2OTJF

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2otjF00
3AGKA 1T0KB 3GYQA 2QA4F 4TZZA 2QEXF 1NMUB 3RA5A 3RA6A 1VQ7F 3CCEF 3G71F 3JCMM 3I55F 3CC7F 3NVIB 3CPWF 2AIFA 2OTLF 3LFOA 3OBYA 2HVYD 2FC3A 3OBWA 3V7EA 3WXMB 3CCSF 3NVKE 3CCMF 2KTVA 1NJIH 2WALA 3CMEF 1K9MH 3CCUF 3CMAF 1E7KA 1CK2A 3G4SF 3NK7A 3LWVC 5FJ4C 1YJ9F 1YI2F 3CC4F 1Q81H 1VQLF 3SIUA 1H7MA 3PAFA 3VMFB 2LBWA 1X52A 1KD1H 3CPQA 4C4WC 5DCVA 1CN7A 2KTUA 1IPAA 1K8AH 3I56F 1VQPF 5IT9M 1PXWA 3N4ZA 1W41A 2KG4A 3CCQF 1VQ8F 1GO1A 3CC2F 1Q7YH 3CCLF 3CCRF 3E20B 2VGNA 3CXCF 1Q82H 1GO0A 1S72F 1SDSA 3E1YA 1M1KH 3PLAC 3O85A 1VQ5F 3CCVF 1JJ2F 3CD6F 3J7AR 1W3EX 3CG6A 1ZWZA 4X3MA 3LWPC 1X7PA 5EO3A 3CCJF 2CZWA 1M90H 1RA4A 1YJNF 2BO1A 5GANK 3OW2F 3LWRC 2I6DA 3MCAB 1QVFF 1VQ4F 3ON1A 2OZBA 3LWOC 5GIOC 1VQKF 2ALEA 3LWQC 3NK6A 4BW0B 1KQSF 5G4UC 1DT9A 4LCKA 4BY9D 1RLGA 5A2QM 1YIJF 3N4YA 3FFMA 3NMUC 1W2BF 2VGMA 3J80M 5FLXM 2OHWA 1YHQF 2JNBA 5GAPK 5GINC 1VQ6F 5EWRA 3IR9A 3HAXD 3V7QA 2QI2A 1KC8H 2LBXA 1YITF 1K73H 1VQ9F 3SIVA 3JAMM 3G6EF 1VQOF 1Q86H 1YJWF 4NUTA 3J81M 1X7OA 1VQMF 1GZ0A 1W42A 5GIPC 4X3LA 1XBIA 1N8RH 1QVGF 2OTJF 1VQNF 3VI6A 5G4VC 1W40A 3HJWC
chains in the Genus database with same CATH superfamily
5LOVB 1T0AA 2CHTA 3IEWA 3K12A 5J2TA 2QA4F 4B45A 3S0YA 3WGKA 3CB2A 4O4JB 5JCOC 1NMUB 2UYPA 1Z5VA 3L7QA 4G4YA 2H8CA 3MDOA 3P4EA 2HS3A 1VQ7F 2ZAUA 2K1SA 4BVRA 3CC7F 3NVIB 2HP3A 1COMA 3WGJA 5JH7A 2ZVZA 2HQSC 3LFOA 2FC3A 3VIUA 1TUBB 4BT2A 4TV9B 4TV8B 3RE3A 3JARB 4LNUB 2KTVA 1XHOA 5CA0A 1CLIA 3CMEF 3MCQA 1ODEA 4HNAB 4U3JA 1E7KA 1CK2A 1FNJA 4DRXB 1YJ9F 3ZP7A 1VQLF 3SIUA 1H7MA 1CN7A 5DCVA 5HXUA 5KMGB 1IPAA 3ESJA 3OONA 4X20A 3CCQF 3CC2F 1Q7YH 3CCLF 3CCRF 2B33A 4PWTA 3E20B 5LA6A 4O2BB 5HWEA 2GZLA 3LWPC 1X7PA 5EO3A 3CCJF 1J7HA 3RYFB 1Q8RA 3HKDA 5LXTA 3R0PA 5IJ0A 3MCAB 5LP6C 3HKBB 3LWOC 5HP8A 1RQ7A 4BT5A 5IYZB 2RHHA 3B6NA 2HS4A 3JAWB 3FFMA 4WBNA 3ERNA 1W2BF 2VGMA 3J80M 5FLXM 2OHWA 4ZHVA 3M4SA 5GAPK 2CVLA 3M84A 2HP0A 3IR9A 3JASB 4X1KB 2LBXA 2PMPA 3RYCA 3K2XA 5LYJB 3GHZA 3C8LA 2Z1UA 1VQVA 5HY4A 