3EORA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
b'EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 41
structure length 157
sequence length 157
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3eorA00
3EORA 3ERNA 3F0EA 1VHAA 3IKEA 1U40A 3B6NA 1IV4A 1VH8A 4C8IA 3F6MA 3MBMA 3ESJA 3KE1A 1H48A 1W57A 4C8EA 5B8FA 1IV3A 3P0ZA 3RE3A 3Q8HA 4C82A 1JY8A 1U3PA 3IEWA 3K14A 3F0FA 3GHZA 3FPIA 1YQNA 3FBAA 3F0GA 3JVHA 3IEQA 2AMTA 1H47A 1U43A 2UZHA 4C8GA 4C81A 1U3LA 2GZLA 3F0DA 1IV1A 3QHDA 3T80A 3P10A 1GX1A 3K2XA 1KNJA 1IV2A 1T0AA 1JN1A 1KNKA 3IKFA 1W55A 2PMPA 3ELCA
chains in the Genus database with same CATH superfamily
2HX0A 2ZODA 3KIZA 2KG4A 1VK3A 3WJPA 2YXZA 3L7QA 1W2BF 2K1SA 3N4ZA 4BY9D 1W3EX 2KTUA 5J2TB 3N2GA 2HS0A 3RYIB 2CVLA 3K12A 4O4LA 1TVKA 3S02A 1GO0A 2LCAA 3D54A 5FNVB 4TV8B 4X1KB 5HXUA 5G4VC 1FFXB 1W5AA 3WXMB 3JAMM 4LNUB 1JJ2F 1IPAA 2Q1YA 1CK2A 3OW2F 5LP6C 3RA6A 3CCLF 5IJ9A 2UYNA 2QEXF 2ALEA 2HP0A 2OTMA 1VQVA 3D00A 1JFFB 2Z1EA 1YITF 3RA5A 3MBMA 3LWQC 1IV3A 3HKCB 3JARB 1E7KA 3N2KB 4ZHYB 1VQ6F 1H7MA 5MN6A 1K73H 3JATA 3VMFB 3ZP7A 3CMAF 1Q8RA 2OZBA 4C8GA 1W581 3KJKA 4ZK7A 3P10A 4I55B 4FFBB 3VYTC 4BVTA 3IMPA 4X3MA 2ZF8A 4BT2A 3PAFA 2PHNA 3CCQF 3ON1A 5ITZB 3CB2A 1VH8A 5EIBC 1FNJA 4LCKA 4BT5A 5JCOC 3ZO8A 2LBWA 4X20B 5J2TA 3GYQA 3RYIA 3M84A 2UYPA 2N48A 3S03A 4DRXB 4TV8A 4X1KA 4ZI7B 3F0DA 5FJ4C 3CD6F 3T80A 4LNUA 1SA0B 3HKEA 3RYCA 5EB0A 5IJ0A 5C8YB 1VQ5F 3Q8HA 5EIBD 2PMPA 2VAWA 4F6RB 3RYHA 1UI9A 1Q86H 3CC2F 1W42A 5CB4B 3OBWA 3V7QA 5KMGB 2CWJA 1JFFA 2RHJA 3P0ZA 3N2GB 4YJ3B 2HRYA 1NJIH 1U3PA 3JARA 4TUYB 4O4LB 3WJRA 2CHSA 4E6EA 4ZHVA 1VQ7F 2LBXA 1TUBA 1W5EA 1FSZA 5GAPK 4EB6B 1VQNF 1FNKA 3NK7A 1X7PA 3LWVC 3VOBA 3CCMF 5HP7A 2OTJF 4I55A 5EWRA 3G4SF 2VAPA 1QVGF 3CCUF 3HKDA 1IV4A 5ITZA 3JAWA 5HY0A 2NMUA 4C82A 2EWCA 5CA0B 5JH7A 5KX5B 2BO1A 3K14A 5EB1B 1N8RH 4BT7A 4O2AB 3CYPB 2UZHA 1SDSA 4XCQA 4BT3A 1U3LA 2GZLA 4ZI7A 3QHDA 4TZZA 2BTQB 1SA0A 3JCMM 5LA6B 3J80M 5C8YA 4TV9B 4O4IA 5EZYB 2HP3A 4X1YB 4F6RA 5CB4A 5KMGA 5GIPC 3TD5A 1VQKF 2WALA 3DDNA 5IT9M 2P6YA 3UT5B 5A2QM 2ZVYA 4YJ3A 3V4DA 