3IR9A

C-terminal domain of peptide chain release factor from methanosarcina mazei.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
AYTDESGLSELVNAAGEKLQDLELMGQKNAVRDFFKELIADSGKVAYGESQVRANLEINSVDVLLLSEDLRAERVTTKCSVCGYENKWTRRWKPPAPAAGNCPKCGSSLEVTDVTDIVDEFSELADKSNAKVVFVSTDFDEGSQLMNAFGGIAAILRYNTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Peptide chain release factor subunit 1
publication title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei.
rcsb
source organism Methanosarcina mazei
total genus 48
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ir9A01
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ir9A02
3VYIA 3CPWF 2N9BA 1MV8A 1S9KD 3CXCF 5AW2B 3CCSF 4TZZA 2I6DA 3P8MC 2P7JA 4JYCA 5GIOC 1K9MH 3FFMA 3CCQF 3MGNA 2HVYD 1Q82H 2ZXEB 3M0AA 5GAPK 3CCVF 1ZWZA 1GTWA 2QM7A 1HJBA 1N8RH 4DZOA 1VQOF 5AW7B 3J7AR 2E42A 1IO4A 5FJ4C 2WT7B 3V7QA 2P67A 5GANK 5G4UC 2VRSA 3L36A 3L35A 5DCVA 2BASA 3CCMF 2FC3A 3VMXA 2W27A 2WPSA 1VQMF 2IPPA 1JJ2F 1M90H 1GO1A 3V4WA 1HWTC 3NXSA 2Z5IA 1Q86H 2H7HA 1KQSF 5EO3A 1VQ9F 4X3MA 3NK7A 1KC8H 1YJ9F 2CZWA 2LBWA 3VN0A 4B86A 5AVTB 2WTYA 2YO3A 3LIDA 2ZFCA 3SWFA 1T0KB 5IT9M 3J81M 2R5BA 1FOSE 2KG4A 3NK6A 3CCRF 1T2KC 3TNUA 4GT1A 1H7MA 3KDPB 3P32A 3GYQA 1VQ5F 1W2BF 2Z5HA 2QM8A 2Q5UA 3KQGA 2R3CA 3RA6A 1SP4A 1VQPF 1VQNF 1CSBA 2R5DA 1JNMA 2YNYA 3CCLF 1K73H 1YI2F 3LWQC 5A2QM 1CK2A 1YJNF 5AW8B 3TYYA 2YO2A 1NWQA 1GK4A 3JCMM 4AQRD 1GZLA 2WPRA 3B8EB 3AGKA 1SDSA 1A02J 5AW1B 1W41A 1T2KD 2WT7A 5AW9B 3HAXD 2XV5A 3OW2F 1PXWA 5GIPC 1CN7A 1KQLA 5AVWB 1M1KH 3I5CA 2VGMA 1G2CB 1QVGF 4KHXA 5APYA 4BW0B 3G4SF 3MD0A 4GKGA 3CCUF 3PLAC 4C7NB 4I6MC 3A7OA 3L37A 1K8AH 5AVXB 5AVUB 3M9BA 5AVZB 1H8AA 5FLXM 3T97A 5GINC 3CCEF 3V7EA 2WALA 4AYCA 1Q81H 2WPQA 3VMZA 1HUCA 3LWPC 5APSA 1YJWF 2XZRA 1E7KA 3UIAA 3LFOA 5EWRA 3P7KA 1X8YA 5AW5B 3HTKA 1W3EX 5APQA 1W42A 4C4WC 1JUNA 2E43A 1VQ7F 3HE5B 1GO0A 1VQ4F 4X3LA 3M0DA 5APTA 3NMDA 4I2LC 3G6EF 4NUTA 5APVA 5APUA 3O8ZA 1GZ0A 1X7OA 1VQLF 4LC1A 3N4ZA 1OXZA 2Q3IA 1NMUB 1A02F 3CC7F 2OTLF 5CMZA 3LWOC 1DH3A 4HYTB 2P2UA 1IPAA 4XE5B 2JNBA 4RESB 1GU5A 3LWRC 5AW3B 5G4VC 3CC4F 3OBWA 5AVYB 2C9NY 3NVIB 3CD6F 2C9LY 1VQ8F 4M3LA 3NTNA 3CCJF 4JYBA 4C46A 3CMEF 3N4YA 5APXA 3NVKE 3E20B 1YIJF 1S72F 2Q7CA 3SIUA 3CC2F 3VMYA 1H89A 3PAFA 3JAMM 3A3YB 1W40A 1SLQA 2WWWA 1Q7YH 3G71F 4C7NA 3VI6A 3SIVA 1DT9A 5AVQB 5AW0B 3M9HA 1KD1H 5AW6B 2JJLA 3E1YA 1NAFA 3V5BA 1H88A 3CMAF 2VGNA 2W6AA 1FAVA 2ALEA 2QEXF 1S9KE 3J80M 1YHQF 3RA5A 4LCKA 1QVFF 1HBWA 3A2AA 2OTJF 3WXMB 1J2JB 3NFQA 3CG6A 3A5TA 3VMFB 3O85A 5AVRB 2QA4F 3NMUC 1MFZA 1RA4A 1OWAA 4AUWA 2KP8A 1GK6A 3HE5A 1VQKF 3OAKA 3LWVC 3CPQA 1MUUA 5AVVB 3MCAB 2LBXA 3ON1A 1YITF 1YYCA 1CI6A 3IR9A 3HE4A 4BY9D 2R32A 1X7PA 2QI2A 3M06A 5AVSB 1CZQA 2KTUA 1VQ6F 1CI6B 4EOTA 3HE4B 2OZBA 2KTVA 5APWA 2OHWA 1NJIH 2XU6A 1RLGA 3OBYA 1GD2E 3LIEA 1GU4A 3I56F 2BO1A 3TNUB 1FOSF 1XBIA 3M91A 3TK1A 3VTPC 3V4QA 2AIFA 3I55F 1X52A 3HJWC 5AW4B
chains in the Genus database with same CATH superfamily
2HPCB 1K05A 3VYIA 2NMUA 3CPWF 5KLVK 1URQC 2RHJA 4KWEA 2ZYGA 3HUSB 1EZVG 2WSSH 1VK3A 1S9KD 4X1YA 4K3AA 1XHOA 3G9RA 5AW2B 1FZGA 2NRGA 3CCSF 1ODEA 3WUUA 3P8MC 4X1YB 4B5CA 1Q82Q 5IYZB 1SQBJ 2HVYD 1FNKA 3M0AA 5GAPK 3CCVF 1ZWZA 1N8RQ 3E1IA 1EZVE 1ZP0C 4WBNA 3C9IA 4Y99C 2B33A 5AW7B 1VQOF 3H1KG 3J7AR 2E42A 4NWOB 1UFYA 1IV3A 2FYZA 4WBNB 5GANK 2KLVA 4BT7A 3PHLA 1GX1A 4E6EA 5AVMA 3MHVA 1SQPJ 1LTTC 3W67A 2W27A 3V3TA 1AV1A 3L71D 5H2FH 1QL1A 2QRXA 1GO1A 2IG8A 1URQD 2WSCJ 1Q86Q 1JY8A 1HWTC 2HODA 1L0LK 2YIUC 3NXSA 3AE2C 2C0WA 1DEBA 3VOPA 1L0NK 1KC8Q 2IQQA 5HY4A 2Q1YA 2HODB 2OTLP 1BE3D 3L74G 1S4XA 1NGMB 1URQB 3C8VA 4PWTA 3ZOPA 3LIDA 3VOAA 3K5BA 4K35A 1YJNP 4LLHA 5CB4A 1FOSE 1L4AB 3A0HE 5B66H 2ZAUA 2Q6QA 2HRYA 3L74E 3RYFB 3HKCB 4IOIH 3K2XA 4U3FG 2GZLA 4OWFA 1LP1A 3AEFC 1Z5VA 3KDPB 2KS1B 1OFUA 2FFDB 1USEA 3E22B 4EIJA 1SQVD 1HGVA 5JH7B 3KQGA 2ZOVA 2JO1A 4JF7A 2AIZP 1KQSO 1JY3N 4HNAA 4U3FE 3H1KJ 3R0PA 1CSBA 2FXMA 4ZHQA 3II6A 5EYPA 3AEEC 4X20A 3CCLF 1K73H 1SS1A 3LWQC 2YIUB 5EYPB 1IFDA 3N2KA 1YJNF 2YO2A 1GK4A 3VIUA 2BCCG 3V2QA 3PP5A 1E79H 1FDOA 1NTKK 2FYUD 2M5AB 3USSA 1A02J 2OARA 4EYYQ 5AW1B 1IFPA 1Y8AA 3PLNA 3AE6C 4L76A 4FFBA 4XCQA 3W68A 3L74J 2BCCE 3H32B 3E1RA 4BRYA 1PXWA 3A0BE 5CCHC 4UB6H 1KNJA 3RYIB 5JVDA 1KQLA 2IFNA 5AVWB 3KJJA 2H8PD 1IFIA 1M1JB 2ZT9C 2OYOA 5E79H 1PZQA 5APYA 5CA0B 4BW0B 1RLUA 4GKGA 3PLAC 3A7OA 4U3FJ 2BEZF 3GF7A 1H8AA 4PD4D 1NTMK 1MKMA 1J1DC 4I4TA 2WALA 1OW7A 1TU3F 1QD9A 1KYOH 3S1KA 2LR2A 3JATB 3AE9C 4YJ2A 2KOGA 2AEFA 3VP8A 4I4TB 2XZRA 1E7KA 1DEEG 5JQGA 5EWRA 4KT0J 5KX5A 3VYSC 1PGJA 3M4SA 1USDA 5TJHA 1W3EX 3TSIA 1RF1C 5CCHD 4I7ZB 1WRGA 2E43A 1FZFA 2BCCJ 2H8CA 2W6BA 1GO0A 3ZDMA 2XDJA 3PRJA 2ZT9D 1QVGO 3CMEP 1N7SC 3NMDA 2UYNA 1J1EC 1X79B 3V2NA 1NAYA 2DW3A 4D6TG 1EZVI 4R4MA 3F0FA 1M7LA 1YGYA 1ZR2A 1FZBA 2ZT9B 2K9YA 1H0TB 2VAMA 1NMUB 3CL3D 5CMZA 3Q5PA 2HS4A 3LWOC 1KILE 1DH3A 1AFOA 1W5BA 1IC2A 4D6TE 1FBMA 3JAKB 4RESB 3KPEA 3IAOA 2JWDA 3LWRC 5AW3B 1P84E 1J1DB 3CMAP 3C9RA 5AVYB 3TGUD 2IX7C 4O4IB 3CD6F 2CHSA 4M3LA 3R2PA 2AMTA 3H1JD 5TISE 4JYBA 4ZOLA 3CMEF 1RF1A 3N4YA 4WWIA 3VO8A 2KGWA 2QA4P 3HRNA 3EWKA 2V9YA 1N7SD 4O2BB 4I1LA 1H89A 3B71A 3O6QB 3KZIE 1LJ2A 2H43A 1JOCA 1W40A 3BATA 1JD1A 1JY3O 3KJKA 3SIVA 1DT9A 1YITP 1N7SB 1VHAA 2P58A 4PV1D 1J1EB 4N78E 5DJUB 5HY0A 2W8BC 2QTPA 2JJLA 1X22A 2PRRA 2Z1TA 1JFFB 3V5BA 1UIXA 2L91A 2Z01A 3CMAF 3L75D 5KLVD 1FAVA 2ALEA 2AEMA 4W7ZA 4PV1B 1S9KE 4D6TJ 3F89A 3GLMA 3VCZA 2IBZD 4WY4C 1U43A 1HBWA 3A2AA 4NPFX 1U7MA 2RHOA 3CG6A 1JCCA 2JEEA 3WGNA 2QA4F 3NMUC 1EC5A 1FC2C 2N1TC 1ZXGA 2KP8A 1FJKA 4YJ3B 2AEJA 4EB6A 1QEXA 5GTHE 1IFMA 3L71G 3LWVC 2HR3A 5EFWB 1MUUA 5AVVB 1GL2C 2LBXA 1YITF 3HKEB 3IR9A 1OFCX 3GHGC 4EI2A 2R32A 2HS3A 1BE3G 2R3SA 4EOTA 3AE7C 3L71E 4I50A 2OHWA 2PHNA 1WMKA 2QG4A 2D2CC 1SQQK 1L0LD 5ITZB 3WJRA 5BMVA 3M1XA 2BO1A 1QVFO 4WY4D 1BE3E 5C8YB 2J59M 1XBIA 2VXYA 1X0TA 3VTPC 2KSJA 2N1TD 1QL2A 2PAJA 1JTHB 4WY4B 3T80A 3JCUE 2N1TA 1SQVG 1X52A 5AW4B 5KAFH 1JN1A 3H25A 1J7HA 1L2PA 1VQMP 1GL2D 5EZYB 2DT4A 4WVZA 2WSFJ 2L5GB 1XRGA 3CXCF 1GL2A 2OYIC 3B5NC 4U3JA 1K9MQ 2M3EA 1RF0C 4JYCA 1OVRA 3PJSK 4O2AB 1SQVE 3GHGA 3FFMA 1YJ9P 1VPCA 3UT5B 2O01H 