3IR9A

C-terminal domain of peptide chain release factor from methanosarcina mazei.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
162
Chain Sequence
AYTDESGLSELVNAAGEKLQDLELMGQKNAVRDFFKELIADSGKVAYGESQVRANLEINSVDVLLLSEDLRAERVTTKCSVCGYENKWTRRWKPPAPAAGNCPKCGSSLEVTDVTDIVDEFSELADKSNAKVVFVSTDFDEGSQLMNAFGGIAAILRYNTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
molecule keywords Peptide chain release factor subunit 1
total genus 48
structure length 162
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ir9A01
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ir9A02
3SWFA 5DCVA 1GO0A 5GAPK 2QI2A 1XBIA 3CXCF 3LWPC 2OZBA 1YHQF 4AUWA 2FC3A 2QEXF 3V5BA 3TK1A 1GK4A 1VQPF 2P67A 1GZLA 1NJIH 3JCMM 4LC1A 1K8AH 1J2JB 3A3YB 1M1KH 3M0AA 4TZZA 5GINC 2QA4F 3NK6A 2WPSA 4LCKA 3J81M 1YI2F 2P7JA 1YYCA 3NTNA 5APXA 2E42A 3TYYA 1X52A 3CCEF 1G2CB 1W2BF 3LWQC 2W27A 5AW7B 4GKGA 1CSBA 2C9NY 2XU6A 2LBXA 2W6AA 4X3MA 2KG4A 2WT7B 3O8ZA 5AW1B 3TNUA 3LWVC 5G4UC 1K73H 1YIJF 4RESB 3CCMF 1QVGF 1SP4A 4JYCA 5APTA 2WT7A 3RA5A 3V4QA 4DZOA 3CCSF 2WPRA 2OTLF 1JNMA 1E7KA 2ZXEB 2YNYA 4KHXA 3VMXA 1W40A 1NMUB 3HE5A 5AW9B 1VQ8F 3MGNA 5FLXM 3M91A 1SDSA 3CC4F 5GANK 3HE5B 1T0KB 3HAXD 3CC2F 3JAMM 5APUA 3A7OA 3CD6F 3P7KA 1Q7YH 3LFOA 3NK7A 2N9BA 2HVYD 3V7QA 3A5TA 3M9HA 5AVYB 1X7OA 3OBWA 3G6EF 3L37A 2Z5IA 5IT9M 1S9KE 1ZWZA 4I6MC 4I2LC 3GYQA 2LBWA 3LWRC 1GTWA 1YITF 5AW4B 5AVSB 3L35A 5AW2B 3IR9A 2AIFA 4BY9D 4JYBA 1KD1H 2JNBA 3V7EA 2IPPA 3N4ZA 5G4VC 4AQRD 4BW0B 1GU4A 1JUNA 5APVA 4B86A 3M06A 1CN7A 1DH3A 5AVWB 2KP8A 3NVIB 1VQNF 2I6DA 1SLQA 1VQ9F 3V4WA 3CCJF 3CPWF 1Q81H 4HYTB 2C9LY 3CPQA 1VQKF 1CI6A 3G71F 1S72F 3VMYA 1H89A 3CC7F 2R3CA 5APYA 1FOSE 1RLGA 5AVVB 1RA4A 3KQGA 2KTUA 1HUCA 1A02J 3VMZA 2YO3A 3VTPC 3VYIA 2ALEA 3I56F 3T97A 1T2KD 3G4SF 3J7AR 5AVTB 4M3LA 1HBWA 3CCQF 1GD2E 2VRSA 1QVFF 5AVQB 5A2QM 3NVKE 3VMFB 5EO3A 1Q82H 5GIPC 1HJBA 5FJ4C 1PXWA 1GK6A 4C7NB 3P32A 3CCUF 1VQ7F 2R5DA 3M9BA 2R32A 3NMUC 1S9KD 2CZWA 2BO1A 1IPAA 1VQ6F 1W3EX 4C46A 5APQA 1MFZA 3LIDA 2Q3IA 1GZ0A 1X8YA 3RA6A 3CCVF 1HWTC 3PAFA 1YJ9F 3LIEA 2WWWA 1YJNF 2H7HA 1N8RH 1T2KC 5EWRA 3PLAC 3AGKA 1W41A 2OHWA 3B8EB 3N4YA 2JJLA 2R5BA 3CG6A 3SIUA 2OTJF 3LWOC 3NXSA 5AW0B 1OXZA 1KQSF 2QM7A 3UIAA 5AW8B 3J80M 1H88A 3SIVA 3HE4B 3OAKA 4XE5B 3L36A 1NAFA 1IO4A 3P8MC 1DT9A 4AYCA 3ON1A 1FOSF 3MCAB 3O85A 2P2UA 2XZRA 3VN0A 1VQOF 3WXMB 3NMDA 3MD0A 1VQ5F 3I55F 1FAVA 1X7PA 3KDPB 3OBYA 4X3LA 1VQLF 1MUUA 2VGMA 1KC8H 1CI6B 3HE4A 2Z5HA 1YJWF 3FFMA 1A02F 5APWA 2ZFCA 5AW3B 3NFQA 5AW5B 3HJWC 1W42A 1VQ4F 5CMZA 2BASA 3CMEF 1VQMF 3TNUB 3VI6A 2XV5A 1Q86H 2QM8A 1H8AA 5APSA 3CCLF 1CZQA 5AVZB 3HTKA 2WALA 5AW6B 2YO2A 5AVXB 3CCRF 2VGNA 2Q5UA 3CMAF 1K9MH 1CK2A 2KTVA 1OWAA 3I5CA 4NUTA 1H7MA 4C4WC 1M90H 4EOTA 4GT1A 5AVUB 3A2AA 2WTYA 1KQLA 5AVRB 2E43A 5GIOC 1GO1A 1JJ2F 3E1YA 1MV8A 3E20B 1GU5A 4C7NA 3M0DA 2Q7CA 1NWQA 3OW2F 2WPQA
chains in the Genus database with same CATH superfamily
5DCVA 3BRTB 3KIZA 4I4TA 1LT9C 4BVTA 3IFMA 1LWUA 3LWPC 2B87A 2B88A 4AUWA 3VIUA 4WY4B 1QL2A 4EI7A 2O1KA 1M90Q 2XDJA 2H88C 2K9JA 2P67A 1ZMEC 2QTPA 2IBZE 1LP1B 1PPJD 2GVIA 3G3ZA 1AV1A 3HKCB 3L73D 3VYSC 2A06E 3MCQA 2A45H 1YHQP 2ZODA 3OW2O 4PD4E 4LCKA 1URQC 3J81M 1YI2F 2D2CC 2FYZA 2WMMA 2YKQA 2W6JH 4YJ2A 3H1ID 2E42A 3AE9C 1KFMA 4O4HA 3TYYA 2B87B 1G2CB 1W2BF 5BU5A 4JPZB 3JALB 1LWUB 2JWAA 1IFMA 4TV8A 2XU6A 2H8EA 3FD6A 3WPWA 2QJKC 4IL6H 1SQQG 2M0BA 1T3UA 1BGYD 2HPCB 1RF1A 1NTME 1SQVD 4C82A 3D54A 3Q5RA 1NU1K 3JAWA 3WJPA 1JMBA 4RESB 2RB9A 3MHVA 3TGUE 3HKCA 5CJ4A 5B66H 2Y9YA 5APTA 2WT7A 3B4SA 4QMAA 3RA5A 1YI2P 3L72J 3USSA 2P1JA 5EB0A 2ZYGA 3HKBA 3PTZA 2PRRA 1EZVD 1NMUB 1N73C 5AW9B 4U3FE 2AIZP 3H6PA 4X20B 3M91A 3CWBE 3CC4F 3H32A 1BDDA 2KSEA 1LJ2A 4I4TB 3F6MA 1LTJC 2IBZG 2HODB 3L74G 3A7OA 3CD6F 4G4YA 1W59A 3P7KA 1IV2A 2KS1B 3A0BH 2OARA 2EWCA 3V7QA 4ZK7A 1JY3N 1S2EA 3H1HG 2NPSB 2YMYA 3CCSP 3BASA 1GW3A 2P10A 5KLVG 2Q1XA 1X79B 2IZ1A 1IFDA 3SWYA 3SWKA 1LNQA 4BRYB 2N1TB 2RMZA 1BE3D 4N3YB 2NMUA 1NYHA 5TISE 3RYIB 2CWJA 4DRXB 2J5UA 2NZ2A 1U40A 3L72D 3L35A 3D70A 1FZFA 4LNUB 3CCQP 1AA0A 2YKOA 1NJIQ 3IR9A 2OYHA 4BY9D 3JCUE 5GTIE 4JYBA 1KORA 3V2QA 1KD1H 3RL0g 2BTUA 2J59M 1N7SD 3G71P 2IPPA 2CHSA 1SS1A 1PGPA 5G4VC 2WSFJ 4AQRD 1GU4A 5APVA 1T8ZA 5AVWB 3VYTC 2QVAA 1JY2P 1EQ7A 1OVVA 2I6DA 3V4WA 2YIUC 3CPWF 1KN7A 4HYTB 1LTIC 2W6BA 3RK2C 1WRGA 1PP9D 1JD1A 3V4DA 1S5LX 5GTHH 3VMYA 1L4AA 3G71F 3D71A 3CC7F 1FOSE 2Q1KA 5AVVB 1NTKD 2QSIA 3KQGA 2YYEA 1BCCD 3BRVB 2IFMA 2WITA 2IBZI 1FFXB 4ZHWA 4G88A 3FBAA 1M7LA 3GF3A 4F6RB 1JB0J 2H8PD 1SFCD 3G4SF 3PRJA 4EB6A 5AVTB 1J1DC 5KJ7C 2WSFH 2ZT9C 1PZQA 3H1KG 1ZRTE 1UIXA 1DD3A 3L73J 2AEFA 3II6A 3F5HA 2HP0B 2BCCG 3CX5D 1U3LA 1Q82H 1ZR2A 1LTBC 3CI9A 1PXWA 2ZAEB 3CCUF 5MN5A 1L4AB 2QJPC 3BCCG 2DT4A 2R32A 1JFFA 1KILC 2ZOVA 3VTIC 3A0HH 3A0HE 4OWFA 2PFXA 4BVSA 4GOFA 4I55B 4D6TD 4O9BA 3S02A 4C46A 2CHTA 1T0AA 1GDTA 1PIXA 2KGWA 5APQA 1P84I 4WY4D 3AEEC 4RQOA 1MFZA 5J2UA 2BEZF 2E76C 1X8YA 4TT3H 1GL2B 3PAFA 3C9UA 3RYFA 2OQQA 2OYHB 2RHLA 3LIEA 5E79E 2KZJA 2IBZD 1QEXA 1N8RH 3KJKA 3Q1MA 2UYJA 5EWRA 1SQXD 3CWBD 3GTZA 3RK3B 3EQ2A 4WBNB 1TUBB 4C81A 2HS3A 2M8RA 1H48A 3L73G 1UI9A 1NTMG 4O4IB 3CG6A 1SQVG 1RF1B 1XRGA 4H44D 3SIUA 2OTJF 4R4LA 2E76D 4M8IA 5AW8B 4U3JB 1N7LA 1SQBE 3HE4B 3E1RA 1J1EC 2E74D 4XE5B 2OYIB 4NPEA 3AE8C 5HP7A 1DT9A 3ON1A 4O4HB 1LT9A 3L74D 1Q81Q 1FOSF 2C0WA 1KYOE 3C9SA 3MCAB 3Q5SA 2PP6A 2IFNA 2KNCA 2XZRA 5KMGB 3VN0A 3TGUD 3VO8A 1G1JA 1EDKA 1UIIA 1X22A 3MD0A 1IFJA 3IF4A 3KDPB 4X3LA 3L74E 3C9IA 2WPVB 5KLVD 3O6QA 3F0FA 2QRXA 3JAKB 1SQXE 1VF5B 1CI6B 3G9RA 1YJWF 1BE3G 4RKUJ 1OVUA 1NU1G 5AW5B 1NU1J 2Z01A 1NTKG 1NO4A 1Q8RA 1VQ4F 2IYOA 4A7PA 2XKMA 2BASA 3CMEF 4ASWA 4IHJB 4GDOA 3MP7B 2RHOA 3ERNA 1M1JA 1SQBD 1NKZB 1BGYJ 1Q2NA 2I6RA 2QM8A 2R44A 1KYOI 3H1KJ 1HTLC 1LT9B 1VQ5P 3HTKA 1VQLP 1H0TB 1GW4A 5H2FH 4C4WC 3I5CA 3SFEC 1M90H 3HKBB 1NH4A 2V7QJ 1W5CE 1J7HA 1RE3A 5LA6A 1N7SC 1KQLA 1T3JA 2B33A 5AVRB 2GZLA 3AE3C 4U3FD 1NTKK 3K12A 2E43A 3Q5PA 1IJDB 4O4IA 1ZW0A 3JSVC 2FYUK 1LGHB 2QE7H 1KC8Q 2D2CB 3GHGC 3H1KD 3K0TA 1QD9A 3OW2F 2YXZA 3CCEP 3L72G 3HUSB 5IYZB 2I1JA 5KAFE 3S0YA 1KB9H 2OZBA 4C7RA 5J2TB 4ZI7B 1X0TA 3JASB 2FC3A 5HWEA 3JALA 