3EORA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 41
structure length 157
sequence length 157
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3eorA00
1T0AA 3ERNA 3EORA 3KE1A 3F0GA 3P10A 1H47A 1VHAA 3F0EA 3IKFA 4C8EA 3FBAA 2PMPA 4C8IA 1U3PA 3B6NA 3FPIA 3RE3A 1KNJA 3GHZA 3K14A 3F0DA 1W55A 2AMTA 3K2XA 3T80A 4C82A 2GZLA 1KNKA 3ESJA 3MBMA 1IV3A 1JY8A 3IEQA 4C8GA 3F0FA 5B8FA 3IKEA 1GX1A 1U43A 3P0ZA 1VH8A 1IV4A 1H48A 3ELCA 4C81A 3F6MA 1U40A 1IV2A 1U3LA 3IEWA 2UZHA 3Q8HA 1W57A 1IV1A 1JN1A 1YQNA 3QHDA 3JVHA
chains in the Genus database with same CATH superfamily
4O2BB 1YGYA 1FNJA 5EB1B 5LYJA 2PMPA 4RQOA 3S0YA 3JASA 4NQ3A 3CC7F 1CN7A 3ZO8A 3T80A 2H8CA 2R751 3G71F 3KHNA 3MDOA 2GVIA 5HY4A 2OTJF 2CSLA 2NMUA 3C9TA 3N2KB 1H7MA 2CHSA 3HKDA 3JAWA 4X1IA 2H6LA 2Q1YA 5HY2A 4BT6A 1VQ9F 1U3LA 2UZHA 3O85A 1W40A 1X25A 2Z1EA 3I55F 5GINC 5IYZB 4ERHA 3EORA 3KE1A 3IKFA 3MQWA 5ITZA 1ODEA 3FPIA 2KTUA 2Z1FA 5FLXM 5HXUA 1W581 3VO8A 1PF5A 3WGKA 1SZQA 4YJ3A 5EIBC 1QAHA 3HKEB 3HKCA 4TUYB 3JASB 2WALA 3K12A 4G4VA 5CA0B 3E1YA 1VK3A 4O2BA 5KMGA 3JALA 3NK6A 1QVGF 3CYQA 3N2GA 1YQNA 1TVKA 1YJNF 4LNUB 1PXWA 1Q86H 5BMVA 4C8IA 1RQ2A 3B6NA 4ZK7A 4G4ZA 2HS0A 2HS3A 2HX0A 5HP7A 2IAFA 5MN5A 2Z1TA 5LOVB 3DDNA 3E20B 5JVDA 2VAWA 1COMA 2RHOA 5EB0A 3I56F 2P6YA 1DBFA 1XBIA 1GZ0A 4O4JB 1VQKF 4BVSA 3S03A 5EIBD 4F6RA 2QTPA 2RHJA 3JAMM 5HY1A 5LA6B 3LMEA 3VYSC 4TV8A 3U0OA 5JH7A 3LWRC 2UYJA 3I3FA 2CVLA 4HNAA 4X20B 4O4LB 1VQ6F 2ZVZA 4FFBA 2R6R1 2H8EA 2DT4A 4DXDA 1GO1A 5GAPK 1X7PA 3NVKE 4FFBB 2HS4A 3WJRA 1VH8A 5FJ4C 1Q82H 2FC3A 3CC2F 3CD6F 1SDSA 3VYUC 4B5CA 1SA0A 4ZHQB 2HP3A 3OONA 3HAXD 3D01A 2Z01A 1KC8H 3JVHA 3JATB 3D00A 3TD4A 4G88A 1H47A 2HRUA 4TV9B 3S02A 2HRYA 3WGNA 1U3PA 4EI9A 2MQEA 3C8LA 5MN6A 1YI2F 2AIZP 1XV2A 5J2UB 2GLZA 4TV9A 3CCJF 2CZWA 5JCOA 1VQ7F 3V7EA 5BMVB 2HP0B 1QVFF 3CCRF 3LWOC 2Z1UA 3CCLF 2F9ZC 1OFUA 4B46A 3ELCA 1UFYA 3OBYA 5J2TB 5HXZA 3GTZA 3TD3A 5HY0A 4ZOLA 4ZHVA 3P4EA 4YJ2B 1N8RH 2JNBA 3VOAA 4WBNB 3HKEA 2UYNA 1ONIA 3VOBA 3GHZA 3TD5A 3KJJA 2VGNA 4ZHWA 3K2XA 3VYTC 1XRGA 5C8YB 4EB6B 4HNAB 4NWOB 4ZI7A 