3EORA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 41
structure length 157
sequence length 157
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3eorA00
3IEQA 1IV4A 1H47A 3RE3A 3K2XA 1W57A 4C8GA 1U43A 1YQNA 3F0EA 4C8IA 1T0AA 3FBAA 2GZLA 3F0FA 3P0ZA 2UZHA 5B8FA 3B6NA 1IV2A 3ESJA 1VHAA 1U3LA 3IKEA 3ELCA 1U3PA 3FPIA 3JVHA 3GHZA 1W55A 1JY8A 2PMPA 4C81A 1H48A 2AMTA 3F0DA 3ERNA 1U40A 1VH8A 1KNJA 1KNKA 3K14A 3KE1A 3QHDA 4C8EA 1GX1A 3MBMA 1IV3A 3P10A 3EORA 3F0GA 1IV1A 3F6MA 3T80A 1JN1A 4C82A 3IEWA 3Q8HA 3IKFA
chains in the Genus database with same CATH superfamily
3C9UA 3OW2F 3JASB 3K2XA 1VQKF 2BTUA 5FNVB 2HP3A 1KQSF 5GAPK 4DXDA 3GTZA 1T0KB 5KX5B 1SZQA 5GIOC 4O4HA 3ZO8A 5G4VC 2IAFA 1W5AA 4ZHQB 4EI7A 3RYCB 5EYPA 3WJPA 3WJRA 3G4SF 5LXTB 4U39A 1UI9A 3C8LA 1KNJA 3TD3A 3CG6A 5GONB 4R40B 4F6RA 3HWUA 2HP0B 3T80A 5HWEA 4DRXA 3CCRF 1W581 3AGKA 4ZOLB 1XRGA 3CXCF 2LBTA 4BVSA 4X1KB 2UZHA 5BMVA 3VYUC 5J2UA 5HXUA 5JCOC 3RYHB 3LYBA 3MCQA 3ON1A 5CB4A 3LWVC 4BT6A 3RA5A 2LBXA 4O4LB 1GO1A 4O4JA 2L26A 5LYJB 2AMTA 5IJ0A 1VQPF 3FFMA 5LP6C 2Z1UA 3S03A 1XV2A 4I50B 2H6LA 4TV8B 4U3JB 5JVDB 3JATA 4I4TB 1COMA 5KMGB 3N4ZA 1W5FA 5JCOA 4X1IA 4C82A 1YHQF 2BTOA 5JH7B 1R1MA 3D54A 4ERHA 5GANK 4BT3A 1CN7A 1NQ3A 3WGNA 1VQ5F 5DCVA 3HKBA 3ESJA 5CA0B 1RA4A 2HS4A 1VQ4F 1YJ9F 4EB6B 4EI9A 1YJNF 4FFBB 3FD6A 4X1YB 4X20B 3MDOA 2QA4F 2R6R1 1YI2F 3MBMA 5MN5A 3CCVF 4YJ2A 2WALA 1TVKA 3CC7F 3HAXD 1QVFF 5IYZA 1X7OA 3R0PA 3ZP7A 2YYEA 1IPAA 3D01A 3IEQA 2BTQB 4IHJA 5EZYB 3JAKB 3BYQA 1VQVA 4BT2A 3E22B 1IV2A 2H8CA 1E7KA 1Z5VA 2KGWA 3I7TA 3L7QA 4HNAA 1TUBB 3ELCA 4X3LA 4TZZA 5C8YB 1YIJF 3JASA 4BT7A 5LP6B 5FNVA 3I3FA 3VOAA 1K8AH 2W8BC 2OTMA 5HY1A 3N2KB 3LWQC 3J7AR 5KX5A 2ZVZA 1JN1A 4RQOA 4ZHQA 1PF5A 5HY0A 2H8EA 2B33A 4C8IA 3M4SA 4KWEA 4G88A 3WGLA 5LXTA 3B6NA 2UYNB 4C4WC 3HKDB 5GIPC 2ZODA 1NMUB 5A2QM 1ZWZA 5IT9M 1GO0A 1U3PA 4G4ZA 3WXMB 1W41A 2HP0A 4B45A 1KD1H 3OBWA 1N8RH 3NK6A 3CMAF 4ZOLA 5J2TB 5ITZB 4O4IA 3C9SA 1IV3A 5HXZA 1H7MA 2NMUA 3V7QA 2HS0A 3VYSC 3RYHA 3CCLF 2RHJA 3IKFA 3JALB 3LWOC 1H47A 3RE3A 1W57A 1U43A 1X52A 4O4LA 