1GK4A 2W83C 2WVRA 1VQPF 1GZLA 2NRGA 1COMA 1NJIH 3JCMM 2P58A 4LC1A 5CCGA 1JY2O 4LLHA 3P0ZA 1SA0B 3IKEA 4W7ZA 3GHGA 4K35A 1BE3J 2JDIH 3HD7B 4TZZA 5GINC 4JBZA 2QA4F 3S0HA 4B5CA 2IZ0A 2W8ZA 4PD4H 1QAHA 1FZAA 1YYCA 1ZN5A 4ZHVA 2HLOA 2HX0A 3V2PA 2W8BC 2I8DA 4JF7A 3LWQC 3E22A 4HJGH 2W27A 2E75D 2OTLP 1AFOA 2K1SA 2O1JA 3AE1C 4ZHQA 1U3PA 3CWBJ 2C9NY 2V7QH 1X25A 4UB6H 4PJ0E 1KB9D 1OZHA 3AEDC 4X3MA 1IFPA 2QJYC 1SQPG 2UYNB 2CPSA 2E74B 2D2CD 4G4WA 2ZVNB 4NPFX 3TNUA 2A06D 3IAOA 1QU9A 3LWVC 3P4EA 5G4UC 4DXDA 1HVVA 4L73A 3F89A 3CCMF 2HFED 3L70E 1PPJE 3R0PA 1U57A 2HPCA 2E75C 2QA4P 1Q7YQ 4YPCA 2FXPA 2FY8A 3H1LD 1JNMA 3BVHA 2ZXEB 2F9ZC 2N1TC 1SQBG 3IMPA 1OFUA 5HY1A 2Z1TA 4YJ3B 3VOBA 3RK3D 1MKMA 1W40A 1L0LG 3HE5A 4DJGA 3EFGA 5C8YB 1BSNA 5FLXM 2I1KA 1AJYA 5GANK 2K37A 3Q3DA 4O4JB 2OTMA 1SQPE 3CC2F 1PGQA 5DJTB 1OAPA 1Q7YH 3CWBG 3LFOA 3NK7A 2N9BA 2HVYD 3C1LA 2UYPA 1JCCA 1NTMD 1VQ8P 1KB9E 2BCCJ 1IK9A 4NQ3A 2NPSA 2VAMA 4ZOLB 3AE5C 1ZWZA 3CC2P 1PGJA 3JAWB 4I2LC 1DEEG 2POHA 3P10A 1AVOA 4B62A 4N78D 1FS0E 2SPZA 3EWKA 2B9BA 3G6EP 3S06A 4JQ0D 2ZVYA 5JH7A 1M1JB 1SQBJ 2G8YA 2YKPA 3N4ZA 1LTTC 3HTNA 1GMJA 1MZ9A 4BW0B 4OH8B 4B86A 2VAWA 5EIBD 1RF0A 1DH3A 3RYHB 2N1TA 4ZOLA 5EYPB 3L70G 4TUYB 1VQ9F 4ERHA 3CCJF 3RYHA 3GMAA 4UB8H 2WSCH 4TV9A 3KHNA 3S1KA 1XHOA 1JY3P 4BT3A 1CI6A 1TUBA 1S72F 1YITP 1RLGA 3ZDMA 2KTUA 3CL3D 3FX0A 2BEQD 4NWOB 1A02J 1ZR4A 1RQUA 4PD4D 2KI7B 3KXDA 1HGVA 2N1TD 5CCHD 3H1IG 1ZLLA 4PV1B 3T97A 4O4LB 1N73A 1QLED 2LXCB 1D7MA 3JVHA 4XA4A 1GL2C 3C9TA 3VYUC 4UB8E 1HGZA 3H1JD 3GLMA 4Y28J 4EDFA 1AVYA 5KLVJ 4BT6A 5AVQB 5A2QM 3NVKE 1BGYG 3RL0C 5EO3A 5KAIE 3HTKB 1XV2A 1HJBA 4R40B 3WGKA 5KX5B 5FJ4C 1QVGO 1TU3F 1GK6A 2R6R1 3ZOPA 3BCCJ 3V3TA 1KILD 2LXBA 1NTZE 1N86A 1OW7A 3KHUA 3BATA 2ZVZA 3NMUC 2BCCE 4TV9B 1PV3A 3DC2A 3RYCA 3I3FA 1VQ6F 3L71G 5TISH 1W3EX 1URQD 3LDTA 1RQVA 1RF0C 3LIDA 1BCCE 3RA6A 1K73Q 1JCDA 3CCVF 3MBMA 2M3EA 2A06G 1YJ9F 1Z56A 4F6RA 2WWWA 1P84E 3WUUA 2WSEH 3CCUP 1URQA 3GF7A 2Q1YA 2R3SA 5KLIB 3PLAC 4YJ2B 1W41A 1RE4C 5LP6C 3JATB 2VXYA 2OHWA 4OGQC 3B8EB 3SFDC 3N4YA 3I7TA 1E5WA 2JJLA 3AEBC 1SA0A 2R5BA 1FJKA 1NTZK 2UYNA 3AE7C 3L75D 1JTHB 3LWOC 1KZUB 3WGNA 3FXEA 5AW0B 4FFBA 1YJNP 2QM7A 2H89C 3UIAA 3Q8HA 4PJ0H 1USEA 3J80M 2WSEJ 5KTBA 1H88A 1LT1A 2LKMA 2FYUJ 3L36A 1NAFA 3P8CD 1BE3E 2WSSH 1BCCJ 3E22B 1NTKJ 5BMVA 2YMKA 2M5AA 3S9OA 2BTOA 2FYNC 3K14A 5C8YA 1YQ3C 3S0WA 1L0NG 1FZBA 5KLVK 3CXHE 3ZP7A 1SQPJ 3AECC 2L26A 4TV8B 3I55F 1IC2A 2CK3H 3OBYA 4H13B 1VQLF 2OTJP 5K5GB 2FXMA 4O2AB 1AQ5A 1KC8H 5CA1A 4H0LD 1Z5WA 3CYQA 1S5LH 1N2DC 2KLUA 1W55A 1FJPA 2FKWB 5KJ7D 1A02F 1JO5A 3NFQA 3HJWC 1JY3O 1W42A 1FE6A 2RHJA 3RK2D 5CMZA 2UZHA 1DBFA 3TNUB 1JFFB 3MUDA 2XNXA 1SQXK 3M84A 3VI6A 3WUTA 1NTZD 5C39A 2B89A 3V2NA 3A0BE 1PL5A 1LP1A 5APSA 1CZQA 5AVZB 1Y8AA 3RYIA 1FDMA 3H1JG 3HKEA 3CCRF 2AMTA 1K8AQ 2VGNA 3CMAF 4ZHQB 4GIFA 2CSLA 4DRXA 3MIWA 2KIKA 3AE6C 1ZV8A 1NHLA 4GT1A 1ZXGA 4KWEA 1CW5A 5EZYB 3A2AA 4X1KB 2K88A 3BYQA 2WTYA 3M9QA 1DIPA 2OYOA 1SQQK 1ZRTD 3HD7C 1Q82Q 1PFIA 1NQ3A 2O01H 1JJ2F 5KX5A 3VMAA 1U7MA 1NTMJ 2AXCA 3D00A 3MDOA 3QWOC 1RE4A 1NWQA 4B45A 3SWFA 4IL6X 3KZIE 5CCGC 5GAPK 4HKZH 1W2EA 4H0LB 3L4FA 1OX3A 1YHQF 5IYZA 2DYYA 1Q90D 1S4XA 1YGYA 1NGMB 3FD5A 3V5BA 2IG8A 5KJ7A 1FDOA 2QJYB 4EB6B 5CHXA 1OFCX 4LNUA 4FFBB 3RYCB 3IN6A 3A3YB 4I7ZB 1YQ4C 3GG2A 3MZWB 3U59A 4RO0A 2C0XA 1S3JA 1OMIA 1JY8A 3M1XA 4X1IB 2LR2A 4ZMDA 5HXUA 1RY3A 2MJZA 1KYOH 1JMMA 5APXA 1VK3A 2V9YA 2RKLA 1KD1Q 1X52A 3KPEA 3KZIH 1GL2D 1VH8A 2KS1A 1L0LK 5MN6A 3JASA 1N73B 4WY4C 4O4LA 2H43A 1ONIA 2FGYA 1VQ9P 2LBXA 1VF5D 1L0LJ 2IYPA 2JP3A 3CD6P 4C8IA 4Z1MH 2BCCD 2R751 5AW1B 4I1LA 1YIJF 2Z1EA 1M56D 1W5AA 2Z1FA 2L91A 1XTCC 3FGAD 2N48A 2ZT9D 5B8FA 3N7NA 2DW3A 2JR8A 3K5BA 5LYJB 2GA1A 3JAKA 4D6TE 2OTLF 2K9JB 1W57A 2YNYA 1NAYA 3L71E 3B71A 3CB2A 4NPDA 3VMXA 4KT0J 1HH0A 3CXHH 1SFCA 2HR3A 5L8RJ 1PP9E 2CPBA 4I50A 2KYVA 3PH0A 2GUVA 2QJKB 4X1YB 1SDSA 1R8EA 5CB4A 2ZVOB 1E79H 3T80A 3HE5B 3HAXD 5CB4B 1G1IA 1EXIA 3T97B 4YJ3A 2A45G 5APUA 2N9YB 1TVKB 3PLNA 1RLUA 2J58A 1USDA 5JCOA 4WVZA 3A5TA 5LOVA 2HYNA 3M9HA 2QEXP 1QGKB 5AVYB 3L75G 4U3FG 1L0NK 5LYJA 1KQFB 1EXJA 2K3RA 4WBNA 2LBTA 1SQPK 3CCVP 4ZNCA 4L74A 1W5BA 1NKNA 3L75E 3GYQA 3V2RA 3U0OA 3LWRC 4C8GA 1YITF 5AW4B 1QX8A 3HKEB 4C8EA 5AW2B 1LTJA 3QHDA 4ASVA 1IFNA 2Y0CA 3FPIA 2JNBA 1L0ND 2ZT9B 3V7EA 3N2KA 1BDCA 5KLVE 3WJRA 2JWDA 3WU2H 1JUNA 4EIJA 3M06A 1CN7A 4H44B 4IIJB 2IDBA 3NVIB 2K1AA 1VQNF 1SLQA 4N6JA 1VQ7P 2YXQB 2C9LY 4IIJA 3CPQA 3WMM0 4ZHYB 2GM4A 4BT2A 2UYKA 2QJPB 5APYA 2WZ7A 1IV4A 1HUCA 4HNAA 1LTSC 3VMZA 1VQVA 2YO3A 1FZGA 2Y0EA 3RBXA 3VYIA 2UWJE 4XFJA 1T2KD 1JOCA 1OW6A 1NU1E 3RK3E 4M3LA 5IJ9B 3CCQF 2HP3A 3D6ZA 3HWUA 4W80A 2PGDA 1GD2E 4BT5A 2VRSA 3H1HE 1QVFF 3RGUA 4IFFA 3VMFB 5J2UB 3E7KA 5CCGD 2W90A 3FXDA 2YIUB 3G4SP 5HXZA 5LP6B 4C7NB 3M4SA 1VQ7F 2R5DA 3M9BA 3KJJA 5TJHA 5KAIH 4HNAB 1RF1C 1NTZJ 3CC7P 1GX1A 4RHAA 3P8CE 1S9KD 1IPAA 2E5TA 1W2BO 2FYUE 2FFDA 4X20A 3L74J 2QIWA 2Z4EA 3RL0D 3SSUA 1VHAA 2GUSA 3L75J 5CA1B 2IAFA 4N78E 5KKZB 2OYIC 1NTKE 2Q3IA 1L0LD 3RBZA 1GZ0A 2FYUG 5HY2A 2CVLA 1HWTC 4EI8A 4U3JA 2FYNB 2O01J 2H7HA 5ITZA 1T2KC 2HG5D 3WGJA 1RH5B 4Y99B 5B66E 4IHJA 5BVZA 2GLZA 4KJMA 2IX7C 4WWIA 1VF5C 4PD4I 1P84D 1FSZA 1FZCA 1T6AA 1SQQJ 4ZKUA 1KQSF 1VL2A 3B5NC 3SIVA 1RE3C 3LW5H 1EC5A 1OIPA 4G4XA 3P8MC 4XCQA 1S72P 2E76B 4AYCA 3CLQA 2Y9ZA 1QL1A 2ZXXA 2Q9IA 2LCAA 2KUBA 2OYHC 2G3AA 3HKDA 3N2GB 2RH0A 1YJWP 3CX5I 1KMIZ 3WXMB 3FWLA 1FU1A 2M5AB 1KTMA 1FAVA 1SFCC 1X7PA 1MUUA 3EFFK 3OJAB 1DD4A 3WJQA 3L7QA 1VDFA 3F0GA 2JEEA 5EYPA 1RHZB 2H8CA 3B5NA 5APWA 2ZFCA 5AW3B 1W5EA 3H1KE 1J1EB 4W7YA 3H1LG 1VQMF 2HS0A 3GHGB 5EIBC 2K9YA 1Q86H 1M57D 3B5ND 4O2BA 2YO2A 3KYQA 5AVXB 4H0LC 4HB1A 3L70D 2ZYAA 4I50B 5GONB 2IQQA 1OWAA 1H7MA 1PGOA 1X9VA 4BVQA 2OYIA 5AVUB 1YJ9P 1L2PA 1SZQA 4IFMA 1EDIA 3QUWA 5HP8A 3HUSA 2XNDH 5CBOA 4O2AA 1NVOA 3HD7D 2H6LA 3JCUH 5LXTA 3GHZA 1EZVE 4I7ZC 1OVRA 4IOIH 4UB6E 3O6QB 1SQQE 2MQEA 1M1KQ 1VQ4P 3CMEP 1GU5A 1JY2N 3CCLP 2Q7CA 1VQPP 1YTZI 5BU8B 1SP4A 2HP0A 5B5EH 2HS4A 1MFTA 2AEJA 5DJUB 1EDJA 5LA6B 3BCCE 1GO0A 5IJ0A 3DDNA 2KNCB 4PWTA 4TUYA 5KMGA 3CMAP 2QI2A 1Z5VA 1XBIA 3D01A 1HF9A 2QG4A 3CXCF 3JARA 1FC2C 4WY4A 3LYBA 3AE2C 2L5GB 