5B8FA 5ITZB 1U43A 4X3LA 1W41A 1U40A 3WJPA 3KIZA 3HJWC 4F6RB 3RYIB 5CA1B 5KX5A 1Q81H 3Q8HA 1J7HA 3QTYA 4C4WC 3CYPB 2G9IA 4RHAA 4I50B 3ERNA 3PLAC 4BT3A 3N2KA 3WGLA 3LWQC 4EI8A 1ZWZA 4BT7A 1W5BA 3JARB 4G4YA 2B33A 2IG8A 3HKBB 1KNKA 3G6EF 4BT4A 2KGWA 3S06A 2OZBA 1RA4A 4LCKA 1GX1A 1E7KA 4YJ2A 5LYJB 1K9MH 3VTIC 3NVIB 4U3JB 4O4LA 5A2QM 4DRXB 4I4TB 3CC4F 1XHOA 2ALEA 3CCUF 5JQGB 2BTQB 3J81M 1W59A 4X1KB 4TUYA 4BT2A 5CB4B 2OTLF 1M1KH 2ZOVA 3UT5A 3FBAA 3J80M 1JD1A 1KNJA 2KTVA 1FFXB 1OAPA 4NUTA 3CCSF 1FSZA 1W42A 1Q7YH 2Q1XA 3D54A 1K73H 2I6DA 3C9RA 3OBWA 5IJ0A 1IV4A 1W5AA 3RYHB 5JQGA 2I6RA 3RA5A 3WGMA 4X1IB 4M8IA 3JAWB 5HP8A 3N2GB 1IV3A 4DRXA 2LCAA 3M1XA 1VQLF 4IIJB 3BYQA 3E22A 3JAKB 2LBWA 1NJIH 3HKCB 4C82A 2HQSC 3L7QA 3ON1A 3HKBA 3ESJA 2OHWA 3WPXA 4B45A 3FD5A 5AVMA 3MCQA 1YJWF 5HWEA 2YXZA 4I55A 3C9UA 1RLGA 3F6MA 5EZYA 2LBXA 3QUWA 3IEWA 3C9SA 2RHHA 3NK7A 1YITF 2IQQA 3M4SA 5FNVB 3F0EA 2BTUA 5EAZA 3R0PA 4O4IB 3MCAB 1T0KB 3VI6A 1X7OA 2AIFA 4ZHYB 1Z5WA 5LP6C 2V9YA 3M84A 3HTNA 4X1YB 4C8GA 3JAKA 4E6EA 1TVKB 5EYPB 4WBNA 3ZP7A 2ZVYA 4BVQA 3LWPC 2EWCA 4PWTA 4ZOLB 3IMPA 5LXTA 3CPWF 5LP6A 1JY8A 4IHJB 3S0HA 3SIUA 4TV8B 5JCOC 5EO3A 3GYQA 4BY9D 3WGJA 5LA6A 5J2TA 3CG6A 3HWUA 5EYPA 3N4ZA 3RYHA 3P10A 5IJ0B 5MN4A 3LFOA 4YJ3B 4X1YA 4O4JA 3I7TA 4KWEA 3V4DA 3WXMB 1M90H 3FD6A 5DCVA 5J2UA 3CCMF 4O4IA 2VXYA 1YJ9F 2ZF8A 4BVTA 1VQNF 5IYZA 5FNVA 1H48A 4X1KA 2QA4F 3JATA 1JJ2F 1K8AH 3K0TA 4U39A 2UYPA 2N48A 1W57A 4C81A 4U3JA 1TUBA 2K1SA 4B62A 1YHQF 1VQ5F 3RE3A 1QU9A 2CHTA 1W55A 4O4HA 3G4SF 3OW2F 3E22B 3JARA 5G4VC 3F0FA 4I50A 1IV2A 1FNKA 3LDTA 4G4XA 3RYIA 5CA1A 5KX5B 1IV1A 3QHDA 4O2AB 4BW0B 3RYFA 2QEXF 5EWRA 3DC2A 1W2BF 1VQMF 4C8EA 3IR9A 2VGMA 3ZP4A 4ZI7B 5GONA 3N4YA 4G4WA 4EB6A 2VAPA 1UI9A 2GZLA 3RA6A 3CCEF 1FFXA 3CMAF 1RQ7A 2FGYA 2RHLA 3FFMA 5G4UC 5GANK 3LYBA 5CB4A 1RLUA 4R40B 3RYCB 4LNUA 3CXCF 1JFFA 2ZODA 4I4TA 4X3MA 4BT5A 3LWVC 1Q8RA 3JALB 2CWJA 3SIVA 1CK2A 5KMGB 4TZZA 3VMFB 1JFFB 3F0GA 3ZOPA 1W5FA 2KG4A 5CA0A 3RYCA 2HP0A 3K14A 3F0DA 4O4HB 1W3EX 1NMUB 2AMTA 1IPAA 1KD1H 3IEQA 3NMUC 3IKEA 5GONB 5IJ9B 3JCMM 2HVYD 