1W40A 4TV8A 4LCKA 2OHWA 4U3JA 2KG4A 2Z1FA 5JVDA 3S06A 3GHZA 3VIUA 1W55A 1XHOA 3G71F 5FLXM 4M8IA 5JH7A 3G6EF 3CCEF 1UFYA 1JFFB 2CHSA 1YITF 1OFUA 1M1KH 4TUYA 2OTLF 3S0WA 3EORA 3CYQA 2Z1EA 3TD4A 5CA0A 4ZI7A 3OONA 3IEWA 4EB6A 3SIUA 5MN6A 1FNKA 3CCJF 4FFBA 1W5BA 4X1YA 5LOVB 2UYPA 1QAHA 3C9RA 1RQ7A 5AVMA 2OZBA 3CB2A 3N4YA 2VGMA 3ZP4A 5EZYA 2HVYD 3JAKA 5IJ9B 3NVIB 2FGYA 4G4XA 3JARB 3P10A 3S02A 1FFXB 3E22A 5EB0A 3KJJA 2QI2A 4E6EA 1TUBA 3RYFA 3VTIC 5C8YA 1YQNA 3NVKE 1ONIA 1DT9A 4BW0B 4IIJB 3J81M 1ODEA 3JAWB 3DDNA 5LP6A 3NMUC 3IKEA 3CPWF 3N2KA 4ZK7A 1DBFA 3KJKA 4BVQA 3CMEF 2AIZP 2VAMA 1QVGF 1FSZA 1VH8A 4O4HB 4I55B 1GX1A 1YGYA 4LNUB 3WPWA 2GLZA 2UYNA 3LDTA 3HKDA 1IV1A 3OBYA 2LBWA 1M90H 2ZF8A 3CCSF 1VQNF 1IV4A 1RLGA 3WGJA 1S72F 5B8FA 3FBAA 5GINC 2F9ZC 2OTJF 5HP8A 1Z5WA 5J2TA 1VHAA 2CSLA 5EIBD 4DRXB 1Q81H 2HQSC 2CVLA 5HY4A 1Q86H 4NQ3A 1Q8RA 4YJ3B 2UYKA 3JALA 3ERNA 1U40A 3VOBA 3E20B 3QHDA 1JD1A 3CYPB 2DYYA 4B5CA 3Q8HA 1PXWA 5JQGB 1GZ0A 1K73H 3RYCA 1VQ7F 2I6RA 4G4YA 1JFFA 5GONA 1RLUA 3RYIB 3IMPA 4X3MA 2DT4A 4O2BB 1QU9A 2QTPA 3CPQA 3CCQF 3VYTC 4C8EA 1XBIA 2P6YA 4X1KA 3CCMF 3LMEA 3ZOPA 5LOVA 1VQOF 2RHHA 1VQLF 3E1YA 3N2GB 2V9YA 1TVKB 5LYJA 3O85A 5IYZB 2Q1YA 5IJ9A 1W59A 4BVTA 4WBNB 1SDSA 4I50A 3JARA 1X7PA 1YJWF 1FFXA 4XCQA 4I4TA 5KMGA 2CHTA 2N48A 3UT5B 3U0OA 3JCMM 1KNKA 3KIZA 3QTYA 3C9TA 2KTVA 2MQEA 5G4UC 3JAWA 5LA6B 1CLIA 3F0EA 1FNJA 1T0AA 2RHLA 1Q82H 4X20A 4I55A 4LNUA 3HJWC 2AIFA 2ZVYA 3HKCB 4C81A 5HP7A 1SA0B 4O2AB 3HKEB 2EWCA 3K0TA 4B46A 3DC2A 3FD5A 3V3TA 3KE1A 5CA1B 3CC2F 1W2BF 2HS3A 4TV9B 3F0GA 4PWTA 3F6MA 3JAMM 2YXZA 2RB9A 1W5EA 4NUTA 3WPXA 3V7EA 3IR9A 3QUWA 4O4IB 4YJ3A 4EI8A 3F0FA 2RHOA 3GYQA 2HRUA 4ZHWA 4BY9D 1U3LA 3LWPC 3FPIA 2R751 3JVHA 3V4DA 3MQWA 3S0HA 2ALEA 1H48A 3K12A 5HY2A 3KHNA 5JQGA 2G9IA 4RHAA 3J80M 2CZWA 4BVRA 1KC8H 2VXYA 5EYPB 5EAZA 3NK7A 2JNBA 1NJIH 1OAPA 3VI6A 3RYIA 2GVIA 4TUYB 2VAPA 2GZLA 4O2BA 3CCUF 2FC3A 1QD9A 4F6RB 4ZI7B 4NWOB 5ITZA 2HRYA 2PMPA 3VO8A 5BMVB 5EO3A 2VGNA 5J2UB 1K9MH 2Q1XA 4BT5A 3I55F 3N2GA 1VQ9F 1X25A 3VCZA 4B62A 5CB4B 2HX0A 3TD5A 4WBNA 2CW4A 1RQ2A 