3EORA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 41
structure length 157
sequence length 157
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3eorA00
3EORA 3B6NA 2UZHA 4C8GA 2AMTA 1IV3A 4C82A 3ELCA 3IKEA 1JN1A 2GZLA 5B8FA 1U3PA 1W55A 1IV2A 1H47A 1IV1A 2PMPA 1KNKA 3K2XA 3F0FA 3KE1A 3ESJA 1U3LA 3IEWA 3F6MA 3K14A 3MBMA 3P10A 4C81A 3GHZA 1JY8A 3RE3A 1T0AA 1U40A 3F0GA 1GX1A 4C8EA 3F0DA 3JVHA 3P0ZA 1W57A 3FBAA 3T80A 1YQNA 4C8IA 1VHAA 3FPIA 3IEQA 3IKFA 3ERNA 1IV4A 3Q8HA 1KNJA 3F0EA 1H48A 1VH8A 1U43A 3QHDA
chains in the Genus database with same CATH superfamily
4I50A 3JCMM 1JFFA 2P6YA 1Z5VA 2ZOVA 1U3PA 4EI7A 3D54A 1XHOA 3CCLF 3KE1A 1VQ9F 4BT3A 2N48A 4TV8A 3S0HA 4BT4A 5GINC 2IG8A 3E1YA 3RYHA 4X1YB 4G4VA 5EYPA 2DT4A 5C8YA 5AVMA 3C8LA 2CZWA 3ZOPA 5EIBD 5A2QM 1W5BA 4TZZA 3HKEA 3Q8HA 4YJ3B 1RA4A 3RYIA 1X7PA 4ZOLA 1YI2F 2OTJF 4X3LA 5JCOA 1N8RH 2HQSC 3JAKB 3G71F 4TV9A 1JN1A 4X1KA 4IHJB 3D01A 1KNKA 1TUBA 3IEWA 4EB6B 4B46A 1TVKA 1Q82H 3JASB 5G4UC 1M90H 3SIUA 5GONA 1YQNA 3HKBB 1Q81H 3CCEF 5J2UB 5DCVA 3HTNA 3F0EA 1VH8A 3T80A 5EIBC 3GTZA 1QVGF 2MQEA 1PXWA 1SA0A 1CLIA 5FJ4C 3TD4A 5EZYB 3N2GA 5LXTA 1R1MA 3VCZA 5IJ0B 3N4ZA 5HXUA 1S72F 2Q1XA 4BVSA 3JALB 3WPWA 3IEQA 2UYNB 4I4TA 2AIFA 2HP0B 1K9MH 3IMPA 4ZHYB 4U3JB 2BTOA 2CW4A 3LWVC 1DT9A 3M84A 3V4DA 1M1KH 2CSLA 3WJRA 4ZHWA 3HKDA 5MN6A 3MCAB 3OONA 5EO3A 1RQ2A 4WBNA 1COMA 2YYEA 1YGYA 1GO1A 2L26A 2OTMA 3ON1A 3P10A 1Q8RA 4I50B 3CCMF 5FNVA 1X25A 3CCSF 1DBFA 4HNAA 3G6EF 2Z1EA 2QA4F 3JVHA 2RHLA 3VI6A 5KMGB 3FFMA 4TV8B 5LP6C 1NJIH 5LOVB 3CC7F 1QD9A 3GYQA 2Z1FA 2EWCA 2AMTA 2IAFA 5B8FA 5CB4A 3V7EA 4FFBB 5BMVB 2VAPA 3N4YA 3VYTC 1W581 2VGNA 3I7TA 1KQSF 4X1KB 4YJ2B 1ZWZA 1VQOF 2KTUA 4O4JA 5CA1B 1IV4A 5HP7A 2W8BC 4F6RB 1H48A 2UYKA 4LNUA 4O4IA 4O4LA 3CCVF 5HXZA 5ITZA 2QI2A 2VGMA 5LA6B 2K1SA 2HVYD 5GANK 4B45A 5JQGB 1KC8H 1H47A 2CWJA 1NQ3A 3F0FA 5CA0B 2R751 1Z5WA 1X52A 4ZI7B 3CCRF 4B5CA 1CN7A 3IR9A 3VYSC 3S06A 2VXYA 1SA0B 5EWRA 4B62A 2ZVYA 3JATA 5IYZB 1W57A 4BY9D 3N2GB 3N2KA 3OBWA 3KHNA 3RYFA 3JAWB 4G88A 2HS3A 5JVDB 2G9IA 3EORA 4ZHQB 3CYPB 4DRXA 