 A;  1SFC B;  2P67 A;  1RY3 A;  1N8R H;  1CI6 A;  3JCM M;  3CCR F;  1L4A A;  1LWU A;  3U1A A;  4JYB A;  5HXU A;  1CZQ A;  1PFI A;  3VI6 A;  1IJD B;  3CCJ F;  4N6J A;  3NVI B;  3H32 A;  2AIF A;  3VP9 A;  1K9M H;  1GL2 B;  2YO3 A;  1Q82 H;  2FYU K;  5CCH A;  2Z4E A;  2WAL A;  2OYH B;  3NMD A;  4LGD E;  3HRN A;  1IFN A;  2H8P D;  1YYC A;  3L36 A;  3B5N D;  3RL0 B;  1XTG B;  1FZG A;  2WSE H;  2OZB A;  1T2K D;  2WSC H;  1DEB A;  1LTB C;  2A45 I;  3LW5 H;  1X7O A;  4AUW A;  5AW1 B;  3VP8 A;  3A5T A;  3CMA F;  3CG6 A;  1SFC A;  2Q5U A;  3LFO A;  4EI9 A;  5DCV A;  2QEX F;  2PP6 A;  3VMZ A;  1W42 A;  4IFD K;  2P7J A;  3HD7 D;  1GL2 A;  1URQ C;  1T3J A;  5KJ7 C;  1VQ8 F;  2W27 A;  4HYT B;  5CMZ A;  2OYH C;  1W41 A;  1N7S C;  2FGY A;  5AVX B;  2OYH A;  2KG4 A;  5AW3 B;  1CK2 A;  1M1K H;  5GIN C;  3RL0 C;  3NVK E;  1FZF A;  2O1J A;  3B8E B;  5AVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...