1Q86H 3JAKA 2NMUA 4NUTA 3J81M 2HRUA 4EI9A 1GZ0A 1W42A 4XCQA 5BMVA 3FBAA 2EWCA 5JVDA 4IHJB 1XBIA 4RHAA 2GVIA 1QAHA 4YJ3A 1VQNF 1NQ3A 4O4IB 2VXYA 4EB6B 4F6RB 4B5CA 2IG8A 4R40B 4ZI7B 2Q1XA 3RYIB 1H48A 4U39A 3F6MA 1QU9A 3KHNA 3GYQA 3TD4A 3I7TA 3VYSC 2QEXF 4YJ2B 3ZP4A 3F0EA 2UYNA 1U3PA 1SA0A 3CPWF 1VHAA 3OBYA 2OTLF 2HVYD 3ELCA 5C8YB 2R6R1 3V7EA 4ZOLB 3WXMB 5IJ9B 3S06A 3CCSF 3CCMF 2H8EA 1FFXA 3RYHA 3CMAF 5MN5A 3S0WA 3G4SF 2V9YA 3JATA 3WJQA 3NK7A 3M1XA 3LWVC 2UYJA 5FJ4C 3VTIC 1QD9A 4ZK7A 3PAFA 4B46A 4FFBA 2LBWA 2HX0A 3GTZA 4DXDA 4C4WC 3C9TA 2W8BC 3LYBA 2UZHA 4NWOB 2RHJA 5IT9M 3N4ZA 4IHJA 3I3FA 4IIJA 4RQOA 4TUYB 1H47A 3IMPA 4X1YB 3HKEB 4O2AA 4EB6A 3VO8A 1SDSA 3E1YA 1M1KH 5EIBC 3PLAC 1JJ2F 3CG6A 1ZWZA 2LBTA 1M90H 1YJNF 3KIZA 2BO1A 4G88A 3OW2F 3QUWA 2YYEA 3LWRC 4C8IA 1RLUA 3WGMA 1VQ4F 3ON1A 3FD5A 5EYPA 1JFFA 3K14A 1VQKF 3LWQC 3NK6A 5EZYA 1KQSF 2BTUA 3WGNA 4BY9D 2P6YA 5AVMA 3C9UA 1YIJF 3N4YA 3Q8HA 5JQGA 2CWJA 3N2KA 2PHNA 1YHQF 2JNBA 2AIZP 4I50B 4I55B 3P0ZA 3V7QA 3K0TA 1JN1A 5HY0A 5J2UA 5LOVA 3E22B 4ZHYB 3HKCB 2IQQA 3G6EF 2DT4A 2CHSA 4O4JA 5LP6B 1TVKB 4G4ZA 3WGLA 4O4HB 3UT5B 3S02A 4X3LA 2Z01A 1N8RH 1R1MA 1U40A 4NQ3A 2Z1FA 3N2GB 3VI6A 1TUBA 5G4VC 4TV9A 4TV8A 1W40A 1W5FA 4O4LB 3JALB 3WJRA 5HXZA 3ZOPA 3JARA 4LNUA 2L26A 2LCAA 3AGKA 1W59A 4HNAA 4TZZA 3QHDA 4I4TB 4DRXA 1UI9A 5HP7A 3RA5A 4ZHQB 3FPIA 4X1IB 1JY8A 3CCEF 3G71F 3JCMM 3I55F 5KMGA 3EORA 5ITZB 3KJJA 5FNVB 2AIFA 2VAMA 3JVHA 2UYKA 2I6RA 3CYPB 3IKEA 4I50A 2WALA 4O2BA 1K9MH 1U3LA 3CCUF 5J2TB 3ZO8A 1RQ2A 3C9SA 5CA1B 3VYUC 2F9ZC 3CC4F 1Z5WA 3RYFA 1U43A 2RB9A 3WPWA 4KWEA 5LP6A 3VCZA 1KD1H 1X52A 5CB4B 3CPQA 2R751 3HKBA 4O4HA 5JH7B 1K8AH 2G9IA 3D54A 2Q1YA 1DBFA 3HTNA 4B62A 4BT6A 5IYZA 1W5EA 3JAWA 5CA0B 2CSLA 3V4DA 3QTYA 1GO0A 1S72F 4U3JB 3O85A 1VQ5F 3CCVF 3JASA 4X1KA 1W3EX 3J7AR 3S03A 5KX5B 2QTPA 5EB1B 5LYJA 5GANK 2I6DA 1W581 1QVFF 4C81A 5G4UC 5B8FA 1DT9A 1FSZA 4BVSA 4X20B 1W57A 5A2QM 5ITZA 3BYQA 1PF5A 3D00A 2Z1EA 5LA6B 2FGYA 3MBMA 5GINC 1VQ6F 5EWRA 2HS0A 4M8IA 4O4IA 3HAXD 4F6RA 2QI2A 3T80A 4ZI7A 