1FFXA 5KX5A 3DDNA 3VOBA 4X1IB 4O2BA 1VQLF 3R0PA 4O4HA 2QEXF 3OW2F 3JARB 2FGYA 5J2TA 5LP6A 2KG4A 3MCQA 1XV2A 3WGMA 1YJ9F 4XCQA 1VK3A 3C9RA 4X20B 4IIJB 2H8EA 5FNVB 2V9YA 3CCUF 2CHTA 5IT9M 4LCKA 4O2AA 4I55A 2B33A 1Q7YH 1QAHA 3CC2F 3OBYA 3RYCB 1W55A 4ERHA 1IV1A 3KIZA 5LYJA 3UT5B 3S02A 3HKCB 5G4VC 4C81A 1U40A 4X3MA 1OAPA 3S03A 3RA5A 1YJNF 3E22B 2KTVA 1J7HA 4E6EA 2PHNA 4KWEA 1ODEA 4O4JB 4C4WC 3K12A 3C9SA 3LWOC 3P4EA 2UYJA 5IJ9B 1W41A 1X7OA 3LYBA 4X1YA 2PMPA 3K0TA 1RQ7A 5ITZB 3CYQA 4YJ3A 1JFFB 1FNJA 3QUWA 3NMUC 4C8EA 3MDOA 5MN4A 3JAKA 4NWOB 4IHJA 3ERNA 3J81M 2LBWA 3SIVA 2DYYA 1KNJA 5EAZA 3VIUA 3JAMM 3CMAF 3QHDA 4C8GA 1YITF 3RYHB 3S0WA 5EYPB 3J7AR 3N2KB 5C8YB 1VQ6F 3J80M 2ZODA 3G4SF 1H7MA 3HKEB 3HKBA 1W59A 4BT6A 3RYIB 5J2UA 4ZOLB 3F6MA 1UI9A 2HP3A 2QTPA 2HRUA 3PAFA 2ZVZA 3HJWC 3GHZA 3I55F 4TV9B 1CK2A 2WALA 5HWEA 1TUBB 3WGKA 3CCJF 1W42A 1XBIA 2HRYA 4BT2A 3I3FA 3WGLA 1TVKB 2Q1YA 3CG6A 2VAMA 1JD1A 5EZYA 3LWQC 3S0YA 2RHJA 2KGWA 5IJ0A 2AIZP 5EB0A 5EB1B 5GONB 2Z01A 5HY0A 3WGJA 5HY1A 4R40B 1IPAA 3LWPC 3JALA 3DC2A 5GIPC 1YJWF 2UYNA 2HP0A 3NVKE 3V7QA 4BT7A 4PWTA 3TD5A 1QVFF 2ALEA 2JNBA 1E7KA 3NVIB 3MQWA 3C9TA 4EI9A 5GIOC 5JH7A 3KJJA 5LYJB 1XRGA 5LXTB 3AGKA 4TUYA 2GLZA 2OHWA 4NQ3A 1FNKA 1RLGA 1W40A 5HY4A 2GZLA 3L7QA 1VQNF 1IV2A 4I4TB 1VQ4F 5KMGA 1U3LA 3K14A 4NUTA 5LOVA 1VQKF 3KJKA 3HKDB 1GO0A 1GX1A 3P0ZA 4WBNB 3C9UA 5MN5A 4M8IA 1VHAA 1YIJF 2HS4A 4FFBA 5BMVA 2HX0A 4HNAB 2I6RA 1KD1H 1SZQA 2BTUA 2GVIA 4C82A 3LWRC 2Z1UA 3CXCF 4YJ2A 1ONIA 3E20B 2R6R1 3ESJA 1OFUA 2CHSA 4BW0B 4U39A 5CA1A 2UYPA 2IQQA 3CPQA 4F6RA 3RE3A 1T0AA 3LDTA 5CB4B 3F0GA 2VAWA 4G4XA 3WXMB 3F0DA 2HS0A 5LA6A 4C8IA 1RLUA 5JQGA 2ZF8A 2NMUA 3BYQA 5CA0A 3WJPA 2LBXA 1W2BF 1VQ5F 1U43A 4ZI7A 3I56F 4ZK7A 5HY2A 3B6NA 1T0KB 1IV3A 4BVQA 2I6DA 2RHHA 1VQVA 1JJ2F 5IYZA 3VMFB 1K8AH 2F9ZC 3WPXA 3V3TA 4G4ZA 4LNUB 5FLXM 4O4LB 4O4IB 2ZAUA 2H6LA 3JAWA 3CPWF 3M1XA 5JVDA 3M4SA 4EI8A 4ZHQA 1UFYA 1PF5A 1VQ7F 1NMUB 3VO8A 2RB9A 3ZP7A 3CD6F 3CCQF 4X1IA 3FD6A 2FC3A 2BTQB 2OZBA 2BO1A 1FSZA 3JATB 4G4YA 4EB6A 3JARA 5GAPK 5JH7B 2UZHA 4DXDA 3ELCA 3IKEA 3JASA 