3IR9A

C-terminal domain of peptide chain release factor from methanosarcina mazei.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
AYTDESGLSELVNAAGEKLQDLELMGQKNAVRDFFKELIADSGKVAYGESQVRANLEINSVDVLLLSEDLRAERVTTKCSVCGYENKWTRRWKPPAPAAGNCPKCGSSLEVTDVTDIVDEFSELADKSNAKVVFVSTDFDEGSQLMNAFGGIAAILRYNTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
molecule keywords Peptide chain release factor subunit 1
total genus 48
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ir9A01
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ir9A02
3NMDA 1YIJF 3MD0A 3OAKA 3M9HA 1CI6A 2R32A 3CCEF 1DT9A 5IT9M 3MCAB 1YHQF 2KP8A 2N9BA 3KDPB 3TNUA 5G4VC 1E7KA 1HUCA 2LBXA 2KTVA 3CMAF 1K9MH 1FOSF 3HE5A 1X7PA 1IO4A 3CPQA 1M90H 2QM7A 2OZBA 3V7EA 3CCMF 1JJ2F 3T97A 3M91A 3CCRF 3VTPC 4AQRD 2WT7A 5AVWB 1Q81H 2YO3A 1A02J 3N4YA 4XE5B 4I2LC 3V4QA 1Q86H 3CCSF 1GO1A 1VQPF 5GAPK 1VQ7F 1Q7YH 5AW3B 5AVUB 2JJLA 1YYCA 1G2CB 5A2QM 5APUA 5AVYB 5EO3A 3WXMB 2QM8A 5CMZA 1HJBA 5FLXM 3B8EB 3CC7F 2ZFCA 4C46A 2XV5A 1T2KC 3L35A 2OTJF 3LWOC 3V5BA 1T0KB 1VQ5F 5AW5B 4JYBA 3NK6A 5DCVA 3M0AA 1N8RH 1KC8H 3CCQF 3LWQC 5AW1B 4C7NA 2Q3IA 4EOTA 1YJWF 5APTA 2WT7B 2QEXF 1YITF 3CCVF 2W27A 1S9KD 5APVA 1GO0A 5AW8B 4LCKA 1FAVA 2WPRA 5APWA 3I55F 3P32A 1RA4A 1H88A 1ZWZA 1K8AH 4AUWA 2C9NY 5AVTB 2QI2A 4JYCA 1SP4A 3HTKA 1HBWA 4BW0B 1CZQA 5APSA 1VQLF 3NTNA 1PXWA 1KQSF 3TYYA 5AVZB 3V4WA 1K73H 3CXCF 3N4ZA 1A02F 1VQMF 3LWRC 3I5CA 3E1YA 3NFQA 1X52A 2R5BA 3MGNA 1GTWA 1VQ8F 1NJIH 2CZWA 3J81M 4GKGA 3J7AR 2P2UA 2KG4A 2KTUA 3OBWA 3I56F 1GK6A 3VMFB 2YO2A 3NK7A 1OWAA 5AW4B 5AW2B 3LWPC 1MUUA 3SWFA 3NVKE 1JNMA 2Z5HA 1YI2F 2XZRA 2YNYA 3LWVC 3E20B 5GIOC 1M1KH 1NAFA 3CD6F 1GZLA 4B86A 2I6DA 1GK4A 2WPQA 4BY9D 3UIAA 1X8YA 2W6AA 2H7HA 2QA4F 4DZOA 1H89A 3OBYA 3NXSA 3A3YB 2E43A 4KHXA 4GT1A 2R3CA 3KQGA 1Q82H 5G4UC 3A5TA 1VQNF 1W40A 1FOSE 2WPSA 1RLGA 2Q5UA 1W42A 1GZ0A 3JAMM 4M3LA 3RA5A 3CMEF 3RA6A 4C4WC 3P8MC 3M0DA 5APYA 3NMUC 3M9BA 2WTYA 4LC1A 3L37A 2OHWA 2Z5IA 2ZXEB 1KD1H 5GINC 3VMYA 1CSBA 1QVFF 1GD2E 3SIVA 3NVIB 1YJNF 3VN0A 3IR9A 4RESB 5AW0B 3VI6A 2AIFA 5AVXB 3A7OA 1YJ9F 4I6MC 3O8ZA 1OXZA 3FFMA 5EWRA 3CCJF 1W2BF 1SDSA 3VMXA 3L36A 5AW7B 2P7JA 3OW2F 3P7KA 3V7QA 3CC2F 3AGKA 1S72F 2E42A 1H8AA 5AVSB 1QVGF 2C9LY 2XU6A 1NMUB 1GU5A 5AVVB 1VQOF 4AYCA 5AW9B 1J2JB 1H7MA 1DH3A 3HE5B 3LIDA 1VQ4F 2Q7CA 3LIEA 3TNUB 1MV8A 5AW6B 1T2KD 3PAFA 4NUTA 3VYIA 5GANK 2FC3A 3CCUF 5APQA 2ALEA 3CG6A 1X7OA 3O85A 2WWWA 1HWTC 1IPAA 2BASA 5APXA 3SIUA 2HVYD 4TZZA 2VGMA 3CPWF 1CI6B 5FJ4C 1VQKF 2WALA 1MFZA 3A2AA 2VRSA 3JCMM 2R5DA 2BO1A 3TK1A 3G71F 1VQ9F 5GIPC 3CC4F 4X3MA 1SLQA 3CCLF 3G6EF 1VQ6F 1W3EX 1JUNA 3ON1A 3M06A 2IPPA 1W41A 1CK2A 3GYQA 2VGNA 2OTLF 5AVQB 3HE4B 2LBWA 3HAXD 3HE4A 4HYTB 4X3LA 2P67A 1GU4A 3VMZA 4C7NB 3HJWC 1S9KE 1NWQA 1CN7A 3PLAC 5AVRB 1XBIA 1KQLA 3J80M 3G4SF 3LFOA 2JNBA
chains in the Genus database with same CATH superfamily
2AIZP 3PH0A 2FFDB 4PD4D 2RB9A 2PFXA 1YIJF 2FYUJ 4DJGA 4IL6E 3BCCG 3MD0A 3KIZA 3M9HA 1N73C 4TUYA 5E79H 2KSJA 1EDLA 1Z5VA 1SFCA 1X25A 2V4HA 3BVHA 3ERNA 3ESJA 5LP6B 2ZYDA 3VOPA 1YHQF 3N2KB 1OZHA 2YKQA 1ZV8A 1HUCA 2LBXA 1SQPJ 3CMAF 1KV4A 4IHJA 1K9MH 2OTLP 1X7PA 3TSIA 3S4RA 2WSFH 1AJYA 3IKEA 2WSSH 4RO0A 1OW6A 3C9UA 1QAHA 3IEQA 3VTIC 3VTPC 3A0BH 1KYOE 1BE3D 4UB6E 1Q81H 4ZHYB 1QEXA 2YXZA 1VK3A 3D54A 3N4YA 1YGYA 1RE4C 2E75C 3CXHI 4HJGH 1Q86H 5GTIE 5GAPK 2Z1FA 1AVOA 4DRXB 1RY3A 4ASVA 5C8YA 2LKMA 2WITA 3O6QA 3R0PA 4YTPC 1G2CB 3D70A 2WSFJ 4U3JA 4XA4A 3IEWA 1OMIA 3TGUE 5EO3A 1RF1B 3WXMB 2WSCJ 1VQVA 1HJBA 3HKBB 3RK3B 3CC7F 3L35A 2OTJF 2KLUA 3V5BA 4D6TG 3L73E 3WUTA 2K37A 2ZT9C 2KYVA 1URQA 1HVVA 1LJ2A 3KHNA 2YMKA 2K9YA 3LWQC 3N2GA 4EB6B 4XCQA 3E22A 4ERHA 2JR8A 2WT7B 2QEXF 1IK7A 2C0XA 4TV8B 3PP5A 3EFFK 4R4MA 4N6JA 4G4ZA 2O1JA 1U3LA 4G4WA 1LWUC 4D6TE 1FZCC 3I3FA 1KFMA 5APWA 3P32A 2ZT9D 1RA4A 1P84H 3VYSC 5ITZB 3WUUA 1ZWZA 3S03A 3GHGC 1VQ5P 1RE3C 2C9NY 1EZVG 3K14A 3T97B 1FZCB 5JQGA 3CC7P 1WT6A 4I7ZC 3L70G 1SP4A 1K05A 2D2CD 1BE3J 1HBWA 2LXBA 3AE2C 4H44C 4BW0B 2CPBA 3HD7C 4Y28J 4D6TD 1NTKE 2D2CC 5K5GB 4IIJA 3TDKA 1OX3A 5CA1A 5AVZB 1LT9C 3V4WA 3CXCF 1Q90D 1PZQA 1BCCE 4KT0J 3L72E 1Q81Q 1OVRA 3S9OA 4IHJB 3LWRC 1H48A 2R5BA 4U3FG 1S1CX 4ASWA 1PIXA 5BU5A 2Y0CA 3L72J 3L70E 1PPJD 1FZAA 1VQ8P 2CZWA 5J2UA 2XNXA 2N1TB 2N1TA 3AEFC 2P2UA 3L75G 3OONA 3I56F 4OWFA 1NAYA 3EQ2A 1ZW0A 4X20B 1WMKA 3CMAP 3NK7A 4X1YB 4GOEA 1OWAA 1EC5A 3L72G 5TJHA 4EI2A 5BU8B 3LW5J 1LTGC 1UIXA 3H1KE 3SWKA 2DT4A 5EB0A 2CK3H 5MN6A 1SQQK 5AW2B 3CCSP 4U3FE 1KILB 3LWPC 2Q1YA 1PGPA 3NVKE 2E5TA 1FDMA 3H1IG 2Z5HA 3CCEP 4X20A 1EXJA 1NH4A 2FYUE 1ZXGA 5KAFH 4O4LA 5KMGA 1DEBA 3L74E 1LTJC 5EZYA 2UYPA 2QEXP 5LXTB 4G4XA 1AVYA 2H89C 2OYIC 3H1HG 1GK4A 1DBFA 3H1JG 3AE6C 4C8EA 3H1LJ 3WUVA 2K88A 1YTZT 3CC4P 2IYPA 2XKMA 1KN7A 2E43A 3G71P 1S3JA 1N7SB 1OAPA 1Q82H 3H1IE 2JDIH 3KQGA 4K35A 2OYIB 4HNAA 5CHXA 3L73J 5H2FE 5EIBC 1LTTC 5TISE 2QTPA 2Y0DA 2WPSA 5ITZA 1JTHA 1OFCX 1M1JC 1RLGA 2Q5UA 4C7RA 1W42A 2UYNB 5IJ0A 1U40A 3TD5A 5CA0A 2V7QH 1NYHA 1LT1A 3TGUJ 2FY8A 2OYIA 3V2PA 1KB9D 4XFJA 1NO4A 4TUYB 2BCCJ 3HKDA 2CHSA 3H1HJ 1R1MA 2SPZA 2ZXEB 5GINC 1XV2A 3CYQA 1QVFF 1GD2E 3L71D 4ZOLA 1L4AC 4PD4E 1YJNF 4N3YB 2L26A 3VN0A 4RESB 1Y47A 2KSEA 3A7OA 1FDOA 1N7SD 3HD7A 4WVZA 2MKVA 2FXOA 3S1KA 1W2BF 5FNVA 1JY3N 3L72D 3VMXA 3CB2A 4JPZB 4YXWH 1L0ND 1ZRTD 4OGQB 2P7JA 1KQGB 3V7QA 2IYOA 3VO8A 2E42A 1AQTA 1CLIA 3AE1C 3CCRP 5CB4B 1BGYJ 3HKEB 1ZR2A 5EAZA 2WSEJ 1GU5A 4U7JA 2QJKB 1MZ9A 2W6BA 1SQVK 1LWUA 2CWJA 3H1KD 4LLHA 3C8LA 1SQBJ 3P4EA 1L0NE 2ZVZA 2I1KA 2FGYA 2RH0A 1ZR4A 4I4TA 2J59M 2CSLA 4I4TB 5B66H 2OTJP 2H8EA 3PAFA 4O2AA 5KMGB 1YJ9P 2IZ1A 1LTJA 3HUSB 5LOVA 1DD4A 3AE7C 3BCCE 2FC3A 2ZF8A 2ALEA 5IJ0B 3CG6A 1X7OA 2HRUA 1SQPG 4C8GA 2BASA 5LP6A 4HKZH 4MN4C 1S72P 3H1ID 2G3AA 3P0ZA 1QD9A 3WGJA 1VF5C 2WALA 2W8BC 2M3EA 1M90Q 4WY4A 1KQFB 2VRSA 1NVOA 3TK1A 1VQ9P 5GIPC 3CC4F 2GZLA 3OA7A 1BGYG 1SLQA 2POHA 3G6EF 4R40B 3AEEC 1X9VA 3F0GA 3WGNA 2ZOVA 5AVQB 3HE4B 2LBWA 3HAXD 2I8DA 3HE4A 3GW6A 1FZEA 3EORA 4B46A 1NTZJ 5HXUA 1N73B 2P1JA 4M8IA 3WPXA 4C8IA 2J5UA 1JEKA 5B5EH 3CX5I 1Q8RA 3TGUG 1VDFA 2KIKA 1BGYE 3CL3D 5C8YB 3RL0g 2VAWA 3JC22 3CPWO 5HP8A 3HKDB 3M9QA 1PF5A 