3WU2E 1Q82H 5GTIE 5FNVA 5B8FA 4ZKPA 3CXHH 4C8EA 4TV9A 2PGDA 2D2CD 3HKDB 2K9JB 1N8RH 2FYUG 2H89C 3L71J 4DZOA 3CXHI 1UI9A 4DCKA 3Q5RA 2D2CB 3CCMF 2JP3A 1BE3J 3S9OA 1NOHA 3WUVA 4C81A 2WPSA 2FYUE 1SZQA 4RQOA 4C8IA 1VQMF 1NTKD 1YTZI 1JEKA 4F6RB 1JJ2F 3CPWO 2JR8A 4YTPC 3D00A 5HP7A 2Z5IA 3HKBB 3HUSC 1Q86H 3RYHA 5EO3A 2WITA 2FY8A 3NK7A 5HY1A 1KC8H 1P84I 1GMJA 1LTJA 1YJ9F 3AEAC 2CZWA 3B5ND 4W80A 1VQNP 5TISH 2OYIA 4B86A 3RYCB 1NTZK 5AVTB 3F0GA 4G4YA 1YTZT 4O4HB 2R44A 2ZFCA 5J2UA 1NYHA 1SQVJ 2KYVA 2WSEJ 3B5NB 2ZF8A 5IT9M 3J81M 1JB0J 2FBWC 3KZIH 3AEGC 4H0LB 2KG4A 4QMAA 3TNUA 4BT2A 4PD4E 4Y28J 1W59A 3HTKB 1NTMD 2OGUA 2RHHA 2FGYA 1LT9B 4C82A 3L73D 1H7MA 1W57A 3P32A 4PJ0H 3GYQA 3S03A 2B89A 4OGQB 1IV1A 3AE8C 1R5LA 3IKEA 3FXDA 1FFXB 5KAIE 2KNCB 2R3CA 2FYUJ 4N6JA 2HPCA 1SA0B 3K0TA 3H1LD 3RA6A 3ZO8A 1SP4A 1VQNF 1LWUC 2MKVA 5LYJA 5LXTB 3HUSA 3KYQA 4GDOA 2Q9IA 1U57A 3AE4C 4ZHVA 3F0DA 3CCUP 5A2QM 5LYJB 2EWCA 5IJ0A 3JCMM 1BGYD 2ZVZA 2K1AA 5IYZA 4ZHYB 3B8EB 2DYYA 3AGKA 2WSFH 3JALB 4BVTA 4LGDE 1CLIA 1R5SA 1FS0E 5IJ0B 3D54A 1L4AC 1DD4A 2C0XA 5JCOC 2OTJP 4DRXB 5AW9B 2CHTA 1YJWP 3HAXD 3TGUG 1PF5A 2CWJA 1LTAC 3H1HD 1HVVA 4B45A 1EXIA 2RN0A 2FFDC 3H1JG 2H8EA 5KMGB 2LCAA 1G2CA 2Z1UA 1QLED 3P0ZA 1HGZA 5CBNA 3I5CA 2VGMA 1QU9A 1G2CB 3TGUE 1VQ4P 3K14A 3MD0A 3CCUF 3VYTC 1ZRTD 3H1JE 3G6EP 1LWUA 4HB1A 1ZV8A 1JO5A 2UZHA 3VP9A 1URQA 1Q81Q 1LWUB 4GIFA 3LWPC 5DJTB 3L75G 2JDIH 5APSA 3PH0A 5KLVG 1YJWF 1L4AD 2YXZA 2FXOA 1ZW0A 2JKVA 3UIAA 3JC22 5KKZB 1X8YA 1L4AA 4BT4A 3RYFA 3HKCA 2IBZG 1BDDA 1S1CX 5JCOA 2UYPA 1NQ3A 3AE1C 1U7JA 4C4WC 3JAWA 3MIWA 5J2TB 2KS1A 3L75E 1FDMA 2FFDA 5KLVE 3CCJP 3E22A 3HE5B 4OVNF 2Z1FA 2KLUA 1VQ4F 1M1JC 3JAWB 4G4VA 3RGUA 2E76C 2MQEA 2E5TA 5JH7A 2NPSD 2QJPC 3G6EF 4C8GA 2IBZE 4RHAA 3RK3C 3V2RA 1GZ0A 2QIWA 1S72P 1X7OA 4LC1A 3TGUJ 3EORA 4H44C 1KV4A 2A45H 2NPSB 3CX5H 2Q1KA 2OTLF 3H1JJ 3G71P 2A45I 3CX5I 1IPAA 2HFED 3QUWA 4YXWH 3TD5A 1RE4C 2ITAA 1L0LG 2M5AA 5G4VC 2OTKE 2C9LY 1SFCD 2WMMA 3NTNA 1YHQP 3CCJF 4I7ZC 4ASWA 1SQXK 3H32A 5BU5A 3D6YA 1W5CE 2Y9ZA 1L0LE 1SQQD 3RYIA 2GA1A 1COMA 1JY2P 5KTBA 3E20B 1SFCB 4EI8A 2Q7CA 2E76D 1S72F 3L75J 1R1MA 3TDKA 5KLVJ 1M1JA 1W2BO 2UWJE 3OJAB 3RK3D 5KJ7C 4TUYA 3JAMM 2ZJSE 1IFNA 1UIIA 4G88A 3GW6A 5CA0A 1SLQA 3G71F 4PD4H 4H44D 1E5WA 4TV8B 5AVQB 1KD1Q 4TUYB 2E76B 2QJPB 3KE1A 3D71A 1RQ2A 2AXTE 4PD4I 3RK3B 3E1YA 1LT1A 1NAFA 1FZAA 2HS0A 3P8CD 2OYHB 2W6AA 5KAIH 4H44B 1KORA 3JATA 2V7QJ 1EDKA 2J58A 1RE4A 1GW3A 3J80M 2WSCH 1YHQF 2HQSC 1NU1D 4LCKA 3V6IA 1FNJA 3NFQA 3JVHA 3P10A 2HYNA 3DC2A 3C9UA 5CCGC 3KHNA 4NQ3A 4AUWA 4TLFA 1NTKG 3FWLA 3OAKA 3F0EA 3S4RA 1L0LJ 1TVKB 3I55P 5HP8A 5KJ7D 1VL2A 3FWNA 3KIZA 4MN4C 2RHLA 3D6ZA 3ON1A 5CCHA 5CHXA 1YYCA 5KJ7A 1DBFA 1Y9BA 3M06A 4ZHWA 1CZQA 1H0TA 2KTUA 1KYOD 1NTKE 1IK9A 2KTVA 3WGMA 1W5EA 2V4HA 2XU6A 1JCDA 3OBYA 2MJZA 2GVIA 4PV1C 3JAKA 1GU4A 4ZK7A 1OVVA 2A06D 4N3YB 1PP9D 1KZUB 3WMM0 1S5LE 1EDLA 4O4IA 1NTZD 4IIJB 1NTMG 2HX0A 2O1KA 2G8YA 1LTIC 3L73G 5CCGD 3AECC 2FKWB 3I55F 3L70D 3HJWC 5CCGA 4I55B 2YXRB 2KZIA 4NPEA 4O2BA 2LXCB 3H1LG 3IN6A 1MV8A 3WGKA 3O6QA 1NTME 3ELCA 3IFMA 3U1AA 3P4EA 2K37A 3L73E 4HJGH 2YYEA 3CCEP 4TZZA 2I6DA 4UB8E 3WPXA 1K9MH 3A0HH 3H1KD 1N7SA 5LOVB 3IEQA 2HG5D 3SWKA 1BGYG 1IJDB 1NTKJ 3H1LE 1JFFA 2Q3EA 1GTWA 3BASA 2QM7A 4HH2A 3WJQA 2IZ1A 2F9ZC 3S06A 1IO4A 1D7MA 2WT7B 2P67A 3MZWB 2UYJA 4W7YA 4BT6A 2IBZI 2BEQD 2E75B 3MUDC 3L35A 2BASA 1KB9D 1BGYE 2FC3A 2HLOA 1U3LA 4IL6E 1N2DC 1AVOA 2IPPA 3S02A 1M90Q 1ZN5A 1OW6A 4YJ3A 3KXDA 3C9SA 3H1ID 2H7HA 3FBAA 4EDFA 1AQ5A 1FZCB 3H1HE 1VQPP 2LBWA 3HKEA 3T97B 1NTMJ 1VQVA 1R8EA 5EAZA 3L73J 2WTYA 2Q1XA 1EQ7A 5LP6B 1TUBB 3RK2D 2VAWA 2G9IA 1T0KB 2K3RA 2R6R1 1PGQA 5EB0A 4DOJA 3A0BH 2R5BA 1HJ0A 4YPCA 1LGHB 3H1LJ 1ZRTE 5ITZA 1PV3A 1RH5B 5GONB 1PFIA 1OW8A 3RK2B 3NK6A 2W90A 2ZVOB 2BTUA 2ZVYA 2Y0DA 5C8YA 4IFDK 1L0ND 3MP7B 4GT1A 1ZOYC 3CI9A 4ZI7B 1LTGC 1Z5WA 3ABVC 3HD7D 2E74B 1YIJP 1LTSC 2IAFA 1BGYJ 1JTHA 1OMIA 4CPGA 4WY4A 4X1IB 1NH4A 3RBZA 4U7JA 2YKOA 1VQPF 1RY3A 1DD3A 1VH8A 2R5DA 1ZR4A 5EZYA 3HD7B 1JNMA 1W55A 2LKMA 4DT0A 5EIBD 1AQTA 5H2FE 3LMEA 3G4SP 1CK2A 2O01N 4O2AA 1NWQA 3TYYA 1SQBK 3D70A 3UT5A 1GZLA 4DJGA 4RKUJ 2POHA 2GLZA 3GG2A 1RQUA 1FDIA 2XNDH 4A7PA 3HKDA 2K9JA 3S0WA 3BRTB 3CB2A 4H0LC 2Y9YA 1W41A 3MDOA 1PGPA 1JM0A 1LT9C 3L4FA 3D01A 5CBOA 3OW2F 1SQPK 2WPVB 5GIPC 4OGQC 3JARB 4LNUA 3VYUC 1CN7A 3M0DC 5B66E 3L72D 1M1KQ 1JMBA 2K88A 2I1JA 1XTCC 1SQQG 4F6RA 1LNQA 4LNUB 1Y47A 4BVRA 4BWNA 3HKBA 3F6MA 3G4SF 4C7NB 1K8AQ 4IFFA 1YQ4C 4I6MC 4L75A 1S5LH 5MN5A 1RQ7A 3M9BA 1SQXD 1P84H 1NHLA 3CXHD 1NKZB 1VQLP 2KIKA 1SQQE 3V7EA 3RYCA 4AYCA 3QWOC 1MZ9A 1Q81H 5K5GB 3HWUA 3CC7P 4O4HA 4JPZB 3RK3E 2W6JH 3B5NA 4H0LD 1RF0A 3LFOA 1JY2N 4XFJA 4O4JB 5AW5B 1IV4A 1U40A 1NU1G 3IMPA 1N73B 4UB8H 3HTKA 5APQA 1W42A 4O4LB 4OGQD 1X25A 1LT9A 3P8CE 1AVYA 2N48A 3JASB 3H6PA 2CPBA 4X3LA 3M0DA 4C7RA 1T8ZA 1FFXA 1KILB 3F5HA 4I2LC 2KNCA 2HRUA 1NU1E 1SA0A 2KB7P 5APVA 5APUA 1YQ3C 3O8ZA 3CC2P 4UB6E 1VQLF 3N4ZA 1OXZA 5LXTA 2Q3IA 2ZVNB 1A02F 1KFMA 3CC7F 2HP0B 5E79E 3K12A 3LYBA 2HP3A 1IFJA 5BVZA 2P2UA 4RO0A 3LW5J 1FSZA 2JNBA 3AE3C 1SQQJ 1WT6A 5B5EE 2CVLA 3JALA 4U39A 1Z56A 3GMAA 4ERHA 2K1SA 3EFFK 5KKZC 2JWAA 4Z1MH 1FU1A 2A06G 3OBWA 2QJKB 1PP9G 5GTHH 3I7TA 2P6YA 1IV2A 3NVIB 4DRXA 3M84A 1KYOE 5HY2A 3AEDC 4IHJB 1NTZG 4X1KB 5KMGA 3OONA 2Z1EA 5KLIC 3NVKE 2O3JA 1YQNA 3L70G 3G3ZA 3CC2F 3SIUA 2YKPA 2A06E 3B6NA 1PP9E 3VMYA 1JMMA 2NZ2A 3A3YB 4GOEA 1NTZE 2ZYAA 1Q7YH 1NU1J 4RJTA 2NPSC 1KD1H 3N7NA 1G1IA 2QJYC 5AW6B 3L70E 1ZMEC 3I3FA 4EI7A 3BYQA 3FD6A 2XKMA 1VQ6P 1DIPA 4G4WA 2M3BA 2J5UA 3IKFA 3CWBD 5C39A 2UYKA 3RA5A 3JCUH 3MBMA 2OTJF 1IZNB 3H1KE 3IEWA 1J2JB 3VMFB 3U59A 2Y0EA 2W83C 3O85A 5J2TA 1OWAA 3AE5C 1GK6A 4ZMDA 1SFCC 1KNKA 3HE5A 1CW5A 2WSEH 3V2PA 5L8RJ 3WU2H 5GTIH 3H1IG 1QAHA 3MCAB 1OIPA 5KLIB 3CCLP 1PP9J 1KB9E 3Q5SA 4BY9D 2PP6A 1X7PA 5AVSB 4WB4A 1NTZJ 1N86A 1VQ6F 2NPSA 3Q3DA 3S0YA 1XV2A 3BVHA 1T3JA 4G4XA 1KFNA 1NJIH 2OYHC 1RLGA 3H1IE 3L70J 2SPZA 2YMKA 3CCQP 3Q1MA 5CB4B 1GD2E 2QJYB 4Y99B 5EB1B 2OQQA 3TD4A 1LP1B 1PL5A 3M91A 3FX0A 3N2GA 1JY2O 3TK1A 3BCCD 3LW5H 1L0NG 3SFDC 1N7LA 2AIFA 5HWEA 5M1BA 3U1CA 3N2GB 3RBXA 5APTA 1T6AA 4HNAB 1SFCA 2LXBA 1BSNA 4ZHQB 1MFTA 