3EORA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 41
structure length 157
sequence length 157
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3eorA00
2PMPA 3F0GA 3F0FA 3K2XA 3B6NA 1W57A 3FBAA 3KE1A 3T80A 1H47A 2AMTA 1JY8A 4C8EA 1U3PA 3EORA 3ESJA 1W55A 1KNJA 3P10A 3Q8HA 3IKEA 4C8GA 5B8FA 4C8IA 1T0AA 1IV3A 3ERNA 3IEQA 1VH8A 3F6MA 3K14A 3MBMA 1GX1A 1IV4A 1KNKA 1U40A 3FPIA 3F0EA 1IV2A 1VHAA 1YQNA 4C81A 4C82A 1IV1A 3IKFA 1JN1A 3ELCA 1U3LA 2GZLA 3JVHA 1U43A 3QHDA 3GHZA 3RE3A 1H48A 3P0ZA 3F0DA 3IEWA 2UZHA
chains in the Genus database with same CATH superfamily
3FFMA 2OHWA 2CSLA 1J7HA 2LCAA 3HKEB 4O2AA 5KMGA 3BYQA 5BMVA 3CYPB 5EO3A 3VCZA 4IHJA 5JH7A 5LP6C 3HAXD 1VK3A 3F6MA 5JCOC 4C4WC 2CWJA 5CA0B 1FFXB 1JJ2F 2AIFA 3F0EA 3MDOA 1Q7YH 2Z01A 1VHAA 1VQ6F 1JN1A 2QEXF 5EYPB 4O4HA 3IMPA 3VO8A 1OFUA 3VYSC 5B8FA 1GZ0A 1W5EA 2YYEA 1Q81H 2K1SA 4O4JB 2OTMA 2AMTA 3CCVF 2RB9A 1ONIA 3WPWA 3C9TA 1Q82H 3SIVA 1QU9A 1RQ7A 2VAPA 3CB2A 3HKCA 1GX1A 5IYZA 3U0OA 4EI8A 2I6RA 2HS0A 5LYJB 1W5FA 4X1KA 1QVGF 4NUTA 5HWEA 5LOVA 3N2GA 3VYTC 1RLGA 5ITZB 2RHOA 3GHZA 5JCOA 3VOBA 3CC7F 4B45A 2HS3A 3OBWA 4YJ3B 3E22B 2HS4A 4RQOA 1UI9A 5FNVA 3CCRF 4B46A 1XBIA 3I7TA 4BVQA 2R6R1 3AGKA 2VAMA 2ZF8A 3G4SF 1JFFA 5C8YA 4NWOB 1IV4A 4ZHVA 3GTZA 4TV8B 2V9YA 1YGYA 3I55F 5IJ0B 1N8RH 3S0YA 1QAHA 2ZOVA 3SIUA 3HKEA 5GINC 2UYKA 3HKCB 4XCQA 3VOAA 1JY8A 5MN4A 1H7MA 4HNAA 3P10A 2HX0A 1K73H 3NVKE 3MCAB 2QI2A 3JAWB 3VMFB 1Q86H 3IEQA 5HY4A 2RHHA 1NMUB 4EI9A 2DT4A 3WXMB 3KIZA 5GAPK 3HTNA 1VQVA 4KWEA 4BT6A 2UYNA 5JVDB 1K9MH 3C8LA 4RHAA 1RLUA 1YI2F 2PMPA 1NQ3A 4PWTA 3JCMM 3K2XA 1KD1H 3FBAA 1K8AH 2OTLF 1W41A 5EWRA 2VXYA 1CN7A 3M4SA 2ZODA 3E20B 3CC4F 3JAKB 4B5CA 4YJ2A 2Z1UA 3K14A 3S06A 4ZHQA 4X20A 4BW0B 3KJJA 3NK6A 4O2BB 3V7QA 1T0KB 2OZBA 4BT4A 1YJNF 3K12A 3M84A 2F9ZC 5GONA 3RYFA 1SA0A 5DCVA 3C9UA 4O4IA 1QVFF 3P4EA 3T80A 5ITZA 2Z1TA 2KG4A 3TD3A 2WALA 2BTQB 3ESJA 3O85A 4WBNB 4TV8A 3RYHA 5LYJA 3MBMA 3RYHB 3N2KA 5LA6A 3CCMF 2Q1YA 4I4TB 5HXUA 1W59A 4U3JA 4LCKA 4TV9B 3ON1A 1M90H 2NMUA 2CVLA 4TUYB 1X7OA 3D00A 5GONB 1VQ4F 3IEWA 3JASB 