3RYIA 4G4XA 3IKFA 3V3TA 3HKDB 1YITF 2RHLA 1OFUA 5CA1A 5LXTB 3SIVA 4C8EA 1W5BA 1IV1A 4EI7A 5IJ0B 3VOBA 2RHOA 1VQOF 3DDNA 2MQEA 4YJ2A 1JD1A 5CB4A 2CW4A 3LMEA 4WBNB 2ZODA 1IV2A 2KGWA 1QVGF 2OTJF 1FNKA 3KJKA 3LDTA 2HP0B 2ZF8A 2N48A 5C8YA 4ZOLA 4G4WA 3HJWC 5IJ9A 2ZOVA 3RYCB 3TD5A 3HWUA 2GLZA 2VAPA 1T0KB 3MQWA 5KX5A 3IEQA 5JCOA 3JAKB 4G4VA 4BT7A 1XV2A 3RA6A 4E6EA 5BMVB 5JVDB 4BT4A 1VK3A 3P10A 4YJ3B 3OBWA 3VOAA 4TUYA 4X1YA 5MN4A 1YQNA 3NVKE 5GONB 3HKEA 3C9RA 1NJIH 2OTMA 1IV3A 3CYQA 1KNKA 2BTOA 1YI2F 1Q81H 4BVQA 3WJPA 2UYNB 3VMFB 1SA0B 3FD6A 2KTUA 3I56F 1VQPF 1PXWA 5EAZA 1W41A 1VH8A 1XRGA 2KG4A 4C8GA 1GO1A 1VQ8F 2VGNA 3CXCF 1Q82H 1ONIA 1FFXB 3RYHB 3DC2A 1W55A 4I55A 3JATB 2H6LA 3CD6F 1UFYA 4X3MA 5EIBD 2AMTA 2CZWA 1OAPA 1RA4A 3E22A 3HKCA 5EB0A 4FFBB 3U0OA 5HY1A 2DYYA 2HRYA 2OZBA 3F0DA 5GIOC 1TVKA 2ALEA 4BW0B 3UT5A 4LCKA 4IIJB 1RLGA 3WPXA 3VYTC 3NMUC 4C82A 4O2AB 2BTQB 1KNJA 3S0HA 2ZVYA 1SZQA 3N2GA 3KE1A 5GONA 1KC8H 4O4LA 3JALA 4ZHWA 3D01A 3TD3A 1K73H 1GX1A 1VQ9F 3JAMM 2VAWA 4I4TA 3F0GA 4BT3A 5EYPB 1X25A 4BVTA 5HY2A 1JFFB 1IV4A 1YJWF 1X7OA 5EZYB 1VQMF 4ZHQA 5GIPC 4X1IA 1W5AA 4EI8A 2YXZA 4ERHA 5JQGB 1YGYA 2Z1TA 3N2KB 5FNVA 3F0FA 2IAFA 5MN6A 5J2UB
chains in the Genus database with same CATH topology
3AGKA 2GLZA 1T0KB 3GYQA 2QA4F 4TZZA 2QEXF 1NMUB 3RA5A 3RA6A 1VQ7F 3CCEF 4BVRA 3G71F 3JCMM 3I55F 3CC7F 3NVIB 3CPWF 2AIFA 2OTLF 3LFOA 3OBYA 2HVYD 2FC3A 3OBWA 3V7EA 3WXMB 3CCSF 3NVKE 3CCMF 2KTVA 1NJIH 2WALA 3CMEF 1K9MH 3CCUF 3CMAF 1E7KA 1CK2A 3G4SF 2F9ZC 3NK7A 3LWVC 1YJ9F 5FJ4C 1YI2F 3CC4F 1Q81H 1VQLF 3SIUA 1H7MA 4BVQA 3PAFA 3VMFB 2LBWA 1X52A 1KD1H 3CPQA 4C4WC 5DCVA 1CN7A 5HXUA 2KTUA 1IPAA 1K8AH 3I56F 1VQPF 5IT9M 1PXWA 3N4ZA 1W41A 2KG4A 3CCQF 1VQ8F 1GO1A 3CC2F 1Q7YH 3CCLF 3CCRF 3E20B 2VGNA 5HWEA 3CXCF 1Q82H 1GO0A 1S72F 1SDSA 3E1YA 1M1KH 3PLAC 3O85A 1VQ5F 3CCVF 1JJ2F 3CD6F 3J7AR 1W3EX 3CG6A 1ZWZA 4X3MA 3LWPC 1X7PA 5EO3A 3CCJF 2CZWA 1M90H 1RA4A 1YJNF 2BO1A 5GANK 3OW2F 3LWRC 2I6DA 3MCAB 1QVFF 5HY1A 1VQ4F 3ON1A 2OZBA 3LWOC 5GIOC 1VQKF 2ALEA 3LWQC 3NK6A 