3WJQA 5JCOC 2LBTA 3RYFB 4TUYB 2OTLF 3U0OA 3VOAA 4X20A 4IIJA 3MBMA 3D00A 3PLAC 3CC4F 3QTYA 4DRXB 1FFXB 5KX5B 3ZO8A 3HWUA 1YHQF 4G4WA 4O2BB 1VQPF 1K73H 2RHOA 3FBAA 3ZP4A 4O4HB 2Z1TA 3FPIA 2YXZA 3RYCA 4BT5A 3CB2A 2LCAA 3NK7A 4RHAA 3UT5A 5HP8A 5J2TB 1VQ8F 1QU9A 1W3EX 3HKCA 4BVTA 5LP6B 1SDSA 3RA6A 3CMEF 3FD5A 4RQOA 3VYUC 1W5EA 3K2XA 3NK6A 3LFOA 4O2AB 4I55B 3E22A 2CVLA 4U3JA 1W5FA 1JY8A 1W5AA 3TD3A 3VTIC 2H8CA 4BVRA 5IJ9A 3IKFA 1GZ0A 1Q86H 3LMEA 3HAXD 1VQMF 3WGNA 3O85A 4ZHVA
chains in the Genus database with same CATH topology
3EORA 3B6NA 2UZHA 4C8GA 2AMTA 1IV3A 4C82A 3ELCA 3IKEA 1JN1A 2GZLA 5B8FA 1U3PA 1W55A 1IV2A 1H47A 1IV1A 2PMPA 1KNKA 3K2XA 3F0FA 3KE1A 3ESJA 1U3LA 3IEWA 3F6MA 3K14A 3MBMA 3P10A 4C81A 3GHZA 1JY8A 3RE3A 1T0AA 1U40A 3F0GA 1GX1A 4C8EA 3F0DA 3JVHA 3P0ZA 1W57A 3FBAA 3T80A 1YQNA 4C8IA 1VHAA 3FPIA 3IEQA 3IKFA 3ERNA 1IV4A 3Q8HA 1KNJA 3F0EA 1H48A 1VH8A 1U43A 3QHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOR A;  3B6N A;  2UZH A;  4C8G A;  2AMT A;  1IV3 A;  4C82 A;  3ELC A;  3IKE A;  1JN1 A;  2GZL A;  5B8F A;  1U3P A;  1W55 A;  1IV2 A;  1H47 A;  1IV1 A;  2PMP A;  1KNK A;  3K2X A;  3F0F A;  3KE1 A;  3ESJ A;  1U3L A;  3IEW A;  3F6M A;  3K14 A;  3MBM A;  3P10 A;  4C81 A;  3GHZ A;  1JY8 A;  3RE3 A;  1T0A A;  1U40 A;  3F0G A;  1GX1 A;  4C8E A;  3F0D A;  3JVH A;  3P0Z A;  1W57 A;  3FBA A;  3T80 A;  1YQN A;  4C8I A;  1VHA A;  3FPI A;  3IEQ A;  3IKF A;  3ERN A;  1IV4 A;  3Q8H A;  1KNJ A;  3F0E A;  1H48 A;  1VH8 A;  1U43 A;  3QHD A; 
#chains in the Genus database with same CATH topology
 4I50 A;  3JCM M;  1JFF A;  2P6Y A;  1Z5V A;  2ZOV A;  1U3P A;  4EI7 A;  3D54 A;  1XHO A;  3CCL F;  3KE1 A;  1VQ9 F;  4BT3 A;  2N48 A;  4TV8 A;  3S0H A;  4BT4 A;  5GIN C;  2IG8 A;  3E1Y A;  3RYH A;  4X1Y B;  4G4V A;  5EYP A;  2DT4 A;  5C8Y A;  5AVM A;  3C8L A;  2CZW A;  3ZOP A;  5EIB D;  5A2Q M;  1W5B A;  4TZZ A;  3HKE A;  3Q8H A;  4YJ3 B;  1RA4 A;  3RYI A;  1X7P A;  4ZOL A;  1YI2 F;  2OTJ F;  4X3L A;  5JCO A;  1N8R H;  2HQS C;  3JAK B;  3G71 F;  4TV9 A;  1JN1 A;  4X1K A;  4IHJ B;  