3IR9A

C-terminal domain of peptide chain release factor from methanosarcina mazei.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
b'AYTDESGLSELVNAAGEKLQDLELMGQKNAVRDFFKELIADSGKVAYGESQVRANLEINSVDVLLLSEDLRAERVTTKCSVCGYENKWTRRWKPPAPAAGNCPKCGSSLEVTDVTDIVDEFSELADKSNAKVVFVSTDFDEGSQLMNAFGGIAAILRYNTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide chain release factor subunit 1
publication title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 48
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ir9A01
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ir9A02
1GK6A 3MD0A 3CCEF 3A5TA 3CCQF 1CZQA 2ZFCA 2E43A 3L36A 3NVKE 3M9HA 4M3LA 5AVSB 5GINC 2XU6A 1H88A 5G4VC 5APVA 3A3YB 1VQ6F 1MV8A 3A7OA 1GZ0A 1W3EX 4AUWA 5AVYB 2WTYA 3N4ZA 1KQSF 1G2CB 1VQOF 3L35A 5AW2B 3CCMF 5APWA 5AVRB 2W27A 2VGNA 3PAFA 2QEXF 1RA4A 1A02F 4BW0B 3VMFB 2XV5A 2KG4A 1NAFA 3NMDA 3HJWC 1K73H 4NUTA 2WPQA 3SIUA 3CG6A 3NFQA 1Q82H 3HE5B 4LC1A 1YIJF 1FAVA 2P7JA 2Q7CA 1S72F 5A2QM 2Z5IA 3M0DA 1YI2F 1CK2A 2C9LY 1FOSF 1VQLF 1VQ7F 3CC7F 2VRSA 3N4YA 3AGKA 3E20B 3VMXA 3OBYA 3J81M 1NJIH 1VQ4F 1VQNF 4B86A 4X3LA 4C7NA 1VQ9F 2WALA 3VMZA 5APXA 1T0KB 5FJ4C 3I56F 5AVXB 2R32A 5AVQB 3CC2F 5AVWB 2VGMA 2CZWA 5AVUB 3E1YA 3T97A 3VMYA 2YO2A 3CMAF 3M0AA 1M1KH 2C9NY 2BASA 3CCRF 2KTUA 3TYYA 1YJNF 1W41A 3CD6F 3JAMM 1GK4A 2WWWA 3NMUC 5FLXM 3JCMM 2QM8A 2QI2A 1N8RH 1QVGF 1XBIA 2P2UA 3B8EB 1OWAA 3I55F 1CSBA 3CMEF 3OBWA 1SDSA 5AW0B 1JJ2F 5APTA 3CCSF 5AW1B 2ZXEB 2KP8A 2R5DA 3TNUA 1X7PA 2YNYA 2YO3A 2Z5HA 3KQGA 3M06A 3G6EF 1CI6A 3MCAB 3NK6A 4XE5B 1HWTC 2OTLF 3V7QA 3NVIB 3NTNA 4BY9D 3O8ZA 1YJ9F 5AW3B 4KHXA 1GZLA 1X7OA 1DH3A 4C7NB 3TK1A 1YHQF 2OZBA 1VQMF 3G4SF 1VQPF 2Q3IA 2W6AA 1QVFF 1HBWA 2FC3A 2LBXA 3I5CA 2I6DA 4GKGA 1RLGA 5G4UC 1GU5A 3LWPC 3LWRC 2JNBA 5APUA 3V4QA 3HE4A 4RESB 1DT9A 3GYQA 1IO4A 3NK7A 2BO1A 1SLQA 2JJLA 1T2KD 2HVYD 3SIVA 5AVTB 5IT9M 3UIAA 3LWVC 3SWFA 1YJWF 2ALEA 3LWQC 3G71F 3V4WA 1W42A 5APQA 2QM7A 3LIDA 2OHWA 3OW2F 4GT1A 3PLAC 3CPQA 2IPPA 1ZWZA 1NWQA 1HJBA 3HAXD 2N9BA 1GU4A 1Q86H 3TNUB 3P7KA 1Q7YH 1MFZA 3VTPC 4I2LC 1CI6B 3M9BA 1J2JB 4EOTA 2R5BA 1A02J 3IR9A 1S9KD 1H7MA 2H7HA 3RA5A 1CN7A 4C4WC 1YYCA 4JYBA 1VQ8F 5EO3A 5AW6B 3VYIA 1X52A 4HYTB 3LIEA 1Q81H 4AQRD 1JUNA 3NXSA 5CMZA 3OAKA 1JNMA 1YITF 3CCUF 3HE4B 1W2BF 1KQLA 5AW8B 2KTVA 3O85A 3CPWF 1X8YA 4X3MA 1VQKF 1MUUA 3VN0A 4I6MC 3WXMB 5GANK 2P67A 3FFMA 5GAPK 3CXCF 2XZRA 2WT7A 4C46A 5GIOC 2E42A 4DZOA 1IPAA 3A2AA 3RA6A 5AW5B 1VQ5F 5AVVB 3CC4F 1GO1A 3CCLF 4LCKA 1GO0A 4JYCA 1S9KE 5EWRA 3J7AR 5AW7B 3CCJF 1HUCA 3P8MC 5AW4B 4TZZA 1E7KA 3CCVF 2OTJF 1FOSE 1W40A 3KDPB 1H89A 4AYCA 1K8AH 1OXZA 3HTKA 2WPSA 3VI6A 1NMUB 3ON1A 1KC8H 1K9MH 5DCVA 2WPRA 3M91A 1H8AA 3J80M 5APYA 2Q5UA 3LWOC 5APSA 1GD2E 1KD1H 1SP4A 5GIPC 1GTWA 2AIFA 2LBWA 3HE5A 2R3CA 3V5BA 3V7EA 5AVZB 3MGNA 1PXWA 3LFOA 1T2KC 2QA4F 3P32A 2WT7B 3L37A 5AW9B 1M90H
chains in the Genus database with same CATH superfamily
5CJ0A 3MDOA 1S2EA 2YXRB 1X0TA 1H48A 2JP3A 5IJ0A 1N86A 1CZQA 3FPIA 3CXHH 3GHGA 3L4FA 3L75J 3NVKE 1BGYG 1M90Q 4G4VA 5GINC 4IL6H 3N4XA 3IFMA 3A3YB 2IBZG 1VQ6F 3U1AA 1RF1A 4PD4I 4AUWA 1PPJE 2BEZF 3V3TA 1MZ9A 2W6BA 2E76C 1JTHB 1HVVA 3C1LA 3H32A 2VGNA 3PAFA 2UWJE 2QEXF 1Z5VA 2JWDA 1FBMA 2K9JB 2ZVNB 2UYJA 3VMFB 1OAPA 5LYJA 2KG4A 1LTJC 2WPQA 3SIUA 4O2BB 1Q82H 1FAVA 1LJ2A 3IN6A 1NTKJ 2KS1B 1S72F 5A2QM 2OYHC 2Z5IA 1LTTC 3H25A 2CPSA 1M1JA 2DYYA 2NPSD 3M0DA 1VQ7F 2FYUG 2VRSA 4FFBA 1GW4A 2DT4A 3WPWA 1PFIA 4WY4D 2QJYB 1LP1B 1USDA 5JH7A 1PGPA 1QU9A 2YYEA 3VIUA 2XDJA 3H1HD 4OGQB 3VMXA 3OBYA 1DBFA 4H0LC 1EXJA 1SQQD 5EIBC 1XTGB 1NJIH 1VQ4F 1RE4C 3BASA 4X3LA 5HXUA 2IX7C 3WJRA 5IJ0B 4NWOB 3GW6A 3GHGB 2KXPB 3I56F 1Y47A 5AVXB 3AE4C 3CCUP 2NMUA 4YXDC 3H1LG 5BMVA 1RF1B 1KYOI 3JAKA 1NTMK 1IFNA 2CHTA 3A0HH 4WBAA 4U3FD 3T97A 3S02A 2YO2A 3CMAF 4JPZB 3H32B 1LT1A 1LT9C 3VOBA 3L74G 3EFGA 3G4SP 2V4HA 1L0ND 5LYJB 1J1EB 1QVGF 1BCCG 1RF0A 3B8EB 5KLVG 3RK2C 1OWAA 2QJKB 5AVMA 3GHZA 3OBWA 4ZHQA 2A06E 1SQVD 1M1JB 1YTZI 3B5NA 3FWNA 4JQ0D 4EYYQ 2OTJP 1EZVI 2AXTH 1IV3A 3CWBE 4UB6E 2R751 3C9TA 4FFBB 3AE6C 2YO3A 2Z5HA 1T8ZA 3G6EF 2NPSA 1NU1E 3CX5E 5JH7B 2ZYAA 3FX0A 1KN7A 4EB6A 2H89C 4WY4A 3T80A 4N78E 3VO8A 1PP9G 2PGDA 2IZ1A 5AW3B 3L72E 5KX5A 1DH3A 2YXQB 4H44D 3I3FA 4LNUA 1T0AA 2W6AA 2Y0DA 5MN4A 1M57D 3QHDA 1JY3O 4O2AA 1SQBD 2LBXA 4IFMA 5CHXA 5G4UC 4ZKPA 4NPEA 3M1XA 5BMVB 5KLIC 2L26A 3JAKB 4H13D 1N7SC 3T97B 1KYOD 1CLIA 2KI7B 4ZI7A 5MN5A 2KGWA 1SLQA 1T2KD 2W6JH 4U39A 3C9IA 1ZW0A 1SA0A 1GDTA 5CA1A 2PFXA 5HY1A 2L5GB 4NPDA 1W42A 4D6TG 5APQA 4BWNA 3GHGC 1Q8RA 4O4IA 3PLAC 3DDNA 2H6LA 3CPQA 1BE3D 2RB9A 3D54A 1FE6A 4ZHQB 3HKDA 1ZOYC 1NWQA 3CWBJ 1PGQA 2N9BA 3B5NB 2HP3A 2K88A 3FXEA 2K1SA 5KAFE 1Q86H 2ZXXA 4GDOA 2G3AA 3V2QA 1GL2C 4IOIH 2NPSB 3C9SA 5J2UA 1W5AA 2E76D 4EB6B 2Q1KA 3N2GA 3L72J 4WY4B 2R5BA 1S9KD 3W68A 1JFFA 1VF5D 3RA5A 5KX5B 3CC4P 1YYCA 4JYBA 2MQEA 2PAJA 4GIFA 1OMIA 1OW6A 1IC2A 3L75D 1KV4A 2CW4A 4O2AB 2N9YB 1M1JC 1X52A 1KILD 2AXCA 4XFJA 4HYTB 3M0DC 3TF5A 3LIEA 2IYPA 3HKCA 2BCCD 3G9RA 1YIJP 2P6YA 1AV1A 2V9YA 3CCUF 1SQPK 1P84H 2V7QH 2GVIA 2KSJA 1NU1K 1KQFB 2O1JA 3CPWF 4ZI7B 1X8YA 3U0OA 2QVAA 3VN0A 5JCOC 3S0WA 1L4AC 1EDKA 3EFFK 3FFMA 1SA0B 3CXCF 5CA1B 1RLUA 2G8YA 4R40B 4PD4E 2HR3A 4XCQA 4H0LD 4C46A 3M4SA 1URQD 5GIOC 3WGLA 2E42A 5K5GB 4Y99B 5TJHA 4O4IB 1J1DB 5BVZA 2M5AA 2PMPA 2D2CD 1NTKD 4BT5A 4RHAA 3HKDB 1ZLLA 1L0LE 3SWKA 3TGUG 2XKMA 1AA0A 1W2BO 3P8MC 3CC2P 2P58A 2O01H 1E7KA 2HG5D 2OTJF 1FOSE 1W40A 4YJ2A 5J2UB 1XV2A 4ZHYB 3N2GB 2FYUJ 2W83C 1AJYA 1SQVE 4DOJA 3BCCE 3WGJA 1NTMG 3AEFC 3AE1C 2WPSA 1FZFA 2B87A 2QTPA 1MKMA 1D7MA 3D6ZA 2VAWA 3E7KA 1S3JA 3M84A 3N2KB 3S0YA 1IV4A 2ITAA 1S5LE 3M91A 3CX5H 4H44B 2HP0A 1DD4A 1U7MA 1PPJD 3RK2D 3I55P 3HKCB 2JR8A 3RL0B 1KB9I 1LTJA 1SFCC 1VQ6P 1ZMEC 3HE5A 2R3CA 3I7TA 3IEWA 1KC8Q 1AQTA 3CCSP 3RYHA 3LW5J 2OYHA 1JB0J 1FDOA 4H13B 4EI8A 1RE3C 3HUSC 3LFOA 1PF5A 3P32A 3AE5C 1KYOE 3D00A 3K0TA 1LTGC 5GTHE 1IFMA 3GG2A 3KZIH 1NVOA 1YQ4C 2M5AB 3CCQF 1SQQK 5L8RJ 2GLZA 5B8FA 1URQA 1RE4A 2UYKA 1BCCJ 1S72P 2ZFCA 5KLVJ 4YTPC 4HNAA 3S03A 1W5FA 2LR2A 2YKOA 5AVSB 1J7HA 3FWLA 1T3UA 1PV3A 2OYIC 3BCCJ 4YJ2B 1N7SD 2FBWC 5EFWB 1SQXE 4O4HA 3UT5A 1RQUA 