2N9BA 2W8ZA 2ZAEB 3DDNA 4ASVA 2CPSA 3CX5D 4X20B 1L0NE 3WGJA 2P7JA 1VQ9P 4TV8A 1AA0A 5GIOC 4L74A 3N2KB 1Q7YQ 1T0AA 3CCQF 3MGNA 2IYOA 1BCCD 2ZXEB 4EI9A 2H6LA 3S0HA 1Q8RA 3FGAD 3JSVC 1HJBA 2OYHA 2M8RA 1EDJA 1H48A 1HH0A 5FJ4C 3H1IJ 3V7QA 4FFBB 5G4UC 1X9VA 2VRSA 3L36A 4BRYB 5DCVA 3BRVB 3CCRP 1H47A 1SQBD 5JVDB 3VMXA 1W2EA 2IDBA 1VF5C 3SSUA 1M90H 3L72G 5HXZA 5B5EH 2WZ7A 1VQ5P 1OZHA 4JQ0D 3V4WA 3ZP4A 2IYPA 1TVKA 1KQSF 1PPJD 1VQ9F 2I8DA 4X3MA 2N9YB 4NPDA 1KTMA 1W5FA 1PIXA 1SQPD 5KAFE 1KN7A 3VN0A 4ZNCA 1SQXG 3KHUA 1L0NJ 3L72E 1KQGB 1KYOI 2YO3A 1YI2P 4YJ2B 3SWFA 2G3AA 1FZEA 1BSHA 2I1KA 1RE3C 3R4YA 3CYPB 5JQGB 1NJIQ 3SFEC 5KX5B 3CD6P 1HF9A 1QX8A 3CCRF 1T2KC 1SQXE 2E75C 2ZXXA 3CXHE 3QTYA 2P1JA 2QE7H 4IIJA 4JBZA 2VAPA 1VQ5F 2CW4A 3C1LA 3N4XA 1W2BF 1VF5D 2Z5HA 2QM8A 3MTUE 2KZJA 2RMZA 2Q5UA 2UYNB 1M8OB 4XA4A 2R751 4I55A 3WPWA 3RE3A 1EZVD 5CJ0A 1FZCC 1VF5B 2GUSA 4HKZH 1K73Q 2AXCA 2YNYA 3GF3A 1EDIA 1YI2F 3PTZA 3B4SA 5HXUA 5LP6C 2H88C 5AW8B 3ZP7A 4B62A 5LOVA 3CYQA 4AQRD 2WPRA 1YBKA 1SDSA 3L72J 1RE3A 3RK2C 5MN6A 1T2KD 2WT7A 1KB9H 2E75D 1K04A 3RL0g 3L7QA 2XV5A 2RKLA 4ZOLB 2O01J 2PFXA 1KB9I 1SQXJ 1PGOA 1RF1B 2IZ0A 2E74C 1FE6A 3IF4A 1S5LX 2KXPB 3HTNA 2GM4A 1M1KH 1VQ7P 3H1HG 3OA7A 3WJPA 1LTBC 1QVGF 2V7QH 4KHXA 1OAPA 1GDTA 3HD7C 4PJ0E 2RB9A 3Q8HA 3ITKA 3L37A 3L74D 1FZCA 1K8AH 1G1JA 5AVXB 5LA6A 5AVUB 5AVZB 5FLXM 3T97A 5GINC 3CCEF 1JY3P 5LP6A 5LA6B 2WPQA 1TUBA 3VMZA 1HUCA 1KQFB 4G4ZA 1SQVK 3FPIA 5EIBC 3SWYA 3CWBG 3P7KA 3MCQA 4U3FD 3Q2YA 5GONA 3ESJA 3OW2O 4BT5A 4BVSA 3E7KA 3CC4P 2WQYC 3WGLA 1JUNA 1NKNA 2E74D 1VQ7F 2B9BA 1W581 5CA1A 1VQ8P 4ZI7A 2O1JA 4EB6B 4BVQA 3TD3A 2BTOA 3CWBE 3WUTA 3FD5A 2AXTH 3MUDA 5CA1B 4X1IA 2FYUK 4IL6X 4NUTA 1T3UA 2BTQB 1ONIA 4ZKUA 5BU8B 3HD7A 3U0OA 4O9BA 2CSLA 4L73A 4I50B 2BCCD 4H13C 3EQ2A 1VDFA 2LBTA 1QGKB 4HYTB 1NO4A 4XE5B 2IFMA 4WBAA 1GU5A 3H1HJ 2QVAA 1HTLC 2YKQA 5BMVB 3CC4F 2QEXP 3GHZA 2YXQB 1N73C 2C9NY 2I6RA 3CCMP 2P10A 2Y0CA 4YXDC 4OH8B 1VQ8F 2KUBA 4BT3A 2QSIA 4GODA 1OVUA 3MQWA 3BCCG 4C46A 2N1TB 3JARA 1LTJC 2WVRA 2KI7B 5APXA 5MN4A 2KK7A 2CK3H 1S2EA 2YMYA 1YIJF 3LDTA 1KILC 1NU1K 3PAFA 3QHDA 3CWBJ 1VQKP 1GL2B 2WWWA 2A45G 3BCCE 4U3JB 4C7NA 4BXLA 2ZYDA 3VI6A 5AW0B 3M9HA 3GHGB 3FXEA 3RL0C 3C9TA 4H13D 5FNVB 4TV9B 2PMPA 3EFGA 1M56D 2B88A 1BCCG 1H88A 2XNXA 1AJYA 4M8IA 2B87A 2VGNA 2L26A 2QEXF 1M57D 3CLQA 2FYNC 1EXJA 4DXDA 3CX5E 4H13B 2B87B 2QJKC 1SVFA 2FXPA 4O4JA 2KSEA 4IFMA 1QVFF 2GUVA 3I56P 3WXMB 1XTGB 1N73A 3A5TA 1RQVA 1BCCE 3M9QA 5AVRB 1DX7A 1S3JA 4R4LA 4R40B 1MFZA 3GTZA 1RA4A 1SQBG 4O4LA 4GOFA 3JASA 2Z4EA 1KILD 3VTIC 1VQKF 3V4DA 3CPQA 3RYHB 4D6TD 4KJMA 1KILA 3TF5A 1LTJB 1P84D 1PPJG 5CJ4A 1OX3A 1CI6A 1Q90D 3HE4A 1W5AA 1SQBE 2OYIB 2OTMA 2QI2A 3RL0D 1SQPG 3BCCJ 3QH9A 1CI6B 3CCSP 3HE4B 2OZBA 5J2UB 1BDCA 2HP0A 2E5YA 5IJ9A 5APWA 1Q2NA 1KMIZ 3VOBA 3ERNA 1FJPA 1PPJE 1GW4A 3RL0B 4IL6H 5IJ9B 3LIEA 1RHZB 3I56F 3CCVP 4TT3H 3VMAA 2ZODA 3TNUB 1FOSF 1SQPE 1NVOA 1VQOP 3C8LA 2RH0A 2FYNB 1IK7A 3AEBC 3V4QA 1ZLLA 4IHJA 1U3PA 4N78D 1BCCJ 4X1KA 2M0BA 4B46A
chains in the Genus database with same CATH topology
2HPCB 3VYIA 3CPWF 1SFCA 5KLVK 1URQC 1GL2D 2N9BA 1MV8A 3HUSB 1S9KD 2CPSA 3IFMA 2L5GB 3U1AA 3CXCF 5AW2B 1FZGA 1GL2A 3CCSF 2OYIC 3B5NC 4TZZA 2I6DA 3P8MC 2P7JA 1RF0C 4JYCA 5GIOC 1K9MH 3GHGA 3FFMA 1N7SA 1VPCA 3CCQF 2O01H 3MGNA 2HVYD 1Q82H 2ZXEB 2HG5D 4ZKPA 4EI9A 3M0AA 5GAPK 1IJDB 3CCVF 1ZWZA 1GTWA 3E1IA 3BASA 2QM7A 4HH2A 1HJBA 1N8RH 3C9IA 2OYHA 4DZOA 4Y99C 2M8RA 1HH0A 2F9ZC 5AW7B 1VQOF 3J7AR 2E42A 1IO4A 5FJ4C 2WT7B 3V7QA 2P67A 2FYZA 5GANK 2KLVA 4W7YA 5G4UC 1X9VA 2VRSA 3L36A 3L35A 5DCVA 3BRVB 2BASA 3CCMF 1LTTC 2FC3A 1NOHA 2HLOA 3VMXA 2W27A 2WPSA 1W2EA 1N2DC 1VQMF 2IPPA 3V3TA 1YTZI 1ZN5A 1JJ2F 1M90H 5HXZA 1QL1A 2WZ7A 1GO1A 3D00A 1URQD 3V4WA 1HWTC 2HODA 1L0LK 3NXSA 2Z5IA 3HUSC 1Q86H 2H7HA 1KQSF 2C0WA 1DEBA 3VOPA 5EO3A 1L0NK 4X3MA 2WITA 1AQ5A 1VQ9F 1FZCB 3NK7A 5HY4A 5HY1A 1KC8H 1LTJA 1YJ9F 2CZWA 2HODB 3B5ND 2LBWA 4W80A 3VN0A 1URQB 4B86A 2OYIA 1NTZK 5AVTB 2WTYA 1EQ7A 1YTZT 2YO3A 3LIDA 3RK2D 2ZFCA 3SWFA 1FZEA 1T0KB 2KYVA 3B5NB 5IT9M 4DOJA 2I1KA 3J81M 1RE3C 2R5BA 4LLHA 1LGHB 1FOSE 1L4AB 1PFIA 2KG4A 3RK2B 3NK6A 1T2KC 3CCRF 3TNUA 3HTKB 4IFDK 2FGYA 1LT9B 4GT1A 2P1JA 1H7MA 3CI9A 3KDPB 2FFDB 3P32A 3GYQA 1LTGC 1VQ5F 3HD7D 3N4XA 4EIJA 1W2BF 2Z5HA 1HGVA 1LTSC 2QM8A 3MTUE 1JTHA 4WY4A 2Q5UA 3KQGA 1NH4A 4XA4A 2R3CA 4N6JA 2HPCA 4JF7A 2YKOA 3RA6A 1JY3N 1SP4A 1VQPF 5CJ0A 1RY3A 1VQNF 1CSBA 1LWUC 2FXMA 2R5DA 1FZCC 1ZR4A 3II6A 3HD7B 2GUSA 3HUSA 3KYQA 1JNMA 2LKMA 2YNYA 3CCLF 2Q9IA 1K73H 1YI2F 3LWQC 5HXUA 5A2QM 1CK2A 1IFDA 1YJNF 5AW8B 3TYYA 2YO2A 1NWQA 1GK4A 3JCMM 1SQBK 3V2QA 4AQRD 1GZLA 3PP5A 2WPRA 3B8EB 3AGKA 2POHA 2GLZA 1NTKK 1SDSA 2WSFH 4BVTA 4LGDE 1A02J 2OARA 1L4AC 3BRTB 5AW1B 1RE3A 3RK2C 1W41A 2C0XA 1T2KD 2WT7A 5AW9B 3HAXD 4XCQA 2XV5A 1X52A 1LTAC 1LT9C 3L4FA 1HVVA 3H32B 3OW2F 2FFDC 1PXWA 1SQPK 5GIPC 1RF1B 5CCHC 1G2CA 3M0DC 1CN7A 1KQLA 2IFNA 2GM4A 5AVWB 2I1JA 1XTCC 1HGZA 1M1KH 2H8PD 1IFIA 1M1JB 3I5CA 2VGMA 3OA7A 1LTBC 4BVRA 1G2CB 1QVGF 4KHXA 5APYA 1GDTA 3HD7C 4BW0B 3G4SF 3MD0A 4GKGA 3CCUF 3PLAC 4C7NB 4IFFA 4I6MC 3A7OA 1LWUA 3L37A 1FZCA 1K8AH 1G1JA 5AVXB 5AVUB 1ZV8A 3M9BA 5AVZB 1NHLA 1H8AA 5FLXM 1JO5A 3T97A 5GINC 1NTMK 1NKZB 3CCEF 1J1DC 3VP9A 1URQA 3V7EA 2WALA 1LWUB 4AYCA 1JY3P 1MZ9A 1Q81H 2WPQA 4GIFA 3VMZA 1HUCA 3LWPC 1SQVK 2KOGA 3VP8A 5APSA 1YJWF 3B5NA 1L4AD 2XZRA 1RF0A 3SWYA 1E7KA 3UIAA 3LFOA 1JY2N 5EWRA 3P7KA 1X8YA 1L4AA 5AW5B 1N73B 4BVSA 3HTKA 1W3EX 5APQA 3TSIA 1W42A 4C4WC 1RF1C 3MIWA 1JUNA 5CCHD 1LT9A 1NKNA 1WRGA 3P8CE 2E43A 1VQ7F 1FDMA 1FZFA 2FFDA 2O1JA 2W6BA 3HE5B 4BVQA 1GO0A 3H6PA 2CPBA 1VQ4F 1M1JC 2XDJA 4X3LA 3M0DA 4C7RA 1T8ZA 3MUDA 2NPSD 1KILB 2FYUK 1N7SC 3NMDA 4I2LC 3G6EF 1J1EC 1X79B 4NUTA 3RK3C 3V2NA 3V2RA 2KB7P 5APVA 1T3UA 5APUA 3O8ZA 1GZ0A 1X7OA 4ZKUA 1VQLF 4LC1A 5BU8B 3HD7A 1M7LA 3N4ZA 1OXZA 1ZR2A 2Q3IA 1FZBA 2A45H 4O9BA 1NMUB 1A02F 2NPSB 1KFMA 3CC7F 2OTLF 3CL3D 5CMZA 3EQ2A 1VDFA 3LWOC 2A45I 1IFJA 5BVZA 4HYTB 2P2UA 1DH3A 1NO4A 1IPAA 2HFED 4XE5B 1AFOA 2JNBA 1IC2A 2IFMA 1FBMA 4RESB 3KPEA 4WBAA 1WT6A 1GU5A 1RE4C 3LWRC 1Z56A 1HTLC 2YKQA 5AW3B 5G4VC 1J1DB 3CC4F 1FU1A 3OBWA 5AVYB 1N73C 2C9NY 3NVIB 2IX7C 3CD6F 