3EORA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 41
structure length 157
sequence length 157
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3eorA00
3B6NA 1IV4A 3K2XA 1IV3A 3P0ZA 1IV1A 3K14A 4C81A 4C8GA 1U3PA 3GHZA 1T0AA 1YQNA 3FPIA 1JN1A 3F0FA 3ERNA 4C82A 1W57A 4C8EA 3F0EA 1W55A 3IEQA 1GX1A 1U40A 1KNJA 2UZHA 1U3LA 1JY8A 2PMPA 3JVHA 3ESJA 3IKFA 1KNKA 1IV2A 3Q8HA 3QHDA 3P10A 3T80A 3F0DA 3EORA 3FBAA 3KE1A 3F6MA 3MBMA 3IKEA 5B8FA 3RE3A 1VHAA 1H47A 1H48A 2GZLA 3ELCA 3F0GA 4C8IA 2AMTA 1VH8A 1U43A 3IEWA
chains in the Genus database with same CATH superfamily
3ON1A 1XRGA 1JFFA 4YJ3B 3HTNA 4BVRA 5IJ0B 5BMVA 3AGKA 5JCOA 4X1YB 1VQ8F 4O4HB 5ITZA 1X25A 4DRXA 4X3MA 2KGWA 1PXWA 2FC3A 2UZHA 2N48A 1JY8A 4RQOA 4EI8A 4O2AA 5GINC 3V3TA 5C8YB 3HAXD 3JATB 5EB0A 3EORA 3LFOA 5FLXM 5LOVB 4BT2A 1IPAA 5HY1A 1VHAA 3TD4A 5KX5B 4BT3A 4NUTA 1XHOA 1U43A 1SA0B 3IEWA 5LXTA 2VXYA 2OZBA 3HKCA 2DYYA 3V4DA 3G71F 2G9IA 4O2BA 3M1XA 3KHNA 4ZHQB 1W42A 5IJ9A 5HP7A 4NWOB 3NMUC 2AIZP 3VOAA 3I3FA 5EIBC 3O85A 4I50A 4U3JB 3LWOC 1XV2A 4FFBB 2LBWA 5CA0B 5J2TB 5CB4B 2AMTA 2W8BC 4ZOLB 1VH8A 1VQVA 3JAKA 3RA5A 4ZHWA 4ZK7A 4PWTA 2OTMA 3HKBB 4YJ3A 5LYJB 2LBXA 4LNUB 3S0WA 2Z1UA 4C8EA 5JH7B 3F0EA 3WXMB 2BTQB 1U40A 2Z1EA 4WBNB 1U3LA 3MDOA 3N2KA 4BY9D 3JASB 3IR9A 1VQ7F 2VAPA 1UI9A 1TVKA 1K8AH 5JQGA 3ELCA 3PLAC 3F0GA 4BW0B 2CHTA 3PAFA 5CA1A 2QEXF 4IIJA 2ZAUA 4BT7A 1JFFB 3FPIA 2CZWA 5BMVB 3ERNA 1VQ9F 2HRUA 1W57A 5ITZB 3C9RA 2RHJA 4DRXB 1VQ5F 1NJIH 5GIPC 3WGNA 3J80M 3ZOPA 2PMPA 3C9SA 3ESJA 1W3EX 3Q8HA 2CWJA 4TV9A 5HY4A 3RYHA 5B8FA 1K73H 1KC8H 5CA0A 3RYCA 5EWRA 1YJWF 3QTYA 1QAHA 3B6NA 2OTJF 1RA4A 4TZZA 1X7OA 3VYUC 5LXTB 1FSZA 1JD1A 5J2UA 3L7QA 2RHLA 4G4ZA 3HKCB 2BTUA 3CC2F 3IMPA 4O2BB 4WBNA 2GVIA 5LP6C 3RYIA 1K9MH 1NMUB 2R751 3CMAF 2HP3A 4I55A 4ZI7A 3KJJA 3QUWA 3FBAA 3F6MA 3VO8A 2CHSA 3JALA 3RE3A 3MQWA 3JAMM 1H47A 1W5EA 2RHHA 3P4EA 4I50B 5IT9M 2H6LA 4M8IA 4EB6A 3JAKB 4ZHVA 3FD6A 1QVFF 1FFXA 3BYQA 4C81A 2ALEA 3HWUA 3D00A 3MCAB 1NQ3A 3G4SF 2V9YA 3LWVC 4C82A 2ZOVA 3HKDA 4YJ2A 1W41A 2P6YA 4G4YA 3CCRF 2VGMA 3JVHA 2HP0A 