1RQ7A 3GHZA 1QAHA 2HS3A 4TUYA 3JVHA 4X3LA 3IEQA 2AMTA 4B5CA 3S0HA 1IV1A 3HKEB 3RYCB 3CCVF 5IJ0B 4EB6A 1W5FA 3J7AR 2HVYD 3RYHB 2RHLA 5G4UC 2CZWA 3E22B 3V7EA 3VIUA 3CG6A 1U40A 3C9RA 1VQOF 2V9YA 3OONA 1Q82H 2AIFA 2IG8A 3IEWA 5CA0A 5KX5A 2HRUA 4G4VA 4BVQA 2RB9A 1QVFF 3VCZA 1TUBB 3ZP4A 4O2AA 3PLAC 3CC4F 5LXTB 4G4WA 2Z1FA 3VTIC 4EI8A 3IR9A 1OFUA 2GLZA 4X1IA 3M1XA 5LA6A 4O2BB 3EORA 4TV9A 5EZYA 3TD3A 3CC7F 3WGNA 1QU9A 2HQSC 3HKDB 4X1YA 3JAWB 2DYYA 4EI7A 2H8CA 1UFYA 1OAPA 1R1MA 1CLIA 5JH7B 1K9MH 1VQ9F 3F0FA 3ZOPA 3UT5A 1YJ9F 3FPIA 4RQOA 4KWEA 4EI9A 2Z01A 5LP6B 3K2XA 4ZHQB 2L26A 3FFMA 1Q81H 2GVIA 2MQEA 4B62A 4O4IB 2I6DA 1SZQA 3NVKE 2OHWA 2VXYA 3IKEA 4U3JB 2CHTA 3E22A 3JAKA 3LYBA 2W8BC 2FC3A 3G6EF 4DXDA 3SIVA 3CCEF 3O85A 3S0YA 3CMEF 2RHHA 1VQPF 4BW0B 5J2UA 1M1KH 1JY8A 3I56F 1GO1A 5HP8A 4BVSA 1RA4A 2CSLA 1Q7YH 3OBYA 3NK6A 1PF5A 2R751 3RYFB 2Z1TA 5LXTA 1T0AA 4O4JB 4WBNA 3VYUC 4I4TB 1KQSF 3F0EA 3C9SA 3CPQA 4I50A 4O2BA 2RHOA 5JQGB 3GTZA 2KGWA 3JASB 1XRGA 1W40A 3QUWA 5HWEA 3G71F 3RE3A 1ONIA 2QA4F 5DCVA 3FD5A 1YGYA 3K0TA 3S0WA 3LWOC 3S06A 5EAZA 3NMUC 4O4HA 1PXWA 1ODEA 3E20B 5LP6A 1W59A 3KJJA 3C8LA 4G4XA 4G4ZA 4ZHQA 4X1IB 1M90H 1KNKA 2HS4A 1GZ0A 5EYPB 1CN7A 2IQQA 3CXCF 3V3TA 3B6NA 3JALB 2OTLF 4U3JA 1DBFA 4YJ2B 2VGNA 5GONB 4ERHA 3MCQA 4NQ3A 1Z5VA 4HNAB 4NWOB 4IIJB 2QI2A 5CA1B 1YQNA 3LMEA 1X25A 3F0GA 3TD4A 3WPXA 5IYZB 3D01A 1H47A 1U43A 3FD6A 3WPWA 3LWRC 2I6RA 1K8AH 1IV2A 3RYFA 3HKBA 3MDOA 2Z1UA 1JN1A 2BTUA 3MQWA 3LFOA 4O4JA 4I4TA 5JCOA 3I7TA 3JAKB 1NMUB 3HWUA 5JQGA 4C8IA 3JASA 5MN5A 3C9TA 4IHJB 2F9ZC 5J2UB 2UYKA 3WGLA 1W41A 3WJQA 3WGMA 1X52A 3QTYA 4PWTA 3CCJF 5MN4A 2H6LA 3CPWF 1W55A 4WBNB 3VOAA 3ERNA 5LOVB 4I50B 1Z5WA 5EYPA 1VHAA 1XBIA 5LYJA 1J7HA 4M8IA 3VI6A 5BMVB 3JALA 1H48A 3MCAB 5EO3A 1ZWZA 4C8EA 3J81M 4YJ2A 5AVMA 5GONA 4BT4A 1YHQF 1X7OA 3CCSF 3R0PA 1YJWF 4HNAA 4ZOLB 1RLUA 3M4SA 4IIJA 5CA1A 4O4HB 5HXZA 2AIZP 5IYZA 2VGMA 3C9UA 4ZHWA 1XHOA 5JVDB 1JD1A 3AGKA 1RLGA 3U0OA 3SIUA 2VAMA 3DC2A 5HY2A 3P4EA 3HAXD 3LDTA 3CCRF 2G9IA 1DT9A 2YYEA 3ESJA 3I3FA 5HY1A 2CW4A 5GIOC 1NQ3A 1W5BA 3I55F 4IHJA 3KHNA 1VQLF 