3LMEA 1VQOP 3CCEF 1VQ4P 1KNKA 3DDNA 1K8AQ 2UZHA 3MCAB 3I56P 2KP8A 1Q7YQ 1E7KA 3S0WA 2AXTH 2GM4A 1K9MQ 2KTVA 4HB1A 1KILD 3OW2O 4PJ0H 1FOSF 2IDBA 2WVRA 2B89A 1IO4A 3CPQA 3HUSA 1NTKK 2IFNA 2OZBA 2XNDH 3CCMF 4H0LB 1JJ2F 3L70D 1PPJE 3B5ND 1XHOA 1GDTA 3M91A 4FFBB 1JN1A 4PD4I 2BCCE 3Q5RA 1S5LE 4EDFA 2QVAA 3H1LG 2KS1A 4XE5B 3P10A 4I2LC 3CCSF 1GO1A 2ZYGA 4ZHQB 3IN6A 1VQPF 1URQB 1W5BA 5DJUB 3ZP7A 1PP9D 3E1IA 4O4LB 1Q7YH 2UYKA 1RQ2A 2WQYC 5AVUB 2HS4A 1EZVE 1U43A 2B87B 3HKCA 2NMUA 1ZP0C 4E6EA 5A2QM 2JEEA 5APUA 5KX5A 1PPJG 5AVYB 3HKBA 3H1JD 2PRRA 2RHHA 5KAFE 1JD1A 3S0YA 2QM8A 3B8EB 1NTKG 1L0LG 3H1LE 1W5CE 2JWAA 2QE7H 1LTAC 3LWOC 3ITKA 2Q1XA 1T0KB 3MUDC 4RKUJ 1VQ5F 3CWBJ 2E74D 2HP0B 3NK6A 1JFFA 3RYHA 1EDKA 5AW1B 3USSA 4C7NA 1FFXB 4EOTA 3GLMA 4X1IB 5APTA 3CX5D 4NPFX 3UT5B 3GMAA 1W5AA 4ZK7A 2OYHC 3JASB 3CD6P 3V2NA 1Z5WA 3Q5SA 3H1LD 4U3FJ 4UB8E 1YITP 1L0LE 3D01A 2K9JB 5LA6B 1GO0A 5AW8B 4LCKA 2H43A 4ZOLB 4TV9A 4G88A 5KJ7C 3H1KG 2JO1A 1AQ5A 2D2CB 1ZMEC 2HFED 1E79H 5B66E 1K8AH 3QTYA 1U7JA 5KJ7D 1JY8A 3V3TA 1PGJA 1JM0A 4ZHVA 1LTBC 3V4DA 4C81A 2LR2A 4JYCA 5L8RJ 5EB1B 1W2EA 4PJ0E 1L0LD 3HTKA 4IIJB 1IV4A 5APSA 1SQXG 1VQLF 1LTSC 3RL0B 3RYCA 3L74G 1RLUA 1KQSF 3TYYA 3H1HE 2ZODA 3GHGB 2DW3A 2ITAA 4ZI7A 1PP9G 3AE9C 1SQXK 3N4ZA 1SQPD 3MBMA 2YIUB 3JARA 3IFMA 4YJ3B 2L5GB 1KYOD 1BE3E 2UWJE 3W68A 3HKEA 1NJIH 3BRVB 1JMBA 4BT2A 4BT4A 2YIUC 3J7AR 2OQQA 2B88A 5CCHC 2VXYA 3B5NA 1KILC 1GK6A 3CCVP 4EI8A 2WPVB 3VMFB 1BGYD 1J1EB 2YO2A 3AE3C 4D6TJ 5AW4B 2HP3A 1TVKA 1RH5B 2C0WA 3PLNA 1T6AA 2AXCA 2W6JH 1NOHA 1GL2C 1YIJP 1BE3G 3BASA 3SWFA 2KS1B 3LDTA 2KZIA 3I55P 4GOFA 3H32B 1SQPK 1SQXD 2QG4A 3L71G 3ZDMA 1M1KH 5HY1A 1N86A 2UYJA 1NAFA 4O4HB 3P8CD 2KZJA 4B62A 4U39A 5CCGA 1QGKB 1HGZA 3H1KJ 5J2TB 1KZUB 1T3JA 2BCCD 4IFDK 2Z1TA 2W6AA 3WPWA 1H89A 3OBYA 3C1LA 3NXSA 2G9IA 2Y9ZA 2GA1A 3M1XA 4GT1A 4YXDC 4Z1MH 5EYPA 3A5TA 4ZMDA 2G8YA 3AE8C 2HPCA 3AE4C 2B33A 1VQNF 1M8OB 3L71E 3RYCB 2BTOA 3JAMM 4WBAA 4OGQD 1N7SC 5KTBA 2Z1UA 2IBZG 3VOBA 4GODA 2KUBA 1W5EA 1EDJA 2ZJSE 1VL2A 3RA6A 4DOJA 4C4WC 2Z01A 3G9RA 5C39A 3F5HA 2JWDA 1FNKA 4Y99B 4IL6X 3L71J 3LYBA 2LXCB 1K04A 1M57D 2E76D 1SQVD 3SIVA 3JAKA 2QJYB 1KB9I 4O2BA 1IV3A 3M4SA 1ODEA 1SQPE 1RF1A 2AIFA 3B71A 3FX0A 1QLED 3MHVA 2IBZE 3CXHE 1SQQJ 1VQNP 3Q5PA 2NZ2A 2QJPB 5AW7B 2HX0A 1PGOA 1FJKA 1NTMK 3OW2F 3P7KA 3AGKA 2PAJA 1S72F 4RQOA 1IFDA 1H8AA 1AA0A 3KHUA 1KTMA 2QRXA 2C9LY 2XU6A 5CCGD 1FE6A 1Q86Q 3PTZA 1NQ3A 4WY4B 5JCOC 3JARB 2QIWA 2IBZD 1RQVA 4OVNF 3ZOPA 4OGQC 1X79B 1NU1G 3LW5H 1T8ZA 3HE5B 1DH3A 1HGVA 4YJ2B 1URQD 3K2XA 2E74C 2Q7CA 3W67A 1VHAA 2E75D 1RE3A 3LIEA 4YPCA 1BSNA 1VF5D 1YJNP 1LNQA 3MCQA 4N78D 4WY4C 1LTJB 3F6MA 4NQ3A 1SA0B 5LOVB 3JVHA 1BDCA 2LCAA 4NUTA 3VP9A 2OARA 3L74D 4BVTA 3VYIA 2DYYA 3C9RA 4I1LA 1TUBB 5JQGB 1L4AD 2H88C 5APQA 3JCUH 5J2TA 2KGWA 1W59A 2V9YA 1HWTC 1NTZK 1IPAA 2FFDA 4PWTA 2RN0A 1VH8A 2P58A 3JALA 3SIUA 2BEQD 5LXTA 5EYPB 2VAMA 1SVFA 3CPWF 1RHZB 5FJ4C 1QX8A 3MIWA 1NU1K 1NGMB 2O01N 3CXHH 1MFZA 2A45I 1KYOH 4UB6H 3L73D 4O4JB 1UI9A 3G71F 1VQ9F 2H8PD 5CCHA 2ZAEB 3H1HD 4ZKPA 2OYHA 3MQWA 4U3FD 4Y99C 2BCCG 3M06A 2OTLF 2P6YA 2Y0EA 2QJYC 1GU4A 2FFDC 1S9KE 1YQ3C 1NWQA 1KMIZ 2OYHB 2W90A 3LFOA 5M1BA 2JNBA 3VIUA 4ZKUA 5LP6C 3CWBG 4YJ3A 3OAKA 1CI6A 1NTMJ 2IX7C 4TT3H 4KWEA 3H1JJ 2K1AA 1DT9A 5IT9M 1HJ0A 2PP6A 1DX7A 2K3RA 1ZRTE 4HH2A 2N9BA 3KDPB 3TNUA 1YJWP 3SFEC 3ELCA 3CYPB 1J1DB 5KJ7A 3WJRA 3PRJA 3RYIB 3HD7D 3HE5A 3KZIE 3L4FA 3P8CE 5BMVB 4DCKA 3CWBE 2E75B 5JH7B 3V7EA 2E74B 4KJMA 1W2BO 1U7MA 2XDJA 1LWUB 5HY2A 3BATA 4AQRD 2YO3A 1IFIA 4YJ2A 1Y9BA 1LGHB 3V4QA 1GMJA 2NPSC 1JY3P 5BVZA 4ZHWA 1ZOYC 1ZN5A 3L75J 2JJLA 3SSUA 5FNVB 5GONA 3A0HH 5KAIH 4X1IA 1YYCA 1JY2O 1TU3F 4CPGA 1W5FA 5LYJB 1EXIA 3CCUP 3Q8HA 1KFNA 3RK2C 1DEEG 5CMZA 5FLXM 1N7LA 2ZVYA 1SQXE 5J2UB 2K9JA 5LA6A 2HQSC 1NTZG 5JCOA 1T2KC 4EYYQ 1L4AA 1K73Q 4O4JA 5IJ9A 3WGLA 5IJ9B 5AW5B 1PP9E 3GF3A 5DCVA 3S02A 3M0AA 2M5AB 1VPCA 2YMYA 1KC8H 3GHGA 5CA1B 4H13C 2Q3IA 2KOGA 4BVRA 1YJWF 2MJZA 2ZT9B 1SQQG 4GIFA 3CCVF 1NTZE 1M1JA 3BYQA 3KPEA 1UFYA 4NPEA 3IKFA 2FKWB 5KLVK 4ZI7B 3IMPA 1MFTA 1SQVG 4L74A 1FAVA 4O2BB 3VYTC 3CCQP 2Z4EA 1H0TB 1JCDA 1Y8AA 1M1KQ 1KYOI 3S0HA 3AECC 3V2RA 5EIBD 3CX5H 1MKMA 1JY2N 3QHDA 3CCJP 1DD3A 4AUWA 3B6NA 4NWOB 4DRXA 1IC2A 1URQC 3K0TA 4BRYA 3TF5A 1NJIQ 5AVTB 4ZHQA 1ONIA 3RK2D 3FWNA 3MP7B 1N7SA 5CJ4A 4WB4A 4BVSA 2RHOA 1P84D 1HF9A 2EWCA 4LNUA 1FJPA 1CZQA 2CHTA 3NTNA 1SQBK 1VQLP 4O4IB 1JTHB 1SQVE 1SFCC 1H0TA 1OW7A 4H13D 3JATA 5BMVA 3GG2A 2FXPA 4O4HA 4H44B 4DT0A 5HY0A 1G1JA 1BDDA 2GUSA 2KNCA 1CW5A 2CPSA 3CXHD 3UT5A 2JP3A 2AXTE 2WMMA 1VQ8F 2NPSB 1SQQD 2HLOA 1GL2B 2IAFA 2FYNC 2KK7A 2KG4A 2FYUD 2R44A 1IK9A 2HP0A 2KTUA 3F0DA 3OBWA 1JO5A 3V6IA 4PV1B 1X22A 4EI9A 2HS3A 3WU2E 3VCZA 3M84A 2W83C 5JVDB 2AEFA 1MUUA 3JALB 5LYJA 1NKNA 1FS0E 1JNMA 1IFMA 1YI2F 2XZRA 3WGMA 3SWYA 1J1EC 5EFWB 1YI2P 3E20B 2Q3EA 1SQBE 5GIOC 1FBMA 2GLZA 5GTHE 1U57A 3CD6F 1GZLA 3CWBD 4OH8B 4BY9D 2UYNA 3FGAD 5IYZA 3EFGA 2AMTA 1AV1A 3AEGC 4DZOA 1LT9B 2QSIA 2HPCB 3RBXA 2Z1EA 5G4UC 2N9YB 1QU9A 2MQEA 3JASA 1T3UA 1SQBG 3E7KA 4O4IA 3KJKA 3N4XA 1GZ0A 3QWOC 1NU1E 1SQXJ 4C82A 2IG8A 3TGUD 3C9TA 3CMEF 2AEMA 3Q2YA 1QVGO 5APYA 5KKZB 3KJJA 1M1JB 3L37A 1OFUA 1YBKA 2OHWA 3WU2H 2Z5IA 1KD1H 5KAIE 3SFDC 3PHLA 1VQPP 4I50B 4H44D 3FBAA 3NVIB 3C9SA 3AE5C 5E79E 2YXRB 1UIIA 3CCLP 2QJPC 1FDIA 3AEAC 1KD1Q 2H6LA 5AVXB 5KLIB 4X1YA 1TVKB 3O8ZA 1OXZA 3FFMA 3CLQA 3Q3DA 3CCJF 3H32A 5HP7A 3L36A 5TISH 1JOCA 3N2GB 4B45A 3WJQA 3JSVC 1Q2NA 1NKZB 5KLIC 3D6ZA 2IBZI 3D00A 1QVGF 1OVUA 4JBZA 2FBWC 3TD3A 2K1SA 2NRGA 2F9ZC 3II6A 3CC2P 2KB7P 5AVVB 3BCCD 3G3ZA 1VQOF 3H25A 1NTME 4EI7A 1J2JB 1L0NJ 1H7MA 3G6EP 2A45G 4NPDA 2IFMA 2L91A 5CA0B 2HG5D 1W581 1VQ4F 1YQ4C 2R3SA 4TV9B 3N2KA 1T2KD 5HY4A 4JF7A 1TUBA 1OW8A 2KXPB 3T80A 2A45H 1JMMA 1SQBD 3G4SP 1KQSO 5IYZB 3F0EA 1NTMG 3KE1A 5H2FH 4FFBA 5APXA 3VYUC 1J1DC 2HR3A 4TZZA 4WY4D 2M5AA 4BVQA 1H47A 2WSCH 1VQKF 3RYFB 4H0LD 3S06A 3WMM0 3JCMM 1LTIC 1D7MA 1QVFO 4EB6A 2O01J 5KLVD 3M0DC 1LP1B 2JKVA 4K3AA 3FD6A 3AEDC 3CCLF 1VQ6F 1W3EX 1JUNA 3ON1A 3HWUA 1WRGA 2IPPA 1CK2A 3GYQA 2VGNA 4PD4H 1OIPA 3CX5E 1EZVI 1FC2C 3L7QA 5HWEA 4HYTB 4H13B 4X3LA 4DXDA 2O01H 2ZYAA 3PLAC 2M0BA 1XBIA 