4BW0B 1KQSF 5G4UC 1DT9A 4LCKA 4BVSA 4BY9D 1RLGA 5A2QM 1YIJF 3N4YA 3FFMA 3D00A 3NMUC 1W2BF 2VGMA 2FGYA 3J80M 5FLXM 2OHWA 1YHQF 2JNBA 5GAPK 5GINC 1VQ6F 5EWRA 3IR9A 3HAXD 3V7QA 2QI2A 1KC8H 5HY0A 2LBXA 3V3TA 1YITF 1K73H 1VQ9F 3SIVA 3JAMM 3G6EF 4EI7A 1VQOF 5HY4A 1Q86H 4BVTA 5HY2A 1YJWF 4NUTA 3J81M 4EI9A 1X7OA 1VQMF 1GZ0A 1W42A 5GIPC 4XCQA 4EI8A 4X3LA 1XBIA 1N8RH 1QVGF 2OTJF 4NQ3A 1VQNF 3VI6A 5G4VC 1W40A 5HXZA 3HJWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGK A;  1T0K B;  3GYQ A;  2QA4 F;  4TZZ A;  2QEX F;  1NMU B;  3RA5 A;  3RA6 A;  1VQ7 F;  3CCE F;  3G71 F;  3JCM M;  3I55 F;  3CC7 F;  3NVI B;  3CPW F;  2AIF A;  2OTL F;  3LFO A;  3OBY A;  2HVY D;  2FC3 A;  3OBW A;  3V7E A;  3WXM B;  3CCS F;  3NVK E;  3CCM F;  2KTV A;  1NJI H;  2WAL A;  3CME F;  1K9M H;  3CCU F;  3CMA F;  1E7K A;  1CK2 A;  3G4S F;  3NK7 A;  3LWV C;  5FJ4 C;  1YJ9 F;  1YI2 F;  3CC4 F;  1Q81 H;  1VQL F;  3SIU A;  1H7M A;  3PAF A;  3VMF B;  2LBW A;  1X52 A;  1KD1 H;  3CPQ A;  4C4W C;  5DCV A;  1CN7 A;  2KTU A;  1IPA A;  1K8A H;  3I56 F;  1VQP F;  5IT9 M;  1PXW A;  3N4Z A;  1W41 A;  2KG4 A;  3CCQ F;  1VQ8 F;  1GO1 A;  3CC2 F;  1Q7Y H;  3CCL F;  3CCR F;  3E20 B;  2VGN A;  3CXC F;  1Q82 H;  1GO0 A;  1S72 F;  1SDS A;  3E1Y A;  1M1K H;  3PLA C;  3O85 A;  1VQ5 F;  3CCV F;  1JJ2 F;  3CD6 F;  3J7A R;  1W3E X;  3CG6 A;  1ZWZ A;  4X3M A;  3LWP C;  1X7P A;  5EO3 A;  3CCJ F;  2CZW A;  1M90 H;  1RA4 A;  1YJN F;  2BO1 A;  5GAN K;  3OW2 F;  3LWR C;  2I6D A;  3MCA B;  1QVF F;  1VQ4 F;  3ON1 A;  2OZB A;  3LWO C;  5GIO C;  1VQK F;  2ALE A;  3LWQ C;  3NK6 A;  4BW0 B;  1KQS F;  5G4U C;  1DT9 A;  4LCK A;  4BY9 D;  1RLG A;  5A2Q M;  1YIJ F;  3N4Y A;  3FFM A;  3NMU C;  1W2B F;  2VGM A;  3J80 M;  5FLX M;  2OHW A;  1YHQ F;  2JNB A;  5GAP K;  5GIN C;  1VQ6 F;  5EWR A;  3IR9 A;  3HAX D;  3V7Q A;  2QI2 A;  1KC8 H;  2LBX A;  1YIT F;  1K73 H;  1VQ9 F;  3SIV A;  3JAM M;  3G6E F;  1VQO F;  1Q86 H;  1YJW F;  4NUT A;  3J81 M;  1X7O A;  1VQM F;  1GZ0 A;  1W42 A;  5GIP C;  4X3L A;  1XBI A;  1N8R H;  1QVG F;  2OTJ F;  1VQN F;  3VI6 A;  5G4V C;  1W40 A;  3HJW C; 
