2OTJF

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2otjF00
1S72F 2VGMA 1N8RH 1K8AH 2QEXF 2HVYD 3RA5A 1VQ5F 1XBIA 1QVGF 1GO0A 3G6EF 2FC3A 1X52A 1KQSF 3V7QA 1K73H 4C4WC 3RA6A 3CMAF 3CPWF 5FJ4C 1H7MA 1YHQF 1GO1A 1VQ7F 1VQ6F 1IPAA 3HAXD 1VQKF 3LWQC 1W2BF 3NK6A 5GANK 1YITF 1VQOF 4BY9D 3AGKA 3CXCF 3JAMM 3O85A 3CCVF 1YIJF 3SIUA 2QI2A 1CN7A 4X3LA 3V7EA 1M90H 1SDSA 1W40A 5GINC 3CPQA 2I6DA 3VI6A 3LWOC 5EO3A 3NVKE 1E7KA 1RA4A 3OBYA 3CCLF 1KC8H 3G4SF 3N4ZA 3VMFB 5IT9M 3CCMF 3CCQF 3CC7F 1VQ9F 3LWRC 5GIPC 3JCMM 3CCEF 1JJ2F 2LBXA 3J80M 3SIVA 1Q82H 2BO1A 3I56F 2AIFA 2KG4A 2KTVA 3FFMA 1YJ9F 3OBWA 3MCAB 2KTUA 1CK2A 3CMEF 2ALEA 1QVFF 3CCUF 5A2QM 1RLGA 3CCRF 3HJWC 3CC4F 4X3MA 1W3EX 5G4VC 1PXWA 3LWVC 3LFOA 2QA4F 1Q86H 5GAPK 5GIOC 2JNBA 3OW2F 5EWRA 3NMUC 3PLAC 2OZBA 2CZWA 1NMUB 3GYQA 3CCSF 4TZZA 3J81M 3G71F 3CCJF 5G4UC 1X7OA 1KD1H 4NUTA 2OHWA 4LCKA 1W41A 3CG6A 2OTJF 5DCVA 1VQ4F 1GZ0A 3LWPC 1VQ8F 1YJWF 3IR9A 3PAFA 3I55F 1M1KH 3N4YA 2WALA 1YI2F 2VGNA 3ON1A 3J7AR 3E1YA 1DT9A 5FLXM 2LBWA 1ZWZA 3WXMB 1VQLF 1K9MH 3NVIB 1W42A 3CC2F 1YJNF 1NJIH 1T0KB 2OTLF 3E20B 3NK7A 1VQMF 1VQPF 1X7PA 1Q81H 1Q7YH 4BW0B 1VQNF 3CD6F
chains in the Genus database with same CATH superfamily
3RYHB 1S72F 1N8RH 4WBNA 2MQEA 4BT3A 2HVYD 3RA5A 4I55B 5J2TB 4ZHQA 4YJ2A 1VQ5F 3JAWA 5FNVA 2FC3A 5B8FA 1KQSF 3JAKA 5J2UA 3F0FA 2LBTA 5BMVA 1H7MA 4O4HB 1QD9A 5HXUA 1VQ6F 3S0YA 2VXYA 4TUYB 4DRXB 3JARB 4C8IA 2YYEA 4TV8B 5HWEA 1U3LA 3RYFB 3CXCF 1H47A 3HWUA 4ERHA 3CCVF 5LA6B 1RLUA 5IJ9B 4X3LA 1RQ2A 5LP6C 1XHOA 2I6RA 3LWOC 5EO3A 3K0TA 2PHNA 5CA0A 4BVQA 1RA4A 4WBNB 5GONA 2V9YA 4YJ2B 1FNKA 3JAWB 5IT9M 1FNJA 5FNVB 3S03A 1OAPA 5LYJA 3JAKB 4X1KA 5J2UB 3J80M 2AIZP 2BO1A 5BMVB 4BT2A 2ZVYA 3C9SA 1YJ9F 5HXZA 3IKFA 5CA1A 3CYQA 1XRGA 1QVFF 2HX0A 4EI7A 3KJKA 3LYBA 2W8BC 3FBAA 3QUWA 5MN6A 1X25A 1W3EX 1CLIA 3ZP7A 5G4VC 3LFOA 1ONIA 1Q86H 5GAPK 1UFYA 2JNBA 3MDOA 5LP6B 3OW2F 5JCOA 4ZK7A 5IJ0A 3VCZA 3IEWA 2CZWA 4X1IA 3ZP4A 5CA0B 3F6MA 2CHSA 4I50B 5GONB 1X7OA 3N2KA 4RQOA 3S0WA 2B33A 2OHWA 3C9RA 1W5BA 3P4EA 