2OTJF

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2otjF00
2FC3A 3ON1A 2QEXF 3JCMM 1X7OA 2QI2A 2ALEA 3LWQC 3CCRF 2QA4F 1VQMF 3SIUA 3N4YA 1VQ9F 2OZBA 3CCMF 3IR9A 5GIPC 2LBWA 2JNBA 1YJ9F 4TZZA 5IT9M 2LBXA 2OTLF 3CMAF 1JJ2F 1T0KB 4C4WC 5A2QM 1YIJF 1KQSF 1Q82H 3E1YA 1VQ8F 1VQ6F 3NK7A 1YJNF 1XBIA 3VI6A 3CCJF 1GO1A 1ZWZA 3CMEF 1QVGF 1K8AH 1VQKF 2KTVA 4X3LA 5G4VC 1VQPF 1N8RH 1M90H 3J81M 1GO0A 1YITF 3I55F 3RA5A 3GYQA 3O85A 2BO1A 3PAFA 1RLGA 2KTUA 3CCLF 3LWPC 4X3MA 3CPQA 3CCUF 2AIFA 1Q7YH 3CC7F 2I6DA 3LWOC 3OBWA 1W41A 3FFMA 1RA4A 3E20B 4LCKA 5FJ4C 3WXMB 2KG4A 5G4UC 5FLXM 3CPWF 3G71F 1CN7A 1VQ4F 3G6EF 3OW2F 1IPAA 1VQLF 1SDSA 3LWRC 3CD6F 5GANK 1VQ5F 1QVFF 1W2BF 1YI2F 2VGMA 3N4ZA 3MCAB 1VQNF 3G4SF 3CCEF 5EWRA 1NJIH 3NMUC 1Q86H 1GZ0A 5GAPK 3HJWC 3CXCF 3CCSF 1KC8H 5EO3A 5GIOC 4NUTA 1M1KH 1W42A 3J7AR 3CCVF 1W3EX 3V7EA 2OTJF 3NVIB 1W40A 3AGKA 2VGNA 4BW0B 3J80M 1VQ7F 2HVYD 1K73H 1X7PA 1DT9A 3V7QA 3HAXD 3CCQF 3VMFB 2CZWA 5GINC 2WALA 3LFOA 3I56F 3CC2F 1NMUB 3JAMM 1VQOF 1E7KA 1H7MA 3CC4F 1KD1H 4BY9D 1YHQF 3LWVC 3CG6A 1CK2A 1YJWF 2OHWA 1PXWA 1K9MH 1X52A 3RA6A 3OBYA 1Q81H 3PLAC 3NVKE 3SIVA 5DCVA 3NK6A 1S72F
chains in the Genus database with same CATH superfamily
2F9ZC 5IJ0A 4X1IB 5MN6A 2VXYA 5EZYA 2B33A 3N2GA 2Q1XA 1X7OA 1VQMF 5EIBD 1VHAA 5KX5A 4G4YA 4O2BA 4IIJA 5GIPC 3WPXA 3CMAF 1T0KB 3P4EA 3S0YA 1YIJF 1KQSF 4E6EA 1Q82H 3S0WA 1TUBB 5EB0A 4TUYA 5J2TB 1VQ6F 5JCOC 3C9RA 1XBIA 2HS4A 1QVGF 1QU9A 3GTZA 1VQPF 2CVLA 2H8CA 3E22B 3IEQA 3KIZA 1M90H 3HKBB 1GO0A 2R751 2Z1UA 3KE1A 3IEWA 5EB1B 3PAFA 5LYJA 3CCUF 4FFBA 2BTQB 3IMPA 2AIFA 2RHOA 5JQGB 5CA0A 3LWOC 1W41A 3FFMA 4X20B 4C82A 5CB4B 2KGWA 4LCKA 1W581 1Z5WA 5HXZA 3FPIA 3BYQA 5IJ0B 5G4UC 5LA6B 1IV1A 1CN7A 4X20A 3G6EF 3WJPA 1OAPA 1KNKA 3N2KA 3HKEA 3KJJA 3WJQA 4ERHA 5GANK 5LOVB 4YJ3B 1W2BF 5ITZB 3N4ZA 4O4IA 