3D01 A;  1KNK A;  1TUB A;  3IEW A;  4EB6 B;  4B46 A;  1TVK A;  1Q82 H;  3JAS B;  5G4U C;  1M90 H;  3SIU A;  5GON A;  1YQN A;  3HKB B;  1Q81 H;  3CCE F;  5J2U B;  5DCV A;  3HTN A;  3F0E A;  1VH8 A;  3T80 A;  5EIB C;  3GTZ A;  1QVG F;  2MQE A;  1PXW A;  1SA0 A;  1CLI A;  5FJ4 C;  3TD4 A;  5EZY B;  3N2G A;  5LXT A;  1R1M A;  3VCZ A;  5IJ0 B;  3N4Z A;  5HXU A;  1S72 F;  2Q1X A;  4BVS A;  3JAL B;  3WPW A;  3IEQ A;  2UYN B;  4I4T A;  2AIF A;  2HP0 B;  1K9M H;  3IMP A;  4ZHY B;  4U3J B;  2BTO A;  2CW4 A;  3LWV C;  1DT9 A;  3M84 A;  3V4D A;  1M1K H;  2CSL A;  3WJR A;  4ZHW A;  3HKD A;  5MN6 A;  3MCA B;  3OON A;  5EO3 A;  1RQ2 A;  4WBN A;  1COM A;  2YYE A;  1YGY A;  1GO1 A;  2L26 A;  2OTM A;  3ON1 A;  3P10 A;  1Q8R A;  4I50 B;  3CCM F;  5FNV A;  1X25 A;  3CCS F;  1DBF A;  4HNA A;  3G6E F;  2Z1E A;  2QA4 F;  3JVH A;  2RHL A;  3VI6 A;  5KMG B;  3FFM A;  4TV8 B;  5LP6 C;  1NJI H;  5LOV B;  3CC7 F;  1QD9 A;  3GYQ A;  2Z1F A;  2EWC A;  2AMT A;  2IAF A;  5B8F A;  5CB4 A;  3V7E A;  4FFB B;  5BMV B;  2VAP A;  3N4Y A;  3VYT C;  1W58 1;  2VGN A;  3I7T A;  1KQS F;  4X1K B;  4YJ2 B;  1ZWZ A;  1VQO F;  2KTU A;  4O4J A;  5CA1 B;  1IV4 A;  5HP7 A;  2W8B C;  4F6R B;  1H48 A;  2UYK A;  4LNU A;  4O4I A;  4O4L A;  3CCV F;  5HXZ A;  5ITZ A;  2QI2 A;  2VGM A;  5LA6 B;  2K1S A;  2HVY D;  5GAN K;  4B45 A;  5JQG B;  1KC8 H;  1H47 A;  2CWJ A;  1NQ3 A;  3F0F A;  5CA0 B;  2R75 1;  1Z5W A;  1X52 A;  4ZI7 B;  3CCR F;  4B5C A;  1CN7 A;  3IR9 A;  3VYS C;  3S06 A;  2VXY A;  1SA0 B;  5EWR A;  4B62 A;  2ZVY A;  3JAT A;  5IYZ B;  1W57 A;  4BY9 D;  3N2G B;  3N2K A;  3OBW A;  3KHN A;  3RYF A;  3JAW B;  4G88 A;  2HS3 A;  5JVD B;  2G9I A;  3EOR A;  4ZHQ B;  3CYP B;  4DRX A;  1FFX A;  5KX5 A;  3DDN A;  3VOB A;  4X1I B;  4O2B A;  1VQL F;  3R0P A;  4O4H A;  2QEX F;  3OW2 F;  3JAR B;  2FGY A;  5J2T A;  5LP6 A;  2KG4 A;  3MCQ A;  1XV2 A;  3WGM A;  1YJ9 F;  4XCQ A;  1VK3 A;  3C9R A;  4X20 B;  4IIJ B;  2H8E A;  5FNV B;  2V9Y A;  3CCU F;  2CHT A;  5IT9 M;  4LCK A;  4O2A A;  4I55 A;  2B33 A;  1Q7Y H;  1QAH A;  3CC2 F;  3OBY