1VQ8F 4X1KB 3IR9A 5AVMA 3I55F 3N4YA 4ZI7A 3V4DA 2UYJA 2HP3A 3E1YA 3TD5A 3VO8A 5KMGA 4BT7A 5FLXM 1ZWZA 1K9MH 1IV4A 2R6R1 3CC2F 1NJIH 1T0KB 4NWOB 2CVLA 3E20B 1VQPF 1X7PA 4I55A 1W5AA 3VOAA 3M1XA 1W55A 5IJ0B 2UZHA 3CD6F 3WGMA 4F6RB 3HKEA 3Q8HA 4O4HA 1Q8RA 3D01A 4TUYA 1X52A 2N48A 2BTOA 4DXDA 4EI8A 1JY8A 3RA6A 5FJ4C 3RYFA 5EIBD 1YHQF 1GO1A 3RYIB 1VQ7F 3GTZA 2BTQB 1W2BF 4BT5A 4ZI7B 1DBFA 1VQOF 1YITF 4EB6A 3AGKA 5EB1B 1U40A 3VYSC 3VYTC 3I7TA 5KMGB 4XCQA 5KX5A 2CHTA 2G9IA 2OTMA 3CPQA 3T80A 2Z01A 3R0PA 3WPWA 1E7KA 3RYCA 3OBYA 1Z5VA 3HKEB 1YGYA 4G88A 1JD1A 3CCQF 4ZOLA 4BT4A 3JCMM 3CCEF 2UYPA 3SIVA 3I56F 2AIFA 4B45A 2CW4A 2UYNB 1TVKA 5ITZA 2ALEA 3E22A 4C81A 5HY1A 3CCUF 2Z1FA 1VHAA 3WGKA 5LP6A 2ZF8A 4BVSA 3CCRF 4EB6B 3I3FA 3HTNA 3L7QA 2YXZA 3TD3A 4B62A 5KX5B 1PF5A 4I50A 2Q1YA 3PLAC 2CSLA 3UT5B 2VAMA 1TUBA 1W5FA 3DC2A 3P10A 3GYQA 3CCSF 3J81M 3RYCB 4NUTA 4M8IA 1VQ4F 3GHZA 4ZOLB 3LWPC 4BT6A 2VAWA 1Z5WA 3MBMA 3DDNA 3VTIC 1TVKB 5ITZB 4O2BA 3E22B 4YJ3A 1YI2F 1J7HA 2K1SA 2NMUA 3ON1A 1DT9A 4ZHWA 3QHDA 1FFXA 3CYPB 4F6RA 1Q81H 3HKDA 1SA0A 2R751 1TUBB 4NQ3A 4R40B 2QEXF 3D54A 1K8AH 2AMTA 4FFBA 1XBIA 2GVIA 1QVGF 3RYIA 4LNUB 3ZO8A 4ZHVA 1K73H 3CPWF 5EYPA 5HP8A 2ZOVA 3WJPA 5JVDA 3HAXD 1T0AA 3OONA 2EWCA 2HS4A 3F0DA 2HS0A 1VQKF 3LWQC 3NK6A 3JALA 4C82A 4O2BB 4YJ3B 1GX1A 4X1YB 4BY9D 3JAMM 5MN5A 3S06A 1YIJF 1SZQA 2QI2A 1CN7A 1FFXB 2RB9A 3V7EA 1W40A 5GINC 2I6DA 3HKDB 4I4TA 3VI6A 2HRUA 3KIZA 1SA0B 3CCLF 3K12A 5EZYB 3N2GA 4FFBB 3G4SF 2UYNA 1JFFB 4KWEA 1IV2A 3CC7F 1VQ9F 5GIPC 2VAPA 4TV9A 4ZHYB 2LBXA 1JJ2F 5EYPB 3V3TA 3IKEA 3EORA 4G4VA 1VQVA 4O4IB 3OBWA 2QTPA 3MCAB 2KTUA 1CK2A 5JVDB 3MQWA 2LCAA 3LDTA 5JQGB 3LMEA 2IQQA 3FPIA 2FGYA 1RLGA 3JALB 3FD5A 3HJWC 3CC4F 2RHOA 3C9UA 2BTUA 3UT5A 3LWVC 1PXWA 3IEQA 4X20A 2CWJA 5HY2A 3WGJA 2ZODA 3ERNA 3KE1A 4U3JA 4B5CA 3NMUC 1QU9A 3M84A 3F0GA 1NMUB 4EI9A 1W59A 4I4TB 4TZZA 2RHHA 3CCJF 3KJJA 2ZAUA 2ZVZA 5IYZA 1KNKA 2L26A 1U43A 1KD1H 3N2GB 2DT4A 4C8GA 1H48A 1VH8A 1W41A 3CG6A 2OTJF 3M4SA 4U39A 4TV9B 1YJWF 2Z1UA 3RE3A 3PAFA 3HKBA 3VOBA 