4O4JB 1CK2A 5IJ0B 1W3EX 2ZOVA 3HTNA 2CWJA 3UT5A 1VQ6F 3JATB 1J7HA 1VQMF 4X1IB 3RYFB 4G4VA 3WGKA 2IQQA 5EWRA 5LA6A 1JY8A 2I6DA 2LCAA 2Z1TA 5EB1B 3CD6F 2QEXF 1Q7YH 3M1XA 3HKBB 5EIBC 5MN4A 3K14A 4G4WA 1JJ2F 3SIVA 3PLAC 4ZHYB 5FJ4C 3WGMA 3RA6A 2ZAUA 4C8GA 2K1SA 3HKCA 3S0YA 3P0ZA 2KTUA 1SA0A 2UYJA 2VAWA 3P4EA 3HKEA 3M84A 4O2AA 4YJ2B 2PHNA 2BO1A 2Z01A 4ZHVA 3CC4F 5CA1A 3MCAB 4TV9A 1W42A 4IHJB 3VMFB 3F0DA 3WJQA 4BT4A 2IG8A 3D00A 3LWRC 3LFOA 3I56F 3PAFA 4HNAB 1VK3A 1VQ8F 4IIJA
chains in the Genus database with same CATH topology
3IEQA 1IV4A 1H47A 3RE3A 3K2XA 1W57A 4C8GA 1U43A 1YQNA 3F0EA 4C8IA 1T0AA 3FBAA 2GZLA 3F0FA 3P0ZA 2UZHA 5B8FA 3B6NA 1IV2A 3ESJA 1VHAA 1U3LA 3IKEA 3ELCA 1U3PA 3FPIA 3JVHA 3GHZA 1W55A 1JY8A 2PMPA 4C81A 1H48A 2AMTA 3F0DA 3ERNA 1U40A 1VH8A 1KNJA 1KNKA 3K14A 3KE1A 3QHDA 4C8EA 1GX1A 3MBMA 1IV3A 3P10A 3EORA 3F0GA 1IV1A 3F6MA 3T80A 1JN1A 4C82A 3IEWA 3Q8HA 3IKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEQ A;  1IV4 A;  1H47 A;  3RE3 A;  3K2X A;  1W57 A;  4C8G A;  1U43 A;  1YQN A;  3F0E A;  4C8I A;  1T0A A;  3FBA A;  2GZL A;  3F0F A;  3P0Z A;  2UZH A;  5B8F A;  3B6N A;  1IV2 A;  3ESJ A;  1VHA A;  1U3L A;  3IKE A;  3ELC A;  1U3P A;  3FPI A;  3JVH A;  3GHZ A;  1W55 A;  1JY8 A;  2PMP A;  4C81 A;  1H48 A;  2AMT A;  3F0D A;  3ERN A;  1U40 A;  1VH8 A;  1KNJ A;  1KNK A;  3K14 A;  3KE1 A;  3QHD A;  4C8E A;  1GX1 A;  3MBM A;  1IV3 A;  3P10 A;  3EOR A;  3F0G A;  1IV1 A;  3F6M A;  3T80 A;  1JN1 A;  4C82 A;  3IEW A;  3Q8H A;  3IKF A; 
#chains in the Genus database with same CATH topology
 3C9U A;  3OW2 F;  3JAS B;  3K2X A;  1VQK F;  2BTU A;  5FNV B;  2HP3 A;  1KQS F;  5GAP K;  4DXD A;  3GTZ A;  1T0K B;  5KX5 B;  1SZQ A;  5GIO C;  4O4H A;  3ZO8 A;  5G4V C;  2IAF A;  1W5A A;  4ZHQ B;  4EI7 A;  3RYC B;  5EYP A;  3WJP A;  3WJR A;  3G4S F;  5LXT B;  4U39 A;  1UI9 A;  3C8L A;  1KNJ A;  3TD3 A;  3CG6 A;  5GON B;  4R40 B;  4F6R A;  3HWU A;  2HP0 B;  3T80 A;  5HWE A;  4DRX A;  3CCR F;  1W58 1;  3AGK A;  4ZOL B;  1XRG A;  3CXC F;  2LBT A;  4BVS A;  4X1K B;  2UZH A;  5BMV A;  