A;  3RYC B;  1W55 A;  4ERH A;  1IV1 A;  3KIZ A;  5LYJ A;  3UT5 B;  3S02 A;  3HKC B;  5G4V C;  4C81 A;  1U40 A;  4X3M A;  1OAP A;  3S03 A;  3RA5 A;  1YJN F;  3E22 B;  2KTV A;  1J7H A;  4E6E A;  2PHN A;  4KWE A;  1ODE A;  4O4J B;  4C4W C;  3K12 A;  3C9S A;  3LWO C;  3P4E A;  2UYJ A;  5IJ9 B;  1W41 A;  1X7O A;  3LYB A;  4X1Y A;  2PMP A;  3K0T A;  1RQ7 A;  5ITZ B;  3CYQ A;  4YJ3 A;  1JFF B;  1FNJ A;  3QUW A;  3NMU C;  4C8E A;  3MDO A;  5MN4 A;  3JAK A;  4NWO B;  4IHJ A;  3ERN A;  3J81 M;  2LBW A;  3SIV A;  2DYY A;  1KNJ A;  5EAZ A;  3VIU A;  3JAM M;  3CMA F;  3QHD A;  4C8G A;  1YIT F;  3RYH B;  3S0W A;  5EYP B;  3J7A R;  3N2K B;  5C8Y B;  1VQ6 F;  3J80 M;  2ZOD A;  3G4S F;  1H7M A;  3HKE B;  3HKB A;  1W59 A;  4BT6 A;  3RYI B;  5J2U A;  4ZOL B;  3F6M A;  1UI9 A;  2HP3 A;  2QTP A;  2HRU A;  3PAF A;  2ZVZ A;  3HJW C;  3GHZ A;  3I55 F;  4TV9 B;  1CK2 A;  2WAL A;  5HWE A;  1TUB B;  3WGK A;  3CCJ F;  1W42 A;  1XBI A;  2HRY A;  4BT2 A;  3I3F A;  3WGL A;  1TVK B;  2Q1Y A;  3CG6 A;  2VAM A;  1JD1 A;  5EZY A;  3LWQ C;  3S0Y A;  2RHJ A;  2KGW A;  5IJ0 A;  2AIZ P;  5EB0 A;  5EB1 B;  5GON B;  2Z01 A;  5HY0 A;  3WGJ A;  5HY1 A;  4R40 B;  1IPA A;  3LWP C;  3JAL A;  3DC2 A;  5GIP C;  1YJW F;  2UYN A;  2HP0 A;  3NVK E;  3V7Q A;  4BT7 A;  4PWT A;  3TD5 A;  1QVF F;  2ALE A;  2JNB A;  1E7K A;  3NVI B;  3MQW A;  3C9T A;  4EI9 A;  5GIO C;  5JH7 A;  3KJJ A;  5LYJ B;  1XRG A;  5LXT B;  3AGK A;  4TUY A;  2GLZ A;  2OHW A;  4NQ3 A;  1FNK A;  1RLG A;  1W40 A;  5HY4 A;  2GZL A;  3L7Q A;  1VQN F;  1IV2 A;  4I4T B;  1VQ4 F;  5KMG A;  1U3L A;  3K14 A;  4NUT A;  5LOV A;  1VQK F;  3KJK A;  3HKD B;  1GO0 A;  1GX1 A;  3P0Z A;  4WBN B;  3C9U A;  5MN5 A;  4M8I A;  1VHA A;  1YIJ F;  2HS4 A;  4FFB A;  5BMV A;  2HX0 A;  4HNA B;  2I6R A;  1KD1 H;  1SZQ A;  2BTU A;  2GVI A;  4C82 A;  3LWR C;  2Z1U A;  3CXC F;  4YJ2 A;  1ONI A;  3E20 B;  2R6R 1;  3ESJ A;  1OFU A;  2CHS A;  4BW0 B;  4U39 A;  5CA1 A;  2UYP A;  2IQQ A;  3CPQ A;  4F6R A;  3RE3 A;  1T0A A;  3LDT A;  5CB4 B;  3F0G A;  2VAW A;  4G4X A;  3WXM B;  3F0D A;  