2C9LY 1SFCD 4OH8B 1VQ8F 5HY2A 4M3LA 3R2PA 3NTNA 3CCJF 4JYBA 4C46A 1SQXK 3H32A 5BU5A 3CMEF 1RF1A 2N1TB 1LTJC 3N4YA 5APXA 2YMYA 3NVKE 1JY2P 5KTBA 3E20B 1YIJF 1SFCB 4EI8A 2Q7CA 3HRNA 3G3ZA 1KILC 1NU1K 3CC2F 1S72F 2YKPA 3SIUA 1N7SD 4I1LA 3VMYA 1M1JA 1JMMA 1H89A 3PAFA 3OJAB 3RK3D 5KJ7C 3JAMM 1IFNA 1GL2B 3A3YB 2H43A 1JOCA 1W40A 1SLQA 3BATA 2WWWA 1Q7YH 2A45G 1JY3O 3G71F 4C7NA 1E5WA 3VI6A 3SIVA 1DT9A 5AVQB 5AW0B 2NPSC 3M9HA 3GHGB 1N7SB 3N7NA 5HY0A 1G1IA 1KD1H 1J1EB 4N78E 5AW6B 3RL0C 3RK3B 2JJLA 3E1YA 1NAFA 4EI7A 1FZAA 3EFGA 3V5BA 3P8CD 1H88A 3CMAF 2XKMA 2XNXA 2OYHB 2W6AA 2VGNA 1FAVA 2ALEA 2QEXF 3CLQA 4W7ZA 2M3BA 2J58A 1S9KE 1RE4A 1GW3A 3J80M 2WSCH 1YHQF 3RA5A 1SVFA 4LCKA 4WY4C 4IFMA 1QVFF 1HBWA 3A2AA 2OTJF 2GUVA 3WXMB 1J2JB 3NFQA 3CG6A 1XTGB 1N73A 1JCCA 3A5TA 3VMFB 3U59A 2JEEA 3M9QA 3O85A 5AVRB 2HYNA 1DX7A 2QA4F 3NMUC 1MFZA 2N1TC 1RA4A 5CCGC 4NQ3A 1OWAA 4AUWA 2KP8A 1FJKA 1GK6A 1SFCC 2Z4EA 1KILD 3HE5A 1VQKF 1CW5A 3OAKA 1IFMA 2WSEH 3V2PA 3LWVC 3CPQA 1MUUA 5KJ7D 1KILA 5AVVB 1GL2C 3MCAB 2LBXA 3ON1A 5CCHA 1LTJB 1YYCA 5CHXA 1YITF 5KJ7A 5CJ4A 1CI6A 3IR9A 3HE4A 3GHGC 4BY9D 2OYIB 2PP6A 2R32A 1X7PA 2QI2A 3M06A 5AVSB 4WB4A 1CZQA 3RL0D 1N86A 2KTUA 1VQ6F 2NPSA 1CI6B 4EOTA 3HE4B 1IK9A 2OZBA 3BVHA 2KTVA 1T3JA 5APWA 2OHWA 1KFNA 1NJIH 2OYHC 2XU6A 1RLGA 1JCDA 3OBYA 2MJZA 1SQQK 1FJPA 1GD2E 1GW4A 3RL0B 3LIEA 4Y99B 1GU4A 3I56F 4N3YB 2BO1A 3TNUB 1KZUB 4WY4D 3WMM0 1FOSF 2J59M 1XBIA 3M91A 1JY2O 3TK1A 3VTPC 2KSJA 3LW5H 2O1KA 3V4QA 1N7LA 1ZLLA 1LTIC 2N1TD 1QL2A 5CCGD 2PAJA 2AIFA 5HWEA 1JTHB 4N78D 2FKWB 3U1CA 3I55F 4WY4B 2N1TA 5APTA 3HJWC 5AW4B 5CCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYI A;  3CPW F;  2N9B A;  1MV8 A;  1S9K D;  3CXC F;  5AW2 B;  3CCS F;  4TZZ A;  2I6D A;  3P8M C;  2P7J A;  4JYC A;  5GIO C;  1K9M H;  3FFM A;  3CCQ F;  3MGN A;  2HVY D;  1Q82 H;  2ZXE B;  3M0A A;  5GAP K;  3CCV F;  1ZWZ A;  1GTW A;  2QM7 A;  1HJB A;  1N8R H;  4DZO A;  1VQO F;  5AW7 B;  3J7A R;  2E42 A;  1IO4 A;  5FJ4 C;  2WT7 B;  3V7Q A;  2P67 A;  5GAN K;  5G4U C;  2VRS A;  3L36 A;  3L35 A;  5DCV A;  2BAS A;  3CCM F;  2FC3 A;  3VMX A;  2W27 A;  2WPS A;  1VQM F;  2IPP A;  1JJ2 F;  1M90 H;  1GO1 A;  3V4W A;  1HWT C;  3NXS A;  2Z5I A;  1Q86 H;  2H7H A;  1KQS F;  5EO3 A;  1VQ9 F;  4X3M A;  3NK7 A;  1KC8 H;  1YJ9 F;  2CZW A;  2LBW A;  3VN0 A;  4B86 A;  5AVT B;  2WTY A;  2YO3 A;  3LID A;  2ZFC A;  3SWF A;  1T0K B;  5IT9 M;  3J81 M;  2R5B A;  1FOS E;  2KG4 A;  3NK6 A;  3CCR F;  1T2K C;  3TNU A;  4GT1 A;  1H7M A;  3KDP B;  3P32 A;  3GYQ A;  1VQ5 F;  1W2B F;  2Z5H A;  2QM8 A;  2Q5U A;  3KQG A;  2R3C A;  3RA6 A;  1SP4 A;  1VQP F;  1VQN F;  1CSB A;  2R5D A;  1JNM A;  2YNY A;  3CCL F;  1K73 H;  1YI2 F;  3LWQ C;  5A2Q M;  1CK2 A;  1YJN F;  5AW8 B;  3TYY A;  2YO2 A;  1NWQ A;  1GK4 A;  3JCM M;  4AQR D;  1GZL A;  2WPR A;  3B8E B;  3AGK A;  1SDS A;  1A02 J;  5AW1 B;  1W41 A;  1T2K D;  2WT7 A;  5AW9 B;  3HAX D;  2XV5 A;  3OW2 F;  1PXW A;  5GIP C;  1CN7 A;  1KQL A;  5AVW B;  1M1K H;  3I5C A;  2VGM A;  1G2C B;  1QVG F;  4KHX A;  5APY A;  4BW0 B;  3G4S F;  3MD0 A;  4GKG A;  3CCU F;  3PLA C;  4C7N B;  4I6M C;  3A7O A;  3L37 A;  1K8A H;  5AVX B;  5AVU B;  3M9B A;  5AVZ B;  1H8A A;  5FLX M;  3T97 A;  5GIN C;  3CCE F;  3V7E A;  2WAL A;  4AYC A;  1Q81 H;  2WPQ A;  3VMZ A;  1HUC A;  3LWP C;  5APS A;  1YJW F;  2XZR A;  1E7K A;  3UIA A;  3LFO A;  5EWR A;  3P7K A;  1X8Y A;  5AW5 B;  3HTK A;  1W3E X;  5APQ A;  1W42 A;  4C4W C;  1JUN A;  2E43 A;  1VQ7 F;  3HE5 B;  1GO0 A;  1VQ4 F;  4X3L A;  3M0D A;  5APT A;  3NMD A;  4I2L C;  3G6E F;  4NUT A;  5APV A;  5APU A;  3O8Z A;  1GZ0 A;  1X7O A;  1VQL F;  4LC1 A;  3N4Z A;  1OXZ A;  2Q3I A;  1NMU B;  1A02 F;  3CC7 F;  2OTL F;  5CMZ A;  3LWO C;  1DH3 A;  4HYT B;  2P2U A;  1IPA A;  4XE5 B;  2JNB A;  4RES B;  1GU5 A;  3LWR C;  5AW3 B;  5G4V C;  3CC4 F;  3OBW A;  5AVY B;  2C9N Y;  3NVI B;  3CD6 F;  2C9L Y;  1VQ8 F;  4M3L A;  3NTN A;  3CCJ F;  4JYB A;  4C46 A;  3CME F;  3N4Y A;  5APX A;  3NVK E;  3E20 B;  1YIJ F;  1S72 F;  2Q7C A;  3SIU A;  3CC2 F;  3VMY A;  1H89 A;  3PAF A;  3JAM M;  3A3Y B;  1W40 A;  1SLQ A;  2WWW A;  1Q7Y H;  3G71 F;  4C7N A;  3VI6 A;  3SIV A;  1DT9 A;  5AVQ B;  5AW0 B;  3M9H A;  1KD1 H;  5AW6 B;  2JJL A;  3E1Y A;  1NAF A;  3V5B A;  1H88 A;  3CMA F;  2VGN A;  2W6A A;  1FAV A;  2ALE A;  2QEX F;  1S9K E;  3J80 M;  1YHQ F;  3RA5 A;  4LCK A;  1QVF F;  1HBW A;  3A2A A;  2OTJ F;  3WXM B;  1J2J B;  3NFQ A;  3CG6 A;  3A5T A;  3VMF B;  3O85 A;  5AVR B;  2QA4 F;  3NMU C;  1MFZ A;  1RA4 A;  1OWA A;  4AUW A;  2KP8 A;  1GK6 A;  3HE5 A;  1VQK F;  3OAK A;  3LWV C;  3CPQ A;  1MUU A;  5AVV B;  3MCA B;  2LBX A;  3ON1 A;  1YIT F;  1YYC A;  1CI6 A;  3IR9 A;  3HE4 A;  4BY9 D;  2R32 A;  1X7P A;  2QI2 A;  3M06 A;  5AVS B;  1CZQ A;  2KTU A;  1VQ6 F;  1CI6 B;  4EOT A;  3HE4 B;  2OZB A;  2KTV A;  5APW A;  2OHW A;  1NJI H;  2XU6 A;  1RLG A;  3OBY A;  1GD2 E;  3LIE A;  1GU4 A;  3I56 F;  2BO1 A;  3TNU B;  1FOS F;  1XBI A;  3M91 A;  3TK1 A;  3VTP C;  3V4Q A;  2AIF A;  3I55 F;  1X52 A;  3HJW C;  5AW4 B; 
#chains in the Genus database with same CATH topology
 2HPC B;  1K05 A;  3VYI A;  2NMU A;  3CPW F;  5KLV K;  1URQ C;  2RHJ A;  4KWE A;  2ZYG A;  3HUS B;  1EZV G;  2WSS H;  1VK3 A;  1S9K D;  4X1Y A;  4K3A A;  1XHO A;  3G9R A;  5AW2 B;  1FZG A;  2NRG A;  3CCS F;  1ODE A;  3WUU A;  3P8M C;  4X1Y B;  4B5C A;  1Q82 Q;  5IYZ B;  1SQB J;  2HVY D;  1FNK A;  3M0A A;  5GAP K;  3CCV F;  1ZWZ A;  1N8R Q;  3E1I A;  1EZV E;  1ZP0 C;  4WBN A;  3C9I A;  4Y99 C;  2B33 A;  5AW7 B;  1VQO F;  3H1K G;  3J7A R;  2E42 A;  4NWO B;  1UFY A;  1IV3 A;  2FYZ A;  4WBN B;  5GAN K;  2KLV A;  4BT7 A;  3PHL A;  1GX1 A;  4E6E A;  5AVM A;  3MHV A;  1SQP J;  1LTT C;  3W67 A;  2W27 A;  3V3T A;  1AV1 A;  3L71 D;  5H2F H;  1QL1 A;  2QRX A;  1GO1 A;  2IG8 A;  1URQ D;  2WSC J;  1Q86 Q;  1JY8 A;  1HWT C;  2HOD A;  1L0L K;  2YIU C;  3NXS A;  3AE2 C;  2C0W A;  1DEB A;  3VOP A;  1L0N K;  1KC8 Q;  2IQQ A;  5HY4 A;  2Q1Y A;  2HOD B;  2OTL P;  1BE3 D;  3L74 G;  1S4X A;  1NGM B;  1URQ B;  3C8V A;  4PWT A;  3ZOP A;  3LID A;  3VOA A;  3K5B A;  4K35 A;  1YJN P;  4LLH