3VYU C;  5J2U A;  5HXU A;  5JCO C;  3RYH B;  3LYB A;  3MCQ A;  3ON1 A;  5CB4 A;  3LWV C;  4BT6 A;  3RA5 A;  2LBX A;  4O4L B;  1GO1 A;  4O4J A;  2L26 A;  5LYJ B;  2AMT A;  5IJ0 A;  1VQP F;  3FFM A;  5LP6 C;  2Z1U A;  3S03 A;  1XV2 A;  4I50 B;  2H6L A;  4TV8 B;  4U3J B;  5JVD B;  3JAT A;  4I4T B;  1COM A;  5KMG B;  3N4Z A;  1W5F A;  5JCO A;  4X1I A;  4C82 A;  1YHQ F;  2BTO A;  5JH7 B;  1R1M A;  3D54 A;  4ERH A;  5GAN K;  4BT3 A;  1CN7 A;  1NQ3 A;  3WGN A;  1VQ5 F;  5DCV A;  3HKB A;  3ESJ A;  5CA0 B;  1RA4 A;  2HS4 A;  1VQ4 F;  1YJ9 F;  4EB6 B;  4EI9 A;  1YJN F;  4FFB B;  3FD6 A;  4X1Y B;  4X20 B;  3MDO A;  2QA4 F;  2R6R 1;  1YI2 F;  3MBM A;  5MN5 A;  3CCV F;  4YJ2 A;  2WAL A;  1TVK A;  3CC7 F;  3HAX D;  1QVF F;  5IYZ A;  1X7O A;  3R0P A;  3ZP7 A;  2YYE A;  1IPA A;  3D01 A;  3IEQ A;  2BTQ B;  4IHJ A;  5EZY B;  3JAK B;  3BYQ A;  1VQV A;  4BT2 A;  3E22 B;  1IV2 A;  2H8C A;  1E7K A;  1Z5V A;  2KGW A;  3I7T A;  3L7Q A;  4HNA A;  1TUB B;  3ELC A;  4X3L A;  4TZZ A;  5C8Y B;  1YIJ F;  3JAS A;  4BT7 A;  5LP6 B;  5FNV A;  3I3F A;  3VOA A;  1K8A H;  2W8B C;  2OTM A;  5HY1 A;  3N2K B;  3LWQ C;  3J7A R;  5KX5 A;  2ZVZ A;  1JN1 A;  4RQO A;  4ZHQ A;  1PF5 A;  5HY0 A;  2H8E A;  2B33 A;  4C8I A;  3M4S A;  4KWE A;  4G88 A;  3WGL A;  5LXT A;  3B6N A;  2UYN B;  4C4W C;  3HKD B;  5GIP C;  2ZOD A;  1NMU B;  5A2Q M;  1ZWZ A;  5IT9 M;  1GO0 A;  1U3P A;  4G4Z A;  3WXM B;  1W41 A;  2HP0 A;  4B45 A;  1KD1 H;  3OBW A;  1N8R H;  3NK6 A;  3CMA F;  4ZOL A;  5J2T B;  5ITZ B;  4O4I A;  3C9S A;  1IV3 A;  5HXZ A;  1H7M A;  2NMU A;  3V7Q A;  2HS0 A;  3VYS C;  3RYH A;  3CCL F;  2RHJ A;  3IKF A;  3JAL B;  3LWO C;  1H47 A;  3RE3 A;  1W57 A;  1U43 A;  1X52 A;  4O4L A;  1W40 A;  4TV8 A;  4LCK A;  2OHW A;  4U3J A;  2KG4 A;  2Z1F A;  5JVD A;  3S06 A;  3GHZ A;  3VIU A;  1W55 A;  1XHO A;  3G71 F;  5FLX M;  4M8I A;  5JH7 A;  3G6E F;  3CCE F;  1UFY A;  1JFF B;  2CHS A;  1YIT F;  1OFU A;  1M1K H;  4TUY A;  2OTL F;  3S0W A;  3EOR A;  3CYQ A;  2Z1E A;  3TD4 A;  5CA0 A;  4ZI7 A;  3OON A;  3IEW A;  4EB6 A;  3SIU A;  5MN6 A;  1FNK A;  3CCJ F;  4FFB A;  1W5B A;  4X1Y A;  5LOV B;  2UYP A;  1QAH A;  3C9R A;  1RQ7 A;  5AVM A;  2OZB A;  3CB2 A;  3N4Y A;  2VGM A;  3ZP4 A;  5EZY A;  2HVY D;  3JAK A;  5IJ9 B;  3NVI B;  2FGY A;  4G4X A;  3JAR B;  3P10 A;  3S02 A;  1FFX B;  3E22 A;  5EB0 A;  3KJJ A;  2QI2 A;  4E6E A;  1TUB A;  3RYF A;  3VTI C;  5C8Y A;  1YQN A;  3NVK E;  1ONI A;  1DT9 A;  4BW0 B;  4IIJ B;  3J81 M;  1ODE A;  3JAW B;  3DDN A;  5LP6 A;  3NMU C;  3IKE A;  3CPW F;  3N2K A;  4ZK7 A;  1DBF A;  3KJK A;  4BVQ A;  3CME F;  2AIZ P;  2VAM A;  1QVG F;  1FSZ A;  1VH8 A;  4O4H B;  4I55 B;  1GX1 A;  1YGY A;  4LNU B;  3WPW A;  2GLZ A;  2UYN A;  3LDT A;  3HKD A;  1IV1 A;  3OBY A;  2LBW A;  1M90 H;  2ZF8 A;  3CCS F;  1VQN F;  1IV4 A;  1RLG A;  3WGJ A;  1S72 F;  5B8F A;  3FBA A;  5GIN C;  2F9Z C;  2OTJ F;  5HP8 A;  1Z5W A;  5J2T A;  1VHA A;  2CSL A;  5EIB D;  4DRX B;  1Q81 H;  2HQS C;  2CVL A;  5HY4 A;  1Q86 H;  4NQ3 A;  1Q8R A;  4YJ3 B;  2UYK A;  3JAL A;  3ERN A;  1U40 A;  3VOB A;  3E20 B;  3QHD A;  1JD1 A;  3CYP B;  2DYY A;  4B5C A;  3Q8H A;  1PXW A;  5JQG B;  1GZ0 A;  1K73 H;  3RYC A;  1VQ7 F;  2I6R A;  4G4Y A;  1JFF A;  5GON A;  1RLU A;  3RYI B;  3IMP A;  4X3M A;  2DT4 A;  4O2B B;  1QU9 A;  2QTP A;  3CPQ A;  3CCQ F;  3VYT C;  4C8E A;  1XBI A;  2P6Y A;  4X1K A;  3CCM F;  3LME A;  3ZOP A;  5LOV A;  1VQO F;  2RHH A;  1VQL F;  3E1Y A;  3N2G B;  2V9Y A;  1TVK B;  5LYJ A;  3O85 A;  5IYZ B;  2Q1Y A;  5IJ9 A;  1W59 A;  4BVT A;  4WBN B;  1SDS A;  4I50 A;  3JAR A;  1X7P A;  1YJW F;  1FFX A;  4XCQ A;  4I4T A;  5KMG A;  2CHT A;  2N48 A;  3UT5 B;  3U0O A;  3JCM M;  1KNK A;  3KIZ A;  3QTY A;  3C9T A;  2KTV A;  2MQE A;  5G4U C;  3JAW A;  5LA6 B;  1CLI A;  3F0E A;  1FNJ A;  1T0A A;  2RHL A;  1Q82 H;  4X20 A;  4I55 A;  4LNU A;  3HJW C;  2AIF A;  2ZVY A;  3HKC B;  4C81 A;  5HP7 A;  1SA0 B;  4O2A B;  3HKE B;  2EWC A;  3K0T A;  4B46 A;  3DC2 A;  3FD5 A;  3V3T A;  3KE1 A;  5CA1 B;  3CC2 F;  1W2B F;  2HS3 A;  4TV9 B;  3F0G A;  4PWT A;  3F6M A;  3JAM M;  2YXZ A;  2RB9 A;  1W5E A;  4NUT A;  3WPX A;  3V7E A;  3IR9 A;  