2WTYA 2YXZA 2ZYDA 2P1JA 1ONIA 2HPCA 3L35A 2B87B 2E76B 1PGJA 3CCMF 5KAFH 1EZVE 5KAIE 2A45G 2WSFJ 3G71P 1U3PA 1A02F 1LT9A 4LGDE 1QGKB 1S1CX 3N7NA 3CB2A 3IKEA 2HP0B 1NAFA 1L0NK 2RH0A 1KQGB 4TV8A 1LTJB 2NRGA 3H1IE 2IBZI 3P10A 2JEEA 4WWIA 3HE5B 3VYTC 1YGYA 1YIJF 2P7JA 2E5YA 2M8RA 3RYHB 3Q2YA 2OYHB 2HRUA 1SQVK 5CBOA 1FJPA 1KILE 2W8ZA 3GF7A 3IEQA 3G3ZA 1KFNA 4WBNA 5HXZA 1JY2P 1FOSF 4L75A 1KQSO 1FFXB 2WVRA 2ZT9C 4F6RA 1VHAA 3F0FA 3AE7C 2AEMA 1BDCA 3E20B 2A06D 4H44C 3F5HA 1Z5WA 3J81M 2MJZA 3PP5A 4H0LB 5JVDA 1URQB 1VQ9F 3CWBD 2M3EA 2CVLA 4I55A 2KK7A 2D2CB 5KMGA 4PD4H 4HNAB 2YKQA 1SQXJ 1OVUA 1SQBK 2GZLA 1NTZE 3CC2F 4N78D 3WMM0 3B6NA 2CSLA 5AVUB 3L72D 4O4HB 3E1YA 3UT5B 2DW3A 3VMYA 3L70G 2KYVA 3M0AA 1U43A 4YPCA 1SQPG 1L4AD 1N7SA 5B5EE 1ZR2A 1M1KH 2HPCB 3RYCA 2BASA 2R44A 3E22A 3OA7A 1NKNA 1DX7A 1HTLC 2KTUA 2B9BA 4TV9A 2IQQA 4EI9A 3JAMM 2K37A 1NHLA 2WWWA 2FFDC 1IK9A 1LT9B 4ASVA 3JCMM 5HP7A 3H1IJ 2FXOA 1N8RH 1JEKA 3RL0g 1NO4A 4TV8B 3CCLP 3L73E 3I55F 2KZJA 4I4TA 3RYFA 3RK2B 3AE2C 3FD6A 3KE1A 1SDSA 5AW0B 4PJ0H 5B66E 3D6YA 1EC5A 1FZEA 3CCSF 4WBNB 3AE8C 2KP8A 1X7PA 3F0EA 1JCCA 3M06A 4DXDA 3LMEA 3WU2H 1GL2A 4F6RB 1CI6A 1QLED 2LXBA 2ZF8A 3C9UA 1VF5C 3NK6A 5HP8A 2OTLF 2OGUA 3TSIA 4EDFA 1BSHA 3K12A 3NTNA 4BY9D 1JMBA 5JVDB 2OARA 4I1LA 3MUDC 1VQMF 1VQPF 2O1KA 1LNQA 1KILC 3GMAA 2L91A 4I55B 1KYOH 5KMGB 1NTZJ 1QVFF 3QTYA 1HBWA 5H2FE 3S0HA 3B71A 1SFCD 2C0WA 2PHNA 2G9IA 5CCGC 1GU5A 4BVRA 3OJAB 3RYIA 3LWPC 3LWRC 2FYUD 2JNBA 3V4QA 5KLIB 1K73Q 3HE4A 5HWEA 4YJ3A 4RESB 1RY3A 1N7SB 3RYCB 1IO4A 3NK7A 1H47A 3OONA 3E22B 1OFUA 2XNXA 3SIVA 5JCOA 2JDIH 4TV9B 3CXHI 2ZOVA 1L4AA 1NTMJ 1URQC 3K5BA 5HY0A 2ALEA 2Y0CA 3LWQC 3ZO8A 3G71F 3RE3A 3L73J 3S4RA 2D2CC 3LIDA 1GX1A 2OHWA 3C8LA 1Q2NA 3OW2F 4I4TB 2EWCA 3RYFB 2W90A 3H1HG 4C82A 1FSZA 1NTKK 1SQQG 1HJBA 1W5EA 1VL2A 2ZODA 1GU4A 5CJ4A 4PD4D 2HX0A 4KT0J 1IZNB 4N6JA 3WUVA 1Q7YH 1KB9E 4ASWA 1GL2B 5EAZA 3F0GA 1CI6B 3VOAA 3VYUC 1JY3N 2H88C 1L0LD 4EOTA 3IR9A 2WSEJ 3KIZA 5CCHC 2E74C 1KZUB 4U3FG 3H1KE 1BCCD 2SPZA 5J2TA 4X1IA 5KLVD 4NPFX 2B88A 5EO3A 2ZYGA 1LTBC 5AW6B 2BTQB 2JWAA 4DCKA 2KUBA 3MIWA 3RBXA 4BRYA 3BCCD 1Q81H 1JUNA 1XHOA 3JARA 3TDKA 1KNJA 1TVKA 2Z1UA 3RYIB 3MZWB 1L0NG 1JNMA 4IFDK 3HE4B 1SFCA 1SZQA 4YJ3B 5AW8B 2OTMA 2KTVA 3CI9A 1YI2P 1QAHA 3H1JE 2ZT9D 3WXMB 2P67A 1L4AB 2N1TC 3RGUA 2CPBA 3K2XA 1RE3A 3HUSA 2XZRA 4C81A 3AE3C 4PV1C 5B5EH 3CYPB 1BSNA 2IZ0A 1IPAA 3A2AA 3RA6A 2K3RA 1KNKA 5AVVB 2I6RA 3LDTA 3CCLF 4LCKA 1GO0A 1RH5B 3VP9A 2WPVB 2JO1A 1EXIA 2E5TA 4JYCA 2R6R1 5EWRA 3KHUA 1U3LA 3R0PA 1HUCA 1LTIC 1BGYE 2NZ2A 3VOPA 1QD9A 3CCVF 1SQBG 2OYIA 2IBZE 3AE9C 1K8AH 1HJ0A 1SS1A 1FU1A 3H1KJ 1JD1A 3VI6A 2KLUA 3CCQP 3KYQA 1X22A 3WGMA 5J2TB 4X1IB 5DCVA 1M8OB 5TISE 5APYA 3WJPA 3LWOC 2GUVA 1SQXD 2WSSH 3HD7D 1NQ3A 2AIFA 4BRYB 2M3BA 4UB8E 3JARB 3L71G 1TVKB 3H1JJ 3TD3A 2W8BC 1SFCB 1EZVD 1FDIA 1OW7A 3V6IA 1BE3G 3AEAC 4MN4C 1KD1Q 4TLFA 1TU3F 3MGNA 3CCMP 2HLOA 1IV1A 2FYUE 4BVQA 2KB7P 2WITA 3H1ID 2ZAUA 3C8VA 3HUSB 2BTOA 4I50A 3N2KA 3C9RA 2UYNA 4B45A 1M90H 1YJ9P 2IYOA 5GTIE 4PWTA 3MD0A 2FXPA 3H6PA 1EDLA 1YHQP 4BT3A 1ZRTE 3WGKA 3ZDMA 3O6QA 2ZVYA 1BGYJ 3SFDC 4C7RA 4HKZH 1X25A 1JM0A 1X79B 3RK3E 2QJPC 2POHA 5CCGD 4IL6X 1S4XA 2XU6A 1H88A 3D01A 5G4VC 5APVA 1MV8A 2OYIB 5HY4A 1GZ0A 3H1LE 1W3EX 5AVYB 1K05A 2E75C 5DJUB 2BCCG 2WZ7A 2ZVZA 3N4ZA 3B4SA 1G2CB 3VP8A 4LLHA 3U59A 1JCDA 3A0BE 5AW2B 2I1KA 5APWA 3JC22 5AVRB 1VQ9P 2W27A 3BRVB 1NTZD 3L74E 1GMJA 3V4DA 2FFDA 4ZHWA 1JO5A 2XV5A 3E1RA 5E79E 2J59M 3Q3DA 1RQVA 3HJWC 2FKWB 1K73H 1LTSC 2CHSA 5HY2A 4C8IA 4BVSA 1BCCE 3NFQA 5KLVE 4U3JA 4ZOLB 2Q7CA 4BXLA 2K9YA 3JCUE 3FBAA 1NTKG 2WSCJ 3GTZA 1YI2F 1CK2A 3QUWA 2K1AA 5ITZA 2C0XA 2WMMA 3MTUE 1LTAC 2A45I 1Q82Q 2ZT9B 3L73D 3AGKA 4I50B 4I7ZC 4UB6H 5CB4A 4B46A 3WUUA 5CCHD 2E74D 2UYNB 1P84I 1VQ8P 1PP9E 1FZAA 4C7NA 1KFMA 2WALA 3VMZA 1NH4A 3CXHE 3F0DA 3MUDA 5JQGA 1AVYA 3HTNA 5IJ9A 3O6QB 2Q1YA 1WT6A 1KILA 2VAMA 3DC2A 2LBTA 5FJ4C 1K9MQ 1OFCX 3H1LJ 4X1KA 1YITP 5AVQB 3Q5PA 4U7JA 2VGMA 2CZWA 5CCGA 1PPJG 1VPCA 2FYUK 1FFXA 2Z01A 1JN1A 3VCZA 2OTLP 3Q5RA 1W2EA 2N1TD 3L74J 4O4JA 1Y9BA 5KJ7C 2AMTA 3TYYA 1FS0E 3R4YA 1GK4A 1OVRA 3RK3C 1VQMP 1VQPP 5FLXM 4PV1D 4ZK7A 2FYZA 2Q1XA 2FFDB 1U7JA 1OX3A 1PZQA 1VK3A 1VQ5P 4D6TE 2P2UA 1X9VA 2QRXA 1NOHA 1LGHB 4G4YA 2RHOA 4U3JB 3KPEA 3AEGC 3CCJP 1IK7A 1L0NJ 3TD5A 5APTA 5AW1B 2BTUA 3ERNA 2ZXEB 2R5DA 5ITZB 1N73C 1JY2O 2PP6A 1OZHA 5CB4B 1HWTC 1PP9J 1VF5B 3V7QA 5EZYA 3NVIB 1L0LK 1OIPA 3U1CA 3AEDC 3O8ZA 1M7LA 1YJ9F 1LWUC 1OVVA 4KHXA 4TUYA 1GZLA 4WB4A 5CCHA 1X7OA 4C7NB 3CYQA 4X1YA 1YHQF 4JF7A 5JQGB 1N2DC 1QVGO 5IJ9B 2Q3IA 2GUSA 5KLVK 2RN0A 1KILB 1KB9D 2FC3A 4A7PA 3QWOC 4X1KB 4QMAA 1FDMA 2LKMA 3RBZA 3H1KD 4YXWH 2OYOA 2B89A 1DT9A 3ELCA 2BO1A 1G1JA 3P8CE 5LP6C 4O4JB 2HVYD 3F6MA 2Q3EA 3UIAA 1EDIA 4D6TJ 2N1TA 3LW5H 3V4WA 1CW5A 1WMKA 2QM7A 2FGYA 3R2PA 3IAOA 2KSEA 3H1JD 2IFMA 3A0BH 2A06G 2IPPA 1YTZT 4RQOA 1ZWZA 2M0BA 1JOCA 3L71J 5EYPA 4G4WA 4GOFA 2KIKA 4BT6A 3TGUE 3VYSC 3CWBG 3GLMA 3ITKA 1MFZA 4JBZA 3VTPC 1NU1G 4O4LA 2E75D 4I2LC 3USSA 1VQOP 1BDDA 1YBKA 3JCUH 3LYBA 5EZYB 2O01N 2H8EA 2N48A 3L72G 2IDBA 1H7MA 1NTME 2H7HA 2O3JA 4TUYB 3L7QA 2E74B 3KHNA 2IAFA 1ZV8A 3ESJA 3BATA 4X1YB 3HD7C 2Q6QA 1MFTA 1VQ8F 1BGYD 1SVFA 2KLVA 3VYIA 2HRYA 3VTIC 3II6A 4B62A 4OH8B 2IBZD 1AVOA 1S5LH 1R5SA 1SQXK 1KMIZ 4C8GA 4RO0A 3CCVP 2KZIA 3NXSA 2WSFH 3OAKA 1YITF 1XTCC 1W2BF 1W59A 4NQ3A 2YMKA 3VMAA 3S06A 3MP7B 1IFJA 1VQLP 1MUUA 1FZGA 3CC7P 4BT2A 4M8IA 2BCCJ 2LXCB 3WUTA 2CK3H 3QH9A 2N1TB 1YQ3C 1JY8A 1KTMA 1T6AA 1FZCB 1VQNP 4DZOA 4GOEA 4PV1B 3HKEA 5AW5B 3Q1MA 1VQ5F 3MBMA 5GTHH 1GO1A 3TGUJ 3GF3A 4ZMDA 5EYPB 3J7AR 5AW7B 2JKVA 3CCJF 5AW4B 2OQQA 1COMA 3B5ND 3K14A 1ZXGA 3CPWO 4O4LB 2AEJA 5BU5A 3AECC 2RHLA 2VAPA 1DEBA 1ZRTD 1OXZA 3CCRP 3HTKA 3IF4A 1E5WA 5KJ7D 2HS0A 4IIJA 2YIUC 1YJNP 3CD6P 1W581 3RK3D 1NMUB 3FXDA 3ON1A 4E6EA 1KC8H 4N3YB 1K9MH 4XA4A 2Q5UA 1UFYA 1UI9A 1NTZK 5KAIH 1GD2E 5BU8B 5GIPC 1PGOA 3H1LD 1AQ5A 2LBWA 3AEBC 1P84E 3CMEP 3EORA 2Y0EA 2HQSC 2FY8A 1IFPA 3V5BA 4HJGH 3L74D 1HF9A 1RQ2A 1DEEG 1PXWA 4RKUJ 4KJMA 3ZOPA 1GK6A 3CCEF 3HKEB 3SFEC 3A5TA 2H8CA 2QE7H 1L0LG 3PLNA 1ZR4A 1QL1A 2E43A 2IG8A 2LCAA 1VH8A 4KWEA 3L36A 1ODEA 3PRJA 4G4XA 