3P0ZA 4BVRA 3CB2A 4RHAA 3J7AR 5HY4A 1NQ3A 2UYKA 5JH7B 3WXMB 5HP7A 1VQLF 4HNAB 1YJNF 1U3PA 3ESJA 4IHJA 4E6EA 2OTLF 3BYQA 3NK7A 2H8CA 4X20B 4IIJA 3U0OA 5C8YA 2Z1EA 4LNUA 4U3JB 3C9TA 2VGMA 5LXTA 3JATA 5EB0A 2HS3A 1GO0A 5IYZB 5LOVA 3WGLA 3G6EF 4G4ZA 1QAHA 3V7QA 2HP0A 4C4WC 1VK3A 2Q1XA 3CMAF 2IAFA 4G4WA 4X1YA 4ZHQB 1IPAA 1FSZA 2F9ZC 2P6YA 3TD4A 3HKBB 5GANK 1W5EA 2H8EA 2PMPA 3O85A 3SIUA 3WJRA 2HQSC 4IHJB 5CB4A 4BVTA 4G4XA 5EZYA 1XV2A 1M90H 3JVHA 4IIJB 1SDSA 1JFFA 3WGNA 5C8YB 4O4LA 2HRYA 3VYUC 3NVKE 5LXTB 3FD6A 3JATB 2Z1TA 1W57A 3KHNA 5JCOC 1KC8H 3ZOPA 2IG8A 4O4IA 3N4ZA 3VMFB 1KNJA 3K2XA 5JQGA 1IV1A 5LOVB 3CCMF 1R1MA 1JN1A 1YQNA 3LWRC 4PWTA 4G4YA 5EIBC 3F0EA 2HP0B 1Q82H 2KG4A 2KTVA 3FFMA 2H6LA 3CMEF 2KGWA 3JASA 5A2QM 4B46A 3IMPA 5LYJB 5EAZA 4O2AA 4X3MA 5HY0A 5CA1B 3ELCA 2QA4F 2DYYA 4O4JA 5GIOC 3MCQA 3HKCA 5CB4B 1COMA 5EWRA 4C8EA 5MN4A 3RYHA 3WPXA 2OZBA 1UI9A 2RHLA 4O4LB 5J2TA 3G71F 1RQ7A 5G4UC 1ODEA 4LCKA 4X1IB 5DCVA 2RHJA 1W581 1GZ0A 3N2KB 5JH7A 2GLZA 4DRXA 3JARA 1M1KH 4HNAA 3VIUA 4TV8A 2WALA 3QTYA 2VGNA 3JASB 2GZLA 3K14A 3WJQA 3S02A 4O2AB 5LA6A 2LBWA 3NVIB 5IJ9A 3C8LA 1W42A 3D00A 3B6NA 3S0HA 1OFUA 1VQMF 1IV3A 4O4JB 1Q7YH 3HKCB 4BW0B 1VQNF
chains in the Genus database with same CATH topology
1S72F 2VGMA 1N8RH 4NQ3A 1K8AH 2QEXF 2HVYD 3RA5A 1VQ5F 1XBIA 1QVGF 1GO0A 3G6EF 2FC3A 1X52A 1KQSF 3V7QA 4EI8A 1K73H 3RA6A 4C4WC 3CMAF 3CPWF 5FJ4C 1H7MA 1YHQF 1GO1A 5HXUA 1VQ7F 1IPAA 2F9ZC 1VQ6F 3HAXD 1VQKF 3LWQC 1W2BF 3NK6A 5HWEA 5GANK 1YITF 1VQOF 4BY9D 3AGKA 3CXCF 3JAMM 3O85A 3CCVF 1YIJF 3SIUA 2QI2A 4XCQA 1CN7A 4X3LA 4BVTA 3V7EA 1M90H 1SDSA 1W40A 5GINC 3CPQA 2I6DA 3VI6A 3LWOC 5EO3A 3NVKE 1E7KA 4BVQA 1RA4A 3OBYA 3CCLF 1KC8H 3G4SF 3N4ZA 3VMFB 5IT9M 3CCMF 3CCQF 3CC7F 1VQ9F 3LWRC 5GIPC 3JCMM 3CCEF 1JJ2F 2LBXA 3J80M 3SIVA 1Q82H 2BO1A 3I56F 3V3TA 2AIFA 2KG4A 2KTVA 3FFMA 1YJ9F 5HXZA 3OBWA 3MCAB 2KTUA 1CK2A 3CMEF 2ALEA 1QVFF 4EI7A 5HY1A 5A2QM 3CCUF 2FGYA 1RLGA 3CCRF 3HJWC 4BVSA 3CC4F 4X3MA 5HY0A 1W3EX 5G4VC 1PXWA 3LWVC 3LFOA 2QA4F 1Q86H 5GAPK 5GIOC 5HY2A 