1BSHA 1SQVE 2QEXF 3TK1A 3W67A 3ESJA 5JH7B 1QVFO 1K8AH 1N7SB 1J2JB 2FFDC 1SQBK 1WT6A 1KILA 4YTPC 4YXWH 2P6YA 5CJ0A 2JKVA 1FZCB 1EZVI 1M1KH 3TD4A 1YTZT 3M0AA 3JATA 3HRNA 3S03A 3PJSK 2KXPB 2ZJSE 3PHLA 4RJTA 2O3JA 3NK6A 5EB1B 2WPSA 1OW8A 2P7JA 1YIJP 2E75B 4G4VA 3BCCD 3LW5J 3QH9A 2ITAA 3HUSC 3NTNA 3UT5B 1KNJA 4YXDC 5JQGB 3CCEF 1U7JA 3JARB 3WGMA 5AW7B 4DT0A 3CCMP 5JQGA 4R4MA 4GKGA 1CSBA 4D6TG 2ZAUA 1SQXG 2W6AA 3TGUG 2KG4A 2WT7B 3O8ZA 5CA0A 5HY4A 1K73H 1JEKA 3H1JJ 2FXOA 2G9IA 1QVGF 3CX5E 4JYCA 1URQB 2HRUA 1VPCA 3IEWA 4PV1D 5H2FE 1BGYE 1R1MA 1K9MQ 5MN4A 5LOVB 3V4QA 4DZOA 3CCSF 2WPRA 2A45I 2KLVA 3EORA 1E7KA 5J2TA 3W68A 2WSCJ 3L70J 4KHXA 1LWUC 3S4RA 5JCOC 2HRYA 2AXTE 3TD5A 3R2PA 4ZI7A 4O2BB 1LTGC 2FYUD 3L71J 1VQ8F 3MGNA 2MKVA 5IJ9A 3H1IE 3F0DA 1R5SA 5KAFH 4D6TJ 5AVMA 4E6EA 1T0KB 5ITZB 3Q2YA 2E74C 1M1JC 2KOGA 3JAMM 2KB7P 1DEBA 4EI2A 4WBAA 1PP9J 5LXTB 1ODEA 4H44C 3F0EA 1UFYA 4WB4A 3OA7A 1X7OA 2HQSC 3OBWA 3G6EF 3L37A 2BTQB 4I55A 2Z5IA 5IT9M 1VQNP 4DCKA 1S9KE 4I6MC 3AEAC 5B5EE 3H25A 4U7JA 1H0TA 4L75A 2LBWA 1W5FA 1NU1D 1GTWA 3CC4P 5AVSB 5E79H 4X1YA 4PV1C 3H1IJ 1KFNA 2PAJA 2AIFA 2Y0DA 3JC22 2AEMA 1KB9I 1LTJB 4K3AA 3V6IA 1FNJA 3WGLA 3H1HJ 1KILE 3VCZA 1NTMK 1IK7A 5BMVB 3CPWO 4EYYQ 4GODA 3C8LA 2KP8A 3RL0B 4IFDK 2NPSC 4U39A 4X1IA 1Q81H 4EI9A 1JN1A 1S5LE 1VQKF 1K04A 1H89A 3ELCA 2R3CA 4OGQD 1FFXA 1RA4A 3AEGC 3CXHD 3ABVC 3VTPC 4LGDE 5FNVA 3H1LE 2YXRB 5GTIH 2ALEA 3I56F 3J7AR 3CYPB 1NTZG 3WUVA 1M8OB 5KKZC 1HBWA 3H1LJ 4BVRA 3U1CA 1PPJG 2OTKE 3C8VA 1SQXJ 5GONA 2KK7A 3TD3A 1KNKA 1N8RQ 2E5YA 1VQ6P 1JM0A 3U1AA 3I56P 5GIPC 1PF5A 2Q3EA 4Y99C 3RK2B 4L76A 3P32A 3CCJP 1AQTA 1VQMP 3IKFA 5CA0B 5LP6A 1KQGB 1VQKP 1L0LE 4BRYA 1LTAC 2RN0A 3WPXA 2CZWA 5EZYA 1SQVK 1Y47A 1CLIA 2BO1A 3B5NB 1L4AD 4U3FJ 2WQYC 1ZP0C 1FNKA 2OGUA 1RQ7A 1J1DB 1HJ0A 1K05A 5M1BA 1GL2A 1SQQD 2AXTH 2JO1A 2Q6QA 3RYFB 2ZF8A 2RHHA 2CW4A 3ITKA 3IEQA 2HODA 1G2CA 3L73E 1YJNF 1IV1A 3QTYA 2KZIA 4OVNF 1KYOD 4G4ZA 1L0NJ 3AGKA 2V4HA 3M0DC 4GOEA 1RQ2A 1SFCB 1L4AC 3TF5A 3H1JE 4H13C 4TLFA 3H1HD 1S1CX 1SQPD 4MN4C 1KILB 5JVDA 1N7SA 1L0NE 2ZYDA 1ZOYC 1SQVJ 3TSIA 3NXSA 4BT7A 1OXZA 3PP5A 3ZP4A 1Y9BA 4IL6E 3TDKA 2NPSD 4X1KA 2KSJA 3VOPA 3OAKA 5EAZA 4BWNA 1IO4A 3N2KB 3N4XA 3LMEA 2Z1UA 5IJ0B 3UT5A 4H13D 1P84H 3CCRP 3WU2E 3O85A 4O4JA 1EDLA 2P2UA 3KE1A 3R4YA 1VQOF 3VP8A 3N2GA 5CCHC 5KLIC 2M3BA 3MUDC 3HKDB 3NMDA 1FDIA 1KV4A 1VQ5F 3RK3C 3HD7A 4B46A 1IV3A 1YBKA 4OGQB 3MTUE 2VGMA 2PHNA 4CPGA 5GTHE 3HE4A 2FBWC 2Z5HA 3C9RA 3FFMA 1PP9G 1YQNA 2VAPA 1FZEA 1IZNB 1BCCG 3AE4C 1TVKA 1SVFA 3CXHI 3E1IA 1U43A 3FWNA 4DOJA 1FBMA 3VOAA 1IFIA 3OONA 1EZVG 3H32B 2XV5A 5CCHA 1H8AA 1NOHA 1KQSO 3K2XA 5HY0A 3CCLF 2WALA 5FNVB 5AW6B 1XTGB 5CBNA 2Q5UA 1VQOP 1K9MH 1CK2A 2KTVA 4NUTA 3D6YA 1Q86Q 3B6NA 2PMPA 4EOTA 3CX5H 4BXLA 3I55P 3VP9A 3MQWA 4HH2A 3TGUJ 1W581 1JTHA 1R5LA 5JVDB 2FFDB 3ZO8A 3GW6A 5EFWB 3AEFC 1WMKA 1H47A 1DX7A 1FZCC 3L72E 2O01N 5GIOC 1GO1A 3E1YA 4ZKPA 3RE3A 1MV8A 3E20B 3L71D 4C7NA 4BT4A 3M0DA 2WPQA
chains in the Genus database with same CATH topology
3SWFA 3BRTB 5DCVA 3HUSB 1GO0A 5CCGC 1LT9C 4BVTA 5GAPK 2QI2A 2I1JA 3IFMA 1W2EA 1XBIA 3CXCF 1LWUA 3LWPC 3L4FA 4WY4A 2OZBA 4C7RA 2L5GB 1YHQF 4AUWA 2FC3A 5HWEA 4WY4B 1QL2A 4EI7A 2O1KA 2QEXF 3V5BA 3TK1A 1GK4A 2XDJA 5KJ7A 1VQPF 2P67A 1GZLA 1NJIH 3JCMM 4LC1A 5CHXA 5CCGA 1K8AH 1JY2O 1N7SB 4LLHA 1J2JB 2FFDC 1SQBK 1WT6A 1KILA 3G3ZA 4W7ZA 3GHGA 5CJ0A 1FZCB 3A3YB 1M1KH 1YTZT 3HD7B 3M0AA 4TZZA 3HRNA 2A45H 5GINC 2QA4F 3NK6A 3U59A 2WPSA 1URQC 2C0XA 3J81M 1YI2F 2P7JA 4LCKA 2FYZA 2YKQA 5HXUA 1RY3A 2MJZA 1FZAA 1YYCA 1JMMA 3HUSC 3NTNA 5APXA 2E42A 1ZN5A 1KFMA 2HLOA 3TYYA 1X52A 3V2PA 4JF7A 3CCEF 1G2CB 3KPEA 5BU5A 3LWQC 1W2BF 1LWUB 2W27A 1GL2D 5AW7B 1IFMA 1AFOA 2O1JA 1L0LK 4GKGA 1CSBA 1N73B 2C9NY 4WY4C 2XU6A 2H43A 2FGYA 2LBXA 2W6AA 4X3MA 1T3UA 2KG4A 2WT7B 2HPCB 1RF1A 2CPSA 3O8ZA 5AW1B 3TNUA 3LWVC 1NU1K 5G4UC 5HY4A 1HVVA 1K73H 4I1LA 1YIJF 4RESB 3CCMF 2HFED 5CJ4A 1QVGF 4JYCA 1URQB 5APTA 1XTCC 2WT7A 2HPCA 1VPCA 3RA5A 3N7NA 3V4QA 4DZOA 3CCSF 2WPRA 2A45I 2P1JA 2KLVA 2OTLF 1JNMA 3BVHA 1E7KA 2ZXEB 2YNYA 2F9ZC 2N1TC 4KHXA 1LWUC 5HY1A 3VMXA 3RK3D 1HH0A 1W40A 3R2PA 1SFCA 1NMUB 1N73C 3HE5A 1LTGC 2CPBA 5AW9B 1VQ8F 3EFGA 2KYVA 3MGNA 3H6PA 2GUVA 5FLXM 3M91A 1SDSA 2I1KA 3CC4F 3H32A 5GANK 3HE5B 1T0KB 3HAXD 1LTJC 1G1IA 1M1JC 2A45G 2HODB 2KOGA 3CC2F 3JAMM 2KB7P 1DEBA 5APUA 3A7OA 3CD6F 4WBAA 3P7KA 2J58A 1Q7YH 3LFOA 3NK7A 2N9BA 2HVYD 2OARA 3V7QA 3A5TA 1JY3N 2HYNA 1JCCA 2NPSB 3M9HA 2YMYA 4WB4A 1IK9A 3BASA 3OA7A 5AVYB 1X7OA 3OBWA 4NQ3A 3G6EF 2NPSA 3L37A 1GW3A 1L0NK 2Z5IA 5IT9M 1X79B 1IFDA 3SWYA 1S9KE 1ZWZA 4I6MC 1SQPK 2N1TB 4I2LC 1NKNA 3GYQA 4N3YB 3V2RA 2LBWA 2POHA 3LWRC 1GTWA 1YITF 5AW4B 4N78D 5AVSB 3L35A 1FZFA 5AW2B 1KFNA 1LTJA 2PAJA 2YKOA 3IR9A 2OYHA 2AIFA 4BY9D 1IFNA 4JYBA 3V2QA 1KD1H 1LTJB 2JNBA 1M1JB 2J59M 1N7SD 3V7EA 2IPPA 2YKPA 3N4ZA 1LTTC 5G4VC 1NTMK 1MZ9A 4AQRD 4BW0B 1GU4A 1JUNA 4OH8B 5APVA 4B86A 4EIJA 1T8ZA 3M06A 1CN7A 1RF0A 5AVWB 1DH3A 2KP8A 3RL0B 2N1TA 4IFDK 3NVIB 1JY2P 2NPSC 1EQ7A 1VQNF 2I6DA 1SLQA 1VQ9F 4N6JA 3V4WA 3CCJF 3CPWF 1Q81H 4HYTB 1LTIC 4EI9A 2C9LY 2W6BA 2WSCH 3RK2C 1WRGA 3CPQA 3WMM0 2GM4A 1VQKF 1JY3P 1CI6A 3G71F 1S72F 3VMYA 1L4AA 1H89A 3CC7F 2R3CA 5APYA 1FOSE 5AVVB 2WZ7A 1RA4A 1RLGA 3KQGA 2KTUA 1HUCA 3CL3D 1LTSC 3BRVB 1A02J 2IFMA 2WITA 3VMZA 2YO3A 1ZR4A 3VTPC 4LGDE 1FZGA 1HGVA 2N1TD 3VYIA 5CCHD 1ZLLA 1M7LA 2ALEA 3I56F 2H8PD 3T97A 1T2KD 1SFCD 1JOCA 3G4SF 3J7AR 1N73A 5AVTB 1J1DC 5KJ7C 2WSFH 4M3LA 1HBWA 3CCQF 3OW2F 4BVRA 3U1CA 4XA4A 1GL2C 1HGZA 4W80A 1GD2E 2VRSA 3II6A 1QVFF 5AVQB 5A2QM 4IFFA 3NVKE 3VMFB 3RL0C 5EO3A 5CCGD 3HTKB 3U1AA 1Q82H 1ZR2A 1LTBC 5GIPC 1HJBA 5HXZA 3CI9A 5FJ4C 1PXWA 4Y99C 1GK6A 3RK2B 4C7NB 1KILD 3P32A 3V3TA 3CCUF 1VQ7F 1L4AB 2R5DA 1N86A 3M9BA 3BATA 2R32A 3NMUC 1KILC 1RF1C 1LTAC 3P8CE 1S9KD 2CZWA 1SQVK 2BO1A 1IPAA 3B5NB 2FFDA 1VQ6F 4BVSA 1L4AD 1W3EX 4O9BA 2Z4EA 1URQD 3RL0D 4C46A 2GUSA 1GDTA 1J1DB 5APQA 4N78E 4WY4D 2OYIC 1GL2A 1MFZA 1RF0C 3LIDA 2Q3IA 1GZ0A 1X8YA 3RA6A 1JCDA 5HY2A 3CCVF 1GL2B 1HWTC 3PAFA 4EI8A 2OYHB 1YJ9F 1Z56A 3LIEA 2HODA 1G2CA 2WWWA 1YJNF 2H7HA 2WSEH 1N8RH 1T2KC 2HG5D 1URQA 5EWRA 3PLAC 3AGKA 4Y99B 1W41A 1RE4C 3M0DC 