4C8EA 4W7ZA 3M9HA 4M3LA 2QJPB 3V2PA 3V2RA 5LA6A 5C39A 3A7OA 1EDJA 1SQVG 2FXMA 1PP9D 3BCCG 3E1IA 1KQSF 3CXHD 1UIIA 3HTKB 4BT4A 3S1KA 4IIJB 2E75B 1VQOF 1TUBA 3L70E 1FZCC 1SQPE 2AEFA 1ZP0C 3P0ZA 3M9QA 1YJWP 5DJTB 2J5UA 5KJ7A 4X20A 2GM4A 1RA4A 4BW0B 1HGVA 2V7QJ 2PRRA 5M1BA 5IYZA 4G88A 3NMDA 4NUTA 1FC2C 4ZHVA 3JATA 3CG6A 4IFFA 3F89A 4LC1A 3RL0D 1HH0A 5CBNA 3JALA 1JMMA 1OW8A 4DT0A 1NYHA 2BEQD 2C9LY 1VQLF 1G2CA 1Z56A 5B66H 2HYNA 2QJYC 4O9BA 1R8EA 4D6TD 3CC7F 3N4YA 3HKBA 2MKVA 1N73A 2HS3A 5KKZB 3KZIE 4L73A 4I7ZB 4OGQC 2Z4EA 3TD4A 5FNVA 1VQNF 4CPGA 4B86A 2O01J 3SSUA 4ERHA 1LWUA 3KXDA 3JSVC 3MQWA 1JY3P 2RMZA 3L71D 4Z1MH 4OWFA 5APXA 2Z1TA 1T0KB 4ZOLA 2WSEH 3IMPA 2R32A 4G4ZA 3HRNA 4ZKUA 1RF1C 5LA6B 5H2FH 2FYNB 5AVWB 1SQXG 4B5CA 3L70J 2I8DA 3PJSK 1SQPJ 4Y28J 5GONA 3WGNA 1VQKP 3KJKA 1NU1J 1TUBB 2C9NY 2RHJA 3CCRF 1EZVG 1E79H 4TT3H 5LP6A 1YJNF 1W41A 1RHZB 3CD6F 4X20B 3NMUC 3CLQA 3RK3B 2R3SA 2QM8A 1J1EC 5IYZB 1T3JA 2QI2A 3HWUA 1M1KQ 3S9OA 1XBIA 3H1IG 3JATB 4LNUB 2QJKC 3PHLA 3D71A 3P8CD 1IV2A 1CSBA 3CMEF 3L75G 1S5LX 1KORA 2KNCA 2XNDH 3H1HE 3D70A 3JALB 3JASA 1JJ2F 2A45H 4IHJA 1SQQE 3W67A 3EWKA 1R5LA 1DD3A 3CL3D 1RQ7A 1N8RQ 4GODA 3TNUA 3BRTB 2YNYA 4W80A 4EI7A 3KQGA 3Q8HA 3HKBB 3V2NA 1N73B 1FNKA 3PTZA 3MCAB 2I1JA 4XE5B 1KB9H 1XRGA 5FNVB 3EQ2A 1LWUB 3TGUD 3FD5A 4U3FE 3TK1A 2OZBA 3AEEC 3G4SF 2GA1A 5EIBD 3HD7A 1YQNA 4EI2A 5LXTA 3I5CA 2I6DA 3ABVC 4GKGA 1VDFA 1NTZG 2YKPA 5EB1B 5CA0A 1RLGA 2Z1EA 1NTMD 3Q5SA 4R4MA 3WJQA 5C8YA 1ZN5A 5APUA 5GONB 1L0NE 2B33A 3MHVA 5KKZC 2J58A 3GYQA 2OTKE 2UZHA 2JJLA 1NKZB 5LP6B 5AVTB 2QA4P 5IT9M 3LWVC 1QX8A 3SWFA 1YJWF 2VXYA 1NAYA 3JVHA 1JFFB 1RF0C 4IL6E 3H1HJ 2QG4A 3L73G 3PH0A 4GT1A 1QVFO 4BVTA 4HB1A 1SQQJ 4PJ0E 1JY2N 2FYNC 3FGAD 2KNCB 1NJIQ 3JASB 3B5NC 1IFIA 4IHJB 4DRXA 3HAXD 5LOVA 1PL5A 1H0TA 3WU2E 3TNUB 2NPSC 3P7KA 2WQYC 4DJGA 3MCQA 3ZP7A 1Q90D 1SQBE 1AFOA 3M9BA 1J2JB 2HODA 4WY4C 4U3FJ 1A02J 2F9ZC 1CN7A 1R1MA 4C4WC 3JAWA 1K04A 2QEXP 1EQ7A 1Q7YQ 2Y9ZA 3HD7B 4K3AA 1QEXA 3OW2O 2YMYA 2H43A 1L0LJ 2IFNA 5LXTB 1W55A 5TISH 2ZVOB 1GW3A 2AIZP 4WVZA 5CA0B 4L74A 4AQRD 3BVHA 5EB0A 1FNJA 5CMZA 3CX5I 5C8YB 3L71E 2P10A 2QSIA 4HH2A 4UB8H 1DIPA 1KQLA 1U40A 3O85A 1L2PA 1SQVJ 4X3MA 1VQKF 1VQ7P 1BE3E 4I6MC 2RHHA 2H8PD 2RKLA 5GANK 1Q81Q 5GAPK 4OVNF 1P84D 1FJKA 1FZBA 4OGQD 4EIJA 3KJJA 2WT7A 2WSCH 3SWYA 4Y99C 1VQ4P 1J1DC 3CC4F 3BYQA 5GTIH 3A0HE 1Y8AA 5MN6A 3I56P 1S9KE 4DRXB 5LOVB 1H0TB 1SQBJ 4TZZA 3KDPB 3L75E 2QIWA 1H89A 1N7LA 1UIXA 1USEA 1WRGA 3CMAP 2KOGA 2HODB 4AYCA 2HS4A 1GL2D 1QL2A 1IFDA 4L76A 2BCCE 1JTHA 1W5CE 2HFED 3H1KG 3CCEP 2YIUB 1HGZA 1FZCA 1NGMB 3JAWB 3ZP4A 1VQVA 4R4LA 5KTBA 2WPRA 1H8AA 3P4EA 3J80M 2Q9IA 2K9JA 5APSA 1KD1H 1K8AQ 1SP4A 1GTWA 2AXTE 3RL0C 2ZAEB 3L70D 1SQPD 5E79H 4O2BA 1BE3J 1NU1D 2KS1A 2ZJSE 3CX5D 4W7YA 3H1JG 4BT7A 4H13C 1G1IA 3V7EA 5AVZB 1W5BA 2CWJA 1PIXA 1NTKE 3IKFA 4ZNCA 3G6EP 1M56D 4RJTA 1Q86Q 1T2KC 2QA4F 1LP1A 4K35A 2Z1FA 1U57A 2WT7B 3L37A 5AW9B 1IJDB 1W57A 2UYPA 3WPXA 2Y9YA
chains in the Genus database with same CATH topology
1IFMA 1GK6A 3MD0A 5CJ0A 3CCEF 3H6PA 3A5TA 3CCQF 1SQQK 2GLZA 1URQA 1RE4A 1ZR4A 1N86A 1QL1A 1CZQA 2ZFCA 2E43A 4C7RA 3L36A 3GHGA 3L4FA 1X79B 3NVKE 4W7ZA 2POHA 5CCGD 2YKOA 3M9HA 4M3LA 5AVSB 5GINC 2XU6A 1T3UA 1H88A 3V2PA 5APVA 3N4XA 3IFMA 2OYIC 5G4VC 3A3YB 1VQ6F 1MV8A 3V2RA 1N7SD 3U1AA 2OYIB 3A7OA 5HY4A 1RF1A 2FXMA 1GZ0A 1W3EX 4AUWA 5AVYB 3E1IA 2WTYA 3N4ZA 2P1JA 2WZ7A 1KQSF 3HTKB 3V3TA 1MZ9A 2W6BA 1G2CB 1JTHB 1HVVA 3VP8A 3L35A 4LLHA 2HPCA 1FZCC 1VQOF 3U59A 1JCDA 5AW2B 3H32A 3CCMF 2I1KA 3M9QA 5APWA 5AVRB 5KJ7A 2W27A 2VGNA 3PAFA 2A45G 3BRVB 2QEXF 2GM4A 1RA4A 1A02F 1LT9A 4BW0B 1FBMA 4LGDE 1HGVA 3N7NA 3VMFB 2FFDA 1JO5A 2XV5A 2KG4A 1NAFA 1L0NK 2J59M 3NMDA 3HJWC 2FKWB 1LTJC 1K73H 4NUTA 1LTSC 2WPQA 5HY2A 3SIUA 3CG6A 1LTJB 4BVSA 3NFQA 1Q82H 2JEEA 3HE5B 4IFFA 4LC1A 1FAVA 1YIJF 3RL0D 1HH0A 2P7JA 2Q7CA 1S72F 5A2QM 2M8RA 2OYHC 2Z5IA 1JMMA 1LTTC 2CPSA 1M1JA 2OYHB 1SQVK 1FJPA 2NPSD 3M0DA 1YI2F 3G3ZA 1KFNA 5HXZA 1CK2A 2C9LY 1JY2P 1FOSF 1VQLF 1G2CA 1VQ7F 1Z56A 2C0XA 2HYNA 2VRSA 1GW4A 4O9BA 3MTUE 3CC7F 1LTAC 1PFIA 4WY4D 2A45I 3N4YA 1N73A 3AGKA 3E20B 5CCHD 2XDJA 2Z4EA 3VMXA 3OBYA 3J81M 2MJZA 3PP5A 1XTGB 1NJIH 1VQ4F 1RE4C 1VQNF 4B86A 3BASA 4X3LA 1FZAA 1URQB 5HXUA 1LWUA 4C7NA 1VQ9F 2IX7C 1KFMA 2WALA 3VMZA 1JY3P 1NH4A 3MUDA 5APXA 1WT6A 1KILA 1T0KB 3GHGB 5FJ4C 2YKQA 3I56F 2WSEH 5AVXB 1SQBK 2R32A 3HRNA 4ZKUA 5AVQB 1RF1C 3CC2F 4N78D 5AVWB 3WMM0 2VGMA 1RF1B 2CZWA 5AVUB 5CCGA 1VPCA 1NTMK 3E1YA 1IFNA 2FYUK 4WBAA 3T97A 3VMYA 2YO2A 3CMAF 2KYVA 3M0AA 1L4AD 1N7SA 1ZR2A 1M1KH 2HPCB 1W2EA 2C9NY 2BASA 3CCRF 2N1TD 3OA7A 3H32B 1NKNA 5KJ7C 1HTLC 1DX7A 3TYYA 2KTUA 1YJNF 1W41A 3CD6F 4EI9A 3JAMM 1GK4A 1LT9C 1NHLA 2WWWA 3EFGA 3RK3C 3NMUC 2FFDC 1IK9A 1LT9B 5FLXM 3JCMM 3CLQA 2FYZA 3RK3B 2FFDB 2QM8A 1J1EC 1T3JA 2QI2A 1N8RH 1J1EB 1QVGF 1XBIA 1NO4A 2P2UA 1X9VA 1RF0A 3B8EB 1NOHA 1LGHB 1OWAA 3RK2C 3P8CD 3I55F 1CSBA 3CMEF 3RK2B 3KPEA 3OBWA 1SDSA 5AW0B 1JJ2F 2A45H 1M1JB 1YTZI 3B5NA 5APTA 3CCSF 1FZEA 3CL3D 5AW1B 2ZXEB 2KP8A 2R5DA 3TNUA 3BRTB 1X7PA 2YNYA 2YO3A 4W80A 2Z5HA 4EI7A 3KQGA 1JCCA 3M06A 1T8ZA 1N73C 3G6EF 2NPSA 1GL2A 1JY2O 3V2NA 1N73B 1CI6A 2PP6A 3MCAB 3NK6A 2I1JA 4XE5B 1HWTC 2OTLF 3V7QA 4WY4A 3NVIB 3TSIA 1L0LK 4N78E 3U1CA 3NTNA 4BY9D 3O8ZA 1M7LA 1YJ9F 1LWUC 5AW3B 4KHXA 1GZLA 4WB4A 2OARA 3EQ2A 5CCHA 1DH3A 1LWUB 4I1LA 4C7NB 1X7OA 3TK1A 1YHQF 4JF7A 2OZBA 1VQMF 1N2DC 3G4SF 1VQPF 2O1KA 2Q3IA 1KILC 2GUSA 2W6AA 3HD7A 5KLVK 1KILB 1QVFF 1JY3O 1HBWA 2FC3A 2LBXA 3I5CA 2I6DA 4GKGA 1SFCD 2C0WA 4IFMA 1VDFA 2YKPA 1RLGA 5CHXA 1FDMA 5G4UC 4ZKPA 2LKMA 5CCGC 1GU5A 4BVRA 3OJAB 3LWPC 3LWRC 1ZN5A 2JNBA 5APUA 3V4QA 3HE4A 5HWEA 1N7SC 4RESB 1RY3A 1N7SB 2J58A 1DT9A 3GYQA 1IO4A 3NK7A 2BO1A 1G1JA 3P8CE 1SLQA 2XNXA 2JJLA 1NKZB 1T2KD 2HVYD 3SIVA 5AVTB 1L4AA 3UIAA 3LWVC 3C9IA 5IT9M 1URQC 3SWFA 1GDTA 5HY0A 2ALEA 1YJWF 2N1TA 3LWQC 5HY1A 3G71F 2L5GB 3LW5H 3V4WA 1W42A 1CW5A 5APQA 2QM7A 3GHGC 2FGYA 3R2PA 1RF0C 3LIDA 2OHWA 2IFMA 3OW2F 4GT1A 3PLAC 4BVTA 3CPQA 1JY2N 2IPPA 1NTKK 1YTZT 1ZWZA 1NWQA 3B5NC 1HJBA 1JOCA 1IFIA 3HAXD 2N9BA 3B5NB 1GU4A 5CJ4A 1Q86H 3TNUB 4N6JA 3V2QA 2NPSC 1GL2C 3P7KA 1Q7YH 1MFZA 3VTPC 2NPSB 