3VO8A 5GANK 3HJWC 5FNVA 1FFXA 4U39A 4C81A 1YJNF 2H8EA 2UYJA 4NUTA 3HKBB 3IKFA 2LBTA 1XV2A 5LOVA 1KD1H 5B8FA 5BMVA 3HKCA 1TVKB 3N2KA 5GINC 3VYSC 2BTOA 3LWPC 2FGYA 4ZOLA 2R6R1 2B33A 4R40B 1YI2F 3CYQA 4G4YA 1GX1A 3WGKA 1QD9A 4B45A 5JVDA 4FFBA 5IJ9B 2UYNB 1VQ4F 3BYQA 2HP0B 5LYJB 5FLXM 3F6MA 3E1YA 3KE1A 1VQ8F 1W57A 3NVIB 4C4WC 3N4YA 1T0KB 4G88A 4X20A 3JATB 4BT6A 3WGJA 1YIJF 3FBAA 4BVRA 1VQMF 2ZAUA 1RQ2A 4DRXA 4B46A 2JNBA 1COMA 2KTVA 2DT4A 1KC8H 2ZVZA 2ZOVA 2Q1XA 1KNJA 2QTPA 1S72F 4RHAA 2IAFA 5HY4A 3HTNA 3ELCA
chains in the Genus database with same CATH topology
3EORA 3ERNA 3F0EA 1VHAA 3IKEA 1U40A 3B6NA 1IV4A 1VH8A 4C8IA 3F6MA 3MBMA 3ESJA 3KE1A 1H48A 1W57A 4C8EA 5B8FA 1IV3A 3P0ZA 3RE3A 3Q8HA 4C82A 1JY8A 1U3PA 3IEWA 3K14A 3F0FA 3GHZA 3FPIA 1YQNA 3FBAA 3F0GA 3JVHA 3IEQA 2AMTA 1H47A 1U43A 2UZHA 4C8GA 4C81A 1U3LA 2GZLA 3F0DA 1IV1A 3QHDA 3T80A 3P10A 1GX1A 3K2XA 1KNJA 1IV2A 1T0AA 1JN1A 1KNKA 3IKFA 1W55A 2PMPA 3ELCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOR A;  3ERN A;  3F0E A;  1VHA A;  3IKE A;  1U40 A;  3B6N A;  1IV4 A;  1VH8 A;  4C8I A;  3F6M A;  3MBM A;  3ESJ A;  3KE1 A;  1H48 A;  1W57 A;  4C8E A;  5B8F A;  1IV3 A;  3P0Z A;  3RE3 A;  3Q8H A;  4C82 A;  1JY8 A;  1U3P A;  3IEW A;  3K14 A;  3F0F A;  3GHZ A;  3FPI A;  1YQN A;  3FBA A;  3F0G A;  3JVH A;  3IEQ A;  2AMT A;  1H47 A;  1U43 A;  2UZH A;  4C8G A;  4C81 A;  1U3L A;  2GZL A;  3F0D A;  1IV1 A;  3QHD A;  3T80 A;  3P10 A;  1GX1 A;  3K2X A;  1KNJ A;  1IV2 A;  1T0A A;  1JN1 A;  1KNK A;  3IKF A;  1W55 A;  2PMP A;  3ELC A; 
#chains in the Genus database with same CATH topology
 2HX0 A;  2ZOD A;  3KIZ A;  2KG4 A;  1VK3 A;  3WJP A;  2YXZ A;  3L7Q A;  1W2B F;  2K1S A;  3N4Z A;  4BY9 D;  1W3E X;  2KTU A;  5J2T B;  3N2G A;  2HS0 A;  3RYI B;  2CVL A;  3K12 A;  4O4L A;  1TVK A;  3S02 A;  1GO0 A;  2LCA A;  3D54 A;  5FNV B;  4TV8 B;  4X1K B;  5HXU A;  5G4V C;  1FFX B;  1W5A A;  3WXM B;  3JAM M;  4LNU B;  1JJ2 F;  1IPA A;  2Q1Y A;  1CK2 A;  3OW2 F;  5LP6 C;  3RA6 A;  3CCL F;  5IJ9 A;  2UYN A;  2QEX F;  2ALE A;  2HP0 A;  2OTM A;  1VQV A;  