2VAMA 3NMUC 3P10A 5C8YA 3S0HA 5JH7A 2HS0A 2IAFA 4DRXA 3IKEA 2CW4A 4PWTA 3GHZA 5GIOC 3I3FA 2CHTA 2V9YA 4G4XA 3CCVF 2ZAUA 2OTJF 3NVIB 4BW0B 3AGKA 1VQ7F 4X1YA 4EI7A 1DT9A 2VAWA 3V7QA 4BVQA 3JATB 3VTIC 2Z01A 4LNUA 2N48A 5GINC 3LFOA 1NMUB 3JAMM 1H47A 1JD1A 1H7MA 3WGLA 3ZO8A 2H6LA 2AMTA 1KD1H 3FBAA 4RQOA 2UZHA 1QAHA 2K1SA 3L7QA 2UYNA 5CA1B 3IKFA 1YJWF 1K9MH 3HKEB 1GX1A 3N2KB 3RA6A 3NVKE 3SIVA 3DDNA 2EWCA 1XRGA 2FC3A 1T0AA 3ON1A 3JCMM 3UT5A 4O4HB 2ALEA 3LWQC 3CCRF 2QA4F 2Z1EA 3SIUA 4BVSA 1X25A 3K2XA 3UT5B 2HP3A 2JNBA 5EZYB 2LBWA 4TZZA 2LBXA 1U3LA 2AIZP 5BMVA 3WGKA 4YJ2A 3WGNA 4ZK7A 3JAWA 4BVRA 4C4WC 5ITZA 1FSZA 2CHSA 3CYPB 2UYJA 3RYHA 1PF5A 3E22A 1YJNF 5HP8A 3VI6A 4O4JA 3LDTA 3HKBA 3M84A 2DT4A 4U39A 1K8AH 1VQKF 2KTVA 5HP7A 5G4VC 3I7TA 4ZHYB 3WGJA 4I4TB 3F6MA 4B62A 5J2TA 3I55F 1YITF 3O85A 1FFXB 1RLGA 4I50A 2KTUA 3CCLF 1W55A 5IJ9A 4WBNA 3CPQA 3CC7F 4XCQA 5IYZA 5LP6A 3DC2A 3M4SA 3U0OA 1KNJA 4F6RB 4G4WA 1H48A 3E20B 5FJ4C 3VYTC 3N2GB 1TVKA 3LMEA 3CPWF 3C9UA 1VQLF 1SDSA 1J7HA 3LWRC 1IV3A 3P0ZA 5HY4A 1VQ5F 2ZODA 4X1KB 2YXZA 1W5AA 1VQNF 4TV9A 3CCEF 5EWRA 1Q86H 4LNUB 4O4HA 5IJ9B 4O2BB 3ZP7A 2G9IA 5KX5B 5GAPK 5LA6A 5MN5A 3WGMA 3HJWC 5FNVB 1W5FA 1KC8H 5EO3A 3V3TA 5HY0A 1FNKA 3C9SA 2CWJA 1W40A 3K12A 2VGNA 3J80M 1SA0A 3MCQA 3ZP4A 3HAXD 4U3JA 3RYCA 3CCQF 2RHJA 3VMFB 2CZWA 4ZHQA 4EI8A 3CC2F 2RHLA 1E7KA 3ELCA 4U3JB 3CC4F 3C8LA 2ZF8A 5JVDB 3VOAA 5EYPA 5EAZA 3LWVC 4BVTA 5KMGB 4X1YB 2Z1TA 1X52A 4G4ZA 3ESJA 3OBYA 5GONA 3PLAC 1R1MA 1U40A 1S72F 4DRXB 4NQ3A 1U3PA 1JFFB 2QEXF 4IIJB 2QI2A 5C8YB 3KHNA 3N4YA 4O2AB 1VQ9F 2MQEA 3HTNA 4TV8B 3IR9A 3K0TA 5IT9M 1YJ9F 4X1IA 2OTLF 4O4IB 1JJ2F 3D00A 5A2QM 2R6R1 3CB2A 4B46A 1IV4A 3NK7A 3JALA 3ERNA 3CYQA 2LCAA 1VQVA 2IQQA 3KJKA 3CMEF 4I55B 2DYYA 4TUYB 1W5BA 1JY8A 3C9TA 1VH8A 2HRUA 3GYQA 2BO1A 1W5EA 3Q8HA 3RYFB 3JASB 2OTMA 