3S0HA 3N2KB 3WGMA 4TV8A 2HQSC 1Q86H 1SZQA 1GO0A 2BO1A 1YI2F 1N8RH 3ZO8A 1TVKB 1DBFA 5JQGB 3N2GB 3P0ZA 1VQLF 3K14A 5FJ4C 5CA1B 1VQ4F 5HXUA 3K12A 2I6DA 4IIJB 1JN1A 4EI7A 3CCJF 4C4WC 3G6EF 1QVGF 1VQMF 3KIZA 1VQOF 1FNJA 3RA6A 3CPWF 2VAWA 1Q7YH 1E7KA 1QD9A 3RYHB 1GZ0A 4TV9B 2RHOA 3JCMM 3VI6A 2KG4A 3NK7A 3FD5A 3LYBA 3RYCB 1VK3A 3VYSC 1W55A 3C9TA 5EIBD 2B33A 4IHJA 2Z1TA 3C8LA 1U3PA 4B46A 4G4XA 5J2UB 3WJRA 2R6R1 1RQ7A 1VQPF 3IEQA 1Q8RA 5HWEA 1X7PA 3U0OA 3QHDA 3RYIB 4O4LB 4I55B 4ZI7B 3I56F 4NQ3A 3JALB 2DT4A 3N4ZA 3N2GA 1KD1H 3VIUA 4X3LA 3WGKA 2ZODA 4EB6B 4B45A 4O4JA 3TD5A 1FFXB 2Z1FA 5EYPA 3HJWC 1RLGA 3C9UA 3E22A 5LP6A 3S06A 1KNJA 3HKDB 4YJ2B 3IKFA 1YITF 3OONA 4B62A 3T80A 2HP0B 4O4IA 5IYZB 4F6RA 3CMEF 3E1YA 3CB2A 3VYTC 2H8CA 4XCQA 2HVYD 3LMEA 4TV8B 4C8IA 1TUBA 3JAWA 2BTOA 3VMFB 3SIVA 4TUYA 1GO1A 3S02A 3LWQC 3S03A 1H7MA 4BT6A 5GAPK 1SDSA 4LCKA 1J7HA 2LCAA 1W5AA 2UYPA 1YGYA 4BT4A 2JNBA 3CCUF 2KTVA 1RLUA 4O4LA 1Z5WA 2QA4F 5MN4A 2KTUA 5G4VC 5A2QM 3IKEA 2IQQA 4R40B 1ONIA 4G88A 1RQ2A 5FNVA 2HRYA 2VGNA 3K2XA 2MQEA 3NVKE 5MN5A 5JVDA 4IHJB 2PHNA 3ZP4A 3LWPC 1R1MA 2OTLF 2RB9A 1VQ6F 5HXZA 3R0PA 5MN6A 2H8EA 1IV2A 5IYZA 3ZP7A 3OBYA 5G4UC 4HNAB 1PF5A 3CCEF 3UT5B 4ERHA 1QU9A 3HKEB 1W59A 3CYPB 4KWEA 3J7AR 3N4YA 1T0KB 3VOBA 4O4JB 5EYPB 3WPXA 3D54A 3OW2F 3E22B 5LP6B 2IG8A 2L26A 1CK2A 1COMA 3VTIC 5EAZA 3WJPA 2GLZA 4O4IB 2FGYA 3DC2A 4F6RB 4X1KA 5KMGA 2Q1XA 2HS4A 1DT9A 3WJQA 1TUBB 3DDNA 2CW4A 2YXZA 3JAWB 5LA6A 3CCSF 4BVQA 5GONA 3JARA 3M84A 3GHZA 1T0AA 4B5CA 3S0YA 4TUYB 4BT5A 3CPQA 3F0FA 4X20A 5JCOC 1CN7A 2UYKA 2UYNA 5EZYA 1OFUA 5DCVA 4DXDA 2UYJA 3I55F 3GYQA 4X1IA 1KNKA 3WGJA 3CYQA 3KE1A 4HNAA 3E20B 3CCLF 1W581 3NK6A 4BVSA 3UT5A 1H48A 4I4TA 4RHAA 3LWRC 3HKEA 2F9ZC 1VQKF 3V7QA 5IJ0A 1OAPA 1IV3A 5FNVB 2WALA 4X1YA 3NVIB 1IV1A 4C8GA 4O4HA 5GANK 2CVLA 5JVDB 2ZVZA 3WPWA 5HY2A 1W2BF 5EO3A 1Z5VA 2OHWA 2QTPA 3SIUA 1FNKA 3RYFB 1YJNF 3OBWA 5C8YA 3JATA 1M90H 2LBTA 5LOVA 3VCZA 1JJ2F 3J81M 1W5BA 2EWCA 5KX5A 3D01A 4G4WA 3GTZA 1ODEA 1SA0A 2Q1YA 2YYEA 1KQSF 1S72F 3CCMF 1VQNF 2VAMA 2CSLA 2HX0A 2ZVYA 4G4VA 4ZHQA 1YIJF 