A;  5CB4 A;  1FOS E;  1L4A B;  3A0H E;  5B66 H;  2ZAU A;  2Q6Q A;  2HRY A;  3L74 E;  3RYF B;  3HKC B;  4IOI H;  3K2X A;  4U3F G;  2GZL A;  4OWF A;  1LP1 A;  3AEF C;  1Z5V A;  3KDP B;  2KS1 B;  1OFU A;  2FFD B;  1USE A;  3E22 B;  4EIJ A;  1SQV D;  1HGV A;  5JH7 B;  3KQG A;  2ZOV A;  2JO1 A;  4JF7 A;  2AIZ P;  1KQS O;  1JY3 N;  4HNA A;  4U3F E;  3H1K J;  3R0P A;  1CSB A;  2FXM A;  4ZHQ A;  3II6 A;  5EYP A;  3AEE C;  4X20 A;  3CCL F;  1K73 H;  1SS1 A;  3LWQ C;  2YIU B;  5EYP B;  1IFD A;  3N2K A;  1YJN F;  2YO2 A;  1GK4 A;  3VIU A;  2BCC G;  3V2Q A;  3PP5 A;  1E79 H;  1FDO A;  1NTK K;  2FYU D;  2M5A B;  3USS A;  1A02 J;  2OAR A;  4EYY Q;  5AW1 B;  1IFP A;  1Y8A A;  3PLN A;  3AE6 C;  4L76 A;  4FFB A;  4XCQ A;  3W68 A;  3L74 J;  2BCC E;  3H32 B;  3E1R A;  4BRY A;  1PXW A;  3A0B E;  5CCH C;  4UB6 H;  1KNJ A;  3RYI B;  5JVD A;  1KQL A;  2IFN A;  5AVW B;  3KJJ A;  2H8P D;  1IFI A;  1M1J B;  2ZT9 C;  2OYO A;  5E79 H;  1PZQ A;  5APY A;  5CA0 B;  4BW0 B;  1RLU A;  4GKG A;  3PLA C;  3A7O A;  4U3F J;  2BEZ F;  3GF7 A;  1H8A A;  4PD4 D;  1NTM K;  1MKM A;  1J1D C;  4I4T A;  2WAL A;  1OW7 A;  1TU3 F;  1QD9 A;  1KYO H;  3S1K A;  2LR2 A;  3JAT B;  3AE9 C;  4YJ2 A;  2KOG A;  2AEF A;  3VP8 A;  4I4T B;  2XZR A;  1E7K A;  1DEE G;  5JQG A;  5EWR A;  4KT0 J;  5KX5 A;  3VYS C;  1PGJ A;  3M4S A;  1USD A;  5TJH A;  1W3E X;  3TSI A;  1RF1 C;  5CCH D;  4I7Z B;  1WRG A;  2E43 A;  1FZF A;  2BCC J;  2H8C A;  2W6B A;  1GO0 A;  3ZDM A;  2XDJ A;  3PRJ A;  2ZT9 D;  1QVG O;  3CME P;  1N7S C;  3NMD A;  2UYN A;  1J1E C;  1X79 B;  3V2N A;  1NAY A;  2DW3 A;  4D6T G;  1EZV I;  4R4M A;  3F0F A;  1M7L A;  1YGY A;  1ZR2 A;  1FZB A;  2ZT9 B;  2K9Y A;  1H0T B;  2VAM A;  1NMU B;  3CL3 D;  5CMZ A;  3Q5P A;  2HS4 A;  3LWO C;  1KIL E;  1DH3 A;  1AFO A;  1W5B A;  1IC2 A;  4D6T E;  1FBM A;  3JAK B;  4RES B;  3KPE A;  3IAO A;  2JWD A;  3LWR C;  5AW3 B;  1P84 E;  1J1D B;  3CMA P;  3C9R A;  5AVY B;  3TGU D;  2IX7 C;  4O4I B;  3CD6 F;  2CHS A;  4M3L A;  3R2P A;  2AMT A;  3H1J D;  5TIS E;  4JYB A;  4ZOL A;  3CME F;  1RF1 A;  3N4Y A;  4WWI A;  3VO8 A;  2KGW A;  2QA4 P;  3HRN A;  3EWK A;  2V9Y A;  1N7S D;  4O2B B;  4I1L A;  1H89 A;  3B71 A;  3O6Q B;  3KZI E;  1LJ2 A;  2H43 A;  1JOC A;  1W40 A;  3BAT A;  1JD1 A;  1JY3 O;  3KJK A;  3SIV A;  1DT9 A;  1YIT P;  1N7S B;  1VHA A;  2P58 A;  4PV1 D;  1J1E B;  4N78 E;  5DJU B;  5HY0 A;  2W8B C;  2QTP A;  2JJL A;  1X22 A;  2PRR A;  2Z1T A;  1JFF B;  3V5B A;  1UIX A;  2L91 A;  2Z01 A;  3CMA F;  3L75 D;  5KLV D;  1FAV A;  2ALE A;  2AEM A;  4W7Z A;  4PV1 B;  1S9K E;  4D6T J;  3F89 A;  3GLM A;  3VCZ A;  2IBZ D;  4WY4 C;  1U43 A;  1HBW A;  3A2A A;  4NPF X;  1U7M A;  2RHO A;  3CG6 A;  1JCC A;  2JEE A;  3WGN A;  2QA4 F;  3NMU C;  1EC5 A;  1FC2 C;  2N1T C;  1ZXG A;  2KP8 A;  1FJK A;  4YJ3 B;  2AEJ A;  4EB6 A;  1QEX A;  5GTH E;  1IFM A;  3L71 G;  3LWV C;  2HR3 A;  5EFW B;  1MUU A;  5AVV B;  1GL2 C;  2LBX A;  1YIT F;  3HKE B;  3IR9 A;  1OFC X;  3GHG C;  4EI2 A;  2R32 A;  2HS3 A;  1BE3 G;  2R3S A;  4EOT A;  3AE7 C;  3L71 E;  4I50 A;  2OHW A;  2PHN A;  1WMK A;  2QG4 A;  2D2C C;  1SQQ K;  1L0L D;  5ITZ B;  3WJR A;  5BMV A;  3M1X A;  2BO1 A;  1QVF O;  4WY4 D;  1BE3 E;  5C8Y B;  2J59 M;  1XBI A;  2VXY A;  1X0T A;  3VTP C;  2KSJ A;  2N1T D;  1QL2 A;  2PAJ A;  1JTH B;  4WY4 B;  3T80 A;  3JCU E;  2N1T A;  1SQV G;  1X52 A;  5AW4 B;  5KAF H;  1JN1 A;  3H25 A;  1J7H A;  1L2P A;  1VQM P;  1GL2 D;  5EZY B;  2DT4 A;  4WVZ A;  2WSF J;  2L5G B;  1XRG A;  3CXC F;  1GL2 A;  2OYI C;  3B5N C;  4U3J A;  1K9M Q;  2M3E A;  1RF0 C;  4JYC A;  1OVR A;  3PJS K;  4O2A B;  1SQV E;  3GHG A;  3FFM A;  1YJ9 P;  1VPC A;  3UT5 B;  2O01 H;  3WU2 E;  1Q82 H;  5GTI E;  5FNV A;  5B8F A;  4ZKP A;  3CXH H;  4C8E A;  4TV9 A;  2PGD A;  2D2C D;  3HKD B;  2K9J B;  1N8R H;  2FYU G;  2H89 C;  3L71 J;  4DZO A;  3CXH I;  1UI9 A;  4DCK A;  3Q5R A;  2D2C B;  3CCM F;  2JP3 A;  1BE3 J;  3S9O A;  1NOH A;  3WUV A;  4C81 A;  2WPS A;  2FYU E;  1SZQ A;  4RQO A;  4C8I A;  1VQM F;  1NTK D;  1YTZ I;  1JEK A;  4F6R B;  1JJ2 F;  3CPW O;  2JR8 A;  4YTP C;  3D00 A;  5HP7 A;  2Z5I A;  3HKB B;  3HUS C;  1Q86 H;  3RYH A;  5EO3 A;  2WIT A;  2FY8 A;  3NK7 A;  5HY1 A;  1KC8 H;  1P84 I;  1GMJ A;  1LTJ A;  1YJ9 F;  3AEA C;  2CZW A;  3B5N D;  4W80 A;  1VQN P;  5TIS H;  2OYI A;  4B86 A;  3RYC B;  1NTZ K;  5AVT B;  3F0G A;  4G4Y A;  1YTZ T;  4O4H B;  2R44 A;  2ZFC A;  5J2U A;  1NYH A;  1SQV J;  2KYV A;  2WSE J;  3B5N B;  2ZF8 A;  5IT9 M;  3J81 M;  1JB0 J;  2FBW C;  3KZI H;  3AEG C;  4H0L B;  2KG4 A;  4QMA A;  3TNU A;  4BT2 A;  4PD4 E;  4Y28 J;  1W59 A;  3HTK B;  1NTM D;  2OGU A;  2RHH A;  2FGY A;  1LT9 B;  4C82 A;  3L73 D;  1H7M A;  1W57 A;  3P32 A;  4PJ0 H;  3GYQ A;  3S03 A;  2B89 A;  4OGQ B;  1IV1 A;  3AE8 C;  1R5L A;  3IKE A;  3FXD A;  1FFX B;  5KAI E;  2KNC B;  2R3C A;  2FYU J;  4N6J A;  2HPC A;  1SA0 B;  3K0T A;  3H1L D;  3RA6 A;  3ZO8 A;  1SP4 A;  1VQN F;  1LWU C;  2MKV A;  5LYJ A;  5LXT B;  3HUS A;  3KYQ A;  4GDO A;  2Q9I A;  1U57 A;  3AE4 C;  4ZHV A;  3F0D A;  3CCU P;  5A2Q M;  5LYJ B;  2EWC A;  5IJ0 A;  3JCM M;  1BGY D;  2ZVZ A;  2K1A A;  5IYZ A;  4ZHY B;  3B8E B;  2DYY A;  3AGK A;  2WSF H;  3JAL B;  4BVT A;  4LGD E;  1CLI A;  1R5S A;  1FS0 E;  5IJ0 B;  3D54 A;  1L4A C;  1DD4 A;  2C0X A;  5JCO C;  2OTJ P;  4DRX B;  5AW9 B;  2CHT A;  1YJW P;  3HAX D;  3TGU G;  1PF5 A;  2CWJ A;  1LTA C;  3H1H D;  1HVV A;  4B45 A;  1EXI A;  2RN0 A;  2FFD C;  3H1J G;  2H8E A;  5KMG B;  2LCA A;  1G2C A;  2Z1U A;  1QLE D;  3P0Z A;  1HGZ A;  5CBN A;  3I5C A;  2VGM A;  1QU9 A;  1G2C B;  3TGU E;  1VQ4 P;  3K14 A;  3MD0 A;  3CCU F;  3VYT C;  1ZRT D;  3H1J E;  3G6E P;  1LWU A;  4HB1 A;  1ZV8 A;  1JO5 A;  2UZH A;  3VP9 A;  1URQ A;  1Q81 Q;  1LWU B;  4GIF A;  3LWP C;  5DJT B;  3L75 G;  2JDI H;  5APS A;  3PH0 A;  5KLV G;  1YJW F;  1L4A D;  2YXZ A;  2FXO A;  1ZW0 A;  2JKV A;  3UIA A;  3JC2 2;  5KKZ B;  1X8Y A;  1L4A A;  4BT4 A;  3RYF A;  3HKC A;  2IBZ G;  1BDD A;  1S1C X;  5JCO A;  2UYP A;  1NQ3 A;  3AE1 C;  1U7J A;  4C4W C;  3JAW A;  3MIW A;  5J2T B;  2KS1 A;  3L75 E;  1FDM A;  2FFD A;  5KLV E;  