2JNBA 3OW2F 5EWRA 3NMUC 3PLAC 2OZBA 2CZWA 1NMUB 4EI9A 3GYQA 3CCSF 4TZZA 3J81M 3G71F 3CCJF 5G4UC 1X7OA 1KD1H 4NUTA 2OHWA 4LCKA 1W41A 3CG6A 2OTJF 5DCVA 1VQ4F 1GZ0A 3LWPC 1VQ8F 1YJWF 3IR9A 2GLZA 3PAFA 3I55F 1M1KH 4BVRA 3N4YA 2WALA 1YI2F 2VGNA 3ON1A 3J7AR 3E1YA 1DT9A 5HY4A 5FLXM 2LBWA 1ZWZA 3WXMB 1VQLF 1K9MH 3NVIB 1W42A 3D00A 3CC2F 1YJNF 1NJIH 1T0KB 2OTLF 3E20B 3NK7A 1VQMF 1VQPF 1X7PA 1Q81H 1Q7YH 4BW0B 1VQNF 3CD6F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 F;  2VGM A;  1N8R H;  1K8A H;  2QEX F;  2HVY D;  3RA5 A;  1VQ5 F;  1XBI A;  1QVG F;  1GO0 A;  3G6E F;  2FC3 A;  1X52 A;  1KQS F;  3V7Q A;  1K73 H;  4C4W C;  3RA6 A;  3CMA F;  3CPW F;  5FJ4 C;  1H7M A;  1YHQ F;  1GO1 A;  1VQ7 F;  1VQ6 F;  1IPA A;  3HAX D;  1VQK F;  3LWQ C;  1W2B F;  3NK6 A;  5GAN K;  1YIT F;  1VQO F;  4BY9 D;  3AGK A;  3CXC F;  3JAM M;  3O85 A;  3CCV F;  1YIJ F;  3SIU A;  2QI2 A;  1CN7 A;  4X3L A;  3V7E A;  1M90 H;  1SDS A;  1W40 A;  5GIN C;  3CPQ A;  2I6D A;  3VI6 A;  3LWO C;  5EO3 A;  3NVK E;  1E7K A;  1RA4 A;  3OBY A;  3CCL F;  1KC8 H;  3G4S F;  3N4Z A;  3VMF B;  5IT9 M;  3CCM F;  3CCQ F;  3CC7 F;  1VQ9 F;  3LWR C;  5GIP C;  3JCM M;  3CCE F;  1JJ2 F;  2LBX A;  3J80 M;  3SIV A;  1Q82 H;  2BO1 A;  3I56 F;  2AIF A;  2KG4 A;  2KTV A;  3FFM A;  1YJ9 F;  3OBW A;  3MCA B;  2KTU A;  1CK2 A;  3CME F;  2ALE A;  1QVF F;  3CCU F;  5A2Q M;  1RLG A;  3CCR F;  3HJW C;  3CC4 F;  4X3M A;  1W3E X;  5G4V C;  1PXW A;  3LWV C;  3LFO A;  2QA4 F;  1Q86 H;  5GAP K;  5GIO C;  2JNB A;  3OW2 F;  5EWR A;  3NMU C;  3PLA C;  2OZB A;  2CZW A;  1NMU B;  3GYQ A;  3CCS F;  4TZZ A;  3J81 M;  3G71 F;  3CCJ F;  5G4U C;  1X7O A;  1KD1 H;  4NUT A;  2OHW A;  4LCK A;  1W41 A;  3CG6 A;  2OTJ F;  5DCV A;  1VQ4 F;  1GZ0 A;  3LWP C;  1VQ8 F;  1YJW F;  3IR9 A;  3PAF A;  3I55 F;  1M1K H;  3N4Y A;  2WAL A;  1YI2 F;  2VGN A;  3ON1 A;  3J7A R;  3E1Y A;  1DT9 A;  5FLX M;  2LBW A;  1ZWZ A;  3WXM B;  1VQL F;  1K9M H;  3NVI B;  1W42 A;  3CC2 F;  1YJN F;  1NJI H;  1T0K B;  2OTL F;  3E20 B;  3NK7 A;  1VQM F;  1VQP F;  1X7P A;  1Q81 H;  1Q7Y H;  4BW0 B;  1VQN F;  3CD6 F; 