5GIOC 1Q81H 2HS0A 3LDTA 4E6EA 2ZF8A 5AVMA 3CCQF 3CD6F 2HS3A 1X52A 4O2AB 2Z01A 3P10A 3F0DA 4U3JA 1W40A 3MCQA 4FFBA 5J2TA 3CC4F 5CB4A 4ZOLA 3K0TA 1CLIA 5HY0A 3CC7F 3HKBA 3I7TA 5LYJA 3TD3A 4X1KB 1IV4A 2NMUA 5KMGB 3V7EA 1M1KH 4LNUA 5HP8A 1XBIA 5EB1B 3CG6A 2IAFA 4EI9A 5LA6B 4ZHYB 3KJKA 1YQNA 5GONB 4BVTA 1ZWZA 3JARB 3WGLA 5JH7A 3CCVF 1YJ9F 1UFYA 2QI2A 4X20B 1GX1A 2UYNB 3RYFA 1W5FA 2AIFA 5EZYB 1YHQF 5IJ9B 1Q82H 3M4SA 3JASA 2I6RA 4X1IB 3FFMA 2K1SA 3MBMA 2GZLA 4U39A 4I4TB 3CXCF
chains in the Genus database with same CATH topology
3B6NA 1IV4A 3K2XA 1IV3A 3P0ZA 1IV1A 3K14A 4C81A 4C8GA 1U3PA 3GHZA 1T0AA 1YQNA 3FPIA 1JN1A 3F0FA 3ERNA 4C82A 1W57A 4C8EA 3F0EA 1W55A 3IEQA 1GX1A 1U40A 1KNJA 2UZHA 1U3LA 1JY8A 2PMPA 3JVHA 3ESJA 3IKFA 1KNKA 1IV2A 3Q8HA 3QHDA 3P10A 3T80A 3F0DA 3EORA 3FBAA 3KE1A 3F6MA 3MBMA 3IKEA 5B8FA 3RE3A 1VHAA 1H47A 1H48A 2GZLA 3ELCA 3F0GA 4C8IA 2AMTA 1VH8A 1U43A 3IEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6N A;  1IV4 A;  3K2X A;  1IV3 A;  3P0Z A;  1IV1 A;  3K14 A;  4C81 A;  4C8G A;  1U3P A;  3GHZ A;  1T0A A;  1YQN A;  3FPI A;  1JN1 A;  3F0F A;  3ERN A;  4C82 A;  1W57 A;  4C8E A;  3F0E A;  1W55 A;  3IEQ A;  1GX1 A;  1U40 A;  1KNJ A;  2UZH A;  1U3L A;  1JY8 A;  2PMP A;  3JVH A;  3ESJ A;  3IKF A;  1KNK A;  1IV2 A;  3Q8H A;  3QHD A;  3P10 A;  3T80 A;  3F0D A;  3EOR A;  3FBA A;  3KE1 A;  3F6M A;  3MBM A;  3IKE A;  5B8F A;  3RE3 A;  1VHA A;  1H47 A;  1H48 A;  2GZL A;  3ELC A;  3F0G A;  4C8I A;  2AMT A;  1VH8 A;  1U43 A;  3IEW A; 
#chains in the Genus database with same CATH topology
 3ON1 A;  1XRG A;  1JFF A;  4YJ3 B;  3HTN A;  4BVR A;  5IJ0 B;  5BMV A;  3AGK A;  5JCO A;  4X1Y B;  1VQ8 F;  4O4H B;  5ITZ A;  1X25 A;  4DRX A;  4X3M A;  2KGW A;  1PXW A;  2FC3 A;  2UZH A;  2N48 A;  1JY8 A;  4RQO A;  4EI8 A;  4O2A A;  5GIN C;  3V3T A;  5C8Y B;  3HAX D;  3JAT B;  5EB0 A;  3EOR A;  3LFO A;  5FLX M;  5LOV B;  4BT2 A;  1IPA A;  5HY1 A;  1VHA A;  3TD4 A;  5KX5 B;  4BT3 A;  4NUT A;  1XHO A;  1U43 A;  1SA0 B;  3IEW A;  5LXT A;  2VXY A;  2OZB A;  3HKC A;  2DYY A;  3V4D A;  