3CCJ P;  3E22 A;  3HE5 B;  4OVN F;  2Z1F A;  2KLU A;  1VQ4 F;  1M1J C;  3JAW B;  4G4V A;  3RGU A;  2E76 C;  2MQE A;  2E5T A;  5JH7 A;  2NPS D;  2QJP C;  3G6E F;  4C8G A;  2IBZ E;  4RHA A;  3RK3 C;  3V2R A;  1GZ0 A;  2QIW A;  1S72 P;  1X7O A;  4LC1 A;  3TGU J;  3EOR A;  4H44 C;  1KV4 A;  2A45 H;  2NPS B;  3CX5 H;  2Q1K A;  2OTL F;  3H1J J;  3G71 P;  2A45 I;  3CX5 I;  1IPA A;  2HFE D;  3QUW A;  4YXW H;  3TD5 A;  1RE4 C;  2ITA A;  1L0L G;  2M5A A;  5G4V C;  2OTK E;  2C9L Y;  1SFC D;  2WMM A;  3NTN A;  1YHQ P;  3CCJ F;  4I7Z C;  4ASW A;  1SQX K;  3H32 A;  5BU5 A;  3D6Y A;  1W5C E;  2Y9Z A;  1L0L E;  1SQQ D;  3RYI A;  2GA1 A;  1COM A;  1JY2 P;  5KTB A;  3E20 B;  1SFC B;  4EI8 A;  2Q7C A;  2E76 D;  1S72 F;  3L75 J;  1R1M A;  3TDK A;  5KLV J;  1M1J A;  1W2B O;  2UWJ E;  3OJA B;  3RK3 D;  5KJ7 C;  4TUY A;  3JAM M;  2ZJS E;  1IFN A;  1UII A;  4G88 A;  3GW6 A;  5CA0 A;  1SLQ A;  3G71 F;  4PD4 H;  4H44 D;  1E5W A;  4TV8 B;  5AVQ B;  1KD1 Q;  4TUY B;  2E76 B;  2QJP B;  3KE1 A;  3D71 A;  1RQ2 A;  2AXT E;  4PD4 I;  3RK3 B;  3E1Y A;  1LT1 A;  1NAF A;  1FZA A;  2HS0 A;  3P8C D;  2OYH B;  2W6A A;  5KAI H;  4H44 B;  1KOR A;  3JAT A;  2V7Q J;  1EDK A;  2J58 A;  1RE4 A;  1GW3 A;  3J80 M;  2WSC H;  1YHQ F;  2HQS C;  1NU1 D;  4LCK A;  3V6I A;  1FNJ A;  3NFQ A;  3JVH A;  3P10 A;  2HYN A;  3DC2 A;  3C9U A;  5CCG C;  3KHN A;  4NQ3 A;  4AUW A;  4TLF A;  1NTK G;  3FWL A;  3OAK A;  3F0E A;  3S4R A;  1L0L J;  1TVK B;  3I55 P;  5HP8 A;  5KJ7 D;  1VL2 A;  3FWN A;  3KIZ A;  4MN4 C;  2RHL A;  3D6Z A;  3ON1 A;  5CCH A;  5CHX A;  1YYC A;  5KJ7 A;  1DBF A;  1Y9B A;  3M06 A;  4ZHW A;  1CZQ A;  1H0T A;  2KTU A;  1KYO D;  1NTK E;  1IK9 A;  2KTV A;  3WGM A;  1W5E A;  2V4H A;  2XU6 A;  1JCD A;  3OBY A;  2MJZ A;  2GVI A;  4PV1 C;  3JAK A;  1GU4 A;  4ZK7 A;  1OVV A;  2A06 D;  4N3Y B;  1PP9 D;  1KZU B;  3WMM 0;  1S5L E;  1EDL A;  4O4I A;  1NTZ D;  4IIJ B;  1NTM G;  2HX0 A;  2O1K A;  2G8Y A;  1LTI C;  3L73 G;  5CCG D;  3AEC C;  2FKW B;  3I55 F;  3L70 D;  3HJW C;  5CCG A;  4I55 B;  2YXR B;  2KZI A;  4NPE A;  4O2B A;  2LXC B;  3H1L G;  3IN6 A;  1MV8 A;  3WGK A;  3O6Q A;  1NTM E;  3ELC A;  3IFM A;  3U1A A;  3P4E A;  2K37 A;  3L73 E;  4HJG H;  2YYE A;  3CCE P;  4TZZ A;  2I6D A;  4UB8 E;  3WPX A;  1K9M H;  3A0H H;  3H1K D;  1N7S A;  5LOV B;  3IEQ A;  2HG5 D;  3SWK A;  1BGY G;  1IJD B;  1NTK J;  3H1L E;  1JFF A;  2Q3E A;  1GTW A;  3BAS A;  2QM7 A;  4HH2 A;  3WJQ A;  2IZ1 A;  2F9Z C;  3S06 A;  1IO4 A;  1D7M A;  2WT7 B;  2P67 A;  3MZW B;  2UYJ A;  4W7Y A;  4BT6 A;  2IBZ I;  2BEQ D;  2E75 B;  3MUD C;  3L35 A;  2BAS A;  1KB9 D;  1BGY E;  2FC3 A;  2HLO A;  1U3L A;  4IL6 E;  1N2D C;  1AVO A;  2IPP A;  3S02 A;  1M90 Q;  1ZN5 A;  1OW6 A;  4YJ3 A;  3KXD A;  3C9S A;  3H1I D;  2H7H A;  3FBA A;  4EDF A;  1AQ5 A;  1FZC B;  3H1H E;  1VQP P;  2LBW A;  3HKE A;  3T97 B;  1NTM J;  1VQV A;  1R8E A;  5EAZ A;  3L73 J;  2WTY A;  2Q1X A;  1EQ7 A;  5LP6 B;  1TUB B;  3RK2 D;  2VAW A;  2G9I A;  1T0K B;  2K3R A;  2R6R 1;  1PGQ A;  5EB0 A;  4DOJ A;  3A0B H;  2R5B A;  1HJ0 A;  4YPC A;  1LGH B;  3H1L J;  1ZRT E;  5ITZ A;  1PV3 A;  1RH5 B;  5GON B;  1PFI A;  1OW8 A;  3RK2 B;  3NK6 A;  2W90 A;  2ZVO B;  2BTU A;  2ZVY A;  2Y0D A;  5C8Y A;  4IFD K;  1L0N D;  3MP7 B;  4GT1 A;  1ZOY C;  3CI9 A;  4ZI7 B;  1LTG C;  1Z5W A;  3ABV C;  3HD7 D;  2E74 B;  1YIJ P;  1LTS C;  2IAF A;  1BGY J;  1JTH A;  1OMI A;  4CPG A;  4WY4 A;  4X1I B;  1NH4 A;  3RBZ A;  4U7J A;  2YKO A;  1VQP F;  1RY3 A;  1DD3 A;  1VH8 A;  2R5D A;  1ZR4 A;  5EZY A;  3HD7 B;  1JNM A;  1W55 A;  2LKM A;  4DT0 A;  5EIB D;  1AQT A;  5H2F E;  3LME A;  3G4S P;  1CK2 A;  2O01 N;  4O2A A;  1NWQ A;  3TYY A;  1SQB K;  3D70 A;  3UT5 A;  1GZL A;  4DJG A;  4RKU J;  2POH A;  2GLZ A;  3GG2 A;  1RQU A;  1FDI A;  2XND H;  4A7P A;  3HKD A;  2K9J A;  3S0W A;  3BRT B;  3CB2 A;  4H0L C;  2Y9Y A;  1W41 A;  3MDO A;  1PGP A;  1JM0 A;  1LT9 C;  3L4F A;  3D01 A;  5CBO A;  3OW2 F;  1SQP K;  2WPV B;  5GIP C;  4OGQ C;  3JAR B;  4LNU A;  3VYU C;  1CN7 A;  3M0D C;  5B66 E;  3L72 D;  1M1K Q;  1JMB A;  2K88 A;  2I1J A;  1XTC C;  1SQQ G;  4F6R A;  1LNQ A;  4LNU B;  1Y47 A;  4BVR A;  4BWN A;  3HKB A;  3F6M A;  3G4S F;  4C7N B;  1K8A Q;  4IFF A;  1YQ4 C;  4I6M C;  4L75 A;  1S5L H;  5MN5 A;  1RQ7 A;  3M9B A;  1SQX D;  1P84 H;  1NHL A;  3CXH D;  1NKZ B;  1VQL P;  2KIK A;  1SQQ E;  3V7E A;  3RYC A;  4AYC A;  3QWO C;  1MZ9 A;  1Q81 H;  5K5G B;  3HWU A;  3CC7 P;  4O4H A;  4JPZ B;  3RK3 E;  2W6J H;  3B5N A;  4H0L D;  1RF0 A;  3LFO A;  1JY2 N;  4XFJ A;  4O4J B;  5AW5 B;  1IV4 A;  1U40 A;  1NU1 G;  3IMP A;  1N73 B;  4UB8 H;  3HTK A;  5APQ A;  1W42 A;  4O4L B;  4OGQ D;  1X25 A;  1LT9 A;  3P8C E;  1AVY A;  2N48 A;  3JAS B;  3H6P A;  2CPB A;  4X3L A;  3M0D A;  4C7R A;  1T8Z A;  1FFX A;  1KIL B;  3F5H A;  4I2L C;  2KNC A;  2HRU A;  1NU1 E;  1SA0 A;  2KB7 P;  5APV A;  5APU A;  1YQ3 C;  3O8Z A;  3CC2 P;  4UB6 E;  1VQL F;  3N4Z A;  1OXZ A;  5LXT A;  2Q3I A;  2ZVN B;  1A02 F;  1KFM A;  3CC7 F;  2HP0 B;  5E79 E;  3K12 A;  3LYB A;  2HP3 A;  1IFJ A;  5BVZ A;  2P2U A;  4RO0 A;  3LW5 J;  1FSZ A;  2JNB A;  3AE3 C;  1SQQ J;  1WT6 A;  5B5E E;  2CVL A;  3JAL A;  4U39 A;  1Z56 A;  3GMA A;  4ERH A;  2K1S A;  3EFF K;  5KKZ C;  2JWA A;  4Z1M H;  1FU1 A;  2A06 G;  3OBW A;  2QJK B;  1PP9 G;  5GTH H;  3I7T A;  2P6Y A;  1IV2 A;  3NVI B;  4DRX A;  3M84 A;  1KYO E;  5HY2 A;  3AED C;  4IHJ B;  1NTZ G;  4X1K B;  5KMG A;  3OON A;  2Z1E A;  5KLI C;  3NVK E;  2O3J A;  1YQN A;  3L70 G;  3G3Z A;  3CC2 F;  3SIU A;  2YKP A;  2A06 E;  3B6N A;  1PP9 E;  3VMY A;  1JMM A;  2NZ2 A;  3A3Y B;  4GOE A;  1NTZ E;  2ZYA A;  1Q7Y H;  1NU1 J;  4RJT A;  2NPS C;  1KD1 H;  3N7N A;  1G1I A;  2QJY C;  5AW6 B;  3L70 E;  1ZME C;  3I3F A;  4EI7 A;  3BYQ A;  3FD6 A;  2XKM A;  1VQ6 P;  1DIP A;  4G4W A;  2M3B A;  2J5U A;  3IKF A;  3CWB D;  5C39 A;  2UYK A;  3RA5 A;  3JCU H;  3MBM A;  2OTJ F;  1IZN B;  3H1K E;  3IEW A;  1J2J B;  3VMF B;  3U59 A;  2Y0E A;  2W83 C;  3O85 A;  5J2T A;  1OWA A;  3AE5 C;  1GK6 A;  4ZMD A;  1SFC C;  1KNK A;  3HE5 A;  1CW5 A;  2WSE H;  3V2P A;  5L8R J;  3WU2 H;  5GTI H;  3H1I