1GL2B 4I2LC 1CI6B 1AFOA 3M9BA 1J2JB 2HODA 4WY4C 1JY3N 4EOTA 4WY4B 2R5BA 1A02J 2F9ZC 3IR9A 1S9KD 5CCHC 1H7MA 1KZUB 2H7HA 3RA5A 1CN7A 4C4WC 1ZV8A 1YYCA 3BATA 4JYBA 1EQ7A 3HD7C 2PAJA 4GIFA 1VQ8F 5EO3A 3HD7B 1SVFA 1LTBC 5AW6B 1IC2A 2KLVA 2YMYA 3VYIA 3II6A 2H43A 4OH8B 3MIWA 2IFNA 1M1JC 1X52A 1SQXK 1KILD 1GW3A 4HYTB 3M0DC 3LIEA 1Q81H 4AQRD 3BVHA 3NXSA 1JUNA 2WSFH 5CMZA 3OAKA 1JNMA 1XTCC 3CCUF 1YITF 1SQPK 4HH2A 4IFDK 3HE4B 1SFCA 1W2BF 1KQLA 5AW8B 2KSJA 1NU1K 2KTVA 3O85A 4NQ3A 3CI9A 2O1JA 3CPWF 1X8YA 1IFJA 4X3MA 1VQKF 1MUUA 3VN0A 1FZGA 4I6MC 2H8PD 1L4AC 3WXMB 5GANK 2P67A 1L4AB 3FFMA 5GAPK 2N1TC 3CXCF 1FJKA 2CPBA 2N1TB 1FZBA 1RE3A 3HUSA 2XZRA 4EIJA 4XCQA 2WT7A 2WSCH 4C46A 1FZCB 1URQD 3SWYA 5GIOC 4Y99C 2E42A 4DZOA 1J1DC 1IPAA 4Y99B 3A2AA 3RA6A 5AW5B 1VQ5F 1J1DB 5AVVB 3CC4F 5BVZA 1GO1A 3CCLF 4LCKA 1ZLLA 1GO0A 3VP9A 4JYCA 1S9KE 5EWRA 3J7AR 5AW7B 3CCJF 2XKMA 1HUCA 3P8MC 5AW4B 1LTIC 3B5ND 2O01H 4TZZA 3VOPA 1E7KA 2HG5D 3CCVF 2OTJF 1FOSE 1W40A 3KDPB 1H89A 2OYIA 1N7LA 5BU5A 1WRGA 2KOGA 2HODB 4AYCA 1K8AH 1DEBA 1GL2D 1QL2A 4DOJA 1OXZA 1FU1A 1IFDA 3HTKA 1E5WA 5KJ7D 1JTHA 2WPSA 1FZFA 2HFED 1HGZA 1FZCA 3VI6A 3RK3D 1NMUB 3KYQA 5KTBA 3ON1A 1KC8H 4N3YB 1K9MH 5DCVA 2WPRA 3M91A 1H8AA 4XA4A 3J80M 5APYA 2Q5UA 2Q9IA 3LWOC 1NTZK 2GUVA 5APSA 1GD2E 1KD1H 1SP4A 5BU8B 3HD7D 1GTWA 2AIFA 5GIPC 1AQ5A 2LBWA 3RK2D 3RL0C 2M3BA 3RL0B 1LTJA 1SFCC 3HE5A 2R3CA 1SFCB 4W7YA 2OYHA 3V5BA 1G1IA 3V7EA 5AVZB 3MGNA 2HLOA 4EI8A 1PXWA 4BVQA 3HUSC 1RE3C 3LFOA 2KB7P 1T2KC 2QA4F 2WITA 3P32A 3HUSB 3D00A 2WT7B 3L37A 5AW9B 1IJDB 1LTGC 1M90H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK6 A;  3MD0 A;  3CCE F;  3A5T A;  3CCQ F;  1CZQ A;  2ZFC A;  2E43 A;  3L36 A;  3NVK E;  3M9H A;  4M3L A;  5AVS B;  5GIN C;  2XU6 A;  1H88 A;  5G4V C;  5APV A;  3A3Y B;  1VQ6 F;  1MV8 A;  3A7O A;  1GZ0 A;  1W3E X;  4AUW A;  5AVY B;  2WTY A;  3N4Z A;  1KQS F;  1G2C B;  1VQO F;  3L35 A;  5AW2 B;  3CCM F;  5APW A;  5AVR B;  2W27 A;  2VGN A;  3PAF A;  2QEX F;  1RA4 A;  1A02 F;  4BW0 B;  3VMF B;  2XV5 A;  2KG4 A;  1NAF A;  3NMD A;  3HJW C;  1K73 H;  4NUT A;  2WPQ A;  3SIU A;  3CG6 A;  3NFQ A;  1Q82 H;  3HE5 B;  4LC1 A;  1YIJ F;  1FAV A;  2P7J A;  2Q7C A;  1S72 F;  5A2Q M;  2Z5I A;  3M0D A;  1YI2 F;  1CK2 A;  2C9L Y;  1FOS F;  1VQL F;  1VQ7 F;  3CC7 F;  2VRS A;  3N4Y A;  3AGK A;  3E20 B;  3VMX A;  3OBY A;  3J81 M;  1NJI H;  1VQ4 F;  1VQN F;  4B86 A;  4X3L A;  4C7N A;  1VQ9 F;  2WAL A;  3VMZ A;  5APX A;  1T0K B;  5FJ4 C;  3I56 F;  5AVX B;  2R32 A;  5AVQ B;  3CC2 F;  5AVW B;  2VGM A;  2CZW A;  5AVU B;  3E1Y A;  3T97 A;  3VMY A;  2YO2 A;  3CMA F;  3M0A A;  1M1K H;  2C9N Y;  2BAS A;  3CCR F;  2KTU A;  3TYY A;  1YJN F;  1W41 A;  3CD6 F;  3JAM M;  1GK4 A;  2WWW A;  3NMU C;  5FLX M;  3JCM M;  2QM8 A;  2QI2 A;  1N8R H;  1QVG F;  1XBI A;  2P2U A;  3B8E B;  1OWA A;  3I55 F;  1CSB A;  3CME F;  3OBW A;  1SDS A;  5AW0 B;  1JJ2 F;  5APT A;  3CCS F;  5AW1 B;  2ZXE B;  2KP8 A;  2R5D A;  3TNU A;  1X7P A;  2YNY A;  2YO3 A;  2Z5H A;  3KQG A;  3M06 A;  3G6E F;  1CI6 A;  3MCA B;  3NK6 A;  4XE5 B;  1HWT C;  2OTL F;  3V7Q A;  3NVI B;  3NTN A;  4BY9 D;  3O8Z A;  1YJ9 F;  5AW3 B;  4KHX A;  1GZL A;  1X7O A;  1DH3 A;  4C7N B;  3TK1 A;  1YHQ F;  2OZB A;  1VQM F;  3G4S F;  1VQP F;  2Q3I A;  2W6A A;  1QVF F;  1HBW A;  2FC3 A;  2LBX A;  3I5C A;  2I6D A;  4GKG A;  1RLG A;  5G4U C;  1GU5 A;  3LWP C;  3LWR C;  2JNB A;  5APU A;  3V4Q A;  3HE4 A;  4RES B;  1DT9 A;  3GYQ A;  1IO4 A;  3NK7 A;  2BO1 A;  1SLQ A;  2JJL A;  1T2K D;  2HVY D;  3SIV A;  5AVT B;  5IT9 M;  3UIA A;  3LWV C;  3SWF A;  1YJW F;  2ALE A;  3LWQ C;  3G71 F;  3V4W A;  1W42 A;  5APQ A;  2QM7 A;  3LID A;  2OHW A;  3OW2 F;  4GT1 A;  3PLA C;  3CPQ A;  2IPP A;  1ZWZ A;  1NWQ A;  1HJB A;  3HAX D;  2N9B A;  1GU4 A;  1Q86 H;  3TNU B;  3P7K A;  1Q7Y H;  1MFZ A;  3VTP C;  4I2L C;  1CI6 B;  3M9B A;  1J2J B;  4EOT A;  2R5B A;  1A02 J;  3IR9 A;  1S9K D;  1H7M A;  2H7H A;  3RA5 A;  1CN7 A;  4C4W C;  1YYC A;  4JYB A;  1VQ8 F;  5EO3 A;  5AW6 B;  3VYI A;  1X52 A;  4HYT B;  3LIE A;  1Q81 H;  4AQR D;  1JUN A;  3NXS A;  5CMZ A;  3OAK A;  1JNM A;  1YIT F;  3CCU F;  3HE4 B;  1W2B F;  1KQL A;  5AW8 B;  2KTV A;  3O85 A;  3CPW F;  1X8Y A;  4X3M A;  1VQK F;  1MUU A;  3VN0 A;  4I6M C;  3WXM B;  5GAN K;  2P67 A;  3FFM A;  5GAP K;  3CXC F;  2XZR A;  2WT7 A;  4C46 A;  5GIO C;  2E42 A;  4DZO A;  1IPA A;  3A2A A;  3RA6 A;  5AW5 B;  1VQ5 F;  5AVV B;  3CC4 F;  1GO1 A;  3CCL F;  4LCK A;  1GO0 A;  4JYC A;  1S9K E;  5EWR A;  3J7A R;  5AW7 B;  3CCJ F;  1HUC A;  3P8M C;  5AW4 B;  4TZZ A;  1E7K A;  3CCV F;  2OTJ F;  1FOS E;  1W40 A;  3KDP B;  1H89 A;  4AYC A;  1K8A H;  1OXZ A;  3HTK A;  2WPS A;  3VI6 A;  1NMU B;  3ON1 A;  1KC8 H;  1K9M H;  5DCV A;  2WPR A;  3M91 A;  1H8A A;  3J80 M;  5APY A;  2Q5U A;  3LWO C;  5APS A;  1GD2 E;  1KD1 H;  1SP4 A;  5GIP C;  1GTW A;  2AIF A;  2LBW A;  3HE5 A;  2R3C A;  3V5B A;  3V7E A;  5AVZ B;  3MGN A;  1PXW A;  3LFO A;  1T2K C;  2QA4 F;  3P32 A;  2WT7 B;  3L37 A;  5AW9 B;  1M90 H; 
#chains in the Genus database with same CATH topology
 5CJ0 A;  3MDO A;  1S2E A;  2YXR B;  1X0T A;  1H48 A;  2JP3 A;  5IJ0 A;  1N86 A;  1CZQ A;  3FPI A;  3CXH H;  3GHG A;  3L4F A;  3L75 J;  3NVK E;  1BGY G;  1M90 Q;  4G4V A;  5GIN C;  4IL6 H;  3N4X A;  3IFM A;  3A3Y B;  2IBZ G;  1VQ6 F;  3U1A A;  1RF1 A;  4PD4 I;  4AUW A;  1PPJ E;  2BEZ F;  3V3T A;  1MZ9 A;  2W6B A;  2E76 C;  1JTH B;  1HVV A;  3C1L A;  3H32 A;  2VGN A;  3PAF A;  2UWJ E;  2QEX F;  1Z5V A;  2JWD A;  1FBM A;  2K9J B;  2ZVN B;  2UYJ A;  3VMF B;  1OAP A;  5LYJ A;  2KG4 A;  1LTJ C;  2WPQ A;  3SIU A;  4O2B B;  1Q82 H;  1FAV A;  1LJ2 A;  3IN6 A;  1NTK J;  2KS1 B;  1S72 F;  5A2Q M;  2OYH C;  2Z5I A;  1LTT C;  3H25 A;  2CPS A;  1M1J A;  2DYY A;  2NPS D;  3M0D A;  1VQ7 F;  2FYU G;  2VRS A;  4FFB A;  1GW4 A;  2DT4 A;  3WPW A;  1PFI A;  4WY4 D;  2QJY B;  1LP1 B;  1USD A;  5JH7 A;  1PGP A;  1QU9 A;  2YYE A;  3VIU A;  2XDJ A;  3H1H D;  4OGQ B;  3VMX A;  3OBY A;  1DBF A;  4H0L C;  1EXJ A;  1SQQ D;  5EIB C;  1XTG B;  1NJI H;  1VQ4 F;  1RE4 C;  3BAS A;  4X3L A;  5HXU A;  2IX7 C;  3WJR A;  5IJ0 B;  