2BO1A 4ZHQA 5EZYB 5IJ9A 5GIPC 1VHAA 3AGKA 3HKDB 1VQVA 1W5EA 2UYKA 5C8YA 5IT9M 2L26A 2QI2A 3CMEF 3CCQF 2UYNB 4IIJA 3P0ZA 3CCVF 2CW4A 5LP6B 5GIOC 4X20A 5LXTB 2LBTA 1TUBB 1CLIA 3VIUA 1GO0A 2BTOA 3KJKA 3WJQA 3PAFA 1R1MA 5JH7B 1JN1A 4EI7A 3V7QA 1T0AA 1X52A 3CPQA 3WPWA 2DYYA 2PHNA 1VQPF 2ZAUA 4XCQA 1KQSF 1VQ4F 5JVDB 1QD9A 5LOVA 2VAMA 1YIJF 3J7AR 3MBMA 2OTMA 3S0WA 3UT5B 1DT9A 3RYFB 4O2AA 3V3TA 1S72F 3CB2A 3VCZA 1VQOF 1VQ8F 1SA0B 1NQ3A 2W8BC 4BVRA 4I55B 4IHJA 1Z5VA 2YYEA 2RB9A
chains in the Genus database with same CATH topology
1T0AA 3ERNA 3EORA 3KE1A 3F0GA 3P10A 1H47A 1VHAA 3F0EA 3IKFA 4C8EA 3FBAA 2PMPA 4C8IA 1U3PA 3B6NA 3FPIA 3RE3A 1KNJA 3GHZA 3K14A 3F0DA 1W55A 2AMTA 3K2XA 3T80A 4C82A 2GZLA 1KNKA 3ESJA 3MBMA 1IV3A 1JY8A 3IEQA 4C8GA 3F0FA 5B8FA 3IKEA 1GX1A 1U43A 3P0ZA 1VH8A 1IV4A 1H48A 3ELCA 4C81A 3F6MA 1U40A 1IV2A 1U3LA 3IEWA 2UZHA 3Q8HA 1W57A 1IV1A 1JN1A 1YQNA 3QHDA 3JVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0A A;  3ERN A;  3EOR A;  3KE1 A;  3F0G A;  3P10 A;  1H47 A;  1VHA A;  3F0E A;  3IKF A;  4C8E A;  3FBA A;  2PMP A;  4C8I A;  1U3P A;  3B6N A;  3FPI A;  3RE3 A;  1KNJ A;  3GHZ A;  3K14 A;  3F0D A;  1W55 A;  2AMT A;  3K2X A;  3T80 A;  4C82 A;  2GZL A;  1KNK A;  3ESJ A;  3MBM A;  1IV3 A;  1JY8 A;  3IEQ A;  4C8G A;  3F0F A;  5B8F A;  3IKE A;  1GX1 A;  1U43 A;  3P0Z A;  1VH8 A;  1IV4 A;  1H48 A;  3ELC A;  4C81 A;  3F6M A;  1U40 A;  1IV2 A;  1U3L A;  3IEW A;  2UZH A;  3Q8H A;  1W57 A;  1IV1 A;  1JN1 A;  1YQN A;  3QHD A;  3JVH A; 
#chains in the Genus database with same CATH topology
 4O2B B;  1YGY A;  1FNJ A;  5EB1 B;  5LYJ A;  2PMP A;  4RQO A;  3S0Y A;  3JAS A;  4NQ3 A;  3CC7 F;  1CN7 A;  3ZO8 A;  3T80 A;  2H8C A;  2R75 1;  3G71 F;  3KHN A;  3MDO A;  2GVI A;  5HY4 A;  2OTJ F;  2CSL A;  2NMU A;  3C9T A;  3N2K B;  1H7M A;  2CHS A;  3HKD A;  3JAW A;  4X1I A;  2H6L A;  2Q1Y A;  5HY2 A;  4BT6 A;  1VQ9 F;  1U3L A;  2UZH A;  3O85 A;  1W40 A;  1X25 A;  2Z1E A;  3I55 F;  5GIN C;  5IYZ B;  4ERH A;  3EOR A;  3KE1 A;  3IKF A;  3MQW A;  5ITZ A;  1ODE A;  3FPI A;  2KTU A;  