5BVZA 3RK3B 1SFCB 1L4AC 3EQ2A 2M8RA 2GLZA 2OHWA 2IX7C 3B8EB 3N4YA 1E5WA 2JJLA 1KILB 2R5BA 3CG6A 1N7SA 1FJKA 1NTZK 1RF1B 3SIUA 2OTJF 1FZCA 1JTHB 3LWOC 1KZUB 3TSIA 3NXSA 5AW0B 1OXZA 4ZKUA 3PP5A 1KQSF 2QM7A 3B5NC 3UIAA 5AW8B 3J80M 5KTBA 1N7LA 1H88A 3SIVA 3HE4B 1RE3C 2LKMA 2NPSD 1J1EC 2KSJA 3VOPA 3OAKA 4XE5B 3LW5H 3L36A 2OYIB 1NAFA 3P8CD 3P8MC 1IO4A 4XCQA 3N4XA 1DT9A 4AYCA 3ON1A 3CLQA 1QL1A 2Q9IA 1LT9A 2OYHC 1FOSF 2C0WA 3MCAB 2PP6A 2IFNA 3O85A 2P2UA 1FZBA 2XZRA 5KLVK 3VN0A 1VQOF 3VP8A 1G1JA 5CCHC 2M3BA 3WXMB 3NMDA 1FU1A 3MD0A 1VQ5F 3I55F 3RK3C 1FAVA 1IC2A 1SFCC 3HD7A 1IFJA 1X7PA 3KDPB 3OBYA 4X3LA 3C9IA 1VQLF 1MUUA 2FXMA 3MTUE 2VGMA 3OJAB 1AQ5A 1KC8H 1CI6B 1VDFA 3HE4A 2Z5HA 2JEEA 1YJWF 1N2DC 1FJPA 2FKWB 5KJ7D 3FFMA 3B5NA 1A02F 5APWA 2ZFCA 5AW3B 3NFQA 1JO5A 5AW5B 3HJWC 1JY3O 1W42A 1NO4A 1VQ4F 1J1EB 1FZEA 3RK2D 5CMZA 2XKMA 2BASA 3CMEF 1SVFA 4W7YA 3E1IA 1VQMF 3TNUB 4DOJA 3MUDA 1FBMA 2XNXA 1M1JA 1NKZB 1SQXK 1IFIA 3GHGB 3VI6A 3H32B 2XV5A 1Q86H 3V2NA 2QM8A 5CCHA 1H8AA 1NOHA 1HTLC 5APSA 3B5ND 1LT9B 5HY0A 3CCLF 1CZQA 5AVZB 3HTKA 2WALA 5AW6B 1XTGB 2YO2A 3KYQA 5AVXB 1FDMA 3CCRF 2VGNA 2Q5UA 1GW4A 3CMAF 1K9MH 4GIFA 1CK2A 2KTVA 1OWAA 3I5CA 3MIWA 1H7MA 4NUTA 4C4WC 1M90H 1ZV8A 1X9VA 4EOTA 1NH4A 4BVQA 1NHLA 4GT1A 3VP9A 5AVUB 2OYIA 4HH2A 1CW5A 4IFMA 1JTHA 3A2AA 1RE3A 3HUSA 1N7SC 3HD7D 1KQLA 1T3JA 3M9QA 2WTYA 2FFDB 5AVRB 1DX7A 1FZCC 1SQQK 1NTKK 3HD7C 1PFIA 2E43A 1IJDB 2O01H 5GIOC 1GO1A 1JJ2F 3E1YA 4ZKPA 1MV8A 2FYUK 3E20B 1LGHB 3D00A 1GU5A 1JY2N 3GHGC 4C7NA 1RE4A 3M0DA 2Q7CA 1NWQA 1YTZI 5BU8B 1SP4A 2WPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWF A;  5DCV A;  1GO0 A;  5GAP K;  2QI2 A;  1XBI A;  3CXC F;  3LWP C;  2OZB A;  1YHQ F;  4AUW A;  2FC3 A;  2QEX F;  3V5B A;  3TK1 A;  1GK4 A;  1VQP F;  2P67 A;  1GZL A;  1NJI H;  3JCM M;  4LC1 A;  1K8A H;  1J2J B;  3A3Y B;  1M1K H;  3M0A A;  4TZZ A;  5GIN C;  2QA4 F;  3NK6 A;  2WPS A;  4LCK A;  3J81 M;  1YI2 F;  2P7J A;  1YYC A;  3NTN A;  5APX A;  2E42 A;  3TYY A;  1X52 A;  3CCE F;  1G2C B;  1W2B F;  3LWQ C;  2W27 A;  5AW7 B;  4GKG A;  1CSB A;  2C9N Y;  2XU6 A;  2LBX A;  2W6A A;  4X3M A;  2KG4 A;  2WT7 B;  3O8Z A;  5AW1 B;  3TNU A;  3LWV C;  5G4U C;  1K73 H;  1YIJ F;  4RES B;  3CCM F;  1QVG F;  1SP4 A;  4JYC A;  5APT A;  2WT7 A;  3RA5 A;  3V4Q A;  4DZO A;  3CCS F;  2WPR A;  2OTL F;  1JNM A;  1E7K A;  2ZXE B;  2YNY A;  4KHX A;  3VMX A;  1W40 A;  1NMU B;  3HE5 A;  5AW9 B;  1VQ8 F;  3MGN A;  5FLX M;  3M91 A;  1SDS A;  3CC4 F;  5GAN K;  3HE5 B;  1T0K B;  3HAX D;  3CC2 F;  3JAM M;  5APU A;  3A7O A;  3CD6 F;  3P7K A;  1Q7Y H;  3LFO A;  3NK7 A;  2N9B A;  2HVY D;  3V7Q A;  3A5T A;  3M9H A;  5AVY B;  1X7O A;  3OBW A;  3G6E F;  3L37 A;  2Z5I A;  5IT9 M;  1S9K E;  1ZWZ A;  4I6M C;  4I2L C;  3GYQ A;  2LBW A;  3LWR C;  1GTW A;  1YIT F;  5AW4 B;  5AVS B;  3L35 A;  5AW2 B;  3IR9 A;  2AIF A;  4BY9 D;  4JYB A;  1KD1 H;  2JNB A;  3V7E A;  2IPP A;  3N4Z A;  5G4V C;  4AQR D;  4BW0 B;  1GU4 A;  1JUN A;  5APV A;  4B86 A;  3M06 A;  1CN7 A;  1DH3 A;  5AVW B;  2KP8 A;  3NVI B;  1VQN F;  2I6D A;  1SLQ A;  1VQ9 F;  3V4W A;  3CCJ F;  3CPW F;  1Q81 H;  4HYT B;  2C9L Y;  3CPQ A;  1VQK F;  1CI6 A;  3G71 F;  1S72 F;  3VMY A;  1H89 A;  3CC7 F;  2R3C A;  5APY A;  1FOS E;  1RLG A;  5AVV B;  1RA4 A;  3KQG A;  2KTU A;  1HUC A;  1A02 J;  3VMZ A;  2YO3 A;  3VTP C;  3VYI A;  2ALE A;  3I56 F;  3T97 A;  1T2K D;  3G4S F;  3J7A R;  5AVT B;  4M3L A;  1HBW A;  3CCQ F;  1GD2 E;  2VRS A;  1QVF F;  5AVQ B;  5A2Q M;  3NVK E;  3VMF B;  5EO3 A;  1Q82 H;  5GIP C;  1HJB A;  5FJ4 C;  1PXW A;  1GK6 A;  4C7N B;  3P32 A;  3CCU F;  1VQ7 F;  2R5D A;  3M9B A;  2R32 A;  3NMU C;  1S9K D;  2CZW A;  2BO1 A;  1IPA A;  1VQ6 F;  1W3E X;  4C46 A;  5APQ A;  1MFZ A;  3LID A;  2Q3I A;  1GZ0 A;  1X8Y A;  3RA6 A;  3CCV F;  1HWT C;  3PAF A;  1YJ9 F;  3LIE A;  2WWW A;  1YJN F;  2H7H A;  1N8R H;  1T2K C;  5EWR A;  3PLA C;  3AGK A;  1W41 A;  2OHW A;  3B8E B;  3N4Y A;  2JJL A;  2R5B A;  3CG6 A;  3SIU A;  2OTJ F;  3LWO C;  3NXS A;  5AW0 B;  1OXZ A;  1KQS F;  2QM7 A;  3UIA A;  5AW8 B;  3J80 M;  1H88 A;  3SIV A;  3HE4 B;  3OAK A;  4XE5 B;  3L36 A;  1NAF A;  1IO4 A;  3P8M C;  1DT9 A;  4AYC A;  3ON1 A;  1FOS F;  3MCA B;  3O85 A;  2P2U A;  2XZR A;  3VN0 A;  1VQO F;  3WXM B;  3NMD A;  3MD0 A;  1VQ5 F;  3I55 F;  1FAV A;  1X7P A;  3KDP B;  3OBY A;  4X3L A;  1VQL F;  1MUU A;  2VGM A;  1KC8 H;  1CI6 B;  3HE4 A;  2Z5H A;  1YJW F;  3FFM A;  1A02 F;  5APW A;  2ZFC A;  5AW3 B;  3NFQ A;  5AW5 B;  3HJW C;  1W42 A;  1VQ4 F;  5CMZ A;  2BAS A;  3CME F;  1VQM F;  3TNU B;  3VI6 A;  2XV5 A;  1Q86 H;  2QM8 A;  1H8A A;  5APS A;  3CCL F;  1CZQ A;  5AVZ B;  3HTK A;  2WAL A;  5AW6 B;  2YO2 A;  5AVX B;  3CCR F;  2VGN A;  2Q5U A;  3CMA F;  1K9M H;  1CK2 A;  2KTV A;  1OWA A;  3I5C A;  4NUT A;  1H7M A;  4C4W C;  1M90 H;  4EOT A;  4GT1 A;  5AVU B;  3A2A A;  2WTY A;  1KQL A;  5AVR B;  2E43 A;  5GIO C;  1GO1 A;  1JJ2 F;  3E1Y A;  1MV8 A;  3E20 B;  1GU5 A;  4C7N A;  3M0D A;  2Q7C A;  1NWQ A;  3OW2 F;  2WPQ A; 
#chains in the Genus database with same CATH topology
 5DCV A;  3BRT B;  3KIZ A;  4I4T A;  1LT9 C;  4BVT A;  3IFM A;  1LWU A;  3LWP C;  2B87 A;  2B88 A;  4AUW A;  3VIU A;  4WY4 B;  1QL2 A;  4EI7 A;  2O1K A;  1M90 Q;  2XDJ A;  2H88 C;  2K9J A;  2P67 A;  1ZME C;  2QTP A;  2IBZ E;  1LP1 B;  1PPJ D;  2GVI A;  3G3Z A;  1AV1 A;  3HKC B;  3L73 D;  3VYS C;  2A06 E;  3MCQ A;  2A45 H;  1YHQ P;  2ZOD A;  3OW2 O;  4PD4 E;  4LCK A;  1URQ C;  3J81 M;  1YI2 F;  2D2C C;  2FYZ A;  2WMM A;  2YKQ A;  2W6J H;  4YJ2 A;  3H1I D;  2E42 A;  3AE9 C;  1KFM A;  4O4H A;  3TYY A;  2B87 B;  1G2C B;  1W2B F;  5BU5 A;  4JPZ B;  3JAL B;  1LWU B;  2JWA A;  1IFM A;  4TV8 A;  2XU6 A;  2H8E A;  3FD6 A;  3WPW A;  2QJK C;  4IL6 H;  1SQQ G;  2M0B A;  1T3U A;  1BGY D;  2HPC B;  1RF1 A;  1NTM E;  1SQV D;  4C82 A;  3D54 A;  3Q5R A;  1NU1 K;  3JAW A;  3WJP A;  1JMB A;  4RES B;  2RB9 A;  3MHV A;  3TGU E;  3HKC A;  5CJ4 A;  5B66 H;  2Y9Y A;  5APT A;  2WT7 A;  3B4S A;  4QMA A;  3RA5 A;  1YI2 P;  3L72 J;  3USS A;  2P1J A;  5EB0 A;  2ZYG A;  3HKB A;  3PTZ A;  2PRR A;  1EZV D;  1NMU B;  1N73 C;  