4NWO B;  3GW6 A;  3GHG B;  2KXP B;  3I56 F;  1Y47 A;  5AVX B;  3AE4 C;  3CCU P;  2NMU A;  4YXD C;  3H1L G;  5BMV A;  1RF1 B;  1KYO I;  3JAK A;  1NTM K;  1IFN A;  2CHT A;  3A0H H;  4WBA A;  4U3F D;  3T97 A;  3S02 A;  2YO2 A;  3CMA F;  4JPZ B;  3H32 B;  1LT1 A;  1LT9 C;  3VOB A;  3L74 G;  3EFG A;  3G4S P;  2V4H A;  1L0N D;  5LYJ B;  1J1E B;  1QVG F;  1BCC G;  1RF0 A;  3B8E B;  5KLV G;  3RK2 C;  1OWA A;  2QJK B;  5AVM A;  3GHZ A;  3OBW A;  4ZHQ A;  2A06 E;  1SQV D;  1M1J B;  1YTZ I;  3B5N A;  3FWN A;  4JQ0 D;  4EYY Q;  2OTJ P;  1EZV I;  2AXT H;  1IV3 A;  3CWB E;  4UB6 E;  2R75 1;  3C9T A;  4FFB B;  3AE6 C;  2YO3 A;  2Z5H A;  1T8Z A;  3G6E F;  2NPS A;  1NU1 E;  3CX5 E;  5JH7 B;  2ZYA A;  3FX0 A;  1KN7 A;  4EB6 A;  2H89 C;  4WY4 A;  3T80 A;  4N78 E;  3VO8 A;  1PP9 G;  2PGD A;  2IZ1 A;  5AW3 B;  3L72 E;  5KX5 A;  1DH3 A;  2YXQ B;  4H44 D;  3I3F A;  4LNU A;  1T0A A;  2W6A A;  2Y0D A;  5MN4 A;  1M57 D;  3QHD A;  1JY3 O;  4O2A A;  1SQB D;  2LBX A;  4IFM A;  5CHX A;  5G4U C;  4ZKP A;  4NPE A;  3M1X A;  5BMV B;  5KLI C;  2L26 A;  3JAK B;  4H13 D;  1N7S C;  3T97 B;  1KYO D;  1CLI A;  2KI7 B;  4ZI7 A;  5MN5 A;  2KGW A;  1SLQ A;  1T2K D;  2W6J H;  4U39 A;  3C9I A;  1ZW0 A;  1SA0 A;  1GDT A;  5CA1 A;  2PFX A;  5HY1 A;  2L5G B;  4NPD A;  1W42 A;  4D6T G;  5APQ A;  4BWN A;  3GHG C;  1Q8R A;  4O4I A;  3PLA C;  3DDN A;  2H6L A;  3CPQ A;  1BE3 D;  2RB9 A;  3D54 A;  1FE6 A;  4ZHQ B;  3HKD A;  1ZOY C;  1NWQ A;  3CWB J;  1PGQ A;  2N9B A;  3B5N B;  2HP3 A;  2K88 A;  3FXE A;  2K1S A;  5KAF E;  1Q86 H;  2ZXX A;  4GDO A;  2G3A A;  3V2Q A;  1GL2 C;  4IOI H;  2NPS B;  3C9S A;  5J2U A;  1W5A A;  2E76 D;  4EB6 B;  2Q1K A;  3N2G A;  3L72 J;  4WY4 B;  2R5B A;  1S9K D;  3W68 A;  1JFF A;  1VF5 D;  3RA5 A;  5KX5 B;  3CC4 P;  1YYC A;  4JYB A;  2MQE A;  2PAJ A;  4GIF A;  1OMI A;  1OW6 A;  1IC2 A;  3L75 D;  1KV4 A;  2CW4 A;  4O2A B;  2N9Y B;  1M1J C;  1X52 A;  1KIL D;  2AXC A;  4XFJ A;  4HYT B;  3M0D C;  3TF5 A;  3LIE A;  2IYP A;  3HKC A;  2BCC D;  3G9R A;  1YIJ P;  2P6Y A;  1AV1 A;  2V9Y A;  3CCU F;  1SQP K;  1P84 H;  2V7Q H;  2GVI A;  2KSJ A;  1NU1 K;  1KQF B;  2O1J A;  3CPW F;  4ZI7 B;  1X8Y A;  3U0O A;  2QVA A;  3VN0 A;  5JCO C;  3S0W A;  1L4A C;  1EDK A;  3EFF K;  3FFM A;  1SA0 B;  3CXC F;  5CA1 B;  1RLU A;  2G8Y A;  4R40 B;  4PD4 E;  2HR3 A;  4XCQ A;  4H0L D;  4C46 A;  3M4S A;  1URQ D;  5GIO C;  3WGL A;  2E42 A;  5K5G B;  4Y99 B;  5TJH A;  4O4I B;  1J1D B;  5BVZ A;  2M5A A;  2PMP A;  2D2C D;  1NTK D;  4BT5 A;  4RHA A;  3HKD B;  1ZLL A;  1L0L E;  3SWK A;  3TGU G;  2XKM A;  1AA0 A;  1W2B O;  3P8M C;  3CC2 P;  2P58 A;  2O01 H;  1E7K A;  2HG5 D;  2OTJ F;  1FOS E;  1W40 A;  4YJ2 A;  5J2U B;  1XV2 A;  4ZHY B;  3N2G B;  2FYU J;  2W83 C;  1AJY A;  1SQV E;  4DOJ A;  3BCC E;  3WGJ A;  1NTM G;  3AEF C;  3AE1 C;  2WPS A;  1FZF A;  2B87 A;  2QTP A;  1MKM A;  1D7M A;  3D6Z A;  2VAW A;  3E7K A;  1S3J A;  3M84 A;  3N2K B;  3S0Y A;  1IV4 A;  2ITA A;  1S5L E;  3M91 A;  3CX5 H;  4H44 B;  2HP0 A;  1DD4 A;  1U7M A;  1PPJ D;  3RK2 D;  3I55 P;  3HKC B;  2JR8 A;  3RL0 B;  1KB9 I;  1LTJ A;  1SFC C;  1VQ6 P;  1ZME C;  3HE5 A;  2R3C A;  3I7T A;  3IEW A;  1KC8 Q;  1AQT A;  3CCS P;  3RYH A;  3LW5 J;  2OYH A;  1JB0 J;  1FDO A;  4H13 B;  4EI8 A;  1RE3 C;  3HUS C;  3LFO A;  1PF5 A;  3P32 A;  3AE5 C;  1KYO E;  3D00 A;  3K0T A;  1LTG C;  5GTH E;  1IFM A;  3GG2 A;  3KZI H;  1NVO A;  1YQ4 C;  2M5A B;  3CCQ F;  1SQQ K;  5L8R J;  2GLZ A;  5B8F A;  1URQ A;  1RE4 A;  2UYK A;  1BCC J;  1S72 P;  2ZFC A;  5KLV J;  4YTP C;  4HNA A;  3S03 A;  1W5F A;  2LR2 A;  2YKO A;  5AVS B;  1J7H A;  3FWL A;  1T3U A;  1PV3 A;  2OYI C;  3BCC J;  4YJ2 B;  1N7S D;  2FBW C;  5EFW B;  1SQX E;  4O4H A;  3UT5 A;  1RQU A;  2WTY A;  2YXZ A;  2ZYD A;  2P1J A;  1ONI A;  2HPC A;  3L35 A;  2B87 B;  2E76 B;  1PGJ A;  3CCM F;  5KAF H;  1EZV E;  5KAI E;  2A45 G;  2WSF J;  3G71 P;  1U3P A;  1A02 F;  1LT9 A;  4LGD E;  1QGK B;  1S1C X;  3N7N A;  3CB2 A;  3IKE A;  2HP0 B;  1NAF A;  1L0N K;  2RH0 A;  1KQG B;  4TV8 A;  1LTJ B;  2NRG A;  3H1I E;  2IBZ I;  3P10 A;  2JEE A;  4WWI A;  3HE5 B;  3VYT C;  1YGY A;  1YIJ F;  2P7J A;  2E5Y A;  2M8R A;  3RYH B;  3Q2Y A;  2OYH B;  2HRU A;  1SQV K;  5CBO A;  1FJP A;  1KIL E;  2W8Z A;  3GF7 A;  3IEQ A;  3G3Z A;  1KFN A;  4WBN A;  5HXZ A;  1JY2 P;  1FOS F;  4L75 A;  1KQS O;  1FFX B;  2WVR A;  2ZT9 C;  4F6R A;  1VHA A;  3F0F A;  3AE7 C;  2AEM A;  1BDC A;  3E20 B;  2A06 D;  4H44 C;  3F5H A;  1Z5W A;  3J81 M;  2MJZ A;  3PP5 A;  4H0L B;  5JVD A;  1URQ B;  1VQ9 F;  3CWB D;  2M3E A;  2CVL A;  4I55 A;  2KK7 A;  2D2C B;  5KMG A;  4PD4 H;  4HNA B;  2YKQ A;  1SQX J;  1OVU A;  1SQB K;  2GZL A;  1NTZ E;  3CC2 F;  4N78 D;  3WMM 0;  3B6N A;  2CSL A;  5AVU B;  3L72 D;  4O4H B;  3E1Y A;  3UT5 B;  2DW3 A;  3VMY A;  3L70 G;  2KYV A;  3M0A A;  1U43 A;  4YPC A;  1SQP G;  1L4A D;  1N7S A;  5B5E E;  1ZR2 A;  1M1K H;  2HPC B;  3RYC A;  2BAS A;  2R44 A;  3E22 A;  3OA7 A;  1NKN A;  1DX7 A;  1HTL C;  2KTU A;  2B9B A;  4TV9 A;  2IQQ A;  4EI9 A;  3JAM M;  2K37 A;  1NHL A;  2WWW A;  2FFD C;  1IK9 A;  1LT9 B;  4ASV A;  3JCM M;  5HP7 A;  3H1I J;  2FXO A;  1N8R H;  1JEK A;  3RL0 g;  1NO4 A;  4TV8 B;  3CCL P;  3L73 E;  3I55 F;  2KZJ A;  4I4T A;  3RYF A;  3RK2 B;  3AE2 C;  3FD6 A;  3KE1 A;  1SDS A;  5AW0 B;  4PJ0 H;  5B66 E;  3D6Y A;  1EC5 A;  1FZE A;  3CCS F;  4WBN B;  3AE8 C;  2KP8 A;  1X7P A;  3F0E A;  1JCC A;  3M06 A;  4DXD A;  3LME A;  3WU2 H;  1GL2 A;  4F6R B;  1CI6 A;  1QLE D;  2LXB A;  2ZF8 A;  3C9U A;  1VF5 C;  3NK6 A;  5HP8 A;  2OTL F;  2OGU A;  3TSI A;  4EDF A;  1BSH A;  3K12 A;  3NTN A;  4BY9 D;  1JMB A;  5JVD B;  2OAR A;  4I1L A;  3MUD C;  1VQM F;  1VQP F;  2O1K A;  1LNQ A;  1KIL C;  3GMA A;  2L91 A;  4I55 B;  1KYO H;  5KMG B;  1NTZ J;  1QVF F;  3QTY A;  1HBW A;  5H2F E;  3S0H A;  3B71 A;  1SFC D;  2C0W A;  2PHN A;  2G9I A;  5CCG C;  1GU5 A;  4BVR A;  3OJA B;  3RYI A;  3LWP C;  3LWR C;  2FYU D;  2JNB A;  3V4Q A;  5KLI B;  1K73 Q;  3HE4 A;  5HWE A;  4YJ3 A;  4RES B;  1RY3 A;  1N7S B;  3RYC B;  1IO4 A;  3NK7 A;  1H47 A;  3OON A;  3E22 B;  1OFU A;  2XNX A;  3SIV