3WPXA 1VQ7F 2IAFA 4EB6B 3CYQA 4X20B 4C8EA 3EORA 3LFOA 1W55A 3V3TA 1GO0A 4BVTA 1X7PA 2QTPA 3ERNA 3JAKA 4YJ2B 1DBFA 5GIPC 2YXZA 5IJ9B 5CA0A 4C82A 5FLXM 4WBNA 5EAZA 1TVKB 3WGNA 4G4WA 3RYFB 4O4JA 3GYQA 5BMVB 2ZAUA 4C8GA 1W5AA 1VQ9F 2UYNB 5JVDA 3JAWA 3RYCB 4X3MA 1VQOF 3KE1A 2H8EA 4G4XA 4FFBB 5HP8A 5AVMA 3JALB 5HY0A 3JASA 1TUBB 3UT5B 1VQ8F 4O2BA 5EB1B 1YIJF 3HKDA 4C8IA 5HY1A 2KTVA 3FD5A 5LOVB 3J7AR 2CHTA 2HP3A 5EZYA 4C81A 3G71F 1FNKA 5IJ0A 3J80M 5HXZA 4ZOLA 2Z1FA 3CPWF 3JVHA 1VQNF 2P6YA 3F0DA 3CPQA 2IQQA 5IT9M 1W3EX 3JAMM 3CCLF 1GO1A 1KC8H 3LWPC 1FSZA 2BTUA 4LNUA 4O4IB 2LBTA 3LWVC 1KNJA 3HKDB 4ZHWA 3ZP7A 3TD5A 5J2UB 3J81M 3E22A 1IPAA 4BY9D 3VTIC 2H8CA 1X52A 1Z5VA 4ZI7B 2G9IA 4FFBA 2KGWA 2VGNA 2MQEA 4U3JB 3IR9A 3IKFA 3ELCA 3D54A 3VYUC 3N2KB 3C9SA 4X1KB 5LA6B 4BT7A 4F6RB 3RA5A 3VIUA 3RE3A 3CXCF 4U39A 5EIBC 3PLAC 3HJWC 2LBXA 3WGJA 4BVSA 4EI7A 1XV2A 2Z1EA 2HVYD 1E7KA 2BTOA 3LMEA 1YHQF 3Q8HA 1TUBA 2CW4A 1W42A 1IV3A 2HRUA 3QTYA 3WJPA 2H6LA 3OONA 3LWOC 4EB6A 5FNVB 3LWRC 3CCJF 3RYIB 3I56F 3G6EF 4G4YA 4G4ZA 3P0ZA 5J2TA 3ZO8A 2EWCA 3HKBB 1VQKF 1SDSA 2L26A 3B6NA 3CD6F 1S72F 2HQSC 1ZWZA 5CB4A 1YJ9F 3N4YA 3PAFA 4IHJB 1VH8A 5IYZB 1DT9A 4BT3A 5LXTB 3CCUF 2ALEA 1FNJA 1IV2A 4I55B 1VQPF 3HKBA 4E6EA 3FD6A 1JFFB 5C8YB 1SZQA 3LWQC 3WGKA 1VQLF 2N48A 2QA4F 4TUYA 4X1IA 1H48A 3MCQA 2CZWA 5JQGB 4TV9A 1PXWA 2RHJA 2B33A 1W57A 4I50B 3NVIB 3TD4A 3CMEF 1QD9A 3S0HA 5FJ4C 1Q8RA 5KX5A 5CB4B 3R0PA 3V7EA 3RA6A 2W8BC 3JARA 3V4DA 1R1MA 1T0AA 3CC2F 1FFXA 1XHOA 5EZYB 1KNKA 1W2BF 2UYJA 3WGMA 5IJ9A 3LYBA 5J2TB 4DXDA 3L7QA 5G4UC 5HY2A 4O2AB 5KMGB 2UZHA 4DRXA 2IG8A 3RYCA 4BVRA 1M1KH 1PF5A 4YJ3A 4ZHQB 4X1IB 4O4LB 4X1YB 3NK7A 5EIBD 3S02A 4LNUB 1RQ2A 2KTUA 3ZP4A 2RHLA 3S03A 2BO1A 1X25A 3FPIA 3N4ZA 5GIOC 2OTJF 3JARB 5CA1A 4F6RA 2GZLA 3KJKA 4ZOLB 3WGLA 4ZK7A 4R40B 4G88A 3JATA 5LP6B 5JQGA 1UFYA 5MN5A 3QUWA 1JD1A 4BT2A 2LBWA 1SA0B 5A2QM 4B62A 1W581 3ZOPA 4DRXB 4HNAB 3CMAF 3D01A 5G4VC 1CK2A 3C9RA 3E1YA 2UYPA 4I4TA 2ZVYA 2ZVZA 4IIJB 1YQNA 3WJQA 4ZHYB 5CA1B 3CCSF 2AIZP 2HP0B 1NJIH 3K0TA 3QHDA 1U43A 3NMUC 4NQ3A 1YJWF 3N2GB 3M1XA 