1KQLA 3J80M 5KX5B 1M56D 3EWKA 3F0FA 3H1IJ 1HH0A 1KILE 2WSEH 3NMDA 2Q1KA 3MTUE 3GHZA 2KNCB 4TLFA 3K12A 2OTKE 3FXDA 2ZVOB 2R32A 2FXMA 2CW4A 4F6RA 1KORA 4H0LC 3L74J 1NTKD 3CI9A 1FZGA 1EDIA 5G4VC 1S5LX 4I7ZB 3L75D 5GONB 1RE4A 1RF0A 1EZVD 1M90H 4F6RB 2QM7A 1GW3A 1VF5B 1T0AA 1XTGB 2A06E 4UB8H 4W80A 1N2DC 1SQQE 1IV2A 3T97A 3CCRF 1FU1A 2Y9YA 5GTHH 2W8ZA 2WT7A 5AVWB 1A02J 1IFNA 1QL1A 1VQ7F 1NHLA 5CBNA 5JVDA 1NU1J 1R8EA 5AW3B 4A7PA 2FYNB 3RK3C 3L70J 2RMZA 3KXDA 2A06D 3D6YA 4WWIA 4L75A 1N73A 2M3BA 2RHLA 1SFCB 4G4YA 1W55A 3U59A 1BCCJ 2ZFCA 4C46A 2XV5A 3A0HE 3KYQA 2GVIA 1COMA 3HTNA 2B87A 1NTKJ 3B5NB 3IF4A 4JYBA 3RK2B 2BTUA 1P84I 1XRGA 1N8RH 3CCQF 3ABVC 4BT7A 1USDA 2NPSA 3MZWB 1LP1A 4RJTA 3O6QB 1G2CA 4LNUB 1YITF 3V2QA 4BT5A 1IFJA 5B5EE 1U3PA 2W27A 1S9KD 2YKOA 2I1JA 5APVA 3JATB 2WPRA 1KNJA 3I55F 5CJ0A 4WBNB 2PHNA 3RL0C 1GW4A 1PL5A 4O9BA 4W7ZA 3RGUA 1NU1D 1BCCD 1H88A 3TD4A 4QMAA 3RL0D 5JH7A 3FWLA 3RE3A 1QL2A 1W57A 2QI2A 3MDOA 1NTZD 1FZCA 3JCUE 2E76C 1N8RQ 2KLVA 1RF1C 1FSZA 1PXWA 1USEA 5CCHD 1J7HA 1K73H 3L73G 4O2AB 5CBOA 3ZO8A 2E76B 3FXEA 1L2PA 1SA0A 2N1TC 2O3JA 1A02F 1VQMF 3I5CA 3E1YA 1Q82Q 3NFQA 1E5WA 3Q1MA 1X52A 3CMEP 3FPIA 1L0NK 3VP8A 2H8CA 3MGNA 4IOIH 1GTWA 5CB4A 4PV1C 3HD7B 4BXLA 3HRNA 3JAWB 3J81M 4GKGA 4IL6H 2IQQA 3VOAA 1VQMP 1KB9H 4EIJA 3U1AA 5KKZC 1M7LA 2NPSD 2ZAUA 2M8RA 2ZXXA 1JCCA 1IFPA 1NTMD 3RYHB 3RK3E 3GTZA 3WGKA 2YYEA 5GTIH 3JAKB 1R5SA 4I50A 2HYNA 3JAWA 3IAOA 1FNJA 2BTQB 3QUWA 4IFMA 3RYFA 2YNYA 2OYOA 2KI7B 4BT6A 3LWVC 3A0BE 1FZBA 1L0LJ 4BRYB 3WJPA 1GL2D 1HTLC 4B86A 4R4LA 2I6DA 4U3JB 2WPQA 3ZP4A 3UIAA 1X8YA 1BCCG 1VQ6P 2H7HA 2QA4F 3A3YB 1S2EA 3K5BA 2IZ0A 4KHXA 3FD5A 2R3CA 4L76A 1PFIA 3AEBC 2HRYA 2R751 1FZFA 1W40A 5KLVE 1FOSE 2LBTA 3B4SA 3L75E 3U0OA 1JB0J 2PMPA 1S5LH 4M3LA 3RA5A 1SS1A 4GDOA 2RKLA 4X1KA 3PJSK 2J58A 2GUVA 2N1TD 3P8MC 4HNAB 1GX1A 3M0DA 3GF7A 2V7QJ 3NMUC 1S4XA 3M9BA 1BSHA 2WTYA 3H6PA 4LC1A 5HXZA 5MN5A 1JFFB 1RQUA 1KC8Q 1P84E 4TV8A 3N7NA 5KLVJ 1ZLLA 3VMYA 1SQVJ 1IV1A 1CSBA 1JY2P 5AVMA 5KLVG 3D71A 3IR9A 2N48A 3BCCJ 4JQ0D 1PGQA 5AW0B 2FYUG 4W7YA 3VI6A 2YXQB 1YJ9F 1G1IA 3MUDA 4I6MC 4B5CA 1VQ7P 2VAPA 1IJDB 5EWRA 2E5YA 1JY3O 1SDSA 2CVLA 2HODA 4RHAA 3E22B 1KB9E 1DIPA 2OTMA 3H1JE 2R6R1 1Z56A 3CC2F 1XTCC 2QA4P 5AVSB 2YKPA 2BEZF 1SFCD 1GL2A 1NMUB 3I7TA 2PGDA 3BRTB 4I55B 3C9IA 2OGUA 4AYCA 2P10A 5AW9B 3HUSC 2B9BA 2Q6QA 3E1RA 3LIDA 2Q9IA 4PV1D 3RBZA 1YHQP 1RF0C 5DJTB 3KZIH 4IFFA 3TNUB 2HS0A 5B8FA 1MV8A 5AW6B 1R5LA 2AEJA 1VQKP 3R2PA 3HTKB 1EQ7A 3DC2A 1PV3A 3QH9A 5CCGC 4BT3A 3RYIA 5GANK 4I55A 1RQ7A 4BWNA 3CCUF 3F89A 3O85A 2WWWA 1L0LK 3U1CA 4G4VA 1PP9J 3C8VA 1YTZI 2HVYD 1KILA 3R4YA 2VGMA 1CI6B 5MN4A 4LGDE 4N78E 1LT9A 2O1KA 2RHJA 3A2AA 2R5DA 2BO1A 3VMAA 2A06G 4WBNA 2WZ7A 3B5NC 1AFOA 3RK3D 4X3MA 5EZYB 1OVVA 3CCMP 3OJAB 2ZVNB 1W41A 2QJKC 3HKCB 2HODB 1YQNA 1SZQA 1L4AB 2P67A 1L0NG 3VMZA 2FYZA 4L73A 4C7NB 1FFXA 3HJWC 1CN7A 5AVRB 1X0TA 1IZNB 4ZNCA 2FYUK 3G4SF 2I6RA 4X1KB
chains in the Genus database with same CATH topology
2FFDB 2WSEH 3NMDA 1VDFA 4ZKUA 3MTUE 3CL3D 1YIJF 3MD0A 3OAKA 3M9QA 3M9HA 1CI6A 1N73C 2R32A 2FXMA 3CCEF 2IX7C 2KSJA 1DT9A 1SFCA 3BVHA 5IT9M 2PP6A 1DX7A 3CI9A 3VOPA 3MCAB 1YHQF 4HH2A 2KP8A 2N9BA 3KDPB 1FZGA 3TNUA 5G4VC 2YKQA 1E7KA 2GM4A 1J1DB 1HUCA 1ZV8A 5KJ7A 2KTVA 2LBXA 1KILD 3CMAF 1RE4A 1K9MH 1RF0A 3HD7D 1FOSF 3HE5A 1X7PA 3TSIA 1IO4A 3CPQA 3HUSA 3L4FA 2QM7A 1M90H 1GW3A 1NTKK 2IFNA 3P8CE 2OZBA 1XTGB 2WSFH 3V7EA 4W80A 3CCMF 1N2DC 1JJ2F 3B5ND 3T97A 1GDTA 3M91A 2XDJA 1LWUB 3CCRF 5HY2A 3BATA 1FU1A 3VTPC 4AQRD 2WT7A 5AVWB 1Q81H 2YO3A 1A02J 1IFIA 1IFNA 1LGHB 3N4YA 4XE5B 1RE4C 1QL1A 4I2LC 3V4QA 1Q86H 3CCSF 1GO1A 2NPSC 1JY3P 1VQPF 5BVZA 5GAPK 1VQ7F 1URQB 1NHLA 1ZN5A 3E1IA 1Q7YH 5AW3B 1RY3A 5AVUB 2JJLA 2LKMA 2WITA 3RK3C 1YYCA 1G2CB 1JY2O 5A2QM 2JEEA 5APUA 4XA4A 1N73A 2M3BA 5AVYB 1RF1B 5EO3A 3WXMB 1KFNA 1SFCB 3RK2C 2QM8A 5CMZA 1HJBA 1N7LA 5FLXM 3B8EB 3U59A 3RK3B 3CC7F 2ZFCA 4C46A 2XV5A 1T2KC 3L35A 1L4AA 1LTAC 2OTJF 3LWOC 3KYQA 3V5BA 1T0KB 3B5NB 1VQ5F 5AW5B 4JYBA 3NK6A 3RK2B 5DCVA 3M0AA 2KYVA 1URQA 1HVVA 1VPCA 2YMYA 1N8RH 1KC8H 3GHGA 3CCQF 3LWQC 2NPSA 5AW1B 4C7NA 2Q3IA 4EOTA 2KOGA 4XCQA 4BVRA 1YJWF 2MJZA 1G2CA 5APTA 2WT7B 2QEXF 1YITF 2C0XA 3V2QA 3PP5A 1IFJA 4GIFA 3V2NA 2OYHC 3CCVF 1M1JA 2W27A 3KPEA 1S9KD 4N6JA 2YKOA 2I1JA 5APVA 2O1JA 2FKWB 5KLVK 1GO0A 1LWUC 5AW8B 4LCKA 2H43A 1FAVA 1FZCC 1KFMA 2WPRA 2Z4EA 5APWA 1JCDA 3I55F 5CJ0A 3P32A 1RA4A 5KJ7C 3RL0C 1AQ5A 1GW4A 4O9BA 3V2RA 4W7ZA 2HFED 1H88A 1ZWZA 1JY2N 1K8AH 3RL0D 4AUWA 3GHGC 5KJ7D 1RE3C 2C9NY 1FZCB 3V3TA 1IC2A 1URQC 1LTBC 5AVTB 1QL2A 1WT6A 3RK2D 2QI2A 4JYCA 1N7SA 1SP4A 1FZCA 1W2EA 4WB4A 5CJ4A 3HTKA 4BVSA 1HBWA 4BW0B 1FJPA 1CZQA 2CPBA 5APSA 1VQLF 3HD7C 1SQBK 3NTNA 1LTSC 2KLVA 3RL0B 1JTHB 1RF1C 1PXWA 5CCHD 1KQSF 1SFCC 3TYYA 5AVZB 1LT9C 3V4WA 3GHGB 1K73H 3CXCF 1SQXK 3N4ZA 5HY0A 1G1JA 2N1TC 1A02F 1VQMF 3LWRC 3I5CA 3E1YA 3IFMA 2GUSA 3NFQA 1E5WA 1X52A 2R5BA 1CW5A 2CPSA 2L5GB 1L0NK 3VP8A 5BU5A 3MGNA 1GTWA 1VQ8F 1NJIH 2NPSB 3BRVB 2HLOA 3HD7B 1GL2B 3HRNA 1FZAA 2CZWA 3J81M 2XNXA 2N1TB 4GKGA 3J7AR 2N1TA 2P2UA 2KG4A 5CCHC 1IK9A 4EIJA 3U1AA 2KTUA 1M7LA 3OBWA 1JO5A 3I56F 3B5NA 4EI9A 1KILC 1GK6A 4EI8A 2NPSD 3EQ2A 3VMFB 2M8RA 1J1EB 2YO2A 3NK7A 1OWAA 1JCCA 5BU8B 5AW4B 2C0WA 1LTGC 1NOHA 1GL2C 1SQQK 5AW2B 3BASA 1KILB 3LWPC 1MUUA 3SWFA 2HYNA 3NVKE 1NKNA 1FDMA 1JNMA 1IFMA 2Z5HA 3H32B 1YI2F 4IFMA 2XZRA 1SQPK 2YNYA 1NH4A 3LWVC 3SWYA 1J1EC 3E20B 5GIOC 1FBMA 1M1KH 5HY1A 2GLZA 1FZBA 1N86A 1NAFA 3CD6F 3P8CD 1DEBA 1GZLA 1LTJC 1GL2D 5CCGA 4OH8B 1HTLC 4B86A 2OYIC 2I6DA 1GK4A 2WPQA 4BY9D 3UIAA 1HGZA 1X8YA 1KZUB 1T3JA 3EFGA 4IFDK 2W6AA 1YTZT 2H7HA 2QA4F 4DZOA 1LT9B 1H89A 3OBYA 3NXSA 2XKMA 3A3YB 2E43A 2HPCB 1N7SB 4KHXA 4GT1A 2R3CA 3KQGA 2OYIB 1Q82H 1PFIA 5G4UC 5CHXA 3A5TA 2HPCA 1LTTC 1FZFA 1W40A 1VQNF 1FOSE 1T3UA 2WPSA 1JTHA 1M1JC 1RLGA 2Q5UA 4C7RA 1W42A 3N4XA 1GZ0A 3JAMM 4WBAA 4M3LA 1N7SC 3RA5A 5KTBA 3CMEF 2J58A 2GUVA 2N1TD 3RA6A 4DOJA 4C4WC 3P8MC 3M0DA 2OYIA 5APYA 3NMUC 3M9BA 3V2PA 1M1JB 3H6PA 2WTYA 1NO4A 3L37A 4LC1A 5HXZA 4Y99B 2OHWA 2Z5IA 2ZXEB 1KD1H 3N7NA 1ZLLA 3VMYA 5GINC 1CSBA 1QVFF 1GD2E 1JY2P 3SIVA 3NVIB 1L4AC 1YJNF 4N3YB 3VN0A 3IR9A 