A;  5JCO A;  2JDI H;  4TV9 B;  3CXH I;  2ZOV A;  1L4A A;  1NTM J;  1URQ C;  3K5B A;  5HY0 A;  2ALE A;  2Y0C A;  3LWQ C;  3ZO8 A;  3G71 F;  3RE3 A;  3L73 J;  3S4R A;  2D2C C;  3LID A;  1GX1 A;  2OHW A;  3C8L A;  1Q2N A;  3OW2 F;  4I4T B;  2EWC A;  3RYF B;  2W90 A;  3H1H G;  4C82 A;  1FSZ A;  1NTK K;  1SQQ G;  1HJB A;  1W5E A;  1VL2 A;  2ZOD A;  1GU4 A;  5CJ4 A;  4PD4 D;  2HX0 A;  4KT0 J;  1IZN B;  4N6J A;  3WUV A;  1Q7Y H;  1KB9 E;  4ASW A;  1GL2 B;  5EAZ A;  3F0G A;  1CI6 B;  3VOA A;  3VYU C;  1JY3 N;  2H88 C;  1L0L D;  4EOT A;  3IR9 A;  2WSE J;  3KIZ A;  5CCH C;  2E74 C;  1KZU B;  4U3F G;  3H1K E;  1BCC D;  2SPZ A;  5J2T A;  4X1I A;  5KLV D;  4NPF X;  2B88 A;  5EO3 A;  2ZYG A;  1LTB C;  5AW6 B;  2BTQ B;  2JWA A;  4DCK A;  2KUB A;  3MIW A;  3RBX A;  4BRY A;  3BCC D;  1Q81 H;  1JUN A;  1XHO A;  3JAR A;  3TDK A;  1KNJ A;  1TVK A;  2Z1U A;  3RYI B;  3MZW B;  1L0N G;  1JNM A;  4IFD K;  3HE4 B;  1SFC A;  1SZQ A;  4YJ3 B;  5AW8 B;  2OTM A;  2KTV A;  3CI9 A;  1YI2 P;  1QAH A;  3H1J E;  2ZT9 D;  3WXM B;  2P67 A;  1L4A B;  2N1T C;  3RGU A;  2CPB A;  3K2X A;  1RE3 A;  3HUS A;  2XZR A;  4C81 A;  3AE3 C;  4PV1 C;  5B5E H;  3CYP B;  1BSN A;  2IZ0 A;  1IPA A;  3A2A A;  3RA6 A;  2K3R A;  1KNK A;  5AVV B;  2I6R A;  3LDT A;  3CCL F;  4LCK A;  1GO0 A;  1RH5 B;  3VP9 A;  2WPV B;  2JO1 A;  1EXI A;  2E5T A;  4JYC A;  2R6R 1;  5EWR A;  3KHU A;  1U3L A;  3R0P A;  1HUC A;  1LTI C;  1BGY E;  2NZ2 A;  3VOP A;  1QD9 A;  3CCV F;  1SQB G;  2OYI A;  2IBZ E;  3AE9 C;  1K8A H;  1HJ0 A;  1SS1 A;  1FU1 A;  3H1K J;  1JD1 A;  3VI6 A;  2KLU A;  3CCQ P;  3KYQ A;  1X22 A;  3WGM A;  5J2T B;  4X1I B;  5DCV A;  1M8O B;  5TIS E;  5APY A;  3WJP A;  3LWO C;  2GUV A;  1SQX D;  2WSS H;  3HD7 D;  1NQ3 A;  2AIF A;  4BRY B;  2M3B A;  4UB8 E;  3JAR B;  3L71 G;  1TVK B;  3H1J J;  3TD3 A;  2W8B C;  1SFC B;  1EZV D;  1FDI A;  1OW7 A;  3V6I A;  1BE3 G;  3AEA C;  4MN4 C;  1KD1 Q;  4TLF A;  1TU3 F;  3MGN A;  3CCM P;  2HLO A;  1IV1 A;  2FYU E;  4BVQ A;  2KB7 P;  2WIT A;  3H1I D;  2ZAU A;  3C8V A;  3HUS B;  2BTO A;  4I50 A;  3N2K A;  3C9R A;  2UYN A;  4B45 A;  1M90 H;  1YJ9 P;  2IYO A;  5GTI E;  4PWT A;  3MD0 A;  2FXP A;  3H6P A;  1EDL A;  1YHQ P;  4BT3 A;  1ZRT E;  3WGK A;  3ZDM A;  3O6Q A;  2ZVY A;  1BGY J;  3SFD C;  4C7R A;  4HKZ H;  1X25 A;  1JM0 A;  1X79 B;  3RK3 E;  2QJP C;  2POH A;  5CCG D;  4IL6 X;  1S4X A;  2XU6 A;  1H88 A;  3D01 A;  5G4V C;  5APV A;  1MV8 A;  2OYI B;  5HY4 A;  1GZ0 A;  3H1L E;  1W3E X;  5AVY B;  1K05 A;  2E75 C;  5DJU B;  2BCC G;  2WZ7 A;  2ZVZ A;  3N4Z A;  3B4S A;  1G2C B;  3VP8 A;  4LLH A;  3U59 A;  1JCD A;  3A0B E;  5AW2 B;  2I1K A;  5APW A;  3JC2 2;  5AVR B;  1VQ9 P;  2W27 A;  3BRV B;  1NTZ D;  3L74 E;  1GMJ A;  3V4D A;  2FFD A;  4ZHW A;  1JO5 A;  2XV5 A;  3E1R A;  5E79 E;  2J59 M;  3Q3D A;  1RQV A;  3HJW C;  2FKW B;  1K73 H;  1LTS C;  2CHS A;  5HY2 A;  4C8I A;  4BVS A;  1BCC E;  3NFQ A;  5KLV E;  4U3J A;  4ZOL B;  2Q7C A;  4BXL A;  2K9Y A;  3JCU E;  3FBA A;  1NTK G;  2WSC J;  3GTZ A;  1YI2 F;  1CK2 A;  3QUW A;  2K1A A;  5ITZ A;  2C0X A;  2WMM A;  3MTU E;  1LTA C;  2A45 I;  1Q82 Q;  2ZT9 B;  3L73 D;  3AGK A;  4I50 B;  4I7Z C;  4UB6 H;  5CB4 A;  4B46 A;  3WUU A;  5CCH D;  2E74 D;  2UYN B;  1P84 I;  1VQ8 P;  1PP9 E;  1FZA A;  4C7N A;  1KFM A;  2WAL A;  3VMZ A;  1NH4 A;  3CXH E;  3F0D A;  3MUD A;  5JQG A;  1AVY A;  3HTN A;  5IJ9 A;  3O6Q B;  2Q1Y A;  1WT6 A;  1KIL A;  2VAM A;  3DC2 A;  2LBT A;  5FJ4 C;  1K9M Q;  1OFC X;  3H1L J;  4X1K A;  1YIT P;  5AVQ B;  3Q5P A;  4U7J A;  2VGM A;  2CZW A;  5CCG A;  1PPJ G;  1VPC A;  2FYU K;  1FFX A;  2Z01 A;  1JN1 A;  3VCZ A;  2OTL P;  3Q5R A;  1W2E A;  2N1T D;  3L74 J;  4O4J A;  1Y9B A;  5KJ7 C;  2AMT A;  3TYY A;  1FS0 E;  3R4Y A;  1GK4 A;  1OVR A;  3RK3 C;  1VQM P;  1VQP P;  5FLX M;  4PV1 D;  4ZK7 A;  2FYZ A;  2Q1X A;  2FFD B;  1U7J A;  1OX3 A;  1PZQ A;  1VK3 A;  1VQ5 P;  4D6T E;  2P2U A;  1X9V A;  2QRX A;  1NOH A;  1LGH B;  4G4Y A;  2RHO A;  4U3J B;  3KPE A;  3AEG C;  3CCJ P;  1IK7 A;  1L0N J;  3TD5 A;  5APT A;  5AW1 B;  2BTU A;  3ERN A;  2ZXE B;  2R5D A;  5ITZ B;  1N73 C;  1JY2 O;  2PP6 A;  1OZH A;  5CB4 B;  1HWT C;  1PP9 J;  1VF5 B;  3V7Q A;  5EZY A;  3NVI B;  1L0L K;  1OIP A;  3U1C A;  3AED C;  3O8Z A;  1M7L A;  1YJ9 F;  1LWU C;  1OVV A;  4KHX A;  4TUY A;  1GZL A;  4WB4 A;  5CCH A;  1X7O A;  4C7N B;  3CYQ A;  4X1Y A;  1YHQ F;  4JF7 A;  5JQG B;  1N2D C;  1QVG O;  5IJ9 B;  2Q3I A;  2GUS A;  5KLV K;  2RN0 A;  1KIL B;  1KB9 D;  2FC3 A;  4A7P A;  3QWO C;  4X1K B;  4QMA A;  1FDM A;  2LKM A;  3RBZ A;  3H1K D;  4YXW H;  2OYO A;  2B89 A;  1DT9 A;  3ELC A;  2BO1 A;  1G1J A;  3P8C E;  5LP6 C;  4O4J B;  2HVY D;  3F6M A;  2Q3E A;  3UIA A;  1EDI A;  4D6T J;  2N1T A;  3LW5 H;  3V4W A;  1CW5 A;  1WMK A;  2QM7 A;  2FGY A;  3R2P A;  3IAO A;  2KSE A;  3H1J D;  2IFM A;  3A0B H;  2A06 G;  2IPP A;  1YTZ T;  4RQO A;  1ZWZ A;  2M0B A;  1JOC A;  3L71 J;  5EYP A;  4G4W A;  4GOF A;  2KIK A;  4BT6 A;  3TGU E;  3VYS C;  3CWB G;  3GLM A;  3ITK A;  1MFZ A;  4JBZ A;  3VTP C;  1NU1 G;  4O4L A;  2E75 D;  4I2L C;  3USS A;  1VQO P;  1BDD A;  1YBK A;  3JCU H;  3LYB A;  5EZY B;  2O01 N;  2H8E A;  2N48 A;  3L72 G;  2IDB A;  1H7M A;  1NTM E;  2H7H A;  2O3J A;  4TUY B;  3L7Q A;  2E74 B;  3KHN A;  2IAF A;  1ZV8 A;  3ESJ A;  3BAT A;  4X1Y B;  3HD7 C;  2Q6Q A;  1MFT A;  1VQ8 F;  1BGY D;  1SVF A;  2KLV A;  3VYI A;  2HRY A;  3VTI C;  3II6 A;  4B62 A;  4OH8 B;  2IBZ D;  1AVO A;  1S5L H;  1R5S A;  1SQX K;  1KMI Z;  4C8G A;  4RO0 A;  3CCV P;  2KZI A;  3NXS A;  2WSF H;  3OAK A;  1YIT F;  1XTC C;  1W2B F;  1W59 A;  4NQ3 A;  2YMK A;  3VMA A;  3S06 A;  3MP7 B;  1IFJ A;  1VQL P;  1MUU A;  1FZG A;  3CC7 P;  4BT2 A;  4M8I A;  2BCC J;  2LXC B;  3WUT A;  2CK3 H;  3QH9 A;  2N1T B;  1YQ3 C;  1JY8 A;  1KTM A;  1T6A A;  1FZC B;  1VQN P;  4DZO A;  4GOE A;  4PV1 B;  3HKE A;  5AW5 B;  3Q1M A;  1VQ5 F;  3MBM A;  5GTH H;  1GO1 A;  3TGU J;  3GF3 A;  4ZMD A;  5EYP B;  3J7A R;  5AW7 B;  2JKV A;  3CCJ F;  5AW4 B;  2OQQ A;  1COM A;  3B5N D;  3K14 A;  1ZXG A;  3CPW O;  4O4L B;  2AEJ A;  5BU5 A;  3AEC C;  2RHL A;  2VAP A;  1DEB