1NQ3A 3K14A 5LP6C 3LWPC 3F0GA 2GLZA 4WBNB 3HWUA 2I6DA 3OONA 4X1KA 5LYJB 3OBWA 4FFBB 2BTUA 3S02A 4G4VA 3MQWA 2VAPA 4C81A 3D54A 3WXMB 4IHJA 4KWEA 4BT3A 3RYCB 1JFFA 3JATA 4NWOB 5FLXM 3G71F 4C8IA 3TD5A 1VQ4F 1IPAA 5MN4A 1OFUA 4EB6B 5HWEA 5LP6B 1YI2F 3RYIA 2VGMA 5EYPB 2PMPA 5HY2A 1FFXA 1GZ0A 3VYUC 4I4TA 4C8EA 1XV2A 3VYSC 2LBTA 4BT7A 3HKDB 4NUTA 1W42A 3RYHB 3J7AR 2HP0A 4HNAB 3V7EA 2UYNB 4ZI7B 2YYEA 2HVYD 3S06A 1VK3A 3M1XA 1K73H 4BT4A 5AVMA 1FNJA 1TVKB 3EORA 4YJ2B 5BMVB 2WALA 3JARB 3I56F 4B45A 4ZHWA 2L26A 2UYPA 3JARA 4BY9D 1YQNA 1YHQF 3CG6A 1CK2A 1RQ7A 2I6RA 2OHWA 2H8EA 5J2UB 1SZQA 1Q8RA 3TD3A 4BT5A 4I50B 5KMGA 1Q81H 4R40B 2NMUA 5DCVA 3NK6A 2RHHA 4M8IA 2P6YA 5CA1A 3F0DA 3D01A 4IHJB 4G88A 3V4DA 2OZBA 4RHAA 3CCMF 5HXUA 3LYBA 3ZOPA 3S03A 3B6NA 1W59A 4C8GA 3RYIB 4B5CA 5GONB 2HRYA 3F0EA 3WPWA 2HX0A 3E1YA 4ZOLA 4ZHVA 4I55A 1VQ8F 2BTOA 2W8BC 3CCJF 3JVHA 1GO1A 1W57A 1ZWZA 2GVIA 4X3LA 1N8RH 1JN1A 2HQSC 3J81M 4ZOLB 3RA5A 4BT2A 3T80A 3QUWA 1ONIA 3FD6A 3VCZA 2Q1YA 1RQ2A 3HKCA 2RB9A 4X3MA 4O4LB 1Q7YH 3JAWB 3RE3A 1QD9A 2ZVYA 4YJ3A 3HKCB 1U43A 4BT6A 5EIBC 4O2AA 1UI9A 2HP0B 1RA4A 3VIUA 3QHDA 2HS3A 3WJRA 2KG4A 5FNVA 2ZOVA 1COMA 2UYKA 5B8FA 4F6RA 3OW2F 1TUBA 3JALB 3QTYA 2Z1FA 5J2UA 3CD6F 1RLUA 4TV9B 5CA0B 1QVFF 4EI9A 5JQGA 3MCAB 5JVDA 1XHOA 2QTPA 3G4SF 1NJIH 5JH7B 2CSLA 4TV8A 4ZHQB 3MBMA 3VO8A 1DBFA 3R0PA 3CXCF 3CCSF 1M1KH 1ODEA 1SA0B 1Z5VA 5LOVA 5LXTA 1YGYA 1W3EX 3HKDA 2GZLA 2FGYA 5HY1A 1X7PA 3F0FA 5IYZB 2ZVZA 1UFYA 3RYFA 5CB4A 3FD5A 1VQOF 4DXDA 2PHNA 2IG8A 3JAKB 3JASA 4O4JB 1CLIA 3TD4A 4O4LA 3VOBA 1IV2A 4EB6A 4HNAA 5LXTB 1PXWA 4ZI7A 3MDOA 3JAKA 5JCOA
chains in the Genus database with same CATH topology