G;  1QAH A;  3MCA B;  1OIP A;  5KLI B;  3CCL P;  1PP9 J;  1KB9 E;  3Q5S A;  4BY9 D;  2PP6 A;  1X7P A;  5AVS B;  4WB4 A;  1NTZ J;  1N86 A;  1VQ6 F;  2NPS A;  3Q3D A;  3S0Y A;  1XV2 A;  3BVH A;  1T3J A;  4G4X A;  1KFN A;  1NJI H;  2OYH C;  1RLG A;  3H1I E;  3L70 J;  2SPZ A;  2YMK A;  3CCQ P;  3Q1M A;  5CB4 B;  1GD2 E;  2QJY B;  4Y99 B;  5EB1 B;  2OQQ A;  3TD4 A;  1LP1 B;  1PL5 A;  3M91 A;  3FX0 A;  3N2G A;  1JY2 O;  3TK1 A;  3BCC D;  3LW5 H;  1L0N G;  3SFD C;  1N7L A;  2AIF A;  5HWE A;  5M1B A;  3U1C A;  3N2G B;  3RBX A;  5APT A;  1T6A A;  4HNA B;  1SFC A;  2LXB A;  1BSN A;  4ZHQ B;  1MFT A;  2N9B A;  2W8Z A;  2ZAE B;  3DDN A;  4ASV A;  2CPS A;  3CX5 D;  4X20 B;  1L0N E;  3WGJ A;  2P7J A;  1VQ9 P;  4TV8 A;  1AA0 A;  5GIO C;  4L74 A;  3N2K B;  1Q7Y Q;  1T0A A;  3CCQ F;  3MGN A;  2IYO A;  1BCC D;  2ZXE B;  4EI9 A;  2H6L A;  3S0H A;  1Q8R A;  3FGA D;  3JSV C;  1HJB A;  2OYH A;  2M8R A;  1EDJ A;  1H48 A;  1HH0 A;  5FJ4 C;  3H1I J;  3V7Q A;  4FFB B;  5G4U C;  1X9V A;  2VRS A;  3L36 A;  4BRY B;  5DCV A;  3BRV B;  3CCR P;  1H47 A;  1SQB D;  5JVD B;  3VMX A;  1W2E A;  2IDB A;  1VF5 C;  3SSU A;  1M90 H;  3L72 G;  5HXZ A;  5B5E H;  2WZ7 A;  1VQ5 P;  1OZH A;  4JQ0 D;  3V4W A;  3ZP4 A;  2IYP A;  1TVK A;  1KQS F;  1PPJ D;  1VQ9 F;  2I8D A;  4X3M A;  2N9Y B;  4NPD A;  1KTM A;  1W5F A;  1PIX A;  1SQP D;  5KAF E;  1KN7 A;  3VN0 A;  4ZNC A;  1SQX G;  3KHU A;  1L0N J;  3L72 E;  1KQG B;  1KYO I;  2YO3 A;  1YI2 P;  4YJ2 B;  3SWF A;  2G3A A;  1FZE A;  1BSH A;  2I1K A;  1RE3 C;  3R4Y A;  3CYP B;  5JQG B;  1NJI Q;  3SFE C;  5KX5 B;  3CD6 P;  1HF9 A;  1QX8 A;  3CCR F;  1T2K C;  1SQX E;  2E75 C;  2ZXX A;  3CXH E;  3QTY A;  2P1J A;  2QE7 H;  4IIJ A;  4JBZ A;  2VAP A;  1VQ5 F;  2CW4 A;  3C1L A;  3N4X A;  1W2B F;  1VF5 D;  2Z5H A;  2QM8 A;  3MTU E;  2KZJ A;  2RMZ A;  2Q5U A;  2UYN B;  1M8O B;  4XA4 A;  2R75 1;  4I55 A;  3WPW A;  3RE3 A;  1EZV D;  5CJ0 A;  1FZC C;  1VF5 B;  2GUS A;  4HKZ H;  1K73 Q;  2AXC A;  2YNY A;  3GF3 A;  1EDI A;  1YI2 F;  3PTZ A;  3B4S A;  5HXU A;  5LP6 C;  2H88 C;  5AW8 B;  3ZP7 A;  4B62 A;  5LOV A;  3CYQ A;  4AQR D;  2WPR A;  1YBK A;  1SDS A;  3L72 J;  1RE3 A;  3RK2 C;  5MN6 A;  1T2K D;  2WT7 A;  1KB9 H;  2E75 D;  1K04 A;  3RL0 g;  3L7Q A;  2XV5 A;  2RKL A;  4ZOL B;  2O01 J;  2PFX A;  1KB9 I;  1SQX J;  1PGO A;  1RF1 B;  2IZ0 A;  2E74 C;  1FE6 A;  3IF4 A;  1S5L X;  2KXP B;  3HTN A;  2GM4 A;  1M1K H;  1VQ7 P;  3H1H G;  3OA7 A;  3WJP A;  1LTB C;  1QVG F;  2V7Q H;  4KHX A;  1OAP A;  1GDT A;  3HD7 C;  4PJ0 E;  2RB9 A;  3Q8H A;  3ITK A;  3L37 A;  3L74 D;  1FZC A;  1K8A H;  1G1J A;  5AVX B;  5LA6 A;  5AVU B;  5AVZ B;  5FLX M;  3T97 A;  5GIN C;  3CCE F;  1JY3 P;  5LP6 A;  5LA6 B;  2WPQ A;  1TUB A;  3VMZ A;  1HUC A;  1KQF B;  4G4Z A;  1SQV K;  3FPI A;  5EIB C;  3SWY A;  3CWB G;  3P7K A;  3MCQ A;  4U3F D;  3Q2Y A;  5GON A;  3ESJ A;  3OW2 O;  4BT5 A;  4BVS A;  3E7K A;  3CC4 P;  2WQY C;  3WGL A;  1JUN A;  1NKN A;  2E74 D;  1VQ7 F;  2B9B A;  1W58 1;  5CA1 A;  1VQ8 P;  4ZI7 A;  2O1J A;  4EB6 B;  4BVQ A;  3TD3 A;  2BTO A;  3CWB E;  3WUT A;  3FD5 A;  2AXT H;  3MUD A;  5CA1 B;  4X1I A;  2FYU K;  4IL6 X;  4NUT A;  1T3U A;  2BTQ B;  1ONI A;  4ZKU A;  5BU8 B;  3HD7 A;  3U0O A;  4O9B A;  2CSL A;  4L73 A;  4I50 B;  2BCC D;  4H13 C;  3EQ2 A;  1VDF A;  2LBT A;  1QGK B;  4HYT B;  1NO4 A;  4XE5 B;  2IFM A;  4WBA A;  1GU5 A;  3H1H J;  2QVA A;  1HTL C;  2YKQ A;  5BMV B;  3CC4 F;  2QEX P;  3GHZ A;  2YXQ B;  1N73 C;  2C9N Y;  2I6R A;  3CCM P;  2P10 A;  2Y0C A;  4YXD C;  4OH8 B;  1VQ8 F;  2KUB A;  4BT3 A;  2QSI A;  4GOD A;  1OVU A;  3MQW A;  3BCC G;  4C46 A;  2N1T B;  3JAR A;  1LTJ C;  2WVR A;  2KI7 B;  5APX A;  5MN4 A;  2KK7 A;  2CK3 H;  1S2E A;  2YMY A;  1YIJ F;  3LDT A;  1KIL C;  1NU1 K;  3PAF A;  3QHD A;  3CWB J;  1VQK P;  1GL2 B;  2WWW A;  2A45 G;  3BCC E;  4U3J B;  4C7N A;  4BXL A;  2ZYD A;  3VI6 A;  5AW0 B;  3M9H A;  3GHG B;  3FXE A;  3RL0 C;  3C9T A;  4H13 D;  5FNV B;  4TV9 B;  2PMP A;  3EFG A;  1M56 D;  2B88 A;  1BCC G;  1H88 A;  2XNX A;  1AJY A;  4M8I A;  2B87 A;  2VGN A;  2L26 A;  2QEX F;  1M57 D;  3CLQ A;  2FYN C;  1EXJ A;  4DXD A;  3CX5 E;  4H13 B;  2B87 B;  2QJK C;  1SVF A;  2FXP A;  4O4J A;  2KSE A;  4IFM A;  1QVF F;  2GUV A;  3I56 P;  3WXM B;  1XTG B;  1N73 A;  3A5T A;  1RQV A;  1BCC E;  3M9Q A;  5AVR B;  1DX7 A;  1S3J A;  4R4L A;  4R40 B;  1MFZ A;  3GTZ A;  1RA4 A;  1SQB G;  4O4L A;  4GOF A;  3JAS A;  2Z4E A;  1KIL D;  3VTI C;  1VQK F;  3V4D A;  3CPQ A;  3RYH B;  4D6T D;  4KJM A;  1KIL A;  3TF5 A;  1LTJ B;  1P84 D;  1PPJ G;  5CJ4 A;  1OX3 A;  1CI6 A;  1Q90 D;  3HE4 A;  1W5A A;  1SQB E;  2OYI B;  2OTM A;  2QI2 A;  3RL0 D;  1SQP G;  3BCC J;  3QH9 A;  1CI6 B;  3CCS P;  3HE4 B;  2OZB A;  5J2U B;  1BDC A;  2HP0 A;  2E5Y A;  5IJ9 A;  5APW A;  1Q2N A;  1KMI Z;  3VOB A;  3ERN A;  1FJP A;  1PPJ E;  1GW4 A;  3RL0 B;  4IL6 H;  5IJ9 B;  3LIE A;  1RHZ B;  3I56 F;  3CCV P;  4TT3 H;  3VMA A;  2ZOD A;  3TNU B;  1FOS F;  1SQP E;  1NVO A;  1VQO P;  3C8L A;  2RH0 A;  2FYN B;  1IK7 A;  3AEB C;  3V4Q A;  1ZLL A;  4IHJ A;  1U3P A;  4N78 D;  1BCC J;  4X1K A;  2M0B A;  4B46 A; 
#chains in the Genus database with same CATH homology
 2HPC B;  3VYI A;  3CPW F;  1SFC A;  5KLV K;  1URQ C;  1GL2 D;  2N9B A;  1MV8 A;  3HUS B;  1S9K D;  2CPS A;  3IFM A;  2L5G B;  3U1A A;  3CXC F;  5AW2 B;  1FZG A;  1GL2 A;  3CCS F;  2OYI C;  3B5N C;  4TZZ A;  2I6D A;  3P8M C;  2P7J A;  1RF0 C;  4JYC A;  5GIO C;  1K9M H;  3GHG A;  3FFM A;  1N7S A;  1VPC A;  3CCQ F;  2O01 H;  3MGN A;  2HVY D;  1Q82 H;  2ZXE B;  2HG5 D;  4ZKP A;  4EI9 A;  3M0A A;  5GAP K;  1IJD B;  3CCV F;  1ZWZ A;  1GTW A;  3E1I A;  3BAS A;  2QM7 A;  4HH2 A;  1HJB A;  1N8R H;  3C9I A;  2OYH A;  4DZO A;  4Y99 C;  2M8R A;  1HH0 A;  2F9Z C;  5AW7 B;  1VQO F;  3J7A R;  2E42 A;  1IO4 A;  5FJ4 C;  2WT7 B;  3V7Q A;  2P67 A;  2FYZ A;  5GAN K;  2KLV A;  4W7Y A;  5G4U C;  1X9V A;  2VRS A;  3L36 A;  3L35 A;  5DCV A;  3BRV B;  2BAS A;  3CCM F;  1LTT C;  2FC3 A;  1NOH A;  2HLO A;  3VMX A;  2W27 A;  2WPS A;  1W2E A;  1N2D C;  1VQM F;  2IPP A;  3V3T A;  1YTZ I;  1ZN5 A;  1JJ2 F;  1M90 H;  