#chains in the Genus database with same CATH topology
 5LOV B;  1T0A A;  2CHT A;  3IEW A;  3K12 A;  5J2T A;  2QA4 F;  4B45 A;  3S0Y A;  3WGK A;  3CB2 A;  4O4J B;  5JCO C;  1NMU B;  2UYP A;  1Z5V A;  3L7Q A;  4G4Y A;  2H8C A;  3MDO A;  3P4E A;  2HS3 A;  1VQ7 F;  2ZAU A;  2K1S A;  4BVR A;  3CC7 F;  3NVI B;  2HP3 A;  1COM A;  3WGJ A;  5JH7 A;  2ZVZ A;  2HQS C;  3LFO A;  2FC3 A;  3VIU A;  1TUB B;  4BT2 A;  4TV9 B;  4TV8 B;  3RE3 A;  3JAR B;  4LNU B;  2KTV A;  1XHO A;  5CA0 A;  1CLI A;  3CME F;  3MCQ A;  1ODE A;  4HNA B;  4U3J A;  1E7K A;  1CK2 A;  1FNJ A;  4DRX B;  1YJ9 F;  3ZP7 A;  1VQL F;  3SIU A;  1H7M A;  1CN7 A;  5DCV A;  5HXU A;  5KMG B;  1IPA A;  3ESJ A;  3OON A;  4X20 A;  3CCQ F;  3CC2 F;  1Q7Y H;  3CCL F;  3CCR F;  2B33 A;  4PWT A;  3E20 B;  5LA6 A;  4O2B B;  5HWE A;  2GZL A;  3LWP C;  1X7P A;  5EO3 A;  3CCJ F;  1J7H A;  3RYF B;  1Q8R A;  3HKD A;  5LXT A;  3R0P A;  5IJ0 A;  3MCA B;  5LP6 C;  3HKB B;  3LWO C;  5HP8 A;  1RQ7 A;  4BT5 A;  5IYZ B;  2RHH A;  3B6N A;  2HS4 A;  3JAW B;  3FFM A;  4WBN A;  3ERN A;  1W2B F;  2VGM A;  3J80 M;  5FLX M;  2OHW A;  4ZHV A;  3M4S A;  5GAP K;  2CVL A;  3M84 A;  2HP0 A;  3IR9 A;  3JAS B;  4X1K B;  2LBX A;  2PMP A;  3RYC A;  3K2X A;  5LYJ B;  3GHZ A;  3C8L A;  2Z1U A;  1VQV A;  5HY4 A;  1Q86 H;  3JAK A;  2NMU A;  4NUT A;  3J81 M;  2HRU A;  4EI9 A;  1GZ0 A;  1W42 A;  4XCQ A;  5BMV A;  3FBA A;  2EWC A;  5JVD A;  4IHJ B;  1XBI A;  4RHA A;  2GVI A;  1QAH A;  4YJ3 A;  1VQN F;  1NQ3 A;  4O4I B;  2VXY A;  4EB6 B;  4F6R B;  4B5C A;  2IG8 A;  4R40 B;  4ZI7 B;  2Q1X A;  3RYI B;  1H48 A;  4U39 A;  3F6M A;  1QU9 A;  3KHN A;  3GYQ A;  3TD4 A;  3I7T A;  3VYS C;  2QEX F;  4YJ2 B;  3ZP4 A;  3F0E A;  2UYN A;  1U3P A;  1SA0 A;  3CPW F;  1VHA A;  3OBY A;  2OTL F;  2HVY D;  3ELC A;  5C8Y B;  2R6R 1;  3V7E A;  4ZOL B;  3WXM B;  5IJ9 B;  3S06 A;  3CCS F;  3CCM F;  2H8E A;  1FFX A;  3RYH A;  3CMA F;  5MN5 A;  3S0W A;  3G4S F;  2V9Y A;  3JAT A;  