2R751 5HP7A 1RA4A 1VQ5F 3CG6A 2CHSA 3F0FA 4X3LA 3CCEF 1COMA 1H47A 2VGMA 3UT5A 4O4LA 1CLIA 3JALA 3DC2A 3OW2F 3RYIA 3KHNA 5MN6A 2Q1XA 4I50A 3WJRA 3DDNA 4TZZA 3VI6A 2PHNA 2I6DA 1IV1A 5J2UA 4G4VA 3S0WA 5LXTA 1TVKA 2DYYA 4BT5A 5GANK 4O4HB 4I55A 3JATB 5LP6A 2FC3A 3F0GA 4M8IA 3I3FA 1YITF 2JNBA 1U3PA 4ERHA 3CCQF 1OAPA 5JH7B 1XRGA 3IKEA 3MQWA 1KQSF 2GVIA 2HP0A 1W5BA 1U40A 4X1YA 4ZI7A 5KX5B 3HWUA 1VQMF 2HRYA 1ODEA 4IIJA 1Z5WA 3LDTA 2VAWA 5EB0A 1U3LA 5EYPA 1W40A 3OBYA 2FGYA 2GLZA
chains in the Genus database with same CATH topology
2PMPA 3F0GA 3F0FA 3K2XA 3B6NA 1W57A 3FBAA 3KE1A 3T80A 1H47A 2AMTA 1JY8A 4C8EA 1U3PA 3EORA 3ESJA 1W55A 1KNJA 3P10A 3Q8HA 3IKEA 4C8GA 5B8FA 4C8IA 1T0AA 1IV3A 3ERNA 3IEQA 1VH8A 3F6MA 3K14A 3MBMA 1GX1A 1IV4A 1KNKA 1U40A 3FPIA 3F0EA 1IV2A 1VHAA 1YQNA 4C81A 4C82A 1IV1A 3IKFA 1JN1A 3ELCA 1U3LA 2GZLA 3JVHA 1U43A 3QHDA 3GHZA 3RE3A 1H48A 3P0ZA 3F0DA 3IEWA 2UZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMP A;  3F0G A;  3F0F A;  3K2X A;  3B6N A;  1W57 A;  3FBA A;  3KE1 A;  3T80 A;  1H47 A;  2AMT A;  1JY8 A;  4C8E A;  1U3P A;  3EOR A;  3ESJ A;  1W55 A;  1KNJ A;  3P10 A;  3Q8H A;  3IKE A;  4C8G A;  5B8F A;  4C8I A;  1T0A A;  1IV3 A;  3ERN A;  3IEQ A;  1VH8 A;  3F6M A;  3K14 A;  3MBM A;  1GX1 A;  1IV4 A;  1KNK A;  1U40 A;  3FPI A;  3F0E A;  1IV2 A;  1VHA A;  1YQN A;  4C81 A;  4C82 A;  1IV1 A;  3IKF A;  1JN1 A;  3ELC A;  1U3L A;  2GZL A;  3JVH A;  1U43 A;  3QHD A;  3GHZ A;  3RE3 A;  1H48 A;  3P0Z A;  3F0D A;  3IEW A;  2UZH A; 
#chains in the Genus database with same CATH topology
 3FFM A;  2OHW A;  2CSL A;  1J7H A;  2LCA A;  3HKE B;  4O2A A;  5KMG A;  3BYQ A;  5BMV A;  3CYP B;  5EO3 A;  3VCZ A;  4IHJ A;  5JH7 A;  5LP6 C;  3HAX D;  1VK3 A;  3F6M A;  5JCO C;  4C4W C;  2CWJ A;  5CA0 B;  1FFX B;  1JJ2 F;  2AIF A;  3F0E A;  3MDO A;  1Q7Y H;  2Z01 A;  1VHA A;  1VQ6 F;  1JN1 A;  2QEX F;  5EYP B;  4O4H A;  3IMP A;  3VO8 A;  1OFU A;  3VYS C;  5B8F A;  1GZ0 A;  1W5E A;  2YYE A;  1Q81 H;  2K1S A;  4O4J B;  2OTM A;  2AMT A;  3CCV F;  2RB9 A;  1ONI A;  3WPW A;  3C9T A;  