#chains in the Genus database with same CATH topology
 3RYH B;  1S72 F;  1N8R H;  4WBN A;  2MQE A;  4BT3 A;  2HVY D;  3RA5 A;  4I55 B;  5J2T B;  4ZHQ A;  4YJ2 A;  1VQ5 F;  3JAW A;  5FNV A;  2FC3 A;  5B8F A;  1KQS F;  3JAK A;  5J2U A;  3F0F A;  2LBT A;  5BMV A;  1H7M A;  4O4H B;  1QD9 A;  5HXU A;  1VQ6 F;  3S0Y A;  2VXY A;  4TUY B;  4DRX B;  3JAR B;  4C8I A;  2YYE A;  4TV8 B;  5HWE A;  1U3L A;  3RYF B;  3CXC F;  1H47 A;  3HWU A;  4ERH A;  3CCV F;  5LA6 B;  1RLU A;  5IJ9 B;  4X3L A;  1RQ2 A;  5LP6 C;  1XHO A;  2I6R A;  3LWO C;  5EO3 A;  3K0T A;  2PHN A;  5CA0 A;  4BVQ A;  1RA4 A;  4WBN B;  5GON A;  2V9Y A;  4YJ2 B;  1FNK A;  3JAW B;  5IT9 M;  1FNJ A;  5FNV B;  3S03 A;  1OAP A;  5LYJ A;  3JAK B;  4X1K A;  5J2U B;  3J80 M;  2AIZ P;  2BO1 A;  5BMV B;  4BT2 A;  2ZVY A;  3C9S A;  1YJ9 F;  5HXZ A;  3IKF A;  5CA1 A;  3CYQ A;  1XRG A;  1QVF F;  2HX0 A;  4EI7 A;  3KJK A;  3LYB A;  2W8B C;  3FBA A;  3QUW A;  5MN6 A;  1X25 A;  1W3E X;  1CLI A;  3ZP7 A;  5G4V C;  3LFO A;  1ONI A;  1Q86 H;  5GAP K;  1UFY A;  2JNB A;  3MDO A;  5LP6 B;  3OW2 F;  5JCO A;  4ZK7 A;  5IJ0 A;  3VCZ A;  3IEW A;  2CZW A;  4X1I A;  3ZP4 A;  5CA0 B;  3F6M A;  2CHS A;  4I50 B;  5GON B;  1X7O A;  3N2K A;  4RQO A;  3S0W A;  2B33 A;  2OHW A;  3C9R A;  1W5B A;  3P4E A;  1VQ8 F;  4X1K B;  3IR9 A;  5AVM A;  3I55 F;  3N4Y A;  4ZI7 A;  3V4D A;  2UYJ A;  2HP3 A;  3E1Y A;  3TD5 A;  3VO8 A;  5KMG A;  4BT7 A;  5FLX M;  1ZWZ A;  1K9M H;  1IV4 A;  2R6R 1;  3CC2 F;  1NJI H;  1T0K B;  4NWO B;  2CVL A;  3E20 B;  1VQP F;  1X7P A;  4I55 A;  1W5A A;  3VOA A;  3M1X A;  1W55 A;  5IJ0 B;  2UZH A;  3CD6 F;  3WGM A;  4F6R B;  3HKE A;  3Q8H A;  4O4H A;  1Q8R A;  3D01 A;  4TUY A;  1X52 A;  2N48 A;  2BTO A;  4DXD A;  4EI8 A;  1JY8 A;  3RA6 A;  5FJ4 C;  3RYF A;  5EIB D;  1YHQ F;  1GO1 A;  3RYI B;  1VQ7 F;  3GTZ A;  2BTQ B;  1W2B F;  4BT5 A;  4ZI7 B;  1DBF A;  1VQO F;  1YIT F;  4EB6 A;  3AGK A;  5EB1 B;  1U40 A;  3VYS C;  3VYT C;  