3G71 F;  2G9I A;  4O2B A;  3M1X A;  3KHN A;  4ZHQ B;  1W42 A;  5IJ9 A;  5HP7 A;  4NWO B;  3NMU C;  2AIZ P;  3VOA A;  3I3F A;  5EIB C;  3O85 A;  4I50 A;  4U3J B;  3LWO C;  1XV2 A;  4FFB B;  2LBW A;  5CA0 B;  5J2T B;  5CB4 B;  2AMT A;  2W8B C;  4ZOL B;  1VH8 A;  1VQV A;  3JAK A;  3RA5 A;  4ZHW A;  4ZK7 A;  4PWT A;  2OTM A;  3HKB B;  4YJ3 A;  5LYJ B;  2LBX A;  4LNU B;  3S0W A;  2Z1U A;  4C8E A;  5JH7 B;  3F0E A;  3WXM B;  2BTQ B;  1U40 A;  2Z1E A;  4WBN B;  1U3L A;  3MDO A;  3N2K A;  4BY9 D;  3JAS B;  3IR9 A;  1VQ7 F;  2VAP A;  1UI9 A;  1TVK A;  1K8A H;  5JQG A;  3ELC A;  3PLA C;  3F0G A;  4BW0 B;  2CHT A;  3PAF A;  5CA1 A;  2QEX F;  4IIJ A;  2ZAU A;  4BT7 A;  1JFF B;  3FPI A;  2CZW A;  5BMV B;  3ERN A;  1VQ9 F;  2HRU A;  1W57 A;  5ITZ B;  3C9R A;  2RHJ A;  4DRX B;  1VQ5 F;  1NJI H;  5GIP C;  3WGN A;  3J80 M;  3ZOP A;  2PMP A;  3C9S A;  3ESJ A;  1W3E X;  3Q8H A;  2CWJ A;  4TV9 A;  5HY4 A;  3RYH A;  5B8F A;  1K73 H;  1KC8 H;  5CA0 A;  3RYC A;  5EWR A;  1YJW F;  3QTY A;  1QAH A;  3B6N A;  2OTJ F;  1RA4 A;  4TZZ A;  1X7O A;  3VYU C;  5LXT B;  1FSZ A;  1JD1 A;  5J2U A;  3L7Q A;  2RHL A;  4G4Z A;  3HKC B;  2BTU A;  3CC2 F;  3IMP A;  4O2B B;  4WBN A;  2GVI A;  5LP6 C;  3RYI A;  1K9M H;  1NMU B;  2R75 1;  3CMA F;  2HP3 A;  4I55 A;  4ZI7 A;  3KJJ A;  3QUW A;  3FBA A;  3F6M A;  3VO8 A;  2CHS A;  3JAL A;  3RE3 A;  3MQW A;  3JAM M;  1H47 A;  1W5E A;  2RHH A;  3P4E A;  4I50 B;  5IT9 M;  2H6L A;  4M8I A;  4EB6 A;  3JAK B;  4ZHV A;  3FD6 A;  1QVF F;  1FFX A;  3BYQ A;  4C81 A;  2ALE A;  3HWU A;  3D00 A;  3MCA B;  1NQ3 A;  3G4S F;  2V9Y A;  3LWV C;  4C82 A;  2ZOV A;  3HKD A;  4YJ2 A;  1W41 A;  2P6Y A;  4G4Y A;  3CCR F;  2VGM A;  3JVH A;  2HP0 A;  3S0H A;  3N2K B;  3WGM A;  4TV8 A;  2HQS C;  1Q86 H;  1SZQ A;  1GO0 A;  2BO1 A;  1YI2 F;  1N8R H;  3ZO8 A;  1TVK B;  1DBF A;  5JQG B;  3N2G B;  3P0Z A;  1VQL F;  3K14 A;  5FJ4 C;  5CA1 B;  1VQ4 F;  5HXU A;  3K12 A;  2I6D A;  4IIJ B;  1JN1 A;  4EI7 A;  3CCJ F;  4C4W C;  3G6E F;  1QVG F;  1VQM F;  3KIZ A;  1VQO F;  1FNJ A;  3RA6 A;  3CPW F;  2VAW