1Q82 H;  3SIV A;  1QU9 A;  1RQ7 A;  2VAP A;  3CB2 A;  3HKC A;  1GX1 A;  5IYZ A;  3U0O A;  4EI8 A;  2I6R A;  2HS0 A;  5LYJ B;  1W5F A;  4X1K A;  1QVG F;  4NUT A;  5HWE A;  5LOV A;  3N2G A;  3VYT C;  1RLG A;  5ITZ B;  2RHO A;  3GHZ A;  5JCO A;  3VOB A;  3CC7 F;  4B45 A;  2HS3 A;  3OBW A;  4YJ3 B;  3E22 B;  2HS4 A;  4RQO A;  1UI9 A;  5FNV A;  3CCR F;  4B46 A;  1XBI A;  3I7T A;  4BVQ A;  2R6R 1;  3AGK A;  2VAM A;  2ZF8 A;  3G4S F;  1JFF A;  5C8Y A;  4NWO B;  1IV4 A;  4ZHV A;  3GTZ A;  4TV8 B;  2V9Y A;  1YGY A;  3I55 F;  5IJ0 B;  1N8R H;  3S0Y A;  1QAH A;  2ZOV A;  3SIU A;  3HKE A;  5GIN C;  2UYK A;  3HKC B;  4XCQ A;  3VOA A;  1JY8 A;  5MN4 A;  1H7M A;  4HNA A;  3P10 A;  2HX0 A;  1K73 H;  3NVK E;  3MCA B;  2QI2 A;  3JAW B;  3VMF B;  1Q86 H;  3IEQ A;  5HY4 A;  2RHH A;  1NMU B;  4EI9 A;  2DT4 A;  3WXM B;  3KIZ A;  5GAP K;  3HTN A;  1VQV A;  4KWE A;  4BT6 A;  2UYN A;  5JVD B;  1K9M H;  3C8L A;  4RHA A;  1RLU A;  1YI2 F;  2PMP A;  1NQ3 A;  4PWT A;  3JCM M;  3K2X A;  1KD1 H;  3FBA A;  1K8A H;  2OTL F;  1W41 A;  5EWR A;  2VXY A;  1CN7 A;  3M4S A;  2ZOD A;  3E20 B;  3CC4 F;  3JAK B;  4B5C A;  4YJ2 A;  2Z1U A;  3K14 A;  3S06 A;  4ZHQ A;  4X20 A;  4BW0 B;  3KJJ A;  3NK6 A;  4O2B B;  3V7Q A;  1T0K B;  2OZB A;  4BT4 A;  1YJN F;  3K12 A;  3M84 A;  2F9Z C;  5GON A;  3RYF A;  1SA0 A;  5DCV A;  3C9U A;  4O4I A;  1QVF F;  3P4E A;  3T80 A;  5ITZ A;  2Z1T A;  2KG4 A;  3TD3 A;  2WAL A;  2BTQ B;  3ESJ A;  3O85 A;  4WBN B;  4TV8 A;  3RYH A;  5LYJ A;  3MBM A;  3RYH B;  3N2K A;  5LA6 A;  3CCM F;  2Q1Y A;  4I4T B;  5HXU A;  1W59 A;  4U3J A;  4LCK A;  4TV9 B;  3ON1 A;  1M90 H;  2NMU A;  2CVL A;  4TUY B;  1X7O A;  3D00 A;  5GON B;  1VQ4 F;  3IEW A;  3JAS B;  3WPX A;  1VQ7 F;  2IAF A;  4EB6 B;  3CYQ A;  4X20 B;  4C8E A;  3EOR A;  3LFO A;  1W55 A;  3V3T A;  1GO0 A;  4BVT A;  1X7P A;  2QTP A;  3ERN A;  3JAK A;  4YJ2 B;  1DBF A;  5GIP C;  2YXZ A;  5IJ9 B;  5CA0 A;  4C82 A;  5FLX M;  4WBN A;  5EAZ A;  1TVK B;  3WGN A;  4G4W A;  3RYF B;  4O4J A;  3GYQ A;  5BMV B;  2ZAU A;  4C8G A;  1W5A A;  1VQ9 F;  2UYN