2Z1F A;  5FLX M;  5HXU A;  1W58 1;  3VO8 A;  1PF5 A;  3WGK A;  1SZQ A;  4YJ3 A;  5EIB C;  1QAH A;  3HKE B;  3HKC A;  4TUY B;  3JAS B;  2WAL A;  3K12 A;  4G4V A;  5CA0 B;  3E1Y A;  1VK3 A;  4O2B A;  5KMG A;  3JAL A;  3NK6 A;  1QVG F;  3CYQ A;  3N2G A;  1YQN A;  1TVK A;  1YJN F;  4LNU B;  1PXW A;  1Q86 H;  5BMV A;  4C8I A;  1RQ2 A;  3B6N A;  4ZK7 A;  4G4Z A;  2HS0 A;  2HS3 A;  2HX0 A;  5HP7 A;  2IAF A;  5MN5 A;  2Z1T A;  5LOV B;  3DDN A;  3E20 B;  5JVD A;  2VAW A;  1COM A;  2RHO A;  5EB0 A;  3I56 F;  2P6Y A;  1DBF A;  1XBI A;  1GZ0 A;  4O4J B;  1VQK F;  4BVS A;  3S03 A;  5EIB D;  4F6R A;  2QTP A;  2RHJ A;  3JAM M;  5HY1 A;  5LA6 B;  3LME A;  3VYS C;  4TV8 A;  3U0O A;  5JH7 A;  3LWR C;  2UYJ A;  3I3F A;  2CVL A;  4HNA A;  4X20 B;  4O4L B;  1VQ6 F;  2ZVZ A;  4FFB A;  2R6R 1;  2H8E A;  2DT4 A;  4DXD A;  1GO1 A;  5GAP K;  1X7P A;  3NVK E;  4FFB B;  2HS4 A;  3WJR A;  1VH8 A;  5FJ4 C;  1Q82 H;  2FC3 A;  3CC2 F;  3CD6 F;  1SDS A;  3VYU C;  4B5C A;  1SA0 A;  4ZHQ B;  2HP3 A;  3OON A;  3HAX D;  3D01 A;  2Z01 A;  1KC8 H;  3JVH A;  3JAT B;  3D00 A;  3TD4 A;  4G88 A;  1H47 A;  2HRU A;  4TV9 B;  3S02 A;  2HRY A;  3WGN A;  1U3P A;  4EI9 A;  2MQE A;  3C8L A;  5MN6 A;  1YI2 F;  2AIZ P;  1XV2 A;  5J2U B;  2GLZ A;  4TV9 A;  3CCJ F;  2CZW A;  5JCO A;  1VQ7 F;  3V7E A;  5BMV B;  2HP0 B;  1QVF F;  3CCR F;  3LWO C;  2Z1U A;  3CCL F;  2F9Z C;  1OFU A;  4B46 A;  3ELC A;  1UFY A;  3OBY A;  5J2T B;  5HXZ A;  3GTZ A;  3TD3 A;  5HY0 A;  4ZOL A;  4ZHV A;  3P4E A;  4YJ2 B;  1N8R H;  2JNB A;  3VOA A;  4WBN B;  3HKE A;  2UYN A;  1ONI A;  3VOB A;  3GHZ A;  3TD5 A;  3KJJ A;  2VGN A;  4ZHW A;  3K2X A;  3VYT C;  1XRG A;  5C8Y B;  4EB6 B;  4HNA B;  4NWO B;  4ZI7 A;  5B8F A;  5ITZ B;  1U43 A;  4X3L A;  1W41 A;  1U40 A;  3WJP A;  3KIZ A;  3HJW C;  4F6R B;  3RYI B;  5CA1 B;  5KX5 A;  1Q81 H;  3Q8H A;  1J7H A;  3QTY A;  4C4W C;  3CYP B;  2G9I A;  4RHA A;  4I50 B;  3ERN A;  3PLA C;  4BT3 A;  3N2K A;  3WGL A;  3LWQ C;  4EI8 A;  1ZWZ A;  4BT7 A;  1W5B A;  3JAR B;  4G4Y A;  2B33 A;  2IG8 A;  3HKB B;  1KNK A;  3G6E