4RESB 5AW0B 4W7YA 1RF1A 3VI6A 2AIFA 5AVXB 3A7OA 3HD7A 1N7SD 1YJ9F 1G1IA 3MUDA 4I6MC 3O8ZA 1OXZA 1IJDB 3FFMA 5EWRA 3CLQA 1JY3O 3CCJF 1W2BF 1SDSA 3H32A 1JY3N 3VMXA 2HODA 3L36A 5AW7B 1JOCA 2P7JA 1FJKA 1NTMK 3OW2F 3P7KA 3V7QA 1Z56A 1NKZB 3AGKA 3CC2F 2PAJA 1S72F 2E42A 1XTCC 1IFDA 1H8AA 5AVSB 2YKPA 3D00A 1QVGF 2C9LY 1ZR2A 1SFCD 1GL2A 2XU6A 5CCGD 1NMUB 1GU5A 2F9ZC 3II6A 1MZ9A 2W6BA 2KB7P 1SQVK 4WY4B 1LWUA 3BRTB 3C9IA 5AVVB 3G3ZA 4LLHA 1VQOF 4AYCA 4EI7A 5AW9B 1J2JB 3HUSC 1X79B 3LW5H 1H7MA 1T8ZA 3HE5B 3LIDA 1DH3A 1HGVA 2A45G 2Q9IA 2IFMA 1URQD 2I1KA 1RF0C 2FGYA 2HG5D 1ZR4A 2J59M 1VQ4F 2Q7CA 1RE3A 4IFFA 3LIEA 3TNUB 1MV8A 5AW6B 4N78D 3R2PA 1LTJB 4WY4C 3HTKB 4NQ3A 1EQ7A 1T2KD 5HY4A 4JF7A 3PAFA 5CCGC 4NUTA 3VP9A 2OARA 2A45H 4BVTA 1LTJA 3HUSB 3VYIA 1JMMA 5GANK 4I1LA 1L4AD 2FC3A 3CCUF 5APQA 2ALEA 3CG6A 1X7OA 3O85A 2WWWA 1L0LK 3U1CA 1HWTC 1NTZK 1IPAA 2FFDA 2BASA 5APXA 1J1DC 1YTZI 3SIUA 2HVYD 1KILA 4TZZA 2VGMA 1SVFA 3CPWF 1CI6B 4WY4D 5FJ4C 4BVQA 4LGDE 3MIWA 1NU1K 4N78E 2WSCH 1VQKF 1LT9A 2WALA 2O1KA 1MFZA 2A45I 4WY4A 3WMM0 3A2AA 2VRSA 3JCMM 1LTIC 2R5DA 2BO1A 3TK1A 3G71F 1VQ9F 2H8PD 5CCHA 5GIPC 3M0DC 2WZ7A 3CC4F 3B5NC 1AFOA 3RK3D 4X3MA 3OA7A 4ZKPA 2OYHA 1SLQA 2POHA 3G6EF 3CCLF 1VQ6F 4Y99C 1W3EX 1JUNA 3OJAB 3ON1A 3M06A 1WRGA 2IPPA 1W41A 1X9VA 1CK2A 3GYQA 2VGNA 2OTLF 5AVQB 3HE4B 2LBWA 3HAXD 2HODB 3HE4A 5HWEA 4HYTB 4X3LA 1L4AB 2O01H 2P67A 1GU4A 2FFDC 3VMZA 2FYZA 4C7NB 1FZEA 3HJWC 1S9KE 1NWQA 1CN7A 3PLAC 5AVRB 1XBIA 1KQLA 2OYHB 3J80M 5HXUA 1N73B 2FYUK 2P1JA 3G4SF 3LFOA 1HH0A 2JNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMD A;  1YIJ F;  3MD0 A;  3OAK A;  3M9H A;  1CI6 A;  2R32 A;  3CCE F;  1DT9 A;  5IT9 M;  3MCA B;  1YHQ F;  2KP8 A;  2N9B A;  3KDP B;  3TNU A;  5G4V C;  1E7K A;  1HUC A;  2LBX A;  2KTV A;  3CMA F;  1K9M H;  1FOS F;  3HE5 A;  1X7P A;  1IO4 A;  3CPQ A;  1M90 H;  2QM7 A;  2OZB A;  3V7E A;  3CCM F;  1JJ2 F;  3T97 A;  3M91 A;  3CCR F;  3VTP C;  4AQR D;  2WT7 A;  5AVW B;  1Q81 H;  2YO3 A;  1A02 J;  3N4Y A;  4XE5 B;  4I2L C;  3V4Q A;  1Q86 H;  3CCS F;  1GO1 A;  1VQP F;  5GAP K;  1VQ7 F;  1Q7Y H;  5AW3 B;  5AVU B;  2JJL A;  1YYC A;  1G2C B;  5A2Q M;  5APU A;  5AVY B;  5EO3 A;  3WXM B;  2QM8 A;  5CMZ A;  1HJB A;  5FLX M;  3B8E B;  3CC7 F;  2ZFC A;  4C46 A;  2XV5 A;  1T2K C;  3L35 A;  2OTJ F;  3LWO C;  3V5B A;  1T0K B;  1VQ5 F;  5AW5 B;  4JYB A;  3NK6 A;  5DCV A;  3M0A A;  1N8R H;  1KC8 H;  3CCQ F;  3LWQ C;  5AW1 B;  4C7N A;  2Q3I A;  4EOT A;  1YJW F;  5APT A;  2WT7 B;  2QEX F;  1YIT F;  3CCV F;  2W27 A;  1S9K D;  5APV A;  1GO0 A;  5AW8 B;  4LCK A;  1FAV A;  2WPR A;  5APW A;  3I55 F;  3P32 A;  1RA4 A;  1H88 A;  1ZWZ A;  1K8A H;  4AUW A;  2C9N Y;  5AVT B;  2QI2 A;  4JYC A;  1SP4 A;  3HTK A;  1HBW A;  4BW0 B;  1CZQ A;  5APS A;  1VQL F;  3NTN A;  1PXW A;  1KQS F;  3TYY A;  5AVZ B;  3V4W A;  1K73 H;  3CXC F;  3N4Z A;  1A02 F;  1VQM F;  3LWR C;  3I5C A;  3E1Y A;  3NFQ A;  1X52 A;  2R5B A;  3MGN A;  1GTW A;  1VQ8 F;  1NJI H;  2CZW A;  3J81 M;  4GKG A;  3J7A R;  2P2U A;  2KG4 A;  2KTU A;  3OBW A;  3I56 F;  1GK6 A;  3VMF B;  2YO2 A;  3NK7 A;  1OWA A;  5AW4 B;  5AW2 B;  3LWP C;  1MUU A;  3SWF A;  3NVK E;  1JNM A;  2Z5H A;  1YI2 F;  2XZR A;  2YNY A;  3LWV C;  3E20 B;  5GIO C;  1M1K H;  1NAF A;  3CD6 F;  1GZL A;  4B86 A;  2I6D A;  1GK4 A;  2WPQ A;  4BY9 D;  3UIA A;  1X8Y A;  2W6A A;  2H7H A;  2QA4 F;  4DZO A;  1H89 A;  3OBY A;  3NXS A;  3A3Y B;  2E43 A;  4KHX A;  4GT1 A;  2R3C A;  3KQG A;  1Q82 H;  5G4U C;  3A5T A;  1VQN F;  1W40 A;  1FOS E;  2WPS A;  1RLG A;  2Q5U A;  1W42 A;  1GZ0 A;  3JAM M;  4M3L A;  3RA5 A;  3CME F;  3RA6 A;  4C4W C;  3P8M C;  3M0D A;  5APY A;  3NMU C;  3M9B A;  2WTY A;  4LC1 A;  3L37 A;  2OHW A;  2Z5I A;  2ZXE B;  1KD1 H;  5GIN C;  3VMY A;  1CSB A;  1QVF F;  1GD2 E;  3SIV A;  3NVI B;  1YJN F;  3VN0 A;  3IR9 A;  4RES B;  5AW0 B;  3VI6 A;  2AIF A;  5AVX B;  3A7O A;  1YJ9 F;  4I6M C;  3O8Z A;  1OXZ A;  3FFM A;  5EWR A;  3CCJ F;  1W2B F;  1SDS A;  3VMX A;  3L36 A;  5AW7 B;  2P7J A;  3OW2 F;  3P7K A;  3V7Q A;  3CC2 F;  3AGK A;  1S72 F;  2E42 A;  1H8A A;  5AVS B;  1QVG F;  2C9L Y;  2XU6 A;  1NMU B;  1GU5 A;  5AVV B;  1VQO F;  4AYC A;  5AW9 B;  1J2J B;  1H7M A;  1DH3 A;  3HE5 B;  3LID A;  1VQ4 F;  2Q7C A;  3LIE A;  3TNU B;  1MV8 A;  5AW6 B;  1T2K D;  3PAF A;  4NUT A;  3VYI A;  5GAN K;  2FC3 A;  3CCU F;  5APQ A;  2ALE A;  3CG6 A;  1X7O A;  3O85 A;  2WWW A;  1HWT C;  1IPA A;  2BAS A;  5APX A;  3SIU A;  2HVY D;  4TZZ A;  2VGM A;  3CPW F;  1CI6 B;  5FJ4 C;  1VQK F;  2WAL A;  1MFZ A;  3A2A A;  2VRS A;  3JCM M;  2R5D A;  2BO1 A;  3TK1 A;  3G71 F;  1VQ9 F;  5GIP C;  3CC4 F;  4X3M A;  1SLQ A;  3CCL F;  3G6E F;  1VQ6 F;  1W3E X;  1JUN A;  3ON1 A;  3M06 A;  2IPP A;  1W41 A;  1CK2 A;  3GYQ A;  2VGN A;  2OTL F;  5AVQ B;  3HE4 B;  2LBW A;  3HAX D;  3HE4 A;  4HYT B;  4X3L A;  2P67 A;  1GU4 A;  3VMZ A;  4C7N B;  3HJW C;  1S9K E;  1NWQ A;  1CN7 A;  3PLA C;  5AVR B;  1XBI A;  1KQL A;  3J80 M;  3G4S F;  3LFO A;  2JNB A; 
#chains in the Genus database with same CATH topology
 2AIZ P;  3PH0 A;  2FFD B;  4PD4 D;  2RB9 A;  2PFX A;  1YIJ F;  2FYU J;  4DJG A;  4IL6 E;  3BCC G;  3MD0 A;  3KIZ A;  3M9H A;  1N73 C;  4TUY A;  5E79 H;  2KSJ A;  1EDL A;  1Z5V A;  1SFC A;  1X25 A;  2V4H A;  3BVH A;  3ERN A;  3ESJ A;  5LP6 B;  2ZYD A;  3VOP A;  1YHQ F;  3N2K B;  1OZH A;  2YKQ A;  1ZV8 A;  1HUC A;  2LBX A;  1SQP J;  3CMA F;  1KV4 A;  4IHJ A;  1K9M H;  2OTL P;  1X7P A;  3TSI A;  3S4R A;  2WSF H;  1AJY A;  3IKE A;  2WSS H;  4RO0 A;  1OW6 A;  3C9U A;  1QAH A;  3IEQ A;  3VTI C;  3VTP C;  3A0B H;  1KYO E;  1BE3 D;  4UB6 E;  1Q81 H;  4ZHY B;  1QEX A;  2YXZ A;  1VK3 A;  3D54 A;  3N4Y A;  1YGY A;  1RE4 C;  2E75 C;  3CXH I;  4HJG H;  1Q86 H;  5GTI E;  5GAP K;  2Z1F A;  1AVO A;  4DRX B;  1RY3 A;  4ASV A;  5C8Y A;  2LKM A;  2WIT A;  3O6Q A;  3R0P A;  4YTP C;  1G2C B;  3D70 A;  2WSF J;  4U3J A;  4XA4 A;  3IEW A;  1OMI A;  3TGU E;  5EO3 A;  1RF1 B;  3WXM B;  2WSC J;  1VQV A;  1HJB A;  3HKB B;  3RK3 B;  3CC7 F;  3L35 A;  2OTJ F;  2KLU A;  3V5B A;  4D6T G;  3L73 E;  3WUT A;  2K37 A;  2ZT9 C;  2KYV A;  1URQ A;  