B;  5JVD A;  3JAW A;  3RYC B;  4X3M A;  1VQO F;  3KE1 A;  2H8E A;  4G4X A;  4FFB B;  5HP8 A;  5AVM A;  3JAL B;  5HY0 A;  3JAS A;  1TUB B;  3UT5 B;  1VQ8 F;  4O2B A;  5EB1 B;  1YIJ F;  3HKD A;  4C8I A;  5HY1 A;  2KTV A;  3FD5 A;  5LOV B;  3J7A R;  2CHT A;  2HP3 A;  5EZY A;  4C81 A;  3G71 F;  1FNK A;  5IJ0 A;  3J80 M;  5HXZ A;  4ZOL A;  2Z1F A;  3CPW F;  3JVH A;  1VQN F;  2P6Y A;  3F0D A;  3CPQ A;  2IQQ A;  5IT9 M;  1W3E X;  3JAM M;  3CCL F;  1GO1 A;  1KC8 H;  3LWP C;  1FSZ A;  2BTU A;  4LNU A;  4O4I B;  2LBT A;  3LWV C;  1KNJ A;  3HKD B;  4ZHW A;  3ZP7 A;  3TD5 A;  5J2U B;  3J81 M;  3E22 A;  1IPA A;  4BY9 D;  3VTI C;  2H8C A;  1X52 A;  1Z5V A;  4ZI7 B;  2G9I A;  4FFB A;  2KGW A;  2VGN A;  2MQE A;  4U3J B;  3IR9 A;  3IKF A;  3ELC A;  3D54 A;  3VYU C;  3N2K B;  3C9S A;  4X1K B;  5LA6 B;  4BT7 A;  4F6R B;  3RA5 A;  3VIU A;  3RE3 A;  3CXC F;  4U39 A;  5EIB C;  3PLA C;  3HJW C;  2LBX A;  3WGJ A;  4BVS A;  4EI7 A;  1XV2 A;  2Z1E A;  2HVY D;  1E7K A;  2BTO A;  3LME A;  1YHQ F;  3Q8H A;  1TUB A;  2CW4 A;  1W42 A;  1IV3 A;  2HRU A;  3QTY A;  3WJP A;  2H6L A;  3OON A;  3LWO C;  4EB6 A;  5FNV B;  3LWR C;  3CCJ F;  3RYI B;  3I56 F;  3G6E F;  4G4Y A;  4G4Z A;  3P0Z A;  5J2T A;  3ZO8 A;  2EWC A;  3HKB B;  1VQK F;  1SDS A;  2L26 A;  3B6N A;  3CD6 F;  1S72 F;  2HQS C;  1ZWZ A;  5CB4 A;  1YJ9 F;  3N4Y A;  3PAF A;  4IHJ B;  1VH8 A;  5IYZ B;  1DT9 A;  4BT3 A;  5LXT B;  3CCU F;  2ALE A;  1FNJ A;  1IV2 A;  4I55 B;  1VQP F;  3HKB A;  4E6E A;  3FD6 A;  1JFF B;  5C8Y B;  1SZQ A;  3LWQ C;  3WGK A;  1VQL F;  2N48 A;  2QA4 F;  4TUY A;  4X1I A;  1H48 A;  3MCQ A;  2CZW A;  5JQG B;  4TV9 A;  1PXW A;  2RHJ A;  2B33 A;  1W57 A;  4I50 B;  3NVI B;  3TD4 A;  3CME F;  1QD9 A;  3S0H A;  5FJ4 C;  1Q8R A;  5KX5 A;  5CB4 B;  3R0P A;  3V7E A;  3RA6 A;  2W8B C;  3JAR A;  3V4D A;  1R1M A;  1T0A A;  3CC2 F;  1FFX A;  1XHO A;  5EZY B;  1KNK A;  1W2B F;  2UYJ A;  3WGM A;  5IJ9 A;  3LYB A;  5J2T B;  4DXD A;  3L7Q A;  5G4U C;  5HY2 A;  4O2A B;  5KMG B;  2UZH A;  4DRX A;  2IG8 A;  3RYC A;  4BVR A;  1M1K H;  1PF5 A;  