3I7T A;  5KMG B;  4XCQ A;  5KX5 A;  2CHT A;  2G9I A;  2OTM A;  3CPQ A;  3T80 A;  2Z01 A;  3R0P A;  3WPW A;  1E7K A;  3RYC A;  3OBY A;  1Z5V A;  3HKE B;  1YGY A;  4G88 A;  1JD1 A;  3CCQ F;  4ZOL A;  4BT4 A;  3JCM M;  3CCE F;  2UYP A;  3SIV A;  3I56 F;  2AIF A;  4B45 A;  2CW4 A;  2UYN B;  1TVK A;  5ITZ A;  2ALE A;  3E22 A;  4C81 A;  5HY1 A;  3CCU F;  2Z1F A;  1VHA A;  3WGK A;  5LP6 A;  2ZF8 A;  4BVS A;  3CCR F;  4EB6 B;  3I3F A;  3HTN A;  3L7Q A;  2YXZ A;  3TD3 A;  4B62 A;  5KX5 B;  1PF5 A;  4I50 A;  2Q1Y A;  3PLA C;  2CSL A;  3UT5 B;  2VAM A;  1TUB A;  1W5F A;  3DC2 A;  3P10 A;  3GYQ A;  3CCS F;  3J81 M;  3RYC B;  4NUT A;  4M8I A;  1VQ4 F;  3GHZ A;  4ZOL B;  3LWP C;  4BT6 A;  2VAW A;  1Z5W A;  3MBM A;  3DDN A;  3VTI C;  1TVK B;  5ITZ B;  4O2B A;  3E22 B;  4YJ3 A;  1YI2 F;  1J7H A;  2K1S A;  2NMU A;  3ON1 A;  1DT9 A;  4ZHW A;  3QHD A;  1FFX A;  3CYP B;  4F6R A;  1Q81 H;  3HKD A;  1SA0 A;  2R75 1;  1TUB B;  4NQ3 A;  4R40 B;  2QEX F;  3D54 A;  1K8A H;  2AMT A;  4FFB A;  1XBI A;  2GVI A;  1QVG F;  3RYI A;  4LNU B;  3ZO8 A;  4ZHV A;  1K73 H;  3CPW F;  5EYP A;  5HP8 A;  2ZOV A;  3WJP A;  5JVD A;  3HAX D;  1T0A A;  3OON A;  2EWC A;  2HS4 A;  3F0D A;  2HS0 A;  1VQK F;  3LWQ C;  3NK6 A;  3JAL A;  4C82 A;  4O2B B;  4YJ3 B;  1GX1 A;  4X1Y B;  4BY9 D;  3JAM M;  5MN5 A;  3S06 A;  1YIJ F;  1SZQ A;  2QI2 A;  1CN7 A;  1FFX B;  2RB9 A;  3V7E A;  1W40 A;  5GIN C;  2I6D A;  3HKD B;  4I4T A;  3VI6 A;  2HRU A;  3KIZ A;  1SA0 B;  3CCL F;  3K12 A;  5EZY B;  3N2G A;  4FFB B;  3G4S F;  2UYN A;  1JFF B;  4KWE A;  1IV2 A;  3CC7 F;  1VQ9 F;  5GIP C;  2VAP A;  4TV9 A;  4ZHY B;  2LBX A;  1JJ2 F;  5EYP B;  3V3T A;  3IKE A;  3EOR A;  4G4V A;  1VQV A;  4O4I B;  3OBW A;  2QTP A;  3MCA B;  2KTU A;  1CK2 A;  5JVD B;  3MQW A;  2LCA A;  3LDT A;  5JQG B;  3LME A;  2IQQ A;  3FPI A;  2FGY A;  1RLG A;  3JAL B;  3FD5 A;  3HJW C;  3CC4 F;  2RHO A;  3C9U A;  2BTU A;  3UT5 A;  3LWV C;  1PXW A;  3IEQ A;  4X20 A;  2CWJ A;  5HY2 A;  3WGJ A;  2ZOD A;  3ERN A;  3KE1 A;  4U3J A;  