1HVV A;  1LJ2 A;  3KHN A;  2YMK A;  2K9Y A;  3LWQ C;  3N2G A;  4EB6 B;  4XCQ A;  3E22 A;  4ERH A;  2JR8 A;  2WT7 B;  2QEX F;  1IK7 A;  2C0X A;  4TV8 B;  3PP5 A;  3EFF K;  4R4M A;  4N6J A;  4G4Z A;  2O1J A;  1U3L A;  4G4W A;  1LWU C;  4D6T E;  1FZC C;  3I3F A;  1KFM A;  5APW A;  3P32 A;  2ZT9 D;  1RA4 A;  1P84 H;  3VYS C;  5ITZ B;  3WUU A;  1ZWZ A;  3S03 A;  3GHG C;  1VQ5 P;  1RE3 C;  2C9N Y;  1EZV G;  3K14 A;  3T97 B;  1FZC B;  5JQG A;  3CC7 P;  1WT6 A;  4I7Z C;  3L70 G;  1SP4 A;  1K05 A;  2D2C D;  1BE3 J;  1HBW A;  2LXB A;  3AE2 C;  4H44 C;  4BW0 B;  2CPB A;  3HD7 C;  4Y28 J;  4D6T D;  1NTK E;  2D2C C;  5K5G B;  4IIJ A;  3TDK A;  1OX3 A;  5CA1 A;  5AVZ B;  1LT9 C;  3V4W A;  3CXC F;  1Q90 D;  1PZQ A;  1BCC E;  4KT0 J;  3L72 E;  1Q81 Q;  1OVR A;  3S9O A;  4IHJ B;  3LWR C;  1H48 A;  2R5B A;  4U3F G;  1S1C X;  4ASW A;  1PIX A;  5BU5 A;  2Y0C A;  3L72 J;  3L70 E;  1PPJ D;  1FZA A;  1VQ8 P;  2CZW A;  5J2U A;  2XNX A;  2N1T B;  2N1T A;  3AEF C;  2P2U A;  3L75 G;  3OON A;  3I56 F;  4OWF A;  1NAY A;  3EQ2 A;  1ZW0 A;  4X20 B;  1WMK A;  3CMA P;  3NK7 A;  4X1Y B;  4GOE A;  1OWA A;  1EC5 A;  3L72 G;  5TJH A;  4EI2 A;  5BU8 B;  3LW5 J;  1LTG C;  1UIX A;  3H1K E;  3SWK A;  2DT4 A;  5EB0 A;  2CK3 H;  5MN6 A;  1SQQ K;  5AW2 B;  3CCS P;  4U3F E;  1KIL B;  3LWP C;  2Q1Y A;  1PGP A;  3NVK E;  2E5T A;  1FDM A;  3H1I G;  2Z5H A;  3CCE P;  4X20 A;  1EXJ A;  1NH4 A;  2FYU E;  1ZXG A;  5KAF H;  4O4L A;  5KMG A;  1DEB A;  3L74 E;  1LTJ C;  5EZY A;  2UYP A;  2QEX P;  5LXT B;  4G4X A;  1AVY A;  2H89 C;  2OYI C;  3H1H G;  1GK4 A;  1DBF A;  3H1J G;  3AE6 C;  4C8E A;  3H1L J;  3WUV A;  2K88 A;  1YTZ T;  3CC4 P;  2IYP A;  2XKM A;  1KN7 A;  2E43 A;  3G71 P;  1S3J A;  1N7S B;  1OAP A;  1Q82 H;  3H1I E;  2JDI H;  3KQG A;  4K35 A;  2OYI B;  4HNA A;  5CHX A;  3L73 J;  5H2F E;  5EIB C;  1LTT C;  5TIS E;  2QTP A;  2Y0D A;  2WPS A;  5ITZ A;  1JTH A;  1OFC X;  1M1J C;  1RLG A;  2Q5U A;  4C7R A;  1W42 A;  2UYN B;  5IJ0 A;  1U40 A;  3TD5 A;  5CA0 A;  2V7Q H;  1NYH A;  1LT1 A;  3TGU J;  2FY8 A;  2OYI A;  3V2P A;  1KB9 D;  4XFJ A;  1NO4 A;  4TUY B;  2BCC J;  3HKD A;  2CHS A;  3H1H J;  1R1M A;  2SPZ A;  2ZXE B;  5GIN C;  1XV2 A;  3CYQ A;  1QVF F;  1GD2 E;  3L71 D;  4ZOL A;  1L4A C;  4PD4 E;  1YJN F;  4N3Y B;  2L26 A;  3VN0 A;  4RES B;  1Y47 A;  2KSE A;  3A7O A;  1FDO A;  1N7S D;  3HD7 A;  4WVZ A;  2MKV A;  2FXO A;  3S1K A;  1W2B F;  5FNV A;  1JY3 N;  3L72 D;  3VMX A;  3CB2 A;  4JPZ B;  4YXW H;  1L0N D;  1ZRT D;  4OGQ B;  2P7J A;  1KQG B;  3V7Q A;  2IYO A;  3VO8 A;  2E42 A;  1AQT A;  1CLI A;  3AE1 C;  3CCR P;  5CB4 B;  1BGY J;  3HKE B;  1ZR2 A;  5EAZ A;  2WSE J;  1GU5 A;  4U7J A;  2QJK B;  1MZ9 A;  2W6B A;  1SQV K;  1LWU A;  2CWJ A;  3H1K D;  4LLH A;  3C8L A;  1SQB J;  3P4E A;  1L0N E;  2ZVZ A;  2I1K A;  2FGY A;  2RH0 A;  1ZR4 A;  4I4T A;  2J59 M;  2CSL A;  4I4T B;  5B66 H;  2OTJ P;  2H8E A;  3PAF A;  4O2A A;  5KMG B;  1YJ9 P;  2IZ1 A;  1LTJ A;  3HUS B;  5LOV A;  1DD4 A;  3AE7 C;  3BCC E;  2FC3 A;  2ZF8 A;  2ALE A;  5IJ0 B;  3CG6 A;  1X7O A;  2HRU A;  1SQP G;  4C8G A;  2BAS A;  5LP6 A;  4HKZ H;  4MN4 C;  1S72 P;  3H1I D;  2G3A A;  3P0Z A;  1QD9 A;  3WGJ A;  1VF5 C;  2WAL A;  2W8B C;  2M3E A;  1M90 Q;  4WY4 A;  1KQF B;  2VRS A;  1NVO A;  3TK1 A;  1VQ9 P;  5GIP C;  3CC4 F;  2GZL A;  3OA7 A;  1BGY G;  1SLQ A;  2POH A;  3G6E F;  4R40 B;  3AEE C;  1X9V A;  3F0G A;  3WGN A;  2ZOV A;  5AVQ B;  3HE4 B;  2LBW A;  3HAX D;  2I8D A;  3HE4 A;  3GW6 A;  1FZE A;  3EOR A;  4B46 A;  1NTZ J;  5HXU A;  1N73 B;  2P1J A;  4M8I A;  3WPX A;  4C8I A;  2J5U A;  1JEK A;  5B5E H;  3CX5 I;  1Q8R A;  3TGU G;  1VDF A;  2KIK A;  1BGY E;  3CL3 D;  5C8Y B;  3RL0 g;  2VAW A;  3JC2 2;  3CPW O;  5HP8 A;  3HKD B;  3M9Q A;  1PF5 A;  3LME A;  1VQO P;  3CCE F;  1VQ4 P;  1KNK A;  3DDN A;  1K8A Q;  2UZH A;  3MCA B;  3I56 P;  2KP8 A;  1Q7Y Q;  1E7K A;  3S0W A;  2AXT H;  2GM4 A;  1K9M Q;  2KTV A;  4HB1 A;  1KIL D;  3OW2 O;  4PJ0 H;  1FOS F;  2IDB A;  2WVR A;  2B89 A;  1IO4 A;  3CPQ A;  3HUS A;  1NTK K;  2IFN A;  2OZB A;  2XND H;  3CCM F;  4H0L B;  1JJ2 F;  3L70 D;  1PPJ E;  3B5N D;  1XHO A;  1GDT A;  3M91 A;  4FFB B;  1JN1 A;  4PD4 I;  2BCC E;  3Q5R A;  1S5L E;  4EDF A;  2QVA A;  3H1L G;  2KS1 A;  4XE5 B;  3P10 A;  4I2L C;  3CCS F;  1GO1 A;  2ZYG A;  4ZHQ B;  3IN6 A;  1VQP F;  1URQ B;  1W5B A;  5DJU B;  3ZP7 A;  1PP9 D;  3E1I A;  4O4L B;  1Q7Y H;  2UYK A;  1RQ2 A;  2WQY C;  5AVU B;  2HS4 A;  1EZV E;  1U43 A;  2B87 B;  3HKC A;  2NMU A;  1ZP0 C;  4E6E A;  5A2Q M;  2JEE A;  5APU A;  5KX5 A;  1PPJ G;  5AVY B;  3HKB A;  3H1J D;  2PRR A;  2RHH A;  5KAF E;  1JD1 A;  3S0Y A;  2QM8 A;  3B8E B;  1NTK G;  1L0L G;  3H1L E;  1W5C E;  2JWA A;  2QE7 H;  1LTA C;  3LWO C;  3ITK A;  2Q1X A;  1T0K B;  3MUD C;  4RKU J;  1VQ5 F;  3CWB J;  2E74 D;  2HP0 B;  3NK6 A;  1JFF A;  3RYH A;  1EDK A;  5AW1 B;  3USS A;  4C7N A;  1FFX B;  4EOT A;  3GLM A;  4X1I B;  5APT A;  3CX5 D;  4NPF X;  3UT5 B;  3GMA A;  1W5A A;  4ZK7 A;  2OYH C;  3JAS B;  3CD6 P;  3V2N A;  1Z5W A;  3Q5S A;  3H1L D;  4U3F J;  4UB8 E;  1YIT P;  1L0L E;  3D01 A;  2K9J B;  5LA6 B;  1GO0 A;  5AW8 B;  4LCK A;  2H43 A;  4ZOL B;  4TV9 A;  4G88 A;  5KJ7 C;  3H1K G;  2JO1 A;  1AQ5 A;  2D2C B;  1ZME C;  2HFE D;  1E79 H;  5B66 E;  1K8A H;  3QTY A;  1U7J A;  5KJ7 D;  1JY8 A;  3V3T A;  1PGJ A;  1JM0 A;  4ZHV A;  1LTB C;  3V4D A;  4C81 A;  2LR2 A;  4JYC A;  5L8R J;  5EB1 B;  1W2E A;  4PJ0 E;  1L0L D;  3HTK A;  4IIJ B;  1IV4 A;  5APS A;  1SQX G;  1VQL F;  1LTS C;  3RL0 B;  3RYC A;  3L74 G;  1RLU A;  1KQS F;  3TYY A;  3H1H E;  2ZOD A;  3GHG B;  2DW3 A;  2ITA A;  4ZI7 A;  1PP9 G;  3AE9 C;  1SQX K;  3N4Z A;  1SQP D;  3MBM A;  2YIU B;  3JAR A;  3IFM A;  4YJ3 B;  2L5G B;  1KYO D;  1BE3 E;  2UWJ E;  3W68 A;  3HKE A;  1NJI H;  3BRV B;  1JMB A;  4BT2 A;  4BT4 A;  2YIU C;  3J7A R;  2OQQ A;  2B88 A;  5CCH C;  2VXY A;  3B5N A;  1KIL C;  1GK6 A;  3CCV P;  4EI8 A;  2WPV B;  3VMF B;  1BGY D;  1J1E B;  2YO2 A;  3AE3 C;  4D6T J;  5AW4 B;  2HP3 A;  1TVK A;  1RH5 B;  2C0W A;  3PLN A;  1T6A A;  2AXC A;  2W6J H;  1NOH A;  1GL2 C;  1YIJ P;  