A;  1ZRT D;  1OXZ A;  3CCR P;  3HTK A;  3IF4 A;  1E5W A;  5KJ7 D;  2HS0 A;  4IIJ A;  2YIU C;  1YJN P;  3CD6 P;  1W58 1;  3RK3 D;  1NMU B;  3FXD A;  3ON1 A;  4E6E A;  1KC8 H;  4N3Y B;  1K9M H;  4XA4 A;  2Q5U A;  1UFY A;  1UI9 A;  1NTZ K;  5KAI H;  1GD2 E;  5BU8 B;  5GIP C;  1PGO A;  3H1L D;  1AQ5 A;  2LBW A;  3AEB C;  1P84 E;  3CME P;  3EOR A;  2Y0E A;  2HQS C;  2FY8 A;  1IFP A;  3V5B A;  4HJG H;  3L74 D;  1HF9 A;  1RQ2 A;  1DEE G;  1PXW A;  4RKU J;  4KJM A;  3ZOP A;  1GK6 A;  3CCE F;  3HKE B;  3SFE C;  3A5T A;  2H8C A;  2QE7 H;  1L0L G;  3PLN A;  1ZR4 A;  1QL1 A;  2E43 A;  2IG8 A;  2LCA A;  1VH8 A;  4KWE A;  3L36 A;  1ODE A;  3PRJ A;  4G4X A;  4C8E A;  4W7Z A;  3M9H A;  4M3L A;  2QJP B;  3V2P A;  3V2R A;  5LA6 A;  5C39 A;  3A7O A;  1EDJ A;  1SQV G;  2FXM A;  1PP9 D;  3BCC G;  3E1I A;  1KQS F;  3CXH D;  1UII A;  3HTK B;  4BT4 A;  3S1K A;  4IIJ B;  2E75 B;  1VQO F;  1TUB A;  3L70 E;  1FZC C;  1SQP E;  2AEF A;  1ZP0 C;  3P0Z A;  3M9Q A;  1YJW P;  5DJT B;  2J5U A;  5KJ7 A;  4X20 A;  2GM4 A;  1RA4 A;  4BW0 B;  1HGV A;  2V7Q J;  2PRR A;  5M1B A;  5IYZ A;  4G88 A;  3NMD A;  4NUT A;  1FC2 C;  4ZHV A;  3JAT A;  3CG6 A;  4IFF A;  3F89 A;  4LC1 A;  3RL0 D;  1HH0 A;  5CBN A;  3JAL A;  1JMM A;  1OW8 A;  4DT0 A;  1NYH A;  2BEQ D;  2C9L Y;  1VQL F;  1G2C A;  1Z56 A;  5B66 H;  2HYN A;  2QJY C;  4O9B A;  1R8E A;  4D6T D;  3CC7 F;  3N4Y A;  3HKB A;  2MKV A;  1N73 A;  2HS3 A;  5KKZ B;  3KZI E;  4L73 A;  4I7Z B;  4OGQ C;  2Z4E A;  3TD4 A;  5FNV A;  1VQN F;  4CPG A;  4B86 A;  2O01 J;  3SSU A;  4ERH A;  1LWU A;  3KXD A;  3JSV C;  3MQW A;  1JY3 P;  2RMZ A;  3L71 D;  4Z1M H;  4OWF A;  5APX A;  2Z1T A;  1T0K B;  4ZOL A;  2WSE H;  3IMP A;  2R32 A;  4G4Z A;  3HRN A;  4ZKU A;  1RF1 C;  5LA6 B;  5H2F H;  2FYN B;  5AVW B;  1SQX G;  4B5C A;  3L70 J;  2I8D A;  3PJS K;  1SQP J;  4Y28 J;  5GON A;  3WGN A;  1VQK P;  3KJK A;  1NU1 J;  1TUB B;  2C9N Y;  2RHJ A;  3CCR F;  1EZV G;  1E79 H;  4TT3 H;  5LP6 A;  1YJN F;  1W41 A;  1RHZ B;  3CD6 F;  4X20 B;  3NMU C;  3CLQ A;  3RK3 B;  2R3S A;  2QM8 A;  1J1E C;  5IYZ B;  1T3J A;  2QI2 A;  3HWU A;  1M1K Q;  3S9O A;  1XBI A;  3H1I G;  3JAT B;  4LNU B;  2QJK C;  3PHL A;  3D71 A;  3P8C D;  1IV2 A;  1CSB A;  3CME F;  3L75 G;  1S5L X;  1KOR A;  2KNC A;  2XND H;  3H1H E;  3D70 A;  3JAL B;  3JAS A;  1JJ2 F;  2A45 H;  4IHJ A;  1SQQ E;  3W67 A;  3EWK A;  1R5L A;  1DD3 A;  3CL3 D;  1RQ7 A;  1N8R Q;  4GOD A;  3TNU A;  3BRT B;  2YNY A;  4W80 A;  4EI7 A;  3KQG A;  3Q8H A;  3HKB B;  3V2N A;  1N73 B;  1FNK A;  3PTZ A;  3MCA B;  2I1J A;  4XE5 B;  1KB9 H;  1XRG A;  5FNV B;  3EQ2 A;  1LWU B;  3TGU D;  3FD5 A;  4U3F E;  3TK1 A;  2OZB A;  3AEE C;  3G4S F;  2GA1 A;  5EIB D;  3HD7 A;  1YQN A;  4EI2 A;  5LXT A;  3I5C A;  2I6D A;  3ABV C;  4GKG A;  1VDF A;  1NTZ G;  2YKP A;  5EB1 B;  5CA0 A;  1RLG A;  2Z1E A;  1NTM D;  3Q5S A;  4R4M A;  3WJQ A;  5C8Y A;  1ZN5 A;  5APU A;  5GON B;  1L0N E;  2B33 A;  3MHV A;  5KKZ C;  2J58 A;  3GYQ A;  2OTK E;  2UZH A;  2JJL A;  1NKZ B;  5LP6 B;  5AVT B;  2QA4 P;  5IT9 M;  3LWV C;  1QX8 A;  3SWF A;  1YJW F;  2VXY A;  1NAY A;  3JVH A;  1JFF B;  1RF0 C;  4IL6 E;  3H1H J;  2QG4 A;  3L73 G;  3PH0 A;  4GT1 A;  1QVF O;  4BVT A;  4HB1 A;  1SQQ J;  4PJ0 E;  1JY2 N;  2FYN C;  3FGA D;  2KNC B;  1NJI Q;  3JAS B;  3B5N C;  1IFI A;  4IHJ B;  4DRX A;  3HAX D;  5LOV A;  1PL5 A;  1H0T A;  3WU2 E;  3TNU B;  2NPS C;  3P7K A;  2WQY C;  4DJG A;  3MCQ A;  3ZP7 A;  1Q90 D;  1SQB E;  1AFO A;  3M9B A;  1J2J B;  2HOD A;  4WY4 C;  4U3F J;  1A02 J;  2F9Z C;  1CN7 A;  1R1M A;  4C4W C;  3JAW A;  1K04 A;  2QEX P;  1EQ7 A;  1Q7Y Q;  2Y9Z A;  3HD7 B;  4K3A A;  1QEX A;  3OW2 O;  2YMY A;  2H43 A;  1L0L J;  2IFN A;  5LXT B;  1W55 A;  5TIS H;  2ZVO B;  1GW3 A;  2AIZ P;  4WVZ A;  5CA0 B;  4L74 A;  4AQR D;  3BVH A;  5EB0 A;  1FNJ A;  5CMZ A;  3CX5 I;  5C8Y B;  3L71 E;  2P10 A;  2QSI A;  4HH2 A;  4UB8 H;  1DIP A;  1KQL A;  1U40 A;  3O85 A;  1L2P A;  1SQV J;  4X3M A;  1VQK F;  1VQ7 P;  1BE3 E;  4I6M C;  2RHH A;  2H8P D;  2RKL A;  5GAN K;  1Q81 Q;  5GAP K;  4OVN F;  1P84 D;  1FJK A;  1FZB A;  4OGQ D;  4EIJ A;  3KJJ A;  2WT7 A;  2WSC H;  3SWY A;  4Y99 C;  1VQ4 P;  1J1D C;  3CC4 F;  3BYQ A;  5GTI H;  3A0H E;  1Y8A A;  5MN6 A;  3I56 P;  1S9K E;  4DRX B;  5LOV B;  1H0T B;  1SQB J;  4TZZ A;  3KDP B;  3L75 E;  2QIW A;  1H89 A;  1N7L A;  1UIX A;  1USE A;  1WRG A;  3CMA P;  2KOG A;  2HOD B;  4AYC A;  2HS4 A;  1GL2 D;  1QL2 A;  1IFD A;  4L76 A;  2BCC E;  1JTH A;  1W5C E;  2HFE D;  3H1K G;  3CCE P;  2YIU B;  1HGZ A;  1FZC A;  1NGM B;  3JAW B;  3ZP4 A;  1VQV A;  4R4L A;  5KTB A;  2WPR A;  1H8A A;  3P4E A;  3J80 M;  2Q9I A;  2K9J A;  5APS A;  1KD1 H;  1K8A Q;  1SP4 A;  1GTW A;  2AXT E;  3RL0 C;  2ZAE B;  3L70 D;  1SQP D;  5E79 H;  4O2B A;  1BE3 J;  1NU1 D;  2KS1 A;  2ZJS E;  3CX5 D;  4W7Y A;  3H1J G;  4BT7 A;  4H13 C;  1G1I A;  3V7E A;  5AVZ B;  1W5B A;  2CWJ A;  1PIX A;  1NTK E;  3IKF A;  4ZNC A;  3G6E P;  1M56 D;  4RJT A;  1Q86 Q;  1T2K C;  2QA4 F;  1LP1 A;  4K35 A;  2Z1F A;  1U57 A;  2WT7 B;  3L37 A;  5AW9 B;  1IJD B;  1W57 A;  2UYP A;  3WPX A;  2Y9Y A; 
#chains in the Genus database with same CATH homology
 1IFM A;  1GK6 A;  3MD0 A;  5CJ0 A;  3CCE F;  3H6P A;  3A5T A;  3CCQ F;  1SQQ K;  2GLZ A;  1URQ A;  1RE4 A;  1ZR4 A;  1N86 A;  1QL1 A;  1CZQ A;  2ZFC A;  2E43 A;  4C7R A;  3L36 A;  3GHG A;  3L4F A;  1X79 B;  3NVK E;  4W7Z A;  2POH A;  5CCG D;  2YKO A;  3M9H A;  4M3L A;  5AVS B;  5GIN C;  2XU6 A;  1T3U A;  1H88 A;  3V2P A;  5APV A;  3N4X A;  3IFM A;  2OYI C;  5G4V C;  3A3Y B;  1VQ6 F;  1MV8 A;  3V2R A;  1N7S D;  3U1A A;  2OYI B;  3A7O A;  5HY4 A;  1RF1 A;  2FXM A;  1GZ0 A;  1W3E X;  4AUW A;  5AVY B;  3E1I A;  2WTY A;  3N4Z A;  2P1J A;  2WZ7 A;  1KQS F;  3HTK B;  3V3T A;  1MZ9 A;  2W6B A;  1G2C B;  1JTH B;  1HVV A;  3VP8 A;  3L35 A;  4LLH A;  2HPC A;  1FZC C;  1VQO F;  3U59 A;  1JCD A;  5AW2 B;  3H32 A;  3CCM F;  2I1K A;  3M9Q A;  5APW A;  5AVR B;  5KJ7 A;  2W27 A;  2VGN A;  3PAF A;  2A45 G;  3BRV B;  2QEX F;  2GM4 A;  1RA4 A;  1A02 F;  1LT9 A;  4BW0 B;  1FBM A;  4LGD E;  1HGV A;  3N7N A;  3VMF B;  