2HS0 A;  5LA6 A;  4C8I A;  1RLU A;  5JQG A;  2ZF8 A;  2NMU A;  3BYQ A;  5CA0 A;  3WJP A;  2LBX A;  1W2B F;  1VQ5 F;  1U43 A;  4ZI7 A;  3I56 F;  4ZK7 A;  5HY2 A;  3B6N A;  1T0K B;  1IV3 A;  4BVQ A;  2I6D A;  2RHH A;  1VQV A;  1JJ2 F;  5IYZ A;  3VMF B;  1K8A H;  2F9Z C;  3WPX A;  3V3T A;  4G4Z A;  4LNU B;  5FLX M;  4O4L B;  4O4I B;  2ZAU A;  2H6L A;  3JAW A;  3CPW F;  3M1X A;  5JVD A;  3M4S A;  4EI8 A;  4ZHQ A;  1UFY A;  1PF5 A;  1VQ7 F;  1NMU B;  3VO8 A;  2RB9 A;  3ZP7 A;  3CD6 F;  3CCQ F;  4X1I A;  3FD6 A;  2FC3 A;  2BTQ B;  2OZB A;  2BO1 A;  1FSZ A;  3JAT B;  4G4Y A;  4EB6 A;  3JAR A;  5GAP K;  5JH7 B;  2UZH A;  4DXD A;  3ELC A;  3IKE A;  3JAS A;  3WJQ A;  5JCO C;  2LBT A;  3RYF B;  4TUY B;  2OTL F;  3U0O A;  3VOA A;  4X20 A;  4IIJ A;  3MBM A;  3D00 A;  3PLA C;  3CC4 F;  3QTY A;  4DRX B;  1FFX B;  5KX5 B;  3ZO8 A;  3HWU A;  1YHQ F;  4G4W A;  4O2B B;  1VQP F;  1K73 H;  2RHO A;  3FBA A;  3ZP4 A;  4O4H B;  2Z1T A;  3FPI A;  2YXZ A;  3RYC A;  4BT5 A;  3CB2 A;  2LCA A;  3NK7 A;  4RHA A;  3UT5 A;  5HP8 A;  5J2T B;  1VQ8 F;  1QU9 A;  1W3E X;  3HKC A;  4BVT A;  5LP6 B;  1SDS A;  3RA6 A;  3CME F;  3FD5 A;  4RQO A;  3VYU C;  1W5E A;  3K2X A;  3NK6 A;  3LFO A;  4O2A B;  4I55 B;  3E22 A;  2CVL A;  4U3J A;  1W5F A;  1JY8 A;  1W5A A;  3TD3 A;  3VTI C;  2H8C A;  4BVR A;  5IJ9 A;  3IKF A;  1GZ0 A;  1Q86 H;  3LME A;  3HAX D;  1VQM F;  3WGN A;  3O85 A;  4ZHV A; 
#chains in the Genus database with same CATH homology
 3EOR A;  3B6N A;  2UZH A;  4C8G A;  2AMT A;  1IV3 A;  4C82 A;  3ELC A;  3IKE A;  1JN1 A;  2GZL A;  5B8F A;  1U3P A;  1W55 A;  1IV2 A;  1H47 A;  1IV1 A;  2PMP A;  1KNK A;  3K2X A;  3F0F A;  3KE1 A;  3ESJ A;  1U3L A;  3IEW A;  3F6M A;  3K14 A;  3MBM A;  3P10 A;  4C81 A;  3GHZ A;  1JY8 A;  3RE3 A;  1T0A A;  1U40 A;  3F0G A;  1GX1 A;  4C8E A;  3F0D A;  3JVH A;  3P0Z A;  1W57 A;  3FBA A;  3T80 A;  1YQN A;  4C8I A;  1VHA A;  3FPI A;  3IEQ A;  3IKF A;  3ERN A;  1IV4 A;  3Q8H A;  1KNJ A;  3F0E A;  1H48 A;  1VH8 A;  1U43 A;  3QHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...