1BE3 G;  3BAS A;  3SWF A;  2KS1 B;  3LDT A;  2KZI A;  3I55 P;  4GOF A;  3H32 B;  1SQP K;  1SQX D;  2QG4 A;  3L71 G;  3ZDM A;  1M1K H;  5HY1 A;  1N86 A;  2UYJ A;  1NAF A;  4O4H B;  3P8C D;  2KZJ A;  4B62 A;  4U39 A;  5CCG A;  1QGK B;  1HGZ A;  3H1K J;  5J2T B;  1KZU B;  1T3J A;  2BCC D;  4IFD K;  2Z1T A;  2W6A A;  3WPW A;  1H89 A;  3OBY A;  3C1L A;  3NXS A;  2G9I A;  2Y9Z A;  2GA1 A;  3M1X A;  4GT1 A;  4YXD C;  4Z1M H;  5EYP A;  3A5T A;  4ZMD A;  2G8Y A;  3AE8 C;  2HPC A;  3AE4 C;  2B33 A;  1VQN F;  1M8O B;  3L71 E;  3RYC B;  2BTO A;  3JAM M;  4WBA A;  4OGQ D;  1N7S C;  5KTB A;  2Z1U A;  2IBZ G;  3VOB A;  4GOD A;  2KUB A;  1W5E A;  1EDJ A;  2ZJS E;  1VL2 A;  3RA6 A;  4DOJ A;  4C4W C;  2Z01 A;  3G9R A;  5C39 A;  3F5H A;  2JWD A;  1FNK A;  4Y99 B;  4IL6 X;  3L71 J;  3LYB A;  2LXC B;  1K04 A;  1M57 D;  2E76 D;  1SQV D;  3SIV A;  3JAK A;  2QJY B;  1KB9 I;  4O2B A;  1IV3 A;  3M4S A;  1ODE A;  1SQP E;  1RF1 A;  2AIF A;  3B71 A;  3FX0 A;  1QLE D;  3MHV A;  2IBZ E;  3CXH E;  1SQQ J;  1VQN P;  3Q5P A;  2NZ2 A;  2QJP B;  5AW7 B;  2HX0 A;  1PGO A;  1FJK A;  1NTM K;  3OW2 F;  3P7K A;  3AGK A;  2PAJ A;  1S72 F;  4RQO A;  1IFD A;  1H8A A;  1AA0 A;  3KHU A;  1KTM A;  2QRX A;  2C9L Y;  2XU6 A;  5CCG D;  1FE6 A;  1Q86 Q;  3PTZ A;  1NQ3 A;  4WY4 B;  5JCO C;  3JAR B;  2QIW A;  2IBZ D;  1RQV A;  4OVN F;  3ZOP A;  4OGQ C;  1X79 B;  1NU1 G;  3LW5 H;  1T8Z A;  3HE5 B;  1DH3 A;  1HGV A;  4YJ2 B;  1URQ D;  3K2X A;  2E74 C;  2Q7C A;  3W67 A;  1VHA A;  2E75 D;  1RE3 A;  3LIE A;  4YPC A;  1BSN A;  1VF5 D;  1YJN P;  1LNQ A;  3MCQ A;  4N78 D;  4WY4 C;  1LTJ B;  3F6M A;  4NQ3 A;  1SA0 B;  5LOV B;  3JVH A;  1BDC A;  2LCA A;  4NUT A;  3VP9 A;  2OAR A;  3L74 D;  4BVT A;  3VYI A;  2DYY A;  3C9R A;  4I1L A;  1TUB B;  5JQG B;  1L4A D;  2H88 C;  5APQ A;  3JCU H;  5J2T A;  2KGW A;  1W59 A;  2V9Y A;  1HWT C;  1NTZ K;  1IPA A;  2FFD A;  4PWT A;  2RN0 A;  1VH8 A;  2P58 A;  3JAL A;  3SIU A;  2BEQ D;  5LXT A;  5EYP B;  2VAM A;  1SVF A;  3CPW F;  1RHZ B;  5FJ4 C;  1QX8 A;  3MIW A;  1NU1 K;  1NGM B;  2O01 N;  3CXH H;  1MFZ A;  2A45 I;  1KYO H;  4UB6 H;  3L73 D;  4O4J B;  1UI9 A;  3G71 F;  1VQ9 F;  2H8P D;  5CCH A;  2ZAE B;  3H1H D;  4ZKP A;  2OYH A;  3MQW A;  4U3F D;  4Y99 C;  2BCC G;  3M06 A;  2OTL F;  2P6Y A;  2Y0E A;  2QJY C;  1GU4 A;  2FFD C;  1S9K E;  1YQ3 C;  1NWQ A;  1KMI Z;  2OYH B;  2W90 A;  3LFO A;  5M1B A;  2JNB A;  3VIU A;  4ZKU A;  5LP6 C;  3CWB G;  4YJ3 A;  3OAK A;  1CI6 A;  1NTM J;  2IX7 C;  4TT3 H;  4KWE A;  3H1J J;  2K1A A;  1DT9 A;  5IT9 M;  1HJ0 A;  2PP6 A;  1DX7 A;  2K3R A;  1ZRT E;  4HH2 A;  2N9B A;  3KDP B;  3TNU A;  1YJW P;  3SFE C;  3ELC A;  3CYP B;  1J1D B;  5KJ7 A;  3WJR A;  3PRJ A;  3RYI B;  3HD7 D;  3HE5 A;  3KZI E;  3L4F A;  3P8C E;  5BMV B;  4DCK A;  3CWB E;  2E75 B;  5JH7 B;  3V7E A;  2E74 B;  4KJM A;  1W2B O;  1U7M A;  2XDJ A;  1LWU B;  5HY2 A;  3BAT A;  4AQR D;  2YO3 A;  1IFI A;  4YJ2 A;  1Y9B A;  1LGH B;  3V4Q A;  1GMJ A;  2NPS C;  1JY3 P;  5BVZ A;  4ZHW A;  1ZOY C;  1ZN5 A;  3L75 J;  2JJL A;  3SSU A;  5FNV B;  5GON A;  3A0H H;  5KAI H;  4X1I A;  1YYC A;  1JY2 O;  1TU3 F;  4CPG A;  1W5F A;  5LYJ B;  1EXI A;  3CCU P;  3Q8H A;  1KFN A;  3RK2 C;  1DEE G;  5CMZ A;  5FLX M;  1N7L A;  2ZVY A;  1SQX E;  5J2U B;  2K9J A;  5LA6 A;  2HQS C;  1NTZ G;  5JCO A;  1T2K C;  4EYY Q;  1L4A A;  1K73 Q;  4O4J A;  5IJ9 A;  3WGL A;  5IJ9 B;  5AW5 B;  1PP9 E;  3GF3 A;  5DCV A;  3S02 A;  3M0A A;  2M5A B;  1VPC A;  2YMY A;  1KC8 H;  3GHG A;  5CA1 B;  4H13 C;  2Q3I A;  2KOG A;  4BVR A;  1YJW F;  2MJZ A;  2ZT9 B;  1SQQ G;  4GIF A;  3CCV F;  1NTZ E;  1M1J A;  3BYQ A;  3KPE A;  1UFY A;  4NPE A;  3IKF A;  2FKW B;  5KLV K;  4ZI7 B;  3IMP A;  1MFT A;  1SQV G;  4L74 A;  1FAV A;  4O2B B;  3VYT C;  3CCQ P;  2Z4E A;  1H0T B;  1JCD A;  1Y8A A;  1M1K Q;  1KYO I;  3S0H A;  3AEC C;  3V2R A;  5EIB D;  3CX5 H;  1MKM A;  1JY2 N;  3QHD A;  3CCJ P;  1DD3 A;  4AUW A;  3B6N A;  4NWO B;  4DRX A;  1IC2 A;  1URQ C;  3K0T A;  4BRY A;  3TF5 A;  1NJI Q;  5AVT B;  4ZHQ A;  1ONI A;  3RK2 D;  3FWN A;  3MP7 B;  1N7S A;  5CJ4 A;  4WB4 A;  4BVS A;  2RHO A;  1P84 D;  1HF9 A;  2EWC A;  4LNU A;  1FJP A;  1CZQ A;  2CHT A;  3NTN A;  1SQB K;  1VQL P;  4O4I B;  1JTH B;  1SQV E;  1SFC C;  1H0T A;  1OW7 A;  4H13 D;  3JAT A;  5BMV A;  3GG2 A;  2FXP A;  4O4H A;  4H44 B;  4DT0 A;  5HY0 A;  1G1J A;  1BDD A;  2GUS A;  2KNC A;  1CW5 A;  2CPS A;  3CXH D;  3UT5 A;  2JP3 A;  2AXT E;  2WMM A;  1VQ8 F;  2NPS B;  1SQQ D;  2HLO A;  1GL2 B;  2IAF A;  2FYN C;  2KK7 A;  2KG4 A;  2FYU D;  2R44 A;  1IK9 A;  2HP0 A;  2KTU A;  3F0D A;  3OBW A;  1JO5 A;  3V6I A;  4PV1 B;  1X22 A;  4EI9 A;  2HS3 A;  3WU2 E;  3VCZ A;  3M84 A;  2W83 C;  5JVD B;  2AEF A;  1MUU A;  3JAL B;  5LYJ A;  1NKN A;  1FS0 E;  1JNM A;  1IFM A;  1YI2 F;  2XZR A;  3WGM A;  3SWY A;  1J1E C;  5EFW B;  1YI2 P;  3E20 B;  2Q3E A;  1SQB E;  5GIO C;  1FBM A;  2GLZ A;  5GTH E;  1U57 A;  3CD6 F;  1GZL A;  3CWB D;  4OH8 B;  4BY9 D;  2UYN A;  3FGA D;  5IYZ A;  3EFG A;  2AMT A;  1AV1 A;  3AEG C;  4DZO A;  1LT9 B;  2QSI A;  2HPC B;  3RBX A;  2Z1E A;  5G4U C;  2N9Y B;  1QU9 A;  2MQE A;  3JAS A;  1T3U A;  1SQB G;  3E7K A;  4O4I A;  3KJK A;  3N4X A;  1GZ0 A;  3QWO C;  1NU1 E;  1SQX J;  4C82 A;  2IG8 A;  3TGU D;  3C9T A;  3CME F;  2AEM A;  3Q2Y A;  1QVG O;  5APY A;  5KKZ B;  3KJJ A;  1M1J B;  3L37 A;  1OFU A;  1YBK A;  2OHW A;  3WU2 H;  2Z5I A;  1KD1 H;  5KAI E;  3SFD C;  3PHL A;  1VQP P;  4I50 B;  4H44 D;  3FBA A;  3NVI B;  3C9S A;  3AE5 C;  5E79 E;  2YXR B;  1UII A;  3CCL P;  2QJP C;  1FDI A;  3AEA C;  1KD1 Q;  2H6L A;  5AVX B;  5KLI B;  4X1Y A;  1TVK B;  3O8Z A;  1OXZ A;  3FFM A;  3CLQ A;  3Q3D A;  3CCJ F;  3H32 A;  5HP7 A;  3L36 A;  5TIS H;  1JOC A;  3N2G B;  4B45 A;  3WJQ A;  3JSV C;  1Q2N A;  1NKZ B;  5KLI C;  3D6Z A;  2IBZ I;  3D00 A;  1QVG F;  1OVU A;  4JBZ A;  2FBW C;  3TD3 A;  2K1S A;  2NRG A;  2F9Z C;  3II6 A;  3CC2 P;  2KB7 P;  5AVV B;  3BCC D;  3G3Z A;  1VQO F;  3H25 A;  1NTM E;  4EI7 A;  1J2J B;  1L0N J;  1H7M A;  3G6E P;  2A45 G;  4NPD A;  2IFM A;  2L91 A;  5CA0 B;  2HG5 D;  1W58 1;  1VQ4 F;  1YQ4 