A;  1Q7Y H;  1E7K A;  1QD9 A;  3RYH B;  1GZ0 A;  4TV9 B;  2RHO A;  3JCM M;  3VI6 A;  2KG4 A;  3NK7 A;  3FD5 A;  3LYB A;  3RYC B;  1VK3 A;  3VYS C;  1W55 A;  3C9T A;  5EIB D;  2B33 A;  4IHJ A;  2Z1T A;  3C8L A;  1U3P A;  4B46 A;  4G4X A;  5J2U B;  3WJR A;  2R6R 1;  1RQ7 A;  1VQP F;  3IEQ A;  1Q8R A;  5HWE A;  1X7P A;  3U0O A;  3QHD A;  3RYI B;  4O4L B;  4I55 B;  4ZI7 B;  3I56 F;  4NQ3 A;  3JAL B;  2DT4 A;  3N4Z A;  3N2G A;  1KD1 H;  3VIU A;  4X3L A;  3WGK A;  2ZOD A;  4EB6 B;  4B45 A;  4O4J A;  3TD5 A;  1FFX B;  2Z1F A;  5EYP A;  3HJW C;  1RLG A;  3C9U A;  3E22 A;  5LP6 A;  3S06 A;  1KNJ A;  3HKD B;  4YJ2 B;  3IKF A;  1YIT F;  3OON A;  4B62 A;  3T80 A;  2HP0 B;  4O4I A;  5IYZ B;  4F6R A;  3CME F;  3E1Y A;  3CB2 A;  3VYT C;  2H8C A;  4XCQ A;  2HVY D;  3LME A;  4TV8 B;  4C8I A;  1TUB A;  3JAW A;  2BTO A;  3VMF B;  3SIV A;  4TUY A;  1GO1 A;  3S02 A;  3LWQ C;  3S03 A;  1H7M A;  4BT6 A;  5GAP K;  1SDS A;  4LCK A;  1J7H A;  2LCA A;  1W5A A;  2UYP A;  1YGY A;  4BT4 A;  2JNB A;  3CCU F;  2KTV A;  1RLU A;  4O4L A;  1Z5W A;  2QA4 F;  5MN4 A;  2KTU A;  5G4V C;  5A2Q M;  3IKE A;  2IQQ A;  4R40 B;  1ONI A;  4G88 A;  1RQ2 A;  5FNV A;  2HRY A;  2VGN A;  3K2X A;  2MQE A;  3NVK E;  5MN5 A;  5JVD A;  4IHJ B;  2PHN A;  3ZP4 A;  3LWP C;  1R1M A;  2OTL F;  2RB9 A;  1VQ6 F;  5HXZ A;  3R0P A;  5MN6 A;  2H8E A;  1IV2 A;  5IYZ A;  3ZP7 A;  3OBY A;  5G4U C;  4HNA B;  1PF5 A;  3CCE F;  3UT5 B;  4ERH A;  1QU9 A;  3HKE B;  1W59 A;  3CYP B;  4KWE A;  3J7A R;  3N4Y A;  1T0K B;  3VOB A;  4O4J B;  5EYP B;  3WPX A;  3D54 A;  3OW2 F;  3E22 B;  5LP6 B;  2IG8 A;  2L26 A;  1CK2 A;  1COM A;  3VTI C;  5EAZ A;  3WJP A;  2GLZ A;  4O4I B;  2FGY A;  3DC2 A;  4F6R B;  4X1K A;  5KMG A;  2Q1X A;  2HS4 A;  1DT9 A;  3WJQ A;  1TUB B;  3DDN A;  2CW4 A;  2YXZ A;  3JAW B;  5LA6 A;  3CCS F;  4BVQ A;  5GON A;  3JAR A;  3M84 A;  3GHZ A;  1T0A A;  4B5C A;  3S0Y A;  4TUY B;  4BT5 A;  3CPQ A;  3F0F A;  4X20 A;  5JCO C;  1CN7 A;  2UYK A;  2UYN A;  5EZY A;  1OFU A;  5DCV A;  4DXD A;  2UYJ A;  3I55 F;  3GYQ A;  4X1I A;  1KNK A;  