4YJ3 A;  4ZHQ B;  4X1I B;  4O4L B;  4X1Y B;  3NK7 A;  5EIB D;  3S02 A;  4LNU B;  1RQ2 A;  2KTU A;  3ZP4 A;  2RHL A;  3S03 A;  2BO1 A;  1X25 A;  3FPI A;  3N4Z A;  5GIO C;  2OTJ F;  3JAR B;  5CA1 A;  4F6R A;  2GZL A;  3KJK A;  4ZOL B;  3WGL A;  4ZK7 A;  4R40 B;  4G88 A;  3JAT A;  5LP6 B;  5JQG A;  1UFY A;  5MN5 A;  3QUW A;  1JD1 A;  4BT2 A;  2LBW A;  1SA0 B;  5A2Q M;  4B62 A;  1W58 1;  3ZOP A;  4DRX B;  4HNA B;  3CMA F;  3D01 A;  5G4V C;  1CK2 A;  3C9R A;  3E1Y A;  2UYP A;  4I4T A;  2ZVY A;  2ZVZ A;  4IIJ B;  1YQN A;  3WJQ A;  4ZHY B;  5CA1 B;  3CCS F;  2AIZ P;  2HP0 B;  1NJI H;  3K0T A;  3QHD A;  1U43 A;  3NMU C;  4NQ3 A;  1YJW F;  3N2G B;  3M1X A;  2R75 1;  5HP7 A;  1RA4 A;  1VQ5 F;  3CG6 A;  2CHS A;  3F0F A;  4X3L A;  3CCE F;  1COM A;  1H47 A;  2VGM A;  3UT5 A;  4O4L A;  1CLI A;  3JAL A;  3DC2 A;  3OW2 F;  3RYI A;  3KHN A;  5MN6 A;  2Q1X A;  4I50 A;  3WJR A;  3DDN A;  4TZZ A;  3VI6 A;  2PHN A;  2I6D A;  1IV1 A;  5J2U A;  4G4V A;  3S0W A;  5LXT A;  1TVK A;  2DYY A;  4BT5 A;  5GAN K;  4O4H B;  4I55 A;  3JAT B;  5LP6 A;  2FC3 A;  3F0G A;  4M8I A;  3I3F A;  1YIT F;  2JNB A;  1U3P A;  4ERH A;  3CCQ F;  1OAP A;  5JH7 B;  1XRG A;  3IKE A;  3MQW A;  1KQS F;  2GVI A;  2HP0 A;  1W5B A;  1U40 A;  4X1Y A;  4ZI7 A;  5KX5 B;  3HWU A;  1VQM F;  2HRY A;  1ODE A;  4IIJ A;  1Z5W A;  3LDT A;  2VAW A;  5EB0 A;  1U3L A;  5EYP A;  1W40 A;  3OBY A;  2FGY A;  2GLZ A; 
#chains in the Genus database with same CATH homology
 2PMP A;  3F0G A;  3F0F A;  3K2X A;  3B6N A;  1W57 A;  3FBA A;  3KE1 A;  3T80 A;  1H47 A;  2AMT A;  1JY8 A;  4C8E A;  1U3P A;  3EOR A;  3ESJ A;  1W55 A;  1KNJ A;  3P10 A;  3Q8H A;  3IKE A;  4C8G A;  5B8F A;  4C8I A;  1T0A A;  1IV3 A;  3ERN A;  3IEQ A;  1VH8 A;  3F6M A;  3K14 A;  3MBM A;  1GX1 A;  1IV4 A;  1KNK A;  1U40 A;  3FPI A;  3F0E A;  1IV2 A;  1VHA A;  1YQN A;  4C81 A;  4C82 A;  1IV1 A;  3IKF A;  1JN1 A;  3ELC A;  1U3L A;  2GZL A;  3JVH A;  1U43 A;  3QHD A;  3GHZ A;  3RE3 A;  1H48 A;  3P0Z A;  3F0D A;  3IEW A;  2UZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...