5AW9 B;  4U3F E;  2AIZ P;  3H6P A;  4X20 B;  3M91 A;  3CWB E;  3CC4 F;  3H32 A;  1BDD A;  2KSE A;  1LJ2 A;  4I4T B;  3F6M A;  1LTJ C;  2IBZ G;  2HOD B;  3L74 G;  3A7O A;  3CD6 F;  4G4Y A;  1W59 A;  3P7K A;  1IV2 A;  2KS1 B;  3A0B H;  2OAR A;  2EWC A;  3V7Q A;  4ZK7 A;  1JY3 N;  1S2E A;  3H1H G;  2NPS B;  2YMY A;  3CCS P;  3BAS A;  1GW3 A;  2P10 A;  5KLV G;  2Q1X A;  1X79 B;  2IZ1 A;  1IFD A;  3SWY A;  3SWK A;  1LNQ A;  4BRY B;  2N1T B;  2RMZ A;  1BE3 D;  4N3Y B;  2NMU A;  1NYH A;  5TIS E;  3RYI B;  2CWJ A;  4DRX B;  2J5U A;  2NZ2 A;  1U40 A;  3L72 D;  3L35 A;  3D70 A;  1FZF A;  4LNU B;  3CCQ P;  1AA0 A;  2YKO A;  1NJI Q;  3IR9 A;  2OYH A;  4BY9 D;  3JCU E;  5GTI E;  4JYB A;  1KOR A;  3V2Q A;  1KD1 H;  3RL0 g;  2BTU A;  2J59 M;  1N7S D;  3G71 P;  2IPP A;  2CHS A;  1SS1 A;  1PGP A;  5G4V C;  2WSF J;  4AQR D;  1GU4 A;  5APV A;  1T8Z A;  5AVW B;  3VYT C;  2QVA A;  1JY2 P;  1EQ7 A;  1OVV A;  2I6D A;  3V4W A;  2YIU C;  3CPW F;  1KN7 A;  4HYT B;  1LTI C;  2W6B A;  3RK2 C;  1WRG A;  1PP9 D;  1JD1 A;  3V4D A;  1S5L X;  5GTH H;  3VMY A;  1L4A A;  3G71 F;  3D71 A;  3CC7 F;  1FOS E;  2Q1K A;  5AVV B;  1NTK D;  2QSI A;  3KQG A;  2YYE A;  1BCC D;  3BRV B;  2IFM A;  2WIT A;  2IBZ I;  1FFX B;  4ZHW A;  4G88 A;  3FBA A;  1M7L A;  3GF3 A;  4F6R B;  1JB0 J;  2H8P D;  1SFC D;  3G4S F;  3PRJ A;  4EB6 A;  5AVT B;  1J1D C;  5KJ7 C;  2WSF H;  2ZT9 C;  1PZQ A;  3H1K G;  1ZRT E;  1UIX A;  1DD3 A;  3L73 J;  2AEF A;  3II6 A;  3F5H A;  2HP0 B;  2BCC G;  3CX5 D;  1U3L A;  1Q82 H;  1ZR2 A;  1LTB C;  3CI9 A;  1PXW A;  2ZAE B;  3CCU F;  5MN5 A;  1L4A B;  2QJP C;  3BCC G;  2DT4 A;  2R32 A;  1JFF A;  1KIL C;  2ZOV A;  3VTI C;  3A0H H;  3A0H E;  4OWF A;  2PFX A;  4BVS A;  4GOF A;  4I55 B;  4D6T D;  4O9B A;  3S02 A;  4C46 A;  2CHT A;  1T0A A;  1GDT A;  1PIX A;  2KGW A;  5APQ A;  1P84 I;  4WY4 D;  3AEE C;  4RQO A;  1MFZ A;  5J2U A;  2BEZ F;  2E76 C;  1X8Y A;  4TT3 H;  1GL2 B;  3PAF A;  3C9U A;  3RYF A;  2OQQ A;  2OYH B;  2RHL A;  3LIE A;  5E79 E;  2KZJ A;  2IBZ D;  1QEX A;  1N8R H;  3KJK A;  3Q1M A;  2UYJ A;  5EWR A;  1SQX D;  3CWB D;  3GTZ A;  3RK3 B;  3EQ2 A;  4WBN B;  1TUB B;  4C81 A;  2HS3 A;  2M8R A;  1H48 A;  3L73 G;  1UI9 A;  1NTM G;  4O4I B;  3CG6 A;  1SQV G;  1RF1 B;  1XRG A;  4H44 D;  3SIU A;  2OTJ F;  4R4L A;  2E76 D;  4M8I A;  5AW8 B;  4U3J B;  1N7L A;  1SQB E;  3HE4 B;  3E1R A;  1J1E C;  2E74 D;  4XE5 B;  2OYI B;  4NPE A;  3AE8 C;  5HP7 A;  1DT9 A;  3ON1 A;  4O4H B;  1LT9 A;  3L74 D;  1Q81 Q;  1FOS F;  2C0W A;  1KYO E;  3C9S A;  3MCA B;  3Q5S A;  2PP6 A;  2IFN A;  2KNC A;  2XZR A;  5KMG B;  3VN0 A;  3TGU D;  3VO8 A;  1G1J A;  1EDK A;  1UII A;  1X22 A;  3MD0 A;  1IFJ A;  3IF4 A;  3KDP B;  4X3L A;  3L74 E;  3C9I A;  2WPV B;  5KLV D;  3O6Q A;  3F0F A;  2QRX A;  3JAK B;  1SQX E;  1VF5 B;  1CI6 B;  3G9R A;  1YJW F;  1BE3 G;  4RKU J;  1OVU A;  1NU1 G;  5AW5 B;  1NU1 J;  2Z01 A;  1NTK G;  1NO4 A;  1Q8R A;  1VQ4 F;  2IYO A;  4A7P A;  2XKM A;  2BAS A;  3CME F;  4ASW A;  4IHJ B;  4GDO A;  3MP7 B;  2RHO A;  3ERN A;  1M1J A;  1SQB D;  1NKZ B;  1BGY J;  1Q2N A;  2I6R A;  2QM8 A;  2R44 A;  1KYO I;  3H1K J;  1HTL C;  1LT9 B;  1VQ5 P;  3HTK A;  1VQL P;  1H0T B;  1GW4 A;  5H2F H;  4C4W C;  3I5C A;  3SFE C;  1M90 H;  3HKB B;  1NH4 A;  2V7Q J;  1W5C E;  1J7H A;  1RE3 A;  5LA6 A;  1N7S C;  1KQL A;  1T3J A;  2B33 A;  5AVR B;  2GZL A;  3AE3 C;  4U3F D;  1NTK K;  3K12 A;  2E43 A;  3Q5P A;  1IJD B;  4O4I A;  1ZW0 A;  3JSV C;  2FYU K;  1LGH B;  2QE7 H;  1KC8 Q;  2D2C B;  3GHG C;  3H1K D;  3K0T A;  1QD9 A;  3OW2 F;  2YXZ A;  3CCE P;  3L72 G;  3HUS B;  5IYZ B;  2I1J A;  5KAF E;  3S0Y A;  1KB9 H;  2OZB A;  4C7R A;  5J2T B;  4ZI7 B;  1X0T A;  3JAS B;  2FC3 A;  5HWE A;  3JAL A;  1GK4 A;  2W83 C;  2WVR A;  1VQP F;  1GZL A;  2NRG A;  1COM A;  1NJI H;  3JCM M;  2P58 A;  4LC1 A;  5CCG A;  1JY2 O;  4LLH A;  3P0Z A;  1SA0 B;  3IKE A;  4W7Z A;  3GHG A;  4K35 A;  1BE3 J;  2JDI H;  3HD7 B;  4TZZ A;  5GIN C;  4JBZ A;  2QA4 F;  3S0H A;  4B5C A;  2IZ0 A;  2W8Z A;  4PD4 H;  1QAH A;  1FZA A;  1YYC A;  1ZN5 A;  4ZHV A;  2HLO A;  2HX0 A;  3V2P A;  2W8B C;  2I8D A;  4JF7 A;  3LWQ C;  3E22 A;  4HJG H;  2W27 A;  2E75 D;  2OTL P;  1AFO A;  2K1S A;  2O1J A;  3AE1 C;  4ZHQ A;  1U3P A;  3CWB J;  2C9N Y;  2V7Q H;  1X25 A;  4UB6 H;  4PJ0 E;  1KB9 D;  1OZH A;  3AED C;  4X3M A;  1IFP A;  2QJY C;  1SQP G;  2UYN B;  2CPS A;  2E74 B;  2D2C D;  4G4W A;  2ZVN B;  4NPF X;  3TNU A;  2A06 D;  3IAO A;  1QU9 A;  3LWV C;  3P4E A;  5G4U C;  4DXD A;  1HVV A;  4L73 A;  3F89 A;  3CCM F;  2HFE D;  3L70 E;  1PPJ E;  3R0P A;  1U57 A;  2HPC A;  2E75 C;  2QA4 P;  1Q7Y Q;  4YPC A;  2FXP A;  2FY8 A;  3H1L D;  1JNM A;  3BVH A;  2ZXE B;  2F9Z C;  2N1T C;  1SQB G;  3IMP A;  1OFU A;  5HY1 A;  2Z1T A;  4YJ3 B;  3VOB A;  3RK3 D;  1MKM A;  1W40 A;  1L0L G;  3HE5 A;  4DJG A;  3EFG A;  5C8Y B;  1BSN A;  5FLX M;  2I1K A;  1AJY A;  5GAN K;  2K37 A;  3Q3D A;  4O4J B;  2OTM A;  1SQP E;  3CC2 F;  1PGQ A;  5DJT B;  1OAP A;  1Q7Y H;  3CWB G;  3LFO A;  3NK7 A;  2N9B A;  2HVY D;  3C1L A;  2UYP A;  1JCC A;  1NTM D;  1VQ8 P;  1KB9 E;  2BCC J;  1IK9 A;  4NQ3 A;  2NPS A;  2VAM A;  4ZOL B;  3AE5 C;  1ZWZ A;  3CC2 P;  1PGJ A;  3JAW B;  4I2L C;  1DEE G;  2POH A;  3P10 A;  1AVO A;  4B62 A;  4N78 D;  1FS0 E;  2SPZ A;  3EWK A;  2B9B A;  3G6E P;  3S06 A;  4JQ0 D;  2ZVY A;  5JH7 A;  1M1J B;  1SQB J;  2G8Y A;  2YKP A;  3N4Z A;  1LTT C;  3HTN A;  1GMJ A;  1MZ9 A;  4BW0 B;  4OH8 B;  4B86 A;  2VAW A;  5EIB D;  1RF0 A;  1DH3 A;  3RYH B;  2N1T A;  4ZOL A;  5EYP B;  3L70 G;  4TUY B;  1VQ9 F;  4ERH A;  3CCJ F;  3RYH A;  3GMA A;  4UB8 H;  2WSC H;  4TV9 A;  3KHN A;  3S1K A;  1XHO A;  1JY3 P;  4BT3 A;  1CI6 A;  1TUB A;  1S72 F;  1YIT P;  1RLG A;  3ZDM A;  2KTU A;  3CL3 D;  3FX0 A;  2BEQ D;  4NWO B;  1A02 J;  1ZR4 A;  1RQU A;  4PD4 D;  2KI7 B;  3KXD A;  1HGV A;  2N1T D;  5CCH D;  3H1I G;  1ZLL A;  4PV1 B;  3T97 A;  4O4L B;  1N73 A;  1QLE D;  2LXC B;  1D7M A;  3JVH A;  4XA4 A;  1GL2 C;  3C9T A;  3VYU C;  4UB8 E;  1HGZ A;  3H1J D;  3GLM A;  4Y28 J;  4EDF A;  1AVY A;  5KLV J;  4BT6 A;  5AVQ B;  5A2Q M;  3NVK