3WJQ A;  3NK7 A;  3M1X A;  3LWV C;  2UYJ A;  5FJ4 C;  3VTI C;  1QD9 A;  4ZK7 A;  3PAF A;  4B46 A;  4FFB A;  2LBW A;  2HX0 A;  3GTZ A;  4DXD A;  4C4W C;  3C9T A;  2W8B C;  3LYB A;  2UZH A;  4NWO B;  2RHJ A;  5IT9 M;  3N4Z A;  4IHJ A;  3I3F A;  4IIJ A;  4RQO A;  4TUY B;  1H47 A;  3IMP A;  4X1Y B;  3HKE B;  4O2A A;  4EB6 A;  3VO8 A;  1SDS A;  3E1Y A;  1M1K H;  5EIB C;  3PLA C;  1JJ2 F;  3CG6 A;  1ZWZ A;  2LBT A;  1M90 H;  1YJN F;  3KIZ A;  2BO1 A;  4G88 A;  3OW2 F;  3QUW A;  2YYE A;  3LWR C;  4C8I A;  1RLU A;  3WGM A;  1VQ4 F;  3ON1 A;  3FD5 A;  5EYP A;  1JFF A;  3K14 A;  1VQK F;  3LWQ C;  3NK6 A;  5EZY A;  1KQS F;  2BTU A;  3WGN A;  4BY9 D;  2P6Y A;  5AVM A;  3C9U A;  1YIJ F;  3N4Y A;  3Q8H A;  5JQG A;  2CWJ A;  3N2K A;  2PHN A;  1YHQ F;  2JNB A;  2AIZ P;  4I50 B;  4I55 B;  3P0Z A;  3V7Q A;  3K0T A;  1JN1 A;  5HY0 A;  5J2U A;  5LOV A;  3E22 B;  4ZHY B;  3HKC B;  2IQQ A;  3G6E F;  2DT4 A;  2CHS A;  4O4J A;  5LP6 B;  1TVK B;  4G4Z A;  3WGL A;  4O4H B;  3UT5 B;  3S02 A;  4X3L A;  2Z01 A;  1N8R H;  1R1M A;  1U40 A;  4NQ3 A;  2Z1F A;  3N2G B;  3VI6 A;  1TUB A;  5G4V C;  4TV9 A;  4TV8 A;  1W40 A;  1W5F A;  4O4L B;  3JAL B;  3WJR A;  5HXZ A;  3ZOP A;  3JAR A;  4LNU A;  2L26 A;  2LCA A;  3AGK A;  1W59 A;  4HNA A;  4TZZ A;  3QHD A;  4I4T B;  4DRX A;  1UI9 A;  5HP7 A;  3RA5 A;  4ZHQ B;  3FPI A;  4X1I B;  1JY8 A;  3CCE F;  3G71 F;  3JCM M;  3I55 F;  5KMG A;  3EOR A;  5ITZ B;  3KJJ A;  5FNV B;  2AIF A;  2VAM A;  3JVH A;  2UYK A;  2I6R A;  3CYP B;  3IKE A;  4I50 A;  2WAL A;  4O2B A;  1K9M H;  1U3L A;  3CCU F;  5J2T B;  3ZO8 A;  1RQ2 A;  3C9S A;  5CA1 B;  3VYU C;  2F9Z C;  3CC4 F;  1Z5W A;  3RYF A;  1U43 A;  2RB9 A;  3WPW A;  4KWE A;  5LP6 A;  3VCZ A;  1KD1 H;  1X52 A;  5CB4 B;  3CPQ A;  2R75 1;  3HKB A;  4O4H A;  5JH7 B;  1K8A H;  2G9I A;  3D54 A;  2Q1Y A;  1DBF A;  3HTN A;  4B62 A;  4BT6 A;  5IYZ A;  1W5E A;  3JAW A;  5CA0 B;  2CSL A;  3V4D A;  3QTY A;  1GO0 A;  1S72 F;  4U3J B;  3O85 A;  1VQ5 F;  3CCV F;  3JAS A;  4X1K A;  1W3E X;  3J7A R;  