4B5C A;  3NMU C;  1QU9 A;  3M84 A;  3F0G A;  1NMU B;  4EI9 A;  1W59 A;  4I4T B;  4TZZ A;  2RHH A;  3CCJ F;  3KJJ A;  2ZAU A;  2ZVZ A;  5IYZ A;  1KNK A;  2L26 A;  1U43 A;  1KD1 H;  3N2G B;  2DT4 A;  4C8G A;  1H48 A;  1VH8 A;  1W41 A;  3CG6 A;  2OTJ F;  3M4S A;  4U39 A;  4TV9 B;  1YJW F;  2Z1U A;  3RE3 A;  3PAF A;  3HKB A;  3VOB A;  3P0Z A;  4BVR A;  3CB2 A;  4RHA A;  3J7A R;  5HY4 A;  1NQ3 A;  2UYK A;  5JH7 B;  3WXM B;  5HP7 A;  1VQL F;  4HNA B;  1YJN F;  1U3P A;  3ESJ A;  4IHJ A;  4E6E A;  2OTL F;  3BYQ A;  3NK7 A;  2H8C A;  4X20 B;  4IIJ A;  3U0O A;  5C8Y A;  2Z1E A;  4LNU A;  4U3J B;  3C9T A;  2VGM A;  5LXT A;  3JAT A;  5EB0 A;  2HS3 A;  1GO0 A;  5IYZ B;  5LOV A;  3WGL A;  3G6E F;  4G4Z A;  1QAH A;  3V7Q A;  2HP0 A;  4C4W C;  1VK3 A;  2Q1X A;  3CMA F;  2IAF A;  4G4W A;  4X1Y A;  4ZHQ B;  1IPA A;  1FSZ A;  2F9Z C;  2P6Y A;  3TD4 A;  3HKB B;  5GAN K;  1W5E A;  2H8E A;  2PMP A;  3O85 A;  3SIU A;  3WJR A;  2HQS C;  4IHJ B;  5CB4 A;  4BVT A;  4G4X A;  5EZY A;  1XV2 A;  1M90 H;  3JVH A;  4IIJ B;  1SDS A;  1JFF A;  3WGN A;  5C8Y B;  4O4L A;  2HRY A;  3VYU C;  3NVK E;  5LXT B;  3FD6 A;  3JAT B;  2Z1T A;  1W57 A;  3KHN A;  5JCO C;  1KC8 H;  3ZOP A;  2IG8 A;  4O4I A;  3N4Z A;  3VMF B;  1KNJ A;  3K2X A;  5JQG A;  1IV1 A;  5LOV B;  3CCM F;  1R1M A;  1JN1 A;  1YQN A;  3LWR C;  4PWT A;  4G4Y A;  5EIB C;  3F0E A;  2HP0 B;  1Q82 H;  2KG4 A;  2KTV A;  3FFM A;  2H6L A;  3CME F;  2KGW A;  3JAS A;  5A2Q M;  4B46 A;  3IMP A;  5LYJ B;  5EAZ A;  4O2A A;  4X3M A;  5HY0 A;  5CA1 B;  3ELC A;  2QA4 F;  2DYY A;  4O4J A;  5GIO C;  3MCQ A;  3HKC A;  5CB4 B;  1COM A;  5EWR A;  4C8E A;  5MN4 A;  3RYH A;  3WPX A;  2OZB A;  1UI9 A;  2RHL A;  4O4L B;  5J2T A;  3G71 F;  1RQ7 A;  5G4U C;  1ODE A;  4LCK A;  4X1I B;  5DCV A;  2RHJ A;  1W58 1;  1GZ0 A;  3N2K B;  5JH7 A;  2GLZ A;  4DRX A;  3JAR A;  1M1K H;  4HNA A;  3VIU A;  4TV8 A;  2WAL A;  3QTY A;  2VGN A;  3JAS B;  2GZL A;  3K14 A;  3WJQ A;  3S02 A;  4O2A B;  5LA6 A;  2LBW A;  3NVI B;  5IJ9 A;  3C8L A;  1W42 A;  3D00 A;  3B6N A;  3S0H A;  1OFU A;  1VQM F;  1IV3 A;  4O4J B;  1Q7Y H;  3HKC B;  4BW0 B;  1VQN F; 