3QUW A;  4O4I B;  4YJ3 A;  4EI8 A;  3F0F A;  2RHO A;  3GYQ A;  2HRU A;  4ZHW A;  4BY9 D;  1U3L A;  3LWP C;  3FPI A;  2R75 1;  3JVH A;  3V4D A;  3MQW A;  3S0H A;  2ALE A;  1H48 A;  3K12 A;  5HY2 A;  3KHN A;  5JQG A;  2G9I A;  4RHA A;  3J80 M;  2CZW A;  4BVR A;  1KC8 H;  2VXY A;  5EYP B;  5EAZ A;  3NK7 A;  2JNB A;  1NJI H;  1OAP A;  3VI6 A;  3RYI A;  2GVI A;  4TUY B;  2VAP A;  2GZL A;  4O2B A;  3CCU F;  2FC3 A;  1QD9 A;  4F6R B;  4ZI7 B;  4NWO B;  5ITZ A;  2HRY A;  2PMP A;  3VO8 A;  5BMV B;  5EO3 A;  2VGN A;  5J2U B;  1K9M H;  2Q1X A;  4BT5 A;  3I55 F;  3N2G A;  1VQ9 F;  1X25 A;  3VCZ A;  4B62 A;  5CB4 B;  2HX0 A;  3TD5 A;  4WBN A;  2CW4 A;  1RQ2 A;  4O4J B;  1CK2 A;  5IJ0 B;  1W3E X;  2ZOV A;  3HTN A;  2CWJ A;  3UT5 A;  1VQ6 F;  3JAT B;  1J7H A;  1VQM F;  4X1I B;  3RYF B;  4G4V A;  3WGK A;  2IQQ A;  5EWR A;  5LA6 A;  1JY8 A;  2I6D A;  2LCA A;  2Z1T A;  5EB1 B;  3CD6 F;  2QEX F;  1Q7Y H;  3M1X A;  3HKB B;  5EIB C;  5MN4 A;  3K14 A;  4G4W A;  1JJ2 F;  3SIV A;  3PLA C;  4ZHY B;  5FJ4 C;  3WGM A;  3RA6 A;  2ZAU A;  4C8G A;  2K1S A;  3HKC A;  3S0Y A;  3P0Z A;  2KTU A;  1SA0 A;  2UYJ A;  2VAW A;  3P4E A;  3HKE A;  3M84 A;  4O2A A;  4YJ2 B;  2PHN A;  2BO1 A;  2Z01 A;  4ZHV A;  3CC4 F;  5CA1 A;  3MCA B;  4TV9 A;  1W42 A;  4IHJ B;  3VMF B;  3F0D A;  3WJQ A;  4BT4 A;  2IG8 A;  3D00 A;  3LWR C;  3LFO A;  3I56 F;  3PAF A;  4HNA B;  1VK3 A;  1VQ8 F;  4IIJ A; 
#chains in the Genus database with same CATH homology
 3IEQ A;  1IV4 A;  1H47 A;  3RE3 A;  3K2X A;  1W57 A;  4C8G A;  1U43 A;  1YQN A;  3F0E A;  4C8I A;  1T0A A;  3FBA A;  2GZL A;  3F0F A;  3P0Z A;  2UZH A;  5B8F A;  3B6N A;  1IV2 A;  3ESJ A;  1VHA A;  1U3L A;  3IKE A;  3ELC A;  1U3P A;  3FPI A;  3JVH A;  3GHZ A;  1W55 A;  1JY8 A;  2PMP A;  4C81 A;  1H48 A;  2AMT A;  3F0D A;  3ERN A;  1U40 A;  1VH8 A;  1KNJ A;  1KNK A;  3K14 A;  3KE1 A;  3QHD A;  4C8E A;  1GX1 A;  3MBM A;  1IV3 A;  3P10 A;  3EOR A;  3F0G A;  1IV1 A;  3F6M A;  3T80 A;  1JN1 A;  4C82 A;  3IEW A;  3Q8H A;  3IKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...