E;  1BGY G;  3RL0 C;  5EO3 A;  5KAI E;  3HTK B;  1XV2 A;  1HJB A;  4R40 B;  3WGK A;  5KX5 B;  5FJ4 C;  1QVG O;  1TU3 F;  1GK6 A;  2R6R 1;  3ZOP A;  3BCC J;  3V3T A;  1KIL D;  2LXB A;  1NTZ E;  1N86 A;  1OW7 A;  3KHU A;  3BAT A;  2ZVZ A;  3NMU C;  2BCC E;  4TV9 B;  1PV3 A;  3DC2 A;  3RYC A;  3I3F A;  1VQ6 F;  3L71 G;  5TIS H;  1W3E X;  1URQ D;  3LDT A;  1RQV A;  1RF0 C;  3LID A;  1BCC E;  3RA6 A;  1K73 Q;  1JCD A;  3CCV F;  3MBM A;  2M3E A;  2A06 G;  1YJ9 F;  1Z56 A;  4F6R A;  2WWW A;  1P84 E;  3WUU A;  2WSE H;  3CCU P;  1URQ A;  3GF7 A;  2Q1Y A;  2R3S A;  5KLI B;  3PLA C;  4YJ2 B;  1W41 A;  1RE4 C;  5LP6 C;  3JAT B;  2VXY A;  2OHW A;  4OGQ C;  3B8E B;  3SFD C;  3N4Y A;  3I7T A;  1E5W A;  2JJL A;  3AEB C;  1SA0 A;  2R5B A;  1FJK A;  1NTZ K;  2UYN A;  3AE7 C;  3L75 D;  1JTH B;  3LWO C;  1KZU B;  3WGN A;  3FXE A;  5AW0 B;  4FFB A;  1YJN P;  2QM7 A;  2H89 C;  3UIA A;  3Q8H A;  4PJ0 H;  1USE A;  3J80 M;  2WSE J;  5KTB A;  1H88 A;  1LT1 A;  2LKM A;  2FYU J;  3L36 A;  1NAF A;  3P8C D;  1BE3 E;  2WSS H;  1BCC J;  3E22 B;  1NTK J;  5BMV A;  2YMK A;  2M5A A;  3S9O A;  2BTO A;  2FYN C;  3K14 A;  5C8Y A;  1YQ3 C;  3S0W A;  1L0N G;  1FZB A;  5KLV K;  3CXH E;  3ZP7 A;  1SQP J;  3AEC C;  2L26 A;  4TV8 B;  3I55 F;  1IC2 A;  2CK3 H;  3OBY A;  4H13 B;  1VQL F;  2OTJ P;  5K5G B;  2FXM A;  4O2A B;  1AQ5 A;  1KC8 H;  5CA1 A;  4H0L D;  1Z5W A;  3CYQ A;  1S5L H;  1N2D C;  2KLU A;  1W55 A;  1FJP A;  2FKW B;  5KJ7 D;  1A02 F;  1JO5 A;  3NFQ A;  3HJW C;  1JY3 O;  1W42 A;  1FE6 A;  2RHJ A;  3RK2 D;  5CMZ A;  2UZH A;  1DBF A;  3TNU B;  1JFF B;  3MUD A;  2XNX A;  1SQX K;  3M84 A;  3VI6 A;  3WUT A;  1NTZ D;  5C39 A;  2B89 A;  3V2N A;  3A0B E;  1PL5 A;  1LP1 A;  5APS A;  1CZQ A;  5AVZ B;  1Y8A A;  3RYI A;  1FDM A;  3H1J G;  3HKE A;  3CCR F;  2AMT A;  1K8A Q;  2VGN A;  3CMA F;  4ZHQ B;  4GIF A;  2CSL A;  4DRX A;  3MIW A;  2KIK A;  3AE6 C;  1ZV8 A;  1NHL A;  4GT1 A;  1ZXG A;  4KWE A;  1CW5 A;  5EZY B;  3A2A A;  4X1K B;  2K88 A;  3BYQ A;  2WTY A;  3M9Q A;  1DIP A;  2OYO A;  1SQQ K;  1ZRT D;  3HD7 C;  1Q82 Q;  1PFI A;  1NQ3 A;  2O01 H;  1JJ2 F;  5KX5 A;  3VMA A;  1U7M A;  1NTM J;  2AXC A;  3D00 A;  3MDO A;  3QWO C;  1RE4 A;  1NWQ A;  4B45 A;  3SWF A;  4IL6 X;  3KZI E;  5CCG C;  5GAP K;  4HKZ H;  1W2E A;  4H0L B;  3L4F A;  1OX3 A;  1YHQ F;  5IYZ A;  2DYY A;  1Q90 D;  1S4X A;  1YGY A;  1NGM B;  3FD5 A;  3V5B A;  2IG8 A;  5KJ7 A;  1FDO A;  2QJY B;  4EB6 B;  5CHX A;  1OFC X;  4LNU A;  4FFB B;  3RYC B;  3IN6 A;  3A3Y B;  4I7Z B;  1YQ4 C;  3GG2 A;  3MZW B;  3U59 A;  4RO0 A;  2C0X A;  1S3J A;  1OMI A;  1JY8 A;  3M1X A;  4X1I B;  2LR2 A;  4ZMD A;  5HXU A;  1RY3 A;  2MJZ A;  1KYO H;  1JMM A;  5APX A;  1VK3 A;  2V9Y A;  2RKL A;  1KD1 Q;  1X52 A;  3KPE A;  3KZI H;  1GL2 D;  1VH8 A;  2KS1 A;  1L0L K;  5MN6 A;  3JAS A;  1N73 B;  4WY4 C;  4O4L A;  2H43 A;  1ONI A;  2FGY A;  1VQ9 P;  2LBX A;  1VF5 D;  1L0L J;  2IYP A;  2JP3 A;  3CD6 P;  4C8I A;  4Z1M H;  2BCC D;  2R75 1;  5AW1 B;  4I1L A;  1YIJ F;  2Z1E A;  1M56 D;  1W5A A;  2Z1F A;  2L91 A;  1XTC C;  3FGA D;  2N48 A;  2ZT9 D;  5B8F A;  3N7N A;  2DW3 A;  2JR8 A;  3K5B A;  5LYJ B;  2GA1 A;  3JAK A;  4D6T E;  2OTL F;  2K9J B;  1W57 A;  2YNY A;  1NAY A;  3L71 E;  3B71 A;  3CB2 A;  4NPD A;  3VMX A;  4KT0 J;  1HH0 A;  3CXH H;  1SFC A;  2HR3 A;  5L8R J;  1PP9 E;  2CPB A;  4I50 A;  2KYV A;  3PH0 A;  2GUV A;  2QJK B;  4X1Y B;  1SDS A;  1R8E A;  5CB4 A;  2ZVO B;  1E79 H;  3T80 A;  3HE5 B;  3HAX D;  5CB4 B;  1G1I A;  1EXI A;  3T97 B;  4YJ3 A;  2A45 G;  5APU A;  2N9Y B;  1TVK B;  3PLN A;  1RLU A;  2J58 A;  1USD A;  5JCO A;  4WVZ A;  3A5T A;  5LOV A;  2HYN A;  3M9H A;  2QEX P;  1QGK B;  5AVY B;  3L75 G;  4U3F G;  1L0N K;  5LYJ A;  1KQF B;  1EXJ A;  2K3R A;  4WBN A;  2LBT A;  1SQP K;  3CCV P;  4ZNC A;  4L74 A;  1W5B A;  1NKN A;  3L75 E;  3GYQ A;  3V2R A;  3U0O A;  3LWR C;  4C8G A;  1YIT F;  5AW4 B;  1QX8 A;  3HKE B;  4C8E A;  5AW2 B;  1LTJ A;  3QHD A;  4ASV A;  1IFN A;  2Y0C A;  3FPI A;  2JNB A;  1L0N D;  2ZT9 B;  3V7E A;  3N2K A;  1BDC A;  5KLV E;  3WJR A;  2JWD A;  3WU2 H;  1JUN A;  4EIJ A;  3M06 A;  1CN7 A;  4H44 B;  4IIJ B;  2IDB A;  3NVI B;  2K1A A;  1VQN F;  1SLQ A;  4N6J A;  1VQ7 P;  2YXQ B;  2C9L Y;  4IIJ A;  3CPQ A;  3WMM 0;  4ZHY B;  2GM4 A;  4BT2 A;  2UYK A;  2QJP B;  5APY A;  2WZ7 A;  1IV4 A;  1HUC A;  4HNA A;  1LTS C;  3VMZ A;  1VQV A;  2YO3 A;  1FZG A;  2Y0E A;  3RBX A;  3VYI A;  2UWJ E;  4XFJ A;  1T2K D;  1JOC A;  1OW6 A;  1NU1 E;  3RK3 E;  4M3L A;  5IJ9 B;  3CCQ F;  2HP3 A;  3D6Z A;  3HWU A;  4W80 A;  2PGD A;  1GD2 E;  4BT5 A;  2VRS A;  3H1H E;  1QVF F;  3RGU A;  4IFF A;  3VMF B;  5J2U B;  3E7K A;  5CCG D;  2W90 A;  3FXD A;  2YIU B;  3G4S P;  5HXZ A;  5LP6 B;  4C7N B;  3M4S A;  1VQ7 F;  2R5D A;  3M9B A;  3KJJ A;  5TJH A;  5KAI H;  4HNA B;  1RF1 C;  1NTZ J;  3CC7 P;  1GX1 A;  4RHA A;  3P8C E;  1S9K D;  1IPA A;  2E5T A;  1W2B O;  2FYU E;  2FFD A;  4X20 A;  3L74 J;  2QIW A;  2Z4E A;  3RL0 D;  3SSU A;  1VHA A;  2GUS A;  3L75 J;  5CA1 B;  2IAF A;  4N78 E;  5KKZ B;  2OYI C;  1NTK E;  2Q3I A;  1L0L D;  3RBZ A;  1GZ0 A;  2FYU G;  5HY2 A;  2CVL A;  1HWT C;  4EI8 A;  4U3J A;  2FYN B;  2O01 J;  2H7H A;  5ITZ A;  1T2K C;  2HG5 D;  3WGJ A;  1RH5 B;  4Y99 B;  5B66 E;  4IHJ A;  5BVZ A;  2GLZ A;  4KJM A;  2IX7 C;  4WWI A;  1VF5 C;  4PD4 I;  1P84 D;  1FSZ A;  1FZC A;  1T6A A;  1SQQ J;  4ZKU A;  1KQS F;  1VL2 A;  3B5N C;  3SIV A;  1RE3 C;  3LW5 H;  1EC5 A;  1OIP A;  4G4X A;  3P8M C;  4XCQ A;  1S72 P;  2E76 B;  4AYC A;  3CLQ A;  2Y9Z A;  1QL1 A;  2ZXX A;  2Q9I A;  2LCA A;  2KUB A;  2OYH C;  2G3A A;  3HKD A;  3N2G B;  2RH0 A;  1YJW P;  3CX5 I;  1KMI Z;  3WXM B;  3FWL A;  1FU1 A;  2M5A B;  1KTM A;  1FAV A;  1SFC C;  1X7P A;  1MUU A;  3EFF K;  3OJA B;  1DD4 A;  3WJQ A;  3L7Q A;  1VDF A;  3F0G A;  2JEE A;  5EYP A;  1RHZ B;  2H8C A;  3B5N A;  5APW A;  2ZFC A;  5AW3 B;  1W5E A;  3H1K E;  1J1E B;  4W7Y A;  3H1L G;  1VQM F;  2HS0 A;  3GHG B;  5EIB C;  2K9Y A;  1Q86 H;  1M57 D;  3B5N D;  4O2B A;  2YO2 A;  3KYQ A;  5AVX B;  4H0L C;  4HB1 A;  3L70 D;  2ZYA A;  4I50 B;  5GON B;  2IQQ A;  