2FFD A;  1JO5 A;  2XV5 A;  2KG4 A;  1NAF A;  1L0N K;  2J59 M;  3NMD A;  3HJW C;  2FKW B;  1LTJ C;  1K73 H;  4NUT A;  1LTS C;  2WPQ A;  5HY2 A;  3SIU A;  3CG6 A;  1LTJ B;  4BVS A;  3NFQ A;  1Q82 H;  2JEE A;  3HE5 B;  4IFF A;  4LC1 A;  1FAV A;  1YIJ F;  3RL0 D;  1HH0 A;  2P7J A;  2Q7C A;  1S72 F;  5A2Q M;  2M8R A;  2OYH C;  2Z5I A;  1JMM A;  1LTT C;  2CPS A;  1M1J A;  2OYH B;  1SQV K;  1FJP A;  2NPS D;  3M0D A;  1YI2 F;  3G3Z A;  1KFN A;  5HXZ A;  1CK2 A;  2C9L Y;  1JY2 P;  1FOS F;  1VQL F;  1G2C A;  1VQ7 F;  1Z56 A;  2C0X A;  2HYN A;  2VRS A;  1GW4 A;  4O9B A;  3MTU E;  3CC7 F;  1LTA C;  1PFI A;  4WY4 D;  2A45 I;  3N4Y A;  1N73 A;  3AGK A;  3E20 B;  5CCH D;  2XDJ A;  2Z4E A;  3VMX A;  3OBY A;  3J81 M;  2MJZ A;  3PP5 A;  1XTG B;  1NJI H;  1VQ4 F;  1RE4 C;  1VQN F;  4B86 A;  3BAS A;  4X3L A;  1FZA A;  1URQ B;  5HXU A;  1LWU A;  4C7N A;  1VQ9 F;  2IX7 C;  1KFM A;  2WAL A;  3VMZ A;  1JY3 P;  1NH4 A;  3MUD A;  5APX A;  1WT6 A;  1KIL A;  1T0K B;  3GHG B;  5FJ4 C;  2YKQ A;  3I56 F;  2WSE H;  5AVX B;  1SQB K;  2R32 A;  3HRN A;  4ZKU A;  5AVQ B;  1RF1 C;  3CC2 F;  4N78 D;  5AVW B;  3WMM 0;  2VGM A;  1RF1 B;  2CZW A;  5AVU B;  5CCG A;  1VPC A;  1NTM K;  3E1Y A;  1IFN A;  2FYU K;  4WBA A;  3T97 A;  3VMY A;  2YO2 A;  3CMA F;  2KYV A;  3M0A A;  1L4A D;  1N7S A;  1ZR2 A;  1M1K H;  2HPC B;  1W2E A;  2C9N Y;  2BAS A;  3CCR F;  2N1T D;  3OA7 A;  3H32 B;  1NKN A;  5KJ7 C;  1HTL C;  1DX7 A;  3TYY A;  2KTU A;  1YJN F;  1W41 A;  3CD6 F;  4EI9 A;  3JAM M;  1GK4 A;  1LT9 C;  1NHL A;  2WWW A;  3EFG A;  3RK3 C;  3NMU C;  2FFD C;  1IK9 A;  1LT9 B;  5FLX M;  3JCM M;  3CLQ A;  2FYZ A;  3RK3 B;  2FFD B;  2QM8 A;  1J1E C;  1T3J A;  2QI2 A;  1N8R H;  1J1E B;  1QVG F;  1XBI A;  1NO4 A;  2P2U A;  1X9V A;  1RF0 A;  3B8E B;  1NOH A;  1LGH B;  1OWA A;  3RK2 C;  3P8C D;  3I55 F;  1CSB A;  3CME F;  3RK2 B;  3KPE A;  3OBW A;  1SDS A;  5AW0 B;  1JJ2 F;  2A45 H;  1M1J B;  1YTZ I;  3B5N A;  5APT A;  3CCS F;  1FZE A;  3CL3 D;  5AW1 B;  2ZXE B;  2KP8 A;  2R5D A;  3TNU A;  3BRT B;  1X7P A;  2YNY A;  2YO3 A;  4W80 A;  2Z5H A;  4EI7 A;  3KQG A;  1JCC A;  3M06 A;  1T8Z A;  1N73 C;  3G6E F;  2NPS A;  1GL2 A;  1JY2 O;  3V2N A;  1N73 B;  1CI6 A;  2PP6 A;  3MCA B;  3NK6 A;  2I1J A;  4XE5 B;  1HWT C;  2OTL F;  3V7Q A;  4WY4 A;  3NVI B;  3TSI A;  1L0L K;  4N78 E;  3U1C A;  3NTN A;  4BY9 D;  3O8Z A;  1M7L A;  1YJ9 F;  1LWU C;  5AW3 B;  4KHX A;  1GZL A;  4WB4 A;  2OAR A;  3EQ2 A;  5CCH A;  1DH3 A;  1LWU B;  4I1L A;  4C7N B;  1X7O A;  3TK1 A;  1YHQ F;  4JF7 A;  2OZB A;  1VQM F;  1N2D C;  3G4S F;  1VQP F;  2O1K A;  2Q3I A;  1KIL C;  2GUS A;  2W6A A;  3HD7 A;  5KLV K;  1KIL B;  1QVF F;  1JY3 O;  1HBW A;  2FC3 A;  2LBX A;  3I5C A;  2I6D A;  4GKG A;  1SFC D;  2C0W A;  4IFM A;  1VDF A;  2YKP A;  1RLG A;  5CHX A;  1FDM A;  5G4U C;  4ZKP A;  2LKM A;  5CCG C;  1GU5 A;  4BVR A;  3OJA B;  3LWP C;  3LWR C;  1ZN5 A;  2JNB A;  5APU A;  3V4Q A;  3HE4 A;  5HWE A;  1N7S C;  4RES B;  1RY3 A;  1N7S B;  2J58 A;  1DT9 A;  3GYQ A;  1IO4 A;  3NK7 A;  2BO1 A;  1G1J A;  3P8C E;  1SLQ A;  2XNX A;  2JJL A;  1NKZ B;  1T2K D;  2HVY D;  3SIV A;  5AVT B;  1L4A A;  3UIA A;  3LWV C;  3C9I A;  5IT9 M;  1URQ C;  3SWF A;  1GDT A;  5HY0 A;  2ALE A;  1YJW F;  2N1T A;  3LWQ C;  5HY1 A;  3G71 F;  2L5G B;  3LW5 H;  3V4W A;  1W42 A;  1CW5 A;  5APQ A;  2QM7 A;  3GHG C;  2FGY A;  3R2P A;  1RF0 C;  3LID A;  2OHW A;  2IFM A;  3OW2 F;  4GT1 A;  3PLA C;  4BVT A;  3CPQ A;  1JY2 N;  2IPP A;  1NTK K;  1YTZ T;  1ZWZ A;  1NWQ A;  3B5N C;  1HJB A;  1JOC A;  1IFI A;  3HAX D;  2N9B A;  3B5N B;  1GU4 A;  5CJ4 A;  1Q86 H;  3TNU B;  4N6J A;  3V2Q A;  2NPS C;  1GL2 C;  3P7K A;  1Q7Y H;  1MFZ A;  3VTP C;  2NPS B;  1GL2 B;  4I2L C;  1CI6 B;  1AFO A;  3M9B A;  1J2J B;  2HOD A;  4WY4 C;  1JY3 N;  4EOT A;  4WY4 B;  2R5B A;  1A02 J;  2F9Z C;  3IR9 A;  1S9K D;  5CCH C;  1H7M A;  1KZU B;  2H7H A;  3RA5 A;  1CN7 A;  4C4W C;  1ZV8 A;  1YYC A;  3BAT A;  4JYB A;  1EQ7 A;  3HD7 C;  2PAJ A;  4GIF A;  1VQ8 F;  5EO3 A;  3HD7 B;  1SVF A;  1LTB C;  5AW6 B;  1IC2 A;  2KLV A;  2YMY A;  3VYI A;  3II6 A;  2H43 A;  4OH8 B;  3MIW A;  2IFN A;  1M1J C;  1X52 A;  1SQX K;  1KIL D;  1GW3 A;  4HYT B;  3M0D C;  3LIE A;  1Q81 H;  4AQR D;  3BVH A;  3NXS A;  1JUN A;  2WSF H;  5CMZ A;  3OAK A;  1JNM A;  1XTC C;  3CCU F;  1YIT F;  1SQP K;  4HH2 A;  4IFD K;  3HE4 B;  1SFC A;  1W2B F;  1KQL A;  5AW8 B;  2KSJ A;  1NU1 K;  2KTV A;  3O85 A;  4NQ3 A;  3CI9 A;  2O1J A;  3CPW F;  1X8Y A;  1IFJ A;  4X3M A;  1VQK F;  1MUU A;  3VN0 A;  1FZG A;  4I6M C;  2H8P D;  1L4A C;  3WXM B;  5GAN K;  2P67 A;  1L4A B;  3FFM A;  5GAP K;  2N1T C;  3CXC F;  1FJK A;  2CPB A;  2N1T B;  1FZB A;  1RE3 A;  3HUS A;  2XZR A;  4EIJ A;  4XCQ A;  2WT7 A;  2WSC H;  4C46 A;  1FZC B;  1URQ D;  3SWY A;  5GIO C;  4Y99 C;  2E42 A;  4DZO A;  1J1D C;  1IPA A;  4Y99 B;  3A2A A;  3RA6 A;  5AW5 B;  1VQ5 F;  1J1D B;  5AVV B;  3CC4 F;  5BVZ A;  1GO1 A;  3CCL F;  4LCK A;  1ZLL A;  1GO0 A;  3VP9 A;  4JYC A;  1S9K E;  5EWR A;  3J7A R;  5AW7 B;  3CCJ F;  2XKM A;  1HUC A;  3P8M C;  5AW4 B;  1LTI C;  3B5N D;  2O01 H;  4TZZ A;  3VOP A;  1E7K A;  2HG5 D;  3CCV F;  2OTJ F;  1FOS E;  1W40 A;  3KDP B;  1H89 A;  2OYI A;  1N7L A;  5BU5 A;  1WRG A;  2KOG A;  2HOD B;  4AYC A;  1K8A H;  1DEB A;  1GL2 D;  1QL2 A;  4DOJ A;  1OXZ A;  1FU1 A;  1IFD A;  3HTK A;  1E5W A;  5KJ7 D;  1JTH A;  2WPS A;  1FZF A;  2HFE D;  1HGZ A;  1FZC A;  3VI6 A;  3RK3 D;  1NMU B;  3KYQ A;  5KTB A;  3ON1 A;  1KC8 H;  4N3Y B;  1K9M H;  5DCV A;  2WPR A;  3M91 A;  1H8A A;  4XA4 A;  3J80 M;  5APY A;  2Q5U A;  2Q9I A;  3LWO C;  1NTZ K;  2GUV A;  5APS A;  1GD2 E;  1KD1 H;  1SP4 A;  5BU8 B;  3HD7 D;  1GTW A;  2AIF A;  5GIP C;  1AQ5 A;  2LBW A;  3RK2 D;  3RL0 C;  2M3B A;  3RL0 B;  1LTJ A;  1SFC C;  3HE5 A;  2R3C A;  1SFC B;  4W7Y A;  2OYH A;  3V5B A;  1G1I A;  3V7E A;  5AVZ B;  3MGN A;  2HLO A;  4EI8 A;  1PXW A;  4BVQ A;  3HUS C;  1RE3 C;  3LFO A;  2KB7 P;  1T2K C;  2QA4 F;  2WIT A;  3P32 A;  3HUS B;  3D00 A;  2WT7 B;  3L37 A;  5AW9 B;  1IJD B;  1LTG C;  1M90 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...