C;  2R3S A;  4TV9 B;  3N2K A;  1T2K D;  5HY4 A;  4JF7 A;  1TUB A;  1OW8 A;  2KXP B;  3T80 A;  2A45 H;  1JMM A;  1SQB D;  3G4S P;  1KQS O;  5IYZ B;  3F0E A;  1NTM G;  3KE1 A;  5H2F H;  4FFB A;  5APX A;  3VYU C;  1J1D C;  2HR3 A;  4TZZ A;  4WY4 D;  2M5A A;  4BVQ A;  1H47 A;  2WSC H;  1VQK F;  3RYF B;  4H0L D;  3S06 A;  3WMM 0;  3JCM M;  1LTI C;  1D7M A;  1QVF O;  4EB6 A;  2O01 J;  5KLV D;  3M0D C;  1LP1 B;  2JKV A;  4K3A A;  3FD6 A;  3AED C;  3CCL F;  1VQ6 F;  1W3E X;  1JUN A;  3ON1 A;  3HWU A;  1WRG A;  2IPP A;  1CK2 A;  3GYQ A;  2VGN A;  4PD4 H;  1OIP A;  3CX5 E;  1EZV I;  1FC2 C;  3L7Q A;  5HWE A;  4HYT B;  4H13 B;  4X3L A;  4DXD A;  2O01 H;  2ZYA A;  3PLA C;  2M0B A;  1XBI A;  1KQL A;  3J80 M;  5KX5 B;  1M56 D;  3EWK A;  3F0F A;  3H1I J;  1HH0 A;  1KIL E;  2WSE H;  3NMD A;  2Q1K A;  3MTU E;  3GHZ A;  2KNC B;  4TLF A;  3K12 A;  2OTK E;  3FXD A;  2ZVO B;  2R32 A;  2FXM A;  2CW4 A;  4F6R A;  1KOR A;  4H0L C;  3L74 J;  1NTK D;  3CI9 A;  1FZG A;  1EDI A;  5G4V C;  1S5L X;  4I7Z B;  3L75 D;  5GON B;  1RE4 A;  1RF0 A;  1EZV D;  1M90 H;  4F6R B;  2QM7 A;  1GW3 A;  1VF5 B;  1T0A A;  1XTG B;  2A06 E;  4UB8 H;  4W80 A;  1N2D C;  1SQQ E;  1IV2 A;  3T97 A;  3CCR F;  1FU1 A;  2Y9Y A;  5GTH H;  2W8Z A;  2WT7 A;  5AVW B;  1A02 J;  1IFN A;  1QL1 A;  1VQ7 F;  1NHL A;  5CBN A;  5JVD A;  1NU1 J;  1R8E A;  5AW3 B;  4A7P A;  2FYN B;  3RK3 C;  3L70 J;  2RMZ A;  3KXD A;  2A06 D;  3D6Y A;  4WWI A;  4L75 A;  1N73 A;  2M3B A;  2RHL A;  1SFC B;  4G4Y A;  1W55 A;  3U59 A;  1BCC J;  2ZFC A;  4C46 A;  2XV5 A;  3A0H E;  3KYQ A;  2GVI A;  1COM A;  3HTN A;  2B87 A;  1NTK J;  3B5N B;  3IF4 A;  4JYB A;  3RK2 B;  2BTU A;  1P84 I;  1XRG A;  1N8R H;  3CCQ F;  3ABV C;  4BT7 A;  1USD A;  2NPS A;  3MZW B;  1LP1 A;  4RJT A;  3O6Q B;  1G2C A;  4LNU B;  1YIT F;  3V2Q A;  4BT5 A;  1IFJ A;  5B5E E;  1U3P A;  2W27 A;  1S9K D;  2YKO A;  2I1J A;  5APV A;  3JAT B;  2WPR A;  1KNJ A;  3I55 F;  5CJ0 A;  4WBN B;  2PHN A;  3RL0 C;  1GW4 A;  1PL5 A;  4O9B A;  4W7Z A;  3RGU A;  1NU1 D;  1BCC D;  1H88 A;  3TD4 A;  4QMA A;  3RL0 D;  5JH7 A;  3FWL A;  3RE3 A;  1QL2 A;  1W57 A;  2QI2 A;  3MDO A;  1NTZ D;  1FZC A;  3JCU E;  2E76 C;  1N8R Q;  2KLV A;  1RF1 C;  1FSZ A;  1PXW A;  1USE A;  5CCH D;  1J7H A;  1K73 H;  3L73 G;  4O2A B;  5CBO A;  3ZO8 A;  2E76 B;  3FXE A;  1L2P A;  1SA0 A;  2N1T C;  2O3J A;  1A02 F;  1VQM F;  3I5C A;  3E1Y A;  1Q82 Q;  3NFQ A;  1E5W A;  3Q1M A;  1X52 A;  3CME P;  3FPI A;  1L0N K;  3VP8 A;  2H8C A;  3MGN A;  4IOI H;  1GTW A;  5CB4 A;  4PV1 C;  3HD7 B;  4BXL A;  3HRN A;  3JAW B;  3J81 M;  4GKG A;  4IL6 H;  2IQQ A;  3VOA A;  1VQM P;  1KB9 H;  4EIJ A;  3U1A A;  5KKZ C;  1M7L A;  2NPS D;  2ZAU A;  2M8R A;  2ZXX A;  1JCC A;  1IFP A;  1NTM D;  3RYH B;  3RK3 E;  3GTZ A;  3WGK A;  2YYE A;  5GTI H;  3JAK B;  1R5S A;  4I50 A;  2HYN A;  3JAW A;  3IAO A;  1FNJ A;  2BTQ B;  3QUW A;  4IFM A;  3RYF A;  2YNY A;  2OYO A;  2KI7 B;  4BT6 A;  3LWV C;  3A0B E;  1FZB A;  1L0L J;  4BRY B;  3WJP A;  1GL2 D;  1HTL C;  4B86 A;  4R4L A;  2I6D A;  4U3J B;  2WPQ A;  3ZP4 A;  3UIA A;  1X8Y A;  1BCC G;  1VQ6 P;  2H7H A;  2QA4 F;  3A3Y B;  1S2E A;  3K5B A;  2IZ0 A;  4KHX A;  3FD5 A;  2R3C A;  4L76 A;  1PFI A;  3AEB C;  2HRY A;  2R75 1;  1FZF A;  1W40 A;  5KLV E;  1FOS E;  2LBT A;  3B4S A;  3L75 E;  3U0O A;  1JB0 J;  2PMP A;  1S5L H;  4M3L A;  3RA5 A;  1SS1 A;  4GDO A;  2RKL A;  4X1K A;  3PJS K;  2J58 A;  2GUV A;  2N1T D;  3P8M C;  4HNA B;  1GX1 A;  3M0D A;  3GF7 A;  2V7Q J;  3NMU C;  1S4X A;  3M9B A;  1BSH A;  2WTY A;  3H6P A;  4LC1 A;  5HXZ A;  5MN5 A;  1JFF B;  1RQU A;  1KC8 Q;  1P84 E;  4TV8 A;  3N7N A;  5KLV J;  1ZLL A;  3VMY A;  1SQV J;  1IV1 A;  1CSB A;  1JY2 P;  5AVM A;  5KLV G;  3D71 A;  3IR9 A;  2N48 A;  3BCC J;  4JQ0 D;  1PGQ A;  5AW0 B;  2FYU G;  4W7Y A;  3VI6 A;  2YXQ B;  1YJ9 F;  1G1I A;  3MUD A;  4I6M C;  4B5C A;  1VQ7 P;  2VAP A;  1IJD B;  5EWR A;  2E5Y A;  1JY3 O;  1SDS A;  2CVL A;  2HOD A;  4RHA A;  3E22 B;  1KB9 E;  1DIP A;  2OTM A;  3H1J E;  2R6R 1;  1Z56 A;  3CC2 F;  1XTC C;  2QA4 P;  5AVS B;  2YKP A;  2BEZ F;  1SFC D;  1GL2 A;  1NMU B;  3I7T A;  2PGD A;  3BRT B;  4I55 B;  3C9I A;  2OGU A;  4AYC A;  2P10 A;  5AW9 B;  3HUS C;  2B9B A;  2Q6Q A;  3E1R A;  3LID A;  2Q9I A;  4PV1 D;  3RBZ A;  1YHQ P;  1RF0 C;  5DJT B;  3KZI H;  4IFF A;  3TNU B;  2HS0 A;  5B8F A;  1MV8 A;  5AW6 B;  1R5L A;  2AEJ A;  1VQK P;  3R2P A;  3HTK B;  1EQ7 A;  3DC2 A;  1PV3 A;  3QH9 A;  5CCG C;  4BT3 A;  3RYI A;  5GAN K;  4I55 A;  1RQ7 A;  4BWN A;  3CCU F;  3F89 A;  3O85 A;  2WWW A;  1L0L K;  3U1C A;  4G4V A;  1PP9 J;  3C8V A;  1YTZ I;  2HVY D;  1KIL A;  3R4Y A;  2VGM A;  1CI6 B;  5MN4 A;  4LGD E;  4N78 E;  1LT9 A;  2O1K A;  2RHJ A;  3A2A A;  2R5D A;  2BO1 A;  3VMA A;  2A06 G;  4WBN A;  2WZ7 A;  3B5N C;  1AFO A;  3RK3 D;  4X3M A;  5EZY B;  1OVV A;  3CCM P;  3OJA B;  2ZVN B;  1W41 A;  2QJK C;  3HKC B;  2HOD B;  1YQN A;  1SZQ A;  1L4A B;  2P67 A;  1L0N G;  3VMZ A;  2FYZ A;  4L73 A;  4C7N B;  1FFX A;  3HJW C;  1CN7 A;  5AVR B;  1X0T A;  1IZN B;  4ZNC A;  2FYU K;  3G4S F;  2I6R A;  4X1K B; 
#chains in the Genus database with same CATH homology
 2FFD B;  2WSE H;  3NMD A;  1VDF A;  4ZKU A;  3MTU E;  3CL3 D;  1YIJ F;  3MD0 A;  3OAK A;  3M9Q A;  3M9H A;  1CI6 A;  1N73 C;  2R32 A;  2FXM A;  3CCE F;  2IX7 C;  2KSJ A;  1DT9 A;  1SFC A;  3BVH A;  5IT9 M;  2PP6 A;  1DX7 A;  3CI9 A;  3VOP A;  3MCA B;  1YHQ F;  4HH2 A;  2KP8 A;  2N9B A;  3KDP B;  1FZG A;  3TNU A;  5G4V C;  2YKQ A;  1E7K A;  2GM4 A;  1J1D B;  1HUC A;  1ZV8 A;  5KJ7 A;  2KTV A;  2LBX A;  1KIL D;  3CMA F;  1RE4 A;  1K9M H;  1RF0 A;  3HD7 D;  1FOS F;  3HE5 A;  1X7P A;  3TSI A;  1IO4 A;  3CPQ A;  3HUS A;  3L4F A;  2QM7 A;  1M90 H;  1GW3 A;  1NTK K;  2IFN A;  3P8C E;  2OZB A;  1XTG B;  2WSF H;  3V7E A;  4W80 A;  3CCM F;  1N2D C;  1JJ2 F;  3B5N D;  3T97 A;  1GDT A;  3M91 A;  2XDJ A;  1LWU B;  3CCR F;  5HY2 A;  3BAT A;  1FU1 A;  3VTP C;  4AQR D;  2WT7 A;  5AVW B;  1Q81 H;  2YO3 A;  1A02 J;  1IFI A;  1IFN A;  1LGH B;  3N4Y A;  4XE5 B;  1RE4 C;  1QL1 A;  4I2L C;  3V4Q A;  1Q86 H;  3CCS F;  1GO1 