1OWA A;  1H7M A;  1PGO A;  1X9V A;  4BVQ A;  2OYI A;  5AVU B;  1YJ9 P;  1L2P A;  1SZQ A;  4IFM A;  1EDI A;  3QUW A;  5HP8 A;  3HUS A;  2XND H;  5CBO A;  4O2A A;  1NVO A;  3HD7 D;  2H6L A;  3JCU H;  5LXT A;  3GHZ A;  1EZV E;  4I7Z C;  1OVR A;  4IOI H;  4UB6 E;  3O6Q B;  1SQQ E;  2MQE A;  1M1K Q;  1VQ4 P;  3CME P;  1GU5 A;  1JY2 N;  3CCL P;  2Q7C A;  1VQP P;  1YTZ I;  5BU8 B;  1SP4 A;  2HP0 A;  5B5E H;  2HS4 A;  1MFT A;  2AEJ A;  5DJU B;  1EDJ A;  5LA6 B;  3BCC E;  1GO0 A;  5IJ0 A;  3DDN A;  2KNC B;  4PWT A;  4TUY A;  5KMG A;  3CMA P;  2QI2 A;  1Z5V A;  1XBI A;  3D01 A;  1HF9 A;  2QG4 A;  3CXC F;  3JAR A;  1FC2 C;  4WY4 A;  3LYB A;  3AE2 C;  2L5G B;  1BSH A;  1SQV E;  2QEX F;  3TK1 A;  3W67 A;  3ESJ A;  5JH7 B;  1QVF O;  1K8A H;  1N7S B;  1J2J B;  2FFD C;  1SQB K;  1WT6 A;  1KIL A;  4YTP C;  4YXW H;  2P6Y A;  5CJ0 A;  2JKV A;  1FZC B;  1EZV I;  1M1K H;  3TD4 A;  1YTZ T;  3M0A A;  3JAT A;  3HRN A;  3S03 A;  3PJS K;  2KXP B;  2ZJS E;  3PHL A;  4RJT A;  2O3J A;  3NK6 A;  5EB1 B;  2WPS A;  1OW8 A;  2P7J A;  1YIJ P;  2E75 B;  4G4V A;  3BCC D;  3LW5 J;  3QH9 A;  2ITA A;  3HUS C;  3NTN A;  3UT5 B;  1KNJ A;  4YXD C;  5JQG B;  3CCE F;  1U7J A;  3JAR B;  3WGM A;  5AW7 B;  4DT0 A;  3CCM P;  5JQG A;  4R4M A;  4GKG A;  1CSB A;  4D6T G;  2ZAU A;  1SQX G;  2W6A A;  3TGU G;  2KG4 A;  2WT7 B;  3O8Z A;  5CA0 A;  5HY4 A;  1K73 H;  1JEK A;  3H1J J;  2FXO A;  2G9I A;  1QVG F;  3CX5 E;  4JYC A;  1URQ B;  2HRU A;  1VPC A;  3IEW A;  4PV1 D;  5H2F E;  1BGY E;  1R1M A;  1K9M Q;  5MN4 A;  5LOV B;  3V4Q A;  4DZO A;  3CCS F;  2WPR A;  2A45 I;  2KLV A;  3EOR A;  1E7K A;  5J2T A;  3W68 A;  2WSC J;  3L70 J;  4KHX A;  1LWU C;  3S4R A;  5JCO C;  2HRY A;  2AXT E;  3TD5 A;  3R2P A;  4ZI7 A;  4O2B B;  1LTG C;  2FYU D;  3L71 J;  1VQ8 F;  3MGN A;  2MKV A;  5IJ9 A;  3H1I E;  3F0D A;  1R5S A;  5KAF H;  4D6T J;  5AVM A;  4E6E A;  1T0K B;  5ITZ B;  3Q2Y A;  2E74 C;  1M1J C;  2KOG A;  3JAM M;  2KB7 P;  1DEB A;  4EI2 A;  4WBA A;  1PP9 J;  5LXT B;  1ODE A;  4H44 C;  3F0E A;  1UFY A;  4WB4 A;  3OA7 A;  1X7O A;  2HQS C;  3OBW A;  3G6E F;  3L37 A;  2BTQ B;  4I55 A;  2Z5I A;  5IT9 M;  1VQN P;  4DCK A;  1S9K E;  4I6M C;  3AEA C;  5B5E E;  3H25 A;  4U7J A;  1H0T A;  4L75 A;  2LBW A;  1W5F A;  1NU1 D;  1GTW A;  3CC4 P;  5AVS B;  5E79 H;  4X1Y A;  4PV1 C;  3H1I J;  1KFN A;  2PAJ A;  2AIF A;  2Y0D A;  3JC2 2;  2AEM A;  1KB9 I;  1LTJ B;  4K3A A;  3V6I A;  1FNJ A;  3WGL A;  3H1H J;  1KIL E;  3VCZ A;  1NTM K;  1IK7 A;  5BMV B;  3CPW O;  4EYY Q;  4GOD A;  3C8L A;  2KP8 A;  3RL0 B;  4IFD K;  2NPS C;  4U39 A;  4X1I A;  1Q81 H;  4EI9 A;  1JN1 A;  1S5L E;  1VQK F;  1K04 A;  1H89 A;  3ELC A;  2R3C A;  4OGQ D;  1FFX A;  1RA4 A;  3AEG C;  3CXH D;  3ABV C;  3VTP C;  4LGD E;  5FNV A;  3H1L E;  2YXR B;  5GTI H;  2ALE A;  3I56 F;  3J7A R;  3CYP B;  1NTZ G;  3WUV A;  1M8O B;  5KKZ C;  1HBW A;  3H1L J;  4BVR A;  3U1C A;  1PPJ G;  2OTK E;  3C8V A;  1SQX J;  5GON A;  2KK7 A;  3TD3 A;  1KNK A;  1N8R Q;  2E5Y A;  1VQ6 P;  1JM0 A;  3U1A A;  3I56 P;  5GIP C;  1PF5 A;  2Q3E A;  4Y99 C;  3RK2 B;  4L76 A;  3P32 A;  3CCJ P;  1AQT A;  1VQM P;  3IKF A;  5CA0 B;  5LP6 A;  1KQG B;  1VQK P;  1L0L E;  4BRY A;  1LTA C;  2RN0 A;  3WPX A;  2CZW A;  5EZY A;  1SQV K;  1Y47 A;  1CLI A;  2BO1 A;  3B5N B;  1L4A D;  4U3F J;  2WQY C;  1ZP0 C;  1FNK A;  2OGU A;  1RQ7 A;  1J1D B;  1HJ0 A;  1K05 A;  5M1B A;  1GL2 A;  1SQQ D;  2AXT H;  2JO1 A;  2Q6Q A;  3RYF B;  2ZF8 A;  2RHH A;  2CW4 A;  3ITK A;  3IEQ A;  2HOD A;  1G2C A;  3L73 E;  1YJN F;  1IV1 A;  3QTY A;  2KZI A;  4OVN F;  1KYO D;  4G4Z A;  1L0N J;  3AGK A;  2V4H A;  3M0D C;  4GOE A;  1RQ2 A;  1SFC B;  1L4A C;  3TF5 A;  3H1J E;  4H13 C;  4TLF A;  3H1H D;  1S1C X;  1SQP D;  4MN4 C;  1KIL B;  5JVD A;  1N7S A;  1L0N E;  2ZYD A;  1ZOY C;  1SQV J;  3TSI A;  3NXS A;  4BT7 A;  1OXZ A;  3PP5 A;  3ZP4 A;  1Y9B A;  4IL6 E;  3TDK A;  2NPS D;  4X1K A;  2KSJ A;  3VOP A;  3OAK A;  5EAZ A;  4BWN A;  1IO4 A;  3N2K B;  3N4X A;  3LME A;  2Z1U A;  5IJ0 B;  3UT5 A;  4H13 D;  1P84 H;  3CCR P;  3WU2 E;  3O85 A;  4O4J A;  1EDL A;  2P2U A;  3KE1 A;  3R4Y A;  1VQO F;  3VP8 A;  3N2G A;  5CCH C;  5KLI C;  2M3B A;  3MUD C;  3HKD B;  3NMD A;  1FDI A;  1KV4 A;  1VQ5 F;  3RK3 C;  3HD7 A;  4B46 A;  1IV3 A;  1YBK A;  4OGQ B;  3MTU E;  2VGM A;  2PHN A;  4CPG A;  5GTH E;  3HE4 A;  2FBW C;  2Z5H A;  3C9R A;  3FFM A;  1PP9 G;  1YQN A;  2VAP A;  1FZE A;  1IZN B;  1BCC G;  3AE4 C;  1TVK A;  1SVF A;  3CXH I;  3E1I A;  1U43 A;  3FWN A;  4DOJ A;  1FBM A;  3VOA A;  1IFI A;  3OON A;  1EZV G;  3H32 B;  2XV5 A;  5CCH A;  1H8A A;  1NOH A;  1KQS O;  3K2X A;  5HY0 A;  3CCL F;  2WAL A;  5FNV B;  5AW6 B;  1XTG B;  5CBN A;  2Q5U A;  1VQO P;  1K9M H;  1CK2 A;  2KTV A;  4NUT A;  3D6Y A;  1Q86 Q;  3B6N A;  2PMP A;  4EOT A;  3CX5 H;  4BXL A;  3I55 P;  3VP9 A;  3MQW A;  4HH2 A;  3TGU J;  1W58 1;  1JTH A;  1R5L A;  5JVD B;  2FFD B;  3ZO8 A;  3GW6 A;  5EFW B;  3AEF C;  1WMK A;  1H47 A;  1DX7 A;  1FZC C;  3L72 E;  2O01 N;  5GIO C;  1GO1 A;  3E1Y A;  4ZKP A;  3RE3 A;  1MV8 A;  3E20 B;  3L71 D;  4C7N A;  4BT4 A;  3M0D A;  2WPQ A; 
#chains in the Genus database with same CATH homology
 3SWF A;  3BRT B;  5DCV A;  3HUS B;  1GO0 A;  5CCG C;  1LT9 C;  4BVT A;  5GAP K;  2QI2 A;  2I1J A;  3IFM A;  1W2E A;  1XBI A;  3CXC F;  1LWU A;  3LWP C;  3L4F A;  4WY4 A;  2OZB A;  4C7R A;  2L5G B;  1YHQ F;  4AUW A;  2FC3 A;  5HWE A;  4WY4 B;  1QL2 A;  4EI7 A;  2O1K A;  2QEX F;  3V5B A;  3TK1 A;  1GK4 A;  2XDJ A;  5KJ7 A;  1VQP F;  2P67 A;  1GZL A;  1NJI H;  3JCM M;  4LC1 A;  5CHX A;  5CCG A;  1K8A H;  1JY2 O;  1N7S B;  4LLH A;  1J2J B;  2FFD C;  1SQB K;  1WT6 A;  1KIL A;  3G3Z A;  4W7Z A;  3GHG A;  5CJ0 A;  1FZC B;  3A3Y B;  1M1K H;  1YTZ T;  3HD7 B;  3M0A A;  4TZZ A;  3HRN A;  2A45 H;  5GIN C;  2QA4 F;  3NK6 A;  3U59 A;  2WPS A;  1URQ C;  2C0X A;  3J81 M;  1YI2 F;  2P7J A;  4LCK A;  2FYZ A;  2YKQ A;  5HXU A;  1RY3 A;  2MJZ A;  1FZA A;  1YYC A;  1JMM A;  3HUS C;  3NTN A;  5APX A;  2E42 A;  1ZN5 A;  1KFM A;  2HLO A;  3TYY A;  1X52 A;  3V2P A;  4JF7 A;  3CCE F;  1G2C B;  3KPE A;  5BU5 A;  3LWQ C;  