3D00 A;  1JFF B;  2Z1E A;  1YIT F;  3RA5 A;  3MBM A;  3LWQ C;  1IV3 A;  3HKC B;  3JAR B;  1E7K A;  3N2K B;  4ZHY B;  1VQ6 F;  1H7M A;  5MN6 A;  1K73 H;  3JAT A;  3VMF B;  3ZP7 A;  3CMA F;  1Q8R A;  2OZB A;  4C8G A;  1W58 1;  3KJK A;  4ZK7 A;  3P10 A;  4I55 B;  4FFB B;  3VYT C;  4BVT A;  3IMP A;  4X3M A;  2ZF8 A;  4BT2 A;  3PAF A;  2PHN A;  3CCQ F;  3ON1 A;  5ITZ B;  3CB2 A;  1VH8 A;  5EIB C;  1FNJ A;  4LCK A;  4BT5 A;  5JCO C;  3ZO8 A;  2LBW A;  4X20 B;  5J2T A;  3GYQ A;  3RYI A;  3M84 A;  2UYP A;  2N48 A;  3S03 A;  4DRX B;  4TV8 A;  4X1K A;  4ZI7 B;  3F0D A;  5FJ4 C;  3CD6 F;  3T80 A;  4LNU A;  1SA0 B;  3HKE A;  3RYC A;  5EB0 A;  5IJ0 A;  5C8Y B;  1VQ5 F;  3Q8H A;  5EIB D;  2PMP A;  2VAW A;  4F6R B;  3RYH A;  1UI9 A;  1Q86 H;  3CC2 F;  1W42 A;  5CB4 B;  3OBW A;  3V7Q A;  5KMG B;  2CWJ A;  1JFF A;  2RHJ A;  3P0Z A;  3N2G B;  4YJ3 B;  2HRY A;  1NJI H;  1U3P A;  3JAR A;  4TUY B;  4O4L B;  3WJR A;  2CHS A;  4E6E A;  4ZHV A;  1VQ7 F;  2LBX A;  1TUB A;  1W5E A;  1FSZ A;  5GAP K;  4EB6 B;  1VQN F;  1FNK A;  3NK7 A;  1X7P A;  3LWV C;  3VOB A;  3CCM F;  5HP7 A;  2OTJ F;  4I55 A;  5EWR A;  3G4S F;  2VAP A;  1QVG F;  3CCU F;  3HKD A;  1IV4 A;  5ITZ A;  3JAW A;  5HY0 A;  2NMU A;  4C82 A;  2EWC A;  5CA0 B;  5JH7 A;  5KX5 B;  2BO1 A;  3K14 A;  5EB1 B;  1N8R H;  4BT7 A;  4O2A B;  3CYP B;  2UZH A;  1SDS A;  4XCQ A;  4BT3 A;  1U3L A;  2GZL A;  4ZI7 A;  3QHD A;  4TZZ A;  2BTQ B;  1SA0 A;  3JCM M;  5LA6 B;  3J80 M;  5C8Y A;  4TV9 B;  4O4I A;  5EZY B;  2HP3 A;  4X1Y B;  4F6R A;  5CB4 A;  5KMG A;  5GIP C;  3TD5 A;  1VQK F;  2WAL A;  3DDN A;  5IT9 M;  2P6Y A;  3UT5 B;  5A2Q M;  2ZVY A;  4YJ3 A;  3V4D A;  1RQ7 A;  3GHZ A;  1QAH A;  2HS3 A;  4TUY A;  3JVH A;  4X3L A;  3IEQ A;  2AMT A;  4B5C A;  3S0H A;  1IV1 A;  3HKE B;  3RYC B;  3CCV F;  5IJ0 B;  4EB6 A;  1W5F A;  3J7A R;  2HVY D;  3RYH B;  2RHL A;  5G4U C;  2CZW A;  3E22 B;  3V7E A;  3VIU A;  3CG6 A;  1U40 A;  3C9R A;  1VQO F;  2V9Y A;  3OON A;  1Q82 H;  2AIF A;  2IG8 A;  3IEW A;  5CA0 A;  5KX5 A;  2HRU A;  4G4V A;  4BVQ A;  2RB9 A;  1QVF F;  3VCZ A;  1TUB B;  3ZP4 A;  4O2A A;  3PLA C;  3CC4 F;  5LXT B;  4G4W A;  2Z1F A;  3VTI C;  4EI8 A;  3IR9 A;  1OFU A;  2GLZ A;  4X1I A;  3M1X A;  5LA6 A;  4O2B B;  3EOR A;  4TV9 A;  5EZY A;  3TD3 A;  3CC7 F;  3WGN A;  1QU9 A;  2HQS C;  3HKD B;  4X1Y A;  3JAW B;  2DYY A;  4EI7 A;  2H8C A;  1UFY A;  1OAP A;  1R1M A;  1CLI A;  5JH7 B;  1K9M H;  1VQ9 F;  3F0F A;  3ZOP A;  3UT5 A;  1YJ9 F;  3FPI A;  4RQO A;  4KWE A;  4EI9 A;  2Z01 A;  5LP6 B;  3K2X A;  4ZHQ B;  2L26 A;  3FFM A;  1Q81 H;  2GVI A;  2MQE A;  4B62 A;  4O4I B;  2I6D A;  1SZQ A;  3NVK E;  2OHW A;  2VXY A;  3IKE A;  4U3J B;  2CHT A;  3E22 A;  3JAK A;  3LYB A;  2W8B C;  2FC3 A;  3G6E F;  4DXD A;  3SIV A;  3CCE F;  3O85 A;  3S0Y A;  3CME F;  2RHH A;  1VQP F;  4BW0 B;  5J2U A;  1M1K H;  1JY8 A;  3I56 F;  1GO1 A;  5HP8 A;  4BVS A;  1RA4 A;  2CSL A;  1Q7Y H;  3OBY A;  3NK6 A;  1PF5 A;  2R75 1;  3RYF B;  2Z1T A;  5LXT A;  1T0A A;  4O4J B;  4WBN A;  3VYU C;  4I4T B;  1KQS F;  3F0E A;  3C9S A;  3CPQ A;  4I50 A;  4O2B A;  2RHO A;  5JQG B;  3GTZ A;  2KGW A;  3JAS B;  1XRG A;  1W40 A;  3QUW A;  5HWE A;  3G71 F;  3RE3 A;  1ONI A;  2QA4 F;  5DCV A;  3FD5 A;  1YGY A;  3K0T A;  3S0W A;  3LWO C;  3S06 A;  5EAZ A;  3NMU C;  4O4H A;  1PXW A;  1ODE A;  3E20 B;  5LP6 A;  1W59 A;  3KJJ A;  3C8L A;  4G4X A;  4G4Z A;  4ZHQ A;  4X1I B;  1M90 H;  1KNK A;  2HS4 A;  1GZ0 A;  5EYP B;  1CN7 A;  2IQQ A;  3CXC F;  3V3T A;  3B6N A;  3JAL B;  2OTL F;  4U3J A;  1DBF A;  4YJ2 B;  2VGN A;  5GON B;  4ERH A;  3MCQ A;  4NQ3 A;  1Z5V A;  4HNA B;  4NWO B;  4IIJ B;  2QI2 A;  5CA1 B;  1YQN A;  3LME A;  1X25 A;  3F0G A;  3TD4 A;  3WPX A;  5IYZ B;  3D01 A;  1H47 A;  1U43 A;  3FD6 A;  3WPW A;  3LWR C;  2I6R A;  1K8A H;  1IV2 A;  3RYF A;  3HKB A;  3MDO A;  2Z1U A;  1JN1 A;  2BTU A;  3MQW A;  3LFO A;  4O4J A;  4I4T A;  5JCO A;  3I7T A;  3JAK B;  1NMU B;  3HWU A;  5JQG A;  4C8I A;  3JAS A;  5MN5 A;  3C9T A;  4IHJ B;  2F9Z C;  5J2U B;  2UYK A;  3WGL A;  1W41 A;  3WJQ A;  3WGM A;  1X52 A;  3QTY A;  4PWT A;  3CCJ F;  5MN4 A;  2H6L A;  3CPW F;  1W55 A;  4WBN B;  3VOA A;  3ERN A;  