#chains in the Genus database with same CATH homology
 1S72 F;  2VGM A;  1N8R H;  4NQ3 A;  1K8A H;  2QEX F;  2HVY D;  3RA5 A;  1VQ5 F;  1XBI A;  1QVG F;  1GO0 A;  3G6E F;  2FC3 A;  1X52 A;  1KQS F;  3V7Q A;  4EI8 A;  1K73 H;  3RA6 A;  4C4W C;  3CMA F;  3CPW F;  5FJ4 C;  1H7M A;  1YHQ F;  1GO1 A;  5HXU A;  1VQ7 F;  1IPA A;  2F9Z C;  1VQ6 F;  3HAX D;  1VQK F;  3LWQ C;  1W2B F;  3NK6 A;  5HWE A;  5GAN K;  1YIT F;  1VQO F;  4BY9 D;  3AGK A;  3CXC F;  3JAM M;  3O85 A;  3CCV F;  1YIJ F;  3SIU A;  2QI2 A;  4XCQ A;  1CN7 A;  4X3L A;  4BVT A;  3V7E A;  1M90 H;  1SDS A;  1W40 A;  5GIN C;  3CPQ A;  2I6D A;  3VI6 A;  3LWO C;  5EO3 A;  3NVK E;  1E7K A;  4BVQ A;  1RA4 A;  3OBY A;  3CCL F;  1KC8 H;  3G4S F;  3N4Z A;  3VMF B;  5IT9 M;  3CCM F;  3CCQ F;  3CC7 F;  1VQ9 F;  3LWR C;  5GIP C;  3JCM M;  3CCE F;  1JJ2 F;  2LBX A;  3J80 M;  3SIV A;  1Q82 H;  2BO1 A;  3I56 F;  3V3T A;  2AIF A;  2KG4 A;  2KTV A;  3FFM A;  1YJ9 F;  5HXZ A;  3OBW A;  3MCA B;  2KTU A;  1CK2 A;  3CME F;  2ALE A;  1QVF F;  4EI7 A;  5HY1 A;  5A2Q M;  3CCU F;  2FGY A;  1RLG A;  3CCR F;  3HJW C;  4BVS A;  3CC4 F;  4X3M A;  5HY0 A;  1W3E X;  5G4V C;  1PXW A;  3LWV C;  3LFO A;  2QA4 F;  1Q86 H;  5GAP K;  5GIO C;  5HY2 A;  2JNB A;  3OW2 F;  5EWR A;  3NMU C;  3PLA C;  2OZB A;  2CZW A;  1NMU B;  4EI9 A;  3GYQ A;  3CCS F;  4TZZ A;  3J81 M;  3G71 F;  3CCJ F;  5G4U C;  1X7O A;  1KD1 H;  4NUT A;  2OHW A;  4LCK A;  1W41 A;  3CG6 A;  2OTJ F;  5DCV A;  1VQ4 F;  1GZ0 A;  3LWP C;  1VQ8 F;  1YJW F;  3IR9 A;  2GLZ A;  3PAF A;  3I55 F;  1M1K H;  4BVR A;  3N4Y A;  2WAL A;  1YI2 F;  2VGN A;  3ON1 A;  3J7A R;  3E1Y A;  1DT9 A;  5HY4 A;  5FLX M;  2LBW A;  1ZWZ A;  3WXM B;  1VQL F;  1K9M H;  3NVI B;  1W42 A;  3D00 A;  3CC2 F;  1YJN F;  1NJI H;  1T0K B;  2OTL F;  3E20 B;  3NK7 A;  1VQM F;  1VQP F;  1X7P A;  1Q81 H;  1Q7Y H;  4BW0 B;  1VQN F;  3CD6 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...