A;  2NPS C;  1JY3 P;  1VQP F;  5BVZ A;  5GAP K;  1VQ7 F;  1URQ B;  1NHL A;  1ZN5 A;  3E1I A;  1Q7Y H;  5AW3 B;  1RY3 A;  5AVU B;  2JJL A;  2LKM A;  2WIT A;  3RK3 C;  1YYC A;  1G2C B;  1JY2 O;  5A2Q M;  2JEE A;  5APU A;  4XA4 A;  1N73 A;  2M3B A;  5AVY B;  1RF1 B;  5EO3 A;  3WXM B;  1KFN A;  1SFC B;  3RK2 C;  2QM8 A;  5CMZ A;  1HJB A;  1N7L A;  5FLX M;  3B8E B;  3U59 A;  3RK3 B;  3CC7 F;  2ZFC A;  4C46 A;  2XV5 A;  1T2K C;  3L35 A;  1L4A A;  1LTA C;  2OTJ F;  3LWO C;  3KYQ A;  3V5B A;  1T0K B;  3B5N B;  1VQ5 F;  5AW5 B;  4JYB A;  3NK6 A;  3RK2 B;  5DCV A;  3M0A A;  2KYV A;  1URQ A;  1HVV A;  1VPC A;  2YMY A;  1N8R H;  1KC8 H;  3GHG A;  3CCQ F;  3LWQ C;  2NPS A;  5AW1 B;  4C7N A;  2Q3I A;  4EOT A;  2KOG A;  4XCQ A;  4BVR A;  1YJW F;  2MJZ A;  1G2C A;  5APT A;  2WT7 B;  2QEX F;  1YIT F;  2C0X A;  3V2Q A;  3PP5 A;  1IFJ A;  4GIF A;  3V2N A;  2OYH C;  3CCV F;  1M1J A;  2W27 A;  3KPE A;  1S9K D;  4N6J A;  2YKO A;  2I1J A;  5APV A;  2O1J A;  2FKW B;  5KLV K;  1GO0 A;  1LWU C;  5AW8 B;  4LCK A;  2H43 A;  1FAV A;  1FZC C;  1KFM A;  2WPR A;  2Z4E A;  5APW A;  1JCD A;  3I55 F;  5CJ0 A;  3P32 A;  1RA4 A;  5KJ7 C;  3RL0 C;  1AQ5 A;  1GW4 A;  4O9B A;  3V2R A;  4W7Z A;  2HFE D;  1H88 A;  1ZWZ A;  1JY2 N;  1K8A H;  3RL0 D;  4AUW A;  3GHG C;  5KJ7 D;  1RE3 C;  2C9N Y;  1FZC B;  3V3T A;  1IC2 A;  1URQ C;  1LTB C;  5AVT B;  1QL2 A;  1WT6 A;  3RK2 D;  2QI2 A;  4JYC A;  1N7S A;  1SP4 A;  1FZC A;  1W2E A;  4WB4 A;  5CJ4 A;  3HTK A;  4BVS A;  1HBW A;  4BW0 B;  1FJP A;  1CZQ A;  2CPB A;  5APS A;  1VQL F;  3HD7 C;  1SQB K;  3NTN A;  1LTS C;  2KLV A;  3RL0 B;  1JTH B;  1RF1 C;  1PXW A;  5CCH D;  1KQS F;  1SFC C;  3TYY A;  5AVZ B;  1LT9 C;  3V4W A;  3GHG B;  1K73 H;  3CXC F;  1SQX K;  3N4Z A;  5HY0 A;  1G1J A;  2N1T C;  1A02 F;  1VQM F;  3LWR C;  3I5C A;  3E1Y A;  3IFM A;  2GUS A;  3NFQ A;  1E5W A;  1X52 A;  2R5B A;  1CW5 A;  2CPS A;  2L5G B;  1L0N K;  3VP8 A;  5BU5 A;  3MGN A;  1GTW A;  1VQ8 F;  1NJI H;  2NPS B;  3BRV B;  2HLO A;  3HD7 B;  1GL2 B;  3HRN A;  1FZA A;  2CZW A;  3J81 M;  2XNX A;  2N1T B;  4GKG A;  3J7A R;  2N1T A;  2P2U A;  2KG4 A;  5CCH C;  1IK9 A;  4EIJ A;  3U1A A;  2KTU A;  1M7L A;  3OBW A;  1JO5 A;  3I56 F;  3B5N A;  4EI9 A;  1KIL C;  1GK6 A;  4EI8 A;  2NPS D;  3EQ2 A;  3VMF B;  2M8R A;  1J1E B;  2YO2 A;  3NK7 A;  1OWA A;  1JCC A;  5BU8 B;  5AW4 B;  2C0W A;  1LTG C;  1NOH A;  1GL2 C;  1SQQ K;  5AW2 B;  3BAS A;  1KIL B;  3LWP C;  1MUU A;  3SWF A;  2HYN A;  3NVK E;  1NKN A;  1FDM A;  1JNM A;  1IFM A;  2Z5H A;  3H32 B;  1YI2 F;  4IFM A;  2XZR A;  1SQP K;  2YNY A;  1NH4 A;  3LWV C;  3SWY A;  1J1E C;  3E20 B;  5GIO C;  1FBM A;  1M1K H;  5HY1 A;  2GLZ A;  1FZB A;  1N86 A;  1NAF A;  3CD6 F;  3P8C D;  1DEB A;  1GZL A;  1LTJ C;  1GL2 D;  5CCG A;  4OH8 B;  1HTL C;  4B86 A;  2OYI C;  2I6D A;  1GK4 A;  2WPQ A;  4BY9 D;  3UIA A;  1HGZ A;  1X8Y A;  1KZU B;  1T3J A;  3EFG A;  4IFD K;  2W6A A;  1YTZ T;  2H7H A;  2QA4 F;  4DZO A;  1LT9 B;  1H89 A;  3OBY A;  3NXS A;  2XKM A;  3A3Y B;  2E43 A;  2HPC B;  1N7S B;  4KHX A;  4GT1 A;  2R3C A;  3KQG A;  2OYI B;  1Q82 H;  1PFI A;  5G4U C;  5CHX A;  3A5T A;  2HPC A;  1LTT C;  1FZF A;  1W40 A;  1VQN F;  1FOS E;  1T3U A;  2WPS A;  1JTH A;  1M1J C;  1RLG A;  2Q5U A;  4C7R A;  1W42 A;  3N4X A;  1GZ0 A;  3JAM M;  4WBA A;  4M3L A;  1N7S C;  3RA5 A;  5KTB A;  3CME F;  2J58 A;  2GUV A;  2N1T D;  3RA6 A;  4DOJ A;  4C4W C;  3P8M C;  3M0D A;  2OYI A;  5APY A;  3NMU C;  3M9B A;  3V2P A;  1M1J B;  3H6P A;  2WTY A;  1NO4 A;  3L37 A;  4LC1 A;  5HXZ A;  4Y99 B;  2OHW A;  2Z5I A;  2ZXE B;  1KD1 H;  3N7N A;  1ZLL A;  3VMY A;  5GIN C;  1CSB A;  1QVF F;  1GD2 E;  1JY2 P;  3SIV A;  3NVI B;  1L4A C;  1YJN F;  4N3Y B;  3VN0 A;  3IR9 A;  4RES B;  5AW0 B;  4W7Y A;  1RF1 A;  3VI6 A;  2AIF A;  5AVX B;  3A7O A;  3HD7 A;  1N7S D;  1YJ9 F;  1G1I A;  3MUD A;  4I6M C;  3O8Z A;  1OXZ A;  1IJD B;  3FFM A;  5EWR A;  3CLQ A;  1JY3 O;  3CCJ F;  1W2B F;  1SDS A;  3H32 A;  1JY3 N;  3VMX A;  2HOD A;  3L36 A;  5AW7 B;  1JOC A;  2P7J A;  1FJK A;  1NTM K;  3OW2 F;  3P7K A;  3V7Q A;  1Z56 A;  1NKZ B;  3AGK A;  3CC2 F;  2PAJ A;  1S72 F;  2E42 A;  1XTC C;  1IFD A;  1H8A A;  5AVS B;  2YKP A;  3D00 A;  1QVG F;  2C9L Y;  1ZR2 A;  1SFC D;  1GL2 A;  2XU6 A;  5CCG D;  1NMU B;  1GU5 A;  2F9Z C;  3II6 A;  1MZ9 A;  2W6B A;  2KB7 P;  1SQV K;  4WY4 B;  1LWU A;  3BRT B;  3C9I A;  5AVV B;  3G3Z A;  4LLH A;  1VQO F;  4AYC A;  4EI7 A;  5AW9 B;  1J2J B;  3HUS C;  1X79 B;  3LW5 H;  1H7M A;  1T8Z A;  3HE5 B;  3LID A;  1DH3 A;  1HGV A;  2A45 G;  2Q9I A;  2IFM A;  1URQ D;  2I1K A;  1RF0 C;  2FGY A;  2HG5 D;  1ZR4 A;  2J59 M;  1VQ4 F;  2Q7C A;  1RE3 A;  4IFF A;  3LIE A;  3TNU B;  1MV8 A;  5AW6 B;  4N78 D;  3R2P A;  1LTJ B;  4WY4 C;  3HTK B;  4NQ3 A;  1EQ7 A;  1T2K D;  5HY4 A;  4JF7 A;  3PAF A;  5CCG C;  4NUT A;  3VP9 A;  2OAR A;  2A45 H;  4BVT A;  1LTJ A;  3HUS B;  3VYI A;  1JMM A;  5GAN K;  4I1L A;  1L4A D;  2FC3 A;  3CCU F;  5APQ A;  2ALE A;  3CG6 A;  1X7O A;  3O85 A;  2WWW A;  1L0L K;  3U1C A;  1HWT C;  1NTZ K;  1IPA A;  2FFD A;  2BAS A;  5APX A;  1J1D C;  1YTZ I;  3SIU A;  2HVY D;  1KIL A;  4TZZ A;  2VGM A;  1SVF A;  3CPW F;  1CI6 B;  4WY4 D;  5FJ4 C;  4BVQ A;  4LGD E;  3MIW A;  1NU1 K;  4N78 E;  2WSC H;  1VQK F;  1LT9 A;  2WAL A;  2O1K A;  1MFZ A;  2A45 I;  4WY4 A;  3WMM 0;  3A2A A;  2VRS A;  3JCM M;  1LTI C;  2R5D A;  2BO1 A;  3TK1 A;  3G71 F;  1VQ9 F;  2H8P D;  5CCH A;  5GIP C;  3M0D C;  2WZ7 A;  3CC4 F;  3B5N C;  1AFO A;  3RK3 D;  4X3M A;  3OA7 A;  4ZKP A;  2OYH A;  1SLQ A;  2POH A;  3G6E F;  3CCL F;  1VQ6 F;  4Y99 C;  1W3E X;  1JUN A;  3OJA B;  3ON1 A;  3M06 A;  1WRG A;  2IPP A;  1W41 A;  1X9V A;  1CK2 A;  3GYQ A;  2VGN A;  2OTL F;  5AVQ B;  3HE4 B;  2LBW A;  3HAX D;  2HOD B;  3HE4 A;  5HWE A;  4HYT B;  4X3L A;  1L4A B;  2O01 H;  2P67 A;  1GU4 A;  2FFD C;  3VMZ A;  2FYZ A;  4C7N B;  1FZE A;  3HJW C;  1S9K E;  1NWQ A;  1CN7 A;  3PLA C;  5AVR B;  1XBI A;  1KQL A;  2OYH B;  3J80 M;  5HXU A;  1N73 B;  2FYU K;  2P1J A;  3G4S F;  3LFO A;  1HH0 A;  2JNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...