3S03 A;  5KX5 B;  2QTP A;  5EB1 B;  5LYJ A;  5GAN K;  2I6D A;  1W58 1;  1QVF F;  4C81 A;  5G4U C;  5B8F A;  1DT9 A;  1FSZ A;  4BVS A;  4X20 B;  1W57 A;  5A2Q M;  5ITZ A;  3BYQ A;  1PF5 A;  3D00 A;  2Z1E A;  5LA6 B;  2FGY A;  3MBM A;  5GIN C;  1VQ6 F;  5EWR A;  2HS0 A;  4M8I A;  4O4I A;  3HAX D;  4F6R A;  2QI2 A;  3T80 A;  4ZI7 A;  3RYI A;  4G4X A;  3IKF A;  3V3T A;  3HKD B;  1YIT F;  2RHL A;  1OFU A;  5CA1 A;  5LXT B;  3SIV A;  4C8E A;  1W5B A;  1IV1 A;  4EI7 A;  5IJ0 B;  3VOB A;  2RHO A;  1VQO F;  3DDN A;  2MQE A;  4YJ2 A;  1JD1 A;  5CB4 A;  2CW4 A;  3LME A;  4WBN B;  2ZOD A;  1IV2 A;  2KGW A;  1QVG F;  2OTJ F;  1FNK A;  3KJK A;  3LDT A;  2HP0 B;  2ZF8 A;  2N48 A;  5C8Y A;  4ZOL A;  4G4W A;  3HJW C;  5IJ9 A;  2ZOV A;  3RYC B;  3TD5 A;  3HWU A;  2GLZ A;  2VAP A;  1T0K B;  3MQW A;  5KX5 A;  3IEQ A;  5JCO A;  3JAK B;  4G4V A;  4BT7 A;  1XV2 A;  3RA6 A;  4E6E A;  5BMV B;  5JVD B;  4BT4 A;  1VK3 A;  3P10 A;  4YJ3 B;  3OBW A;  3VOA A;  4TUY A;  4X1Y A;  5MN4 A;  1YQN A;  3NVK E;  5GON B;  3HKE A;  3C9R A;  1NJI H;  2OTM A;  1IV3 A;  3CYQ A;  1KNK A;  2BTO A;  1YI2 F;  1Q81 H;  4BVQ A;  3WJP A;  2UYN B;  3VMF B;  1SA0 B;  3FD6 A;  2KTU A;  3I56 F;  1VQP F;  1PXW A;  5EAZ A;  1W41 A;  1VH8 A;  1XRG A;  2KG4 A;  4C8G A;  1GO1 A;  1VQ8 F;  2VGN A;  3CXC F;  1Q82 H;  1ONI A;  1FFX B;  3RYH B;  3DC2 A;  1W55 A;  4I55 A;  3JAT B;  2H6L A;  3CD6 F;  1UFY A;  4X3M A;  5EIB D;  2AMT A;  2CZW A;  1OAP A;  1RA4 A;  3E22 A;  3HKC A;  5EB0 A;  4FFB B;  3U0O A;  5HY1 A;  2DYY A;  2HRY A;  2OZB A;  3F0D A;  5GIO C;  1TVK A;  2ALE A;  4BW0 B;  3UT5 A;  4LCK A;  4IIJ B;  1RLG A;  3WPX A;  3VYT C;  3NMU C;  4C82 A;  4O2A B;  2BTQ B;  1KNJ A;  3S0H A;  2ZVY A;  1SZQ A;  3N2G A;  3KE1 A;  5GON A;  1KC8 H;  4O4L A;  3JAL A;  4ZHW A;  3D01 A;  3TD3 A;  1K73 H;  1GX1 A;  1VQ9 F;  3JAM M;  2VAW A;  4I4T A;  3F0G A;  4BT3 A;  5EYP B;  1X25 A;  4BVT A;  5HY2 A;  1JFF B;  1IV4 A;  1YJW F;  1X7O A;  5EZY B;  1VQM F;  4ZHQ A;  5GIP C;  4X1I A;  1W5A A;  4EI8 A;  2YXZ A;  4ERH A;  5JQG B;  1YGY A;  2Z1T A;  3N2K B;  5FNV A;  3F0F A;  2IAF A;  5MN6 A;  5J2U B; 