F;  4BT4 A;  2KGW A;  3S06 A;  2OZB A;  1RA4 A;  4LCK A;  1GX1 A;  1E7K A;  4YJ2 A;  5LYJ B;  1K9M H;  3VTI C;  3NVI B;  4U3J B;  4O4L A;  5A2Q M;  4DRX B;  4I4T B;  3CC4 F;  1XHO A;  2ALE A;  3CCU F;  5JQG B;  2BTQ B;  3J81 M;  1W59 A;  4X1K B;  4TUY A;  4BT2 A;  5CB4 B;  2OTL F;  1M1K H;  2ZOV A;  3UT5 A;  3FBA A;  3J80 M;  1JD1 A;  1KNJ A;  2KTV A;  1FFX B;  1OAP A;  4NUT A;  3CCS F;  1FSZ A;  1W42 A;  1Q7Y H;  2Q1X A;  3D54 A;  1K73 H;  2I6D A;  3C9R A;  3OBW A;  5IJ0 A;  1IV4 A;  1W5A A;  3RYH B;  5JQG A;  2I6R A;  3RA5 A;  3WGM A;  4X1I B;  4M8I A;  3JAW B;  5HP8 A;  3N2G B;  1IV3 A;  4DRX A;  2LCA A;  3M1X A;  1VQL F;  4IIJ B;  3BYQ A;  3E22 A;  3JAK B;  2LBW A;  1NJI H;  3HKC B;  4C82 A;  2HQS C;  3L7Q A;  3ON1 A;  3HKB A;  3ESJ A;  2OHW A;  3WPX A;  4B45 A;  3FD5 A;  5AVM A;  3MCQ A;  1YJW F;  5HWE A;  2YXZ A;  4I55 A;  3C9U A;  1RLG A;  3F6M A;  5EZY A;  2LBX A;  3QUW A;  3IEW A;  3C9S A;  2RHH A;  3NK7 A;  1YIT F;  2IQQ A;  3M4S A;  5FNV B;  3F0E A;  2BTU A;  5EAZ A;  3R0P A;  4O4I B;  3MCA B;  1T0K B;  3VI6 A;  1X7O A;  2AIF A;  4ZHY B;  1Z5W A;  5LP6 C;  2V9Y A;  3M84 A;  3HTN A;  4X1Y B;  4C8G A;  3JAK A;  4E6E A;  1TVK B;  5EYP B;  4WBN A;  3ZP7 A;  2ZVY A;  4BVQ A;  3LWP C;  2EWC A;  4PWT A;  4ZOL B;  3IMP A;  5LXT A;  3CPW F;  5LP6 A;  1JY8 A;  4IHJ B;  3S0H A;  3SIU A;  4TV8 B;  5JCO C;  5EO3 A;  3GYQ A;  4BY9 D;  3WGJ A;  5LA6 A;  5J2T A;  3CG6 A;  3HWU A;  5EYP A;  3N4Z A;  3RYH A;  3P10 A;  5IJ0 B;  5MN4 A;  3LFO A;  4YJ3 B;  4X1Y A;  4O4J A;  3I7T A;  4KWE A;  3V4D A;  3WXM B;  1M90 H;  3FD6 A;  5DCV A;  5J2U A;  3CCM F;  4O4I A;  2VXY A;  1YJ9 F;  2ZF8 A;  4BVT A;  1VQN F;  5IYZ A;  5FNV A;  1H48 A;  4X1K A;  2QA4 F;  3JAT A;  1JJ2 F;  1K8A H;  3K0T A;  4U39 A;  2UYP A;  2N48 A;  1W57 A;  4C81 A;  4U3J A;  1TUB A;  2K1S A;  4B62 A;  1YHQ F;  1VQ5 F;  3RE3 A;  1QU9 A;  2CHT A;  1W55 A;  4O4H A;  3G4S F;  3OW2 F;  3E22 B;  3JAR A;  5G4V C;  3F0F A;  4I50 A;  1IV2 A;  1FNK A;  3LDT A;  4G4X A;  3RYI A;  5CA1 A;  5KX5 B;  1IV1 A;  3QHD A;  4O2A B;  