5HXZ A;  1QL1 A;  2WZ7 A;  1GO1 A;  3D00 A;  1URQ D;  3V4W A;  1HWT C;  2HOD A;  1L0L K;  3NXS A;  2Z5I A;  3HUS C;  1Q86 H;  2H7H A;  1KQS F;  2C0W A;  1DEB A;  3VOP A;  5EO3 A;  1L0N K;  4X3M A;  2WIT A;  1AQ5 A;  1VQ9 F;  1FZC B;  3NK7 A;  5HY4 A;  5HY1 A;  1KC8 H;  1LTJ A;  1YJ9 F;  2CZW A;  2HOD B;  3B5N D;  2LBW A;  4W80 A;  3VN0 A;  1URQ B;  4B86 A;  2OYI A;  1NTZ K;  5AVT B;  2WTY A;  1EQ7 A;  1YTZ T;  2YO3 A;  3LID A;  3RK2 D;  2ZFC A;  3SWF A;  1FZE A;  1T0K B;  2KYV A;  3B5N B;  5IT9 M;  4DOJ A;  2I1K A;  3J81 M;  1RE3 C;  2R5B A;  4LLH A;  1LGH B;  1FOS E;  1L4A B;  1PFI A;  2KG4 A;  3RK2 B;  3NK6 A;  1T2K C;  3CCR F;  3TNU A;  3HTK B;  4IFD K;  2FGY A;  1LT9 B;  4GT1 A;  2P1J A;  1H7M A;  3CI9 A;  3KDP B;  2FFD B;  3P32 A;  3GYQ A;  1LTG C;  1VQ5 F;  3HD7 D;  3N4X A;  4EIJ A;  1W2B F;  2Z5H A;  1HGV A;  1LTS C;  2QM8 A;  3MTU E;  1JTH A;  4WY4 A;  2Q5U A;  3KQG A;  1NH4 A;  4XA4 A;  2R3C A;  4N6J A;  2HPC A;  4JF7 A;  2YKO A;  3RA6 A;  1JY3 N;  1SP4 A;  1VQP F;  5CJ0 A;  1RY3 A;  1VQN F;  1CSB A;  1LWU C;  2FXM A;  2R5D A;  1FZC C;  1ZR4 A;  3II6 A;  3HD7 B;  2GUS A;  3HUS A;  3KYQ A;  1JNM A;  2LKM A;  2YNY A;  3CCL F;  2Q9I A;  1K73 H;  1YI2 F;  3LWQ C;  5HXU A;  5A2Q M;  1CK2 A;  1IFD A;  1YJN F;  5AW8 B;  3TYY A;  2YO2 A;  1NWQ A;  1GK4 A;  3JCM M;  1SQB K;  3V2Q A;  4AQR D;  1GZL A;  3PP5 A;  2WPR A;  3B8E B;  3AGK A;  2POH A;  2GLZ A;  1NTK K;  1SDS A;  2WSF H;  4BVT A;  4LGD E;  1A02 J;  2OAR A;  1L4A C;  3BRT B;  5AW1 B;  1RE3 A;  3RK2 C;  1W41 A;  2C0X A;  1T2K D;  2WT7 A;  5AW9 B;  3HAX D;  4XCQ A;  2XV5 A;  1X52 A;  1LTA C;  1LT9 C;  3L4F A;  1HVV A;  3H32 B;  3OW2 F;  2FFD C;  1PXW A;  1SQP K;  5GIP C;  1RF1 B;  5CCH C;  1G2C A;  3M0D C;  1CN7 A;  1KQL A;  2IFN A;  2GM4 A;  5AVW B;  2I1J A;  1XTC C;  1HGZ A;  1M1K H;  2H8P D;  1IFI A;  1M1J B;  3I5C A;  2VGM A;  3OA7 A;  1LTB C;  4BVR A;  1G2C B;  1QVG F;  4KHX A;  5APY A;  1GDT A;  3HD7 C;  4BW0 B;  3G4S F;  3MD0 A;  4GKG A;  3CCU F;  3PLA C;  4C7N B;  4IFF A;  4I6M C;  3A7O A;  1LWU A;  3L37 A;  1FZC A;  1K8A H;  1G1J A;  5AVX B;  5AVU B;  1ZV8 A;  3M9B A;  5AVZ B;  1NHL A;  1H8A A;  5FLX M;  1JO5 A;  3T97 A;  5GIN C;  1NTM K;  1NKZ B;  3CCE F;  1J1D C;  3VP9 A;  1URQ A;  3V7E A;  2WAL A;  1LWU B;  4AYC A;  1JY3 P;  1MZ9 A;  1Q81 H;  2WPQ A;  4GIF A;  3VMZ A;  1HUC A;  3LWP C;  1SQV K;  2KOG A;  3VP8 A;  5APS A;  1YJW F;  3B5N A;  1L4A D;  2XZR A;  1RF0 A;  3SWY A;  1E7K A;  3UIA A;  3LFO A;  1JY2 N;  5EWR A;  3P7K A;  1X8Y A;  1L4A A;  5AW5 B;  1N73 B;  4BVS A;  3HTK A;  1W3E X;  5APQ A;  3TSI A;  1W42 A;  4C4W C;  1RF1 C;  3MIW A;  1JUN A;  5CCH D;  1LT9 A;  1NKN A;  1WRG A;  3P8C E;  2E43 A;  1VQ7 F;  1FDM A;  1FZF A;  2FFD A;  2O1J A;  2W6B A;  3HE5 B;  4BVQ A;  1GO0 A;  3H6P A;  2CPB A;  1VQ4 F;  1M1J C;  2XDJ A;  4X3L A;  3M0D A;  4C7R A;  1T8Z A;  3MUD A;  2NPS D;  1KIL B;  2FYU K;  1N7S C;  3NMD A;  4I2L C;  3G6E F;  1J1E C;  1X79 B;  4NUT A;  3RK3 C;  3V2N A;  3V2R A;  2KB7 P;  5APV A;  1T3U A;  5APU A;  3O8Z A;  1GZ0 A;  1X7O A;  4ZKU A;  1VQL F;  4LC1 A;  5BU8 B;  3HD7 A;  1M7L A;  3N4Z A;  1OXZ A;  1ZR2 A;  2Q3I A;  1FZB A;  2A45 H;  4O9B A;  1NMU B;  1A02 F;  2NPS B;  1KFM A;  3CC7 F;  2OTL F;  3CL3 D;  5CMZ A;  3EQ2 A;  1VDF A;  3LWO C;  2A45 I;  1IFJ A;  5BVZ A;  4HYT B;  2P2U A;  1DH3 A;  1NO4 A;  1IPA A;  2HFE D;  4XE5 B;  1AFO A;  2JNB A;  1IC2 A;  2IFM A;  1FBM A;  4RES B;  3KPE A;  4WBA A;  1WT6 A;  1GU5 A;  1RE4 C;  3LWR C;  1Z56 A;  1HTL C;  2YKQ A;  5AW3 B;  5G4V C;  1J1D B;  3CC4 F;  1FU1 A;  3OBW A;  5AVY B;  1N73 C;  2C9N Y;  3NVI B;  2IX7 C;  3CD6 F;  2C9L Y;  1SFC D;  4OH8 B;  1VQ8 F;  5HY2 A;  4M3L A;  3R2P A;  3NTN A;  3CCJ F;  4JYB A;  4C46 A;  1SQX K;  3H32 A;  5BU5 A;  3CME F;  1RF1 A;  2N1T B;  1LTJ C;  3N4Y A;  5APX A;  2YMY A;  3NVK E;  1JY2 P;  5KTB A;  3E20 B;  1YIJ F;  1SFC B;  4EI8 A;  2Q7C A;  3HRN A;  3G3Z A;  1KIL C;  1NU1 K;  3CC2 F;  1S72 F;  2YKP A;  3SIU A;  1N7S D;  4I1L A;  3VMY A;  1M1J A;  1JMM A;  1H89 A;  3PAF A;  3OJA B;  3RK3 D;  5KJ7 C;  3JAM M;  1IFN A;  1GL2 B;  3A3Y B;  2H43 A;  1JOC A;  1W40 A;  1SLQ A;  3BAT A;  2WWW A;  1Q7Y H;  2A45 G;  1JY3 O;  3G71 F;  4C7N A;  1E5W A;  3VI6 A;  3SIV A;  1DT9 A;  5AVQ B;  5AW0 B;  2NPS C;  3M9H A;  3GHG B;  1N7S B;  3N7N A;  5HY0 A;  1G1I A;  1KD1 H;  1J1E B;  4N78 E;  5AW6 B;  3RL0 C;  3RK3 B;  2JJL A;  3E1Y A;  1NAF A;  4EI7 A;  1FZA A;  3EFG A;  3V5B A;  3P8C D;  1H88 A;  3CMA F;  2XKM A;  2XNX A;  2OYH B;  2W6A A;  2VGN A;  1FAV A;  2ALE A;  2QEX F;  3CLQ A;  4W7Z A;  2M3B A;  2J58 A;  1S9K E;  1RE4 A;  1GW3 A;  3J80 M;  2WSC H;  1YHQ F;  3RA5 A;  1SVF A;  4LCK A;  4WY4 C;  4IFM A;  1QVF F;  1HBW A;  3A2A A;  2OTJ F;  2GUV A;  3WXM B;  1J2J B;  3NFQ A;  3CG6 A;  1XTG B;  1N73 A;  1JCC A;  3A5T A;  3VMF B;  3U59 A;  2JEE A;  3M9Q A;  3O85 A;  5AVR B;  2HYN A;  1DX7 A;  2QA4 F;  3NMU C;  1MFZ A;  2N1T C;  1RA4 A;  5CCG C;  4NQ3 A;  1OWA A;  4AUW A;  2KP8 A;  1FJK A;  1GK6 A;  1SFC C;  2Z4E A;  1KIL D;  3HE5 A;  1VQK F;  1CW5 A;  3OAK A;  1IFM A;  2WSE H;  3V2P A;  3LWV C;  3CPQ A;  1MUU A;  5KJ7 D;  1KIL A;  5AVV B;  1GL2 C;  3MCA B;  2LBX A;  3ON1 A;  5CCH A;  1LTJ B;  1YYC A;  5CHX A;  1YIT F;  5KJ7 A;  5CJ4 A;  1CI6 A;  3IR9 A;  3HE4 A;  3GHG C;  4BY9 D;  2OYI B;  2PP6 A;  2R32 A;  1X7P A;  2QI2 A;  3M06 A;  5AVS B;  4WB4 A;  1CZQ A;  3RL0 D;  1N86 A;  2KTU A;  1VQ6 F;  2NPS A;  1CI6 B;  4EOT A;  3HE4 B;  1IK9 A;  2OZB A;  3BVH A;  2KTV A;  1T3J A;  5APW A;  2OHW A;  1KFN A;  1NJI H;  2OYH C;  2XU6 A;  1RLG A;  1JCD A;  3OBY A;  2MJZ A;  1SQQ K;  1FJP A;  1GD2 E;  1GW4 A;  3RL0 B;  3LIE A;  4Y99 B;  1GU4 A;  3I56 F;  4N3Y B;  2BO1 A;  3TNU B;  1KZU B;  4WY4 D;  3WMM 0;  1FOS F;  2J59 M;  1XBI A;  3M91 A;  1JY2 O;  3TK1 A;  3VTP C;  2KSJ A;  3LW5 H;  2O1K A;  3V4Q A;  1N7L A;  1ZLL A;  1LTI C;  2N1T D;  1QL2 A;  5CCG D;  2PAJ A;  2AIF A;  5HWE A;  1JTH B;  4N78 D;  2FKW B;  3U1C A;  3I55 F;  4WY4 B;  2N1T A;  5APT A;  3HJW C;  5AW4 B;  5CCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...