#chains in the Genus database with same CATH homology
 3AGK A;  2GLZ A;  1T0K B;  3GYQ A;  2QA4 F;  4TZZ A;  2QEX F;  1NMU B;  3RA5 A;  3RA6 A;  1VQ7 F;  3CCE F;  4BVR A;  3G71 F;  3JCM M;  3I55 F;  3CC7 F;  3NVI B;  3CPW F;  2AIF A;  2OTL F;  3LFO A;  3OBY A;  2HVY D;  2FC3 A;  3OBW A;  3V7E A;  3WXM B;  3CCS F;  3NVK E;  3CCM F;  2KTV A;  1NJI H;  2WAL A;  3CME F;  1K9M H;  3CCU F;  3CMA F;  1E7K A;  1CK2 A;  3G4S F;  2F9Z C;  3NK7 A;  3LWV C;  1YJ9 F;  5FJ4 C;  1YI2 F;  3CC4 F;  1Q81 H;  1VQL F;  3SIU A;  1H7M A;  4BVQ A;  3PAF A;  3VMF B;  2LBW A;  1X52 A;  1KD1 H;  3CPQ A;  4C4W C;  5DCV A;  1CN7 A;  5HXU A;  2KTU A;  1IPA A;  1K8A H;  3I56 F;  1VQP F;  5IT9 M;  1PXW A;  3N4Z A;  1W41 A;  2KG4 A;  3CCQ F;  1VQ8 F;  1GO1 A;  3CC2 F;  1Q7Y H;  3CCL F;  3CCR F;  3E20 B;  2VGN A;  5HWE A;  3CXC F;  1Q82 H;  1GO0 A;  1S72 F;  1SDS A;  3E1Y A;  1M1K H;  3PLA C;  3O85 A;  1VQ5 F;  3CCV F;  1JJ2 F;  3CD6 F;  3J7A R;  1W3E X;  3CG6 A;  1ZWZ A;  4X3M A;  3LWP C;  1X7P A;  5EO3 A;  3CCJ F;  2CZW A;  1M90 H;  1RA4 A;  1YJN F;  2BO1 A;  5GAN K;  3OW2 F;  3LWR C;  2I6D A;  3MCA B;  1QVF F;  5HY1 A;  1VQ4 F;  3ON1 A;  2OZB A;  3LWO C;  5GIO C;  1VQK F;  2ALE A;  3LWQ C;  3NK6 A;  4BW0 B;  1KQS F;  5G4U C;  1DT9 A;  4LCK A;  4BVS A;  4BY9 D;  1RLG A;  5A2Q M;  1YIJ F;  3N4Y A;  3FFM A;  3D00 A;  3NMU C;  1W2B F;  2VGM A;  2FGY A;  3J80 M;  5FLX M;  2OHW A;  1YHQ F;  2JNB A;  5GAP K;  5GIN C;  1VQ6 F;  5EWR A;  3IR9 A;  3HAX D;  3V7Q A;  2QI2 A;  1KC8 H;  5HY0 A;  2LBX A;  3V3T A;  1YIT F;  1K73 H;  1VQ9 F;  3SIV A;  3JAM M;  3G6E F;  4EI7 A;  1VQO F;  5HY4 A;  1Q86 H;  4BVT A;  5HY2 A;  1YJW F;  4NUT A;  3J81 M;  4EI9 A;  1X7O A;  1VQM F;  1GZ0 A;  1W42 A;  5GIP C;  4XCQ A;  4EI8 A;  4X3L A;  1XBI A;  1N8R H;  1QVG F;  2OTJ F;  4NQ3 A;  1VQN F;  3VI6 A;  5G4V C;  1W40 A;  5HXZ A;  3HJW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...