3WGJ A;  3CYQ A;  3KE1 A;  4HNA A;  3E20 B;  3CCL F;  1W58 1;  3NK6 A;  4BVS A;  3UT5 A;  1H48 A;  4I4T A;  4RHA A;  3LWR C;  3HKE A;  2F9Z C;  1VQK F;  3V7Q A;  5IJ0 A;  1OAP A;  1IV3 A;  5FNV B;  2WAL A;  4X1Y A;  3NVI B;  1IV1 A;  4C8G A;  4O4H A;  5GAN K;  2CVL A;  5JVD B;  2ZVZ A;  3WPW A;  5HY2 A;  1W2B F;  5EO3 A;  1Z5V A;  2OHW A;  2QTP A;  3SIU A;  1FNK A;  3RYF B;  1YJN F;  3OBW A;  5C8Y A;  3JAT A;  1M90 H;  2LBT A;  5LOV A;  3VCZ A;  1JJ2 F;  3J81 M;  1W5B A;  2EWC A;  5KX5 A;  3D01 A;  4G4W A;  3GTZ A;  1ODE A;  1SA0 A;  2Q1Y A;  2YYE A;  1KQS F;  1S72 F;  3CCM F;  1VQN F;  2VAM A;  2CSL A;  2HX0 A;  2ZVY A;  4G4V A;  4ZHQ A;  1YIJ F;  5GIO C;  1Q81 H;  2HS0 A;  3LDT A;  4E6E A;  2ZF8 A;  5AVM A;  3CCQ F;  3CD6 F;  2HS3 A;  1X52 A;  4O2A B;  2Z01 A;  3P10 A;  3F0D A;  4U3J A;  1W40 A;  3MCQ A;  4FFB A;  5J2T A;  3CC4 F;  5CB4 A;  4ZOL A;  3K0T A;  1CLI A;  5HY0 A;  3CC7 F;  3HKB A;  3I7T A;  5LYJ A;  3TD3 A;  4X1K B;  1IV4 A;  2NMU A;  5KMG B;  3V7E A;  1M1K H;  4LNU A;  5HP8 A;  1XBI A;  5EB1 B;  3CG6 A;  2IAF A;  4EI9 A;  5LA6 B;  4ZHY B;  3KJK A;  1YQN A;  5GON B;  4BVT A;  1ZWZ A;  3JAR B;  3WGL A;  5JH7 A;  3CCV F;  1YJ9 F;  1UFY A;  2QI2 A;  4X20 B;  1GX1 A;  2UYN B;  3RYF A;  1W5F A;  2AIF A;  5EZY B;  1YHQ F;  5IJ9 B;  1Q82 H;  3M4S A;  3JAS A;  2I6R A;  4X1I B;  3FFM A;  2K1S A;  3MBM A;  2GZL A;  4U39 A;  4I4T B;  3CXC F; 
#chains in the Genus database with same CATH homology
 3B6N A;  1IV4 A;  3K2X A;  1IV3 A;  3P0Z A;  1IV1 A;  3K14 A;  4C81 A;  4C8G A;  1U3P A;  3GHZ A;  1T0A A;  1YQN A;  3FPI A;  1JN1 A;  3F0F A;  3ERN A;  4C82 A;  1W57 A;  4C8E A;  3F0E A;  1W55 A;  3IEQ A;  1GX1 A;  1U40 A;  1KNJ A;  2UZH A;  1U3L A;  1JY8 A;  2PMP A;  3JVH A;  3ESJ A;  3IKF A;  1KNK A;  1IV2 A;  3Q8H A;  3QHD A;  3P10 A;  3T80 A;  3F0D A;  3EOR A;  3FBA A;  3KE1 A;  3F6M A;  3MBM A;  3IKE A;  5B8F A;  3RE3 A;  1VHA A;  1H47 A;  1H48 A;  2GZL A;  3ELC A;  3F0G A;  4C8I A;  2AMT A;  1VH8 A;  1U43 A;  3IEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...