1W2B F;  1LWU B;  2W27 A;  1GL2 D;  5AW7 B;  1IFM A;  1AFO A;  2O1J A;  1L0L K;  4GKG A;  1CSB A;  1N73 B;  2C9N Y;  4WY4 C;  2XU6 A;  2H43 A;  2FGY A;  2LBX A;  2W6A A;  4X3M A;  1T3U A;  2KG4 A;  2WT7 B;  2HPC B;  1RF1 A;  2CPS A;  3O8Z A;  5AW1 B;  3TNU A;  3LWV C;  1NU1 K;  5G4U C;  5HY4 A;  1HVV A;  1K73 H;  4I1L A;  1YIJ F;  4RES B;  3CCM F;  2HFE D;  5CJ4 A;  1QVG F;  4JYC A;  1URQ B;  5APT A;  1XTC C;  2WT7 A;  2HPC A;  1VPC A;  3RA5 A;  3N7N A;  3V4Q A;  4DZO A;  3CCS F;  2WPR A;  2A45 I;  2P1J A;  2KLV A;  2OTL F;  1JNM A;  3BVH A;  1E7K A;  2ZXE B;  2YNY A;  2F9Z C;  2N1T C;  4KHX A;  1LWU C;  5HY1 A;  3VMX A;  3RK3 D;  1HH0 A;  1W40 A;  3R2P A;  1SFC A;  1NMU B;  1N73 C;  3HE5 A;  1LTG C;  2CPB A;  5AW9 B;  1VQ8 F;  3EFG A;  2KYV A;  3MGN A;  3H6P A;  2GUV A;  5FLX M;  3M91 A;  1SDS A;  2I1K A;  3CC4 F;  3H32 A;  5GAN K;  3HE5 B;  1T0K B;  3HAX D;  1LTJ C;  1G1I A;  1M1J C;  2A45 G;  2HOD B;  2KOG A;  3CC2 F;  3JAM M;  2KB7 P;  1DEB A;  5APU A;  3A7O A;  3CD6 F;  4WBA A;  3P7K A;  2J58 A;  1Q7Y H;  3LFO A;  3NK7 A;  2N9B A;  2HVY D;  2OAR A;  3V7Q A;  3A5T A;  1JY3 N;  2HYN A;  1JCC A;  2NPS B;  3M9H A;  2YMY A;  4WB4 A;  1IK9 A;  3BAS A;  3OA7 A;  5AVY B;  1X7O A;  3OBW A;  4NQ3 A;  3G6E F;  2NPS A;  3L37 A;  1GW3 A;  1L0N K;  2Z5I A;  5IT9 M;  1X79 B;  1IFD A;  3SWY A;  1S9K E;  1ZWZ A;  4I6M C;  1SQP K;  2N1T B;  4I2L C;  1NKN A;  3GYQ A;  4N3Y B;  3V2R A;  2LBW A;  2POH A;  3LWR C;  1GTW A;  1YIT F;  5AW4 B;  4N78 D;  5AVS B;  3L35 A;  1FZF A;  5AW2 B;  1KFN A;  1LTJ A;  2PAJ A;  2YKO A;  3IR9 A;  2OYH A;  2AIF A;  4BY9 D;  1IFN A;  4JYB A;  3V2Q A;  1KD1 H;  1LTJ B;  2JNB A;  1M1J B;  2J59 M;  1N7S D;  3V7E A;  2IPP A;  2YKP A;  3N4Z A;  1LTT C;  5G4V C;  1NTM K;  1MZ9 A;  4AQR D;  4BW0 B;  1GU4 A;  1JUN A;  4OH8 B;  5APV A;  4B86 A;  4EIJ A;  1T8Z A;  3M06 A;  1CN7 A;  1RF0 A;  5AVW B;  1DH3 A;  2KP8 A;  3RL0 B;  2N1T A;  4IFD K;  3NVI B;  1JY2 P;  2NPS C;  1EQ7 A;  1VQN F;  2I6D A;  1SLQ A;  1VQ9 F;  4N6J A;  3V4W A;  3CCJ F;  3CPW F;  1Q81 H;  4HYT B;  1LTI C;  4EI9 A;  2C9L Y;  2W6B A;  2WSC H;  3RK2 C;  1WRG A;  3CPQ A;  3WMM 0;  2GM4 A;  1VQK F;  1JY3 P;  1CI6 A;  3G71 F;  1S72 F;  3VMY A;  1L4A A;  1H89 A;  3CC7 F;  2R3C A;  5APY A;  1FOS E;  5AVV B;  2WZ7 A;  1RA4 A;  1RLG A;  3KQG A;  2KTU A;  1HUC A;  3CL3 D;  1LTS C;  3BRV B;  1A02 J;  2IFM A;  2WIT A;  3VMZ A;  2YO3 A;  1ZR4 A;  3VTP C;  4LGD E;  1FZG A;  1HGV A;  2N1T D;  3VYI A;  5CCH D;  1ZLL A;  1M7L A;  2ALE A;  3I56 F;  2H8P D;  3T97 A;  1T2K D;  1SFC D;  1JOC A;  3G4S F;  3J7A R;  1N73 A;  5AVT B;  1J1D C;  5KJ7 C;  2WSF H;  4M3L A;  1HBW A;  3CCQ F;  3OW2 F;  4BVR A;  3U1C A;  4XA4 A;  1GL2 C;  1HGZ A;  4W80 A;  1GD2 E;  2VRS A;  3II6 A;  1QVF F;  5AVQ B;  5A2Q M;  4IFF A;  3NVK E;  3VMF B;  3RL0 C;  5EO3 A;  5CCG D;  3HTK B;  3U1A A;  1Q82 H;  1ZR2 A;  1LTB C;  5GIP C;  1HJB A;  5HXZ A;  3CI9 A;  5FJ4 C;  1PXW A;  4Y99 C;  1GK6 A;  3RK2 B;  4C7N B;  1KIL D;  3P32 A;  3V3T A;  3CCU F;  1VQ7 F;  1L4A B;  2R5D A;  1N86 A;  3M9B A;  3BAT A;  2R32 A;  3NMU C;  1KIL C;  1RF1 C;  1LTA C;  3P8C E;  1S9K D;  2CZW A;  1SQV K;  2BO1 A;  1IPA A;  3B5N B;  2FFD A;  1VQ6 F;  4BVS A;  1L4A D;  1W3E X;  4O9B A;  2Z4E A;  1URQ D;  3RL0 D;  4C46 A;  2GUS A;  1GDT A;  1J1D B;  5APQ A;  4N78 E;  4WY4 D;  2OYI C;  1GL2 A;  1MFZ A;  1RF0 C;  3LID A;  2Q3I A;  1GZ0 A;  1X8Y A;  3RA6 A;  1JCD A;  5HY2 A;  3CCV F;  1GL2 B;  1HWT C;  3PAF A;  4EI8 A;  2OYH B;  1YJ9 F;  1Z56 A;  3LIE A;  2HOD A;  1G2C A;  2WWW A;  1YJN F;  2H7H A;  2WSE H;  1N8R H;  1T2K C;  2HG5 D;  1URQ A;  5EWR A;  3PLA C;  3AGK A;  4Y99 B;  1W41 A;  1RE4 C;  3M0D C;  5BVZ A;  3RK3 B;  1SFC B;  1L4A C;  3EQ2 A;  2M8R A;  2GLZ A;  2OHW A;  2IX7 C;  3B8E B;  3N4Y A;  1E5W A;  2JJL A;  1KIL B;  2R5B A;  3CG6 A;  1N7S A;  1FJK A;  1NTZ K;  1RF1 B;  3SIU A;  2OTJ F;  1FZC A;  1JTH B;  3LWO C;  1KZU B;  3TSI A;  3NXS A;  5AW0 B;  1OXZ A;  4ZKU A;  3PP5 A;  1KQS F;  2QM7 A;  3B5N C;  3UIA A;  5AW8 B;  3J80 M;  5KTB A;  1N7L A;  1H88 A;  3SIV A;  3HE4 B;  1RE3 C;  2LKM A;  2NPS D;  1J1E C;  2KSJ A;  3VOP A;  3OAK A;  4XE5 B;  3LW5 H;  3L36 A;  2OYI B;  1NAF A;  3P8C D;  3P8M C;  1IO4 A;  4XCQ A;  3N4X A;  1DT9 A;  4AYC A;  3ON1 A;  3CLQ A;  1QL1 A;  2Q9I A;  1LT9 A;  2OYH C;  1FOS F;  2C0W A;  3MCA B;  2PP6 A;  2IFN A;  3O85 A;  2P2U A;  1FZB A;  2XZR A;  5KLV K;  3VN0 A;  1VQO F;  3VP8 A;  1G1J A;  5CCH C;  2M3B A;  3WXM B;  3NMD A;  1FU1 A;  3MD0 A;  1VQ5 F;  3I55 F;  3RK3 C;  1FAV A;  1IC2 A;  1SFC C;  3HD7 A;  1IFJ A;  1X7P A;  3KDP B;  3OBY A;  4X3L A;  3C9I A;  1VQL F;  1MUU A;  2FXM A;  3MTU E;  2VGM A;  3OJA B;  1AQ5 A;  1KC8 H;  1CI6 B;  1VDF A;  3HE4 A;  2Z5H A;  2JEE A;  1YJW F;  1N2D C;  1FJP A;  2FKW B;  5KJ7 D;  3FFM A;  3B5N A;  1A02 F;  5APW A;  2ZFC A;  5AW3 B;  3NFQ A;  1JO5 A;  5AW5 B;  3HJW C;  1JY3 O;  1W42 A;  1NO4 A;  1VQ4 F;  1J1E B;  1FZE A;  3RK2 D;  5CMZ A;  2XKM A;  2BAS A;  3CME F;  1SVF A;  4W7Y A;  3E1I A;  1VQM F;  3TNU B;  4DOJ A;  3MUD A;  1FBM A;  2XNX A;  1M1J A;  1NKZ B;  1SQX K;  1IFI A;  3GHG B;  3VI6 A;  3H32 B;  2XV5 A;  1Q86 H;  3V2N A;  2QM8 A;  5CCH A;  1H8A A;  1NOH A;  1HTL C;  5APS A;  3B5N D;  1LT9 B;  5HY0 A;  3CCL F;  1CZQ A;  5AVZ B;  3HTK A;  2WAL A;  5AW6 B;  1XTG B;  2YO2 A;  3KYQ A;  5AVX B;  1FDM A;  3CCR F;  2VGN A;  2Q5U A;  1GW4 A;  3CMA F;  1K9M H;  4GIF A;  1CK2 A;  2KTV A;  1OWA A;  3I5C A;  3MIW A;  1H7M A;  4NUT A;  4C4W C;  1M90 H;  1ZV8 A;  1X9V A;  4EOT A;  1NH4 A;  4BVQ A;  1NHL A;  4GT1 A;  3VP9 A;  5AVU B;  2OYI A;  4HH2 A;  1CW5 A;  4IFM A;  1JTH A;  3A2A A;  1RE3 A;  3HUS A;  1N7S C;  3HD7 D;  1KQL A;  1T3J A;  3M9Q A;  2WTY A;  2FFD B;  5AVR B;  1DX7 A;  1FZC C;  1SQQ K;  1NTK K;  3HD7 C;  1PFI A;  2E43 A;  1IJD B;  2O01 H;  5GIO C;  1GO1 A;  1JJ2 F;  3E1Y A;  4ZKP A;  1MV8 A;  2FYU K;  3E20 B;  1LGH B;  3D00 A;  1GU5 A;  1JY2 N;  3GHG C;  4C7N A;  1RE4 A;  3M0D A;  2Q7C A;  1NWQ A;  1YTZ I;  5BU8 B;  1SP4 A;  2WPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...