4BW0 B;  3RYF A;  2QEX F;  5EWR A;  3DC2 A;  1W2B F;  1VQM F;  4C8E A;  3IR9 A;  2VGM A;  3ZP4 A;  4ZI7 B;  5GON A;  3N4Y A;  4G4W A;  4EB6 A;  2VAP A;  1UI9 A;  2GZL A;  3RA6 A;  3CCE F;  1FFX A;  3CMA F;  1RQ7 A;  2FGY A;  2RHL A;  3FFM A;  5G4U C;  5GAN K;  3LYB A;  5CB4 A;  1RLU A;  4R40 B;  3RYC B;  4LNU A;  3CXC F;  1JFF A;  2ZOD A;  4I4T A;  4X3M A;  4BT5 A;  3LWV C;  1Q8R A;  3JAL B;  2CWJ A;  3SIV A;  1CK2 A;  5KMG B;  4TZZ A;  3VMF B;  1JFF B;  3F0G A;  3ZOP A;  1W5F A;  2KG4 A;  5CA0 A;  3RYC A;  2HP0 A;  3K14 A;  3F0D A;  4O4H B;  1W3E X;  1NMU B;  2AMT A;  1IPA A;  1KD1 H;  3IEQ A;  3NMU C;  3IKE A;  5GON B;  5IJ9 B;  3JCM M;  2HVY D;  2BO1 A;  4ZHQ A;  5EZY B;  5IJ9 A;  5GIP C;  1VHA A;  3AGK A;  3HKD B;  1VQV A;  1W5E A;  2UYK A;  5C8Y A;  5IT9 M;  2L26 A;  2QI2 A;  3CME F;  3CCQ F;  2UYN B;  4IIJ A;  3P0Z A;  3CCV F;  2CW4 A;  5LP6 B;  5GIO C;  4X20 A;  5LXT B;  2LBT A;  1TUB B;  1CLI A;  3VIU A;  1GO0 A;  2BTO A;  3KJK A;  3WJQ A;  3PAF A;  1R1M A;  5JH7 B;  1JN1 A;  4EI7 A;  3V7Q A;  1T0A A;  1X52 A;  3CPQ A;  3WPW A;  2DYY A;  2PHN A;  1VQP F;  2ZAU A;  4XCQ A;  1KQS F;  1VQ4 F;  5JVD B;  1QD9 A;  5LOV A;  2VAM A;  1YIJ F;  3J7A R;  3MBM A;  2OTM A;  3S0W A;  3UT5 B;  1DT9 A;  3RYF B;  4O2A A;  3V3T A;  1S72 F;  3CB2 A;  3VCZ A;  1VQO F;  1VQ8 F;  1SA0 B;  1NQ3 A;  2W8B C;  4BVR A;  4I55 B;  4IHJ A;  1Z5V A;  2YYE A;  2RB9 A; 
#chains in the Genus database with same CATH homology
 1T0A A;  3ERN A;  3EOR A;  3KE1 A;  3F0G A;  3P10 A;  1H47 A;  1VHA A;  3F0E A;  3IKF A;  4C8E A;  3FBA A;  2PMP A;  4C8I A;  1U3P A;  3B6N A;  3FPI A;  3RE3 A;  1KNJ A;  3GHZ A;  3K14 A;  3F0D A;  1W55 A;  2AMT A;  3K2X A;  3T80 A;  4C82 A;  2GZL A;  1KNK A;  3ESJ A;  3MBM A;  1IV3 A;  1JY8 A;  3IEQ A;  4C8G A;  3F0F A;  5B8F A;  3IKE A;  1GX1 A;  1U43 A;  3P0Z A;  1VH8 A;  1IV4 A;  1H48 A;  3ELC A;  4C81 A;  3F6M A;  1U40 A;  1IV2 A;  1U3L A;  3IEW A;  2UZH A;  3Q8H A;  1W57 A;  1IV1 A;  1JN1 A;  1YQN A;  3QHD A;  3JVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...