5LOV B;  4I50 B;  1Z5W A;  5EYP A;  1VHA A;  1XBI A;  5LYJ A;  1J7H A;  4M8I A;  3VI6 A;  5BMV B;  3JAL A;  1H48 A;  3MCA B;  5EO3 A;  1ZWZ A;  4C8E A;  3J81 M;  4YJ2 A;  5AVM A;  5GON A;  4BT4 A;  1YHQ F;  1X7O A;  3CCS F;  3R0P A;  1YJW F;  4HNA A;  4ZOL B;  1RLU A;  3M4S A;  4IIJ A;  5CA1 A;  4O4H B;  5HXZ A;  2AIZ P;  5IYZ A;  2VGM A;  3C9U A;  4ZHW A;  1XHO A;  5JVD B;  1JD1 A;  3AGK A;  1RLG A;  3U0O A;  3SIU A;  2VAM A;  3DC2 A;  5HY2 A;  3P4E A;  3HAX D;  3LDT A;  3CCR F;  2G9I A;  1DT9 A;  2YYE A;  3ESJ A;  3I3F A;  5HY1 A;  2CW4 A;  5GIO C;  1NQ3 A;  1W5B A;  3I55 F;  4IHJ A;  3KHN A;  1VQL F;  3VO8 A;  5GAN K;  3HJW C;  5FNV A;  1FFX A;  4U39 A;  4C81 A;  1YJN F;  2H8E A;  2UYJ A;  4NUT A;  3HKB B;  3IKF A;  2LBT A;  1XV2 A;  5LOV A;  1KD1 H;  5B8F A;  5BMV A;  3HKC A;  1TVK B;  3N2K A;  5GIN C;  3VYS C;  2BTO A;  3LWP C;  2FGY A;  4ZOL A;  2R6R 1;  2B33 A;  4R40 B;  1YI2 F;  3CYQ A;  4G4Y A;  1GX1 A;  3WGK A;  1QD9 A;  4B45 A;  5JVD A;  4FFB A;  5IJ9 B;  2UYN B;  1VQ4 F;  3BYQ A;  2HP0 B;  5LYJ B;  5FLX M;  3F6M A;  3E1Y A;  3KE1 A;  1VQ8 F;  1W57 A;  3NVI B;  4C4W C;  3N4Y A;  1T0K B;  4G88 A;  4X20 A;  3JAT B;  4BT6 A;  3WGJ A;  1YIJ F;  3FBA A;  4BVR A;  1VQM F;  2ZAU A;  1RQ2 A;  4DRX A;  4B46 A;  2JNB A;  1COM A;  2KTV A;  2DT4 A;  1KC8 H;  2ZVZ A;  2ZOV A;  2Q1X A;  1KNJ A;  2QTP A;  1S72 F;  4RHA A;  2IAF A;  5HY4 A;  3HTN A;  3ELC A; 
#chains in the Genus database with same CATH homology
 3EOR A;  3ERN A;  3F0E A;  1VHA A;  3IKE A;  1U40 A;  3B6N A;  1IV4 A;  1VH8 A;  4C8I A;  3F6M A;  3MBM A;  3ESJ A;  3KE1 A;  1H48 A;  1W57 A;  4C8E A;  5B8F A;  1IV3 A;  3P0Z A;  3RE3 A;  3Q8H A;  4C82 A;  1JY8 A;  1U3P A;  3IEW A;  3K14 A;  3F0F A;  3GHZ A;  3FPI A;  1YQN A;  3FBA A;  3F0G A;  3JVH A;  3IEQ A;  2AMT A;  1H47 A;  1U43 A;  2UZH A;  4C8G A;  4C81 A;  1U3L A;  2GZL A;  3F0D A;  1IV1 A;  3QHD A;  3T80 A;  3P10 A;  1GX1 A;  3K2X A;  1KNJ A;  1IV2 A;  1T0A A;  1JN1 A;  1KNK A;  3IKF A;  1W55 A;  2PMP A;  3ELC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...