4NQ3A 2F9ZC 2FC3A 3ON1A 2QEXF 3JCMM 1X7OA 2QI2A 2ALEA 3LWQC 3CCRF 2QA4F 1VQMF 3SIUA 3N4YA 1VQ9F 2OZBA 3CCMF 4BVSA 3IR9A 5HXUA 5GIPC 2LBWA 2JNBA 1YJ9F 4TZZA 5IT9M 2LBXA 2OTLF 3CMAF 1JJ2F 1T0KB 4BVRA 3D00A 5A2QM 1YIJF 4C4WC 1KQSF 1Q82H 3E1YA 1VQ8F 1VQ6F 3NK7A 1YJNF 1XBIA 3VI6A 3CCJF 1GO1A 1ZWZA 3CMEF 1QVGF 1K8AH 1VQKF 2KTVA 4X3LA 5G4VC 1VQPF 1N8RH 1M90H 3J81M 1GO0A 1YITF 3I55F 3RA5A 3GYQA 3O85A 2BO1A 3PAFA 1RLGA 2KTUA 3CCLF 3LWPC 4X3MA 2GLZA 3CPQA 3CCUF 2AIFA 1Q7YH 3CC7F 4XCQA 2I6DA 3LWOC 3OBWA 1W41A 2HVYD 3FFMA 1RA4A 3E20B 4LCKA 5FJ4C 3WXMB 5HXZA 2KG4A 5G4UC 5FLXM 3CPWF 3G71F 1CN7A 1VQ4F 3G6EF 3OW2F 1IPAA 1VQLF 1SDSA 3LWRC 5HWEA 3CD6F 5HY4A 5GANK 1VQ5F 1QVFF 1W2BF 4EI9A 1YI2F 2VGMA 3N4ZA 3MCAB 1VQNF 3G4SF 3CCEF 5EWRA 1NJIH 5HY2A 3NMUC 1Q86H 1GZ0A 5GAPK 3HJWC 3CXCF 3CCSF 1KC8H 5EO3A 3V3TA 5GIOC 4NUTA 1M1KH 1W42A 5HY0A 3J7AR 3CCVF 1W3EX 3V7EA 2OTJF 3NVIB 1W40A 3AGKA 2FGYA 2VGNA 4BW0B 4EI7A 3J80M 1K73H 5HY1A 1X7PA 1DT9A 1VQ7F 3V7QA 4BVQA 3HAXD 3CCQF 3VMFB 2CZWA 5GINC 2WALA 4EI8A 3LFOA 3I56F 3CC2F 1NMUB 3JAMM 1VQOF 1E7KA 1H7MA 3CC4F 1KD1H 4BY9D 1YHQF 3LWVC 3CG6A 1CK2A 4BVTA 1YJWF 2OHWA 1PXWA 1K9MH 1X52A 3RA6A 3OBYA 1Q81H 3PLAC 3NVKE 3SIVA 5DCVA 3NK6A 1S72F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FC3 A;  3ON1 A;  2QEX F;  3JCM M;  1X7O A;  2QI2 A;  2ALE A;  3LWQ C;  3CCR F;  2QA4 F;  1VQM F;  3SIU A;  3N4Y A;  1VQ9 F;  2OZB A;  3CCM F;  3IR9 A;  5GIP C;  2LBW A;  2JNB A;  1YJ9 F;  4TZZ A;  5IT9 M;  2LBX A;  2OTL F;  3CMA F;  1JJ2 F;  1T0K B;  4C4W C;  5A2Q M;  1YIJ F;  1KQS F;  1Q82 H;  3E1Y A;  1VQ8 F;  1VQ6 F;  3NK7 A;  1YJN F;  1XBI A;  3VI6 A;  3CCJ F;  1GO1 A;  1ZWZ A;  3CME F;  1QVG F;  1K8A H;  1VQK F;  2KTV A;  4X3L A;  5G4V C;  1VQP F;  1N8R H;  1M90 H;  3J81 M;  1GO0 A;  1YIT F;  3I55 F;  3RA5 A;  3GYQ A;  3O85 A;  2BO1 A;  3PAF A;  1RLG A;  2KTU A;  3CCL F;  3LWP C;  4X3M A;  3CPQ A;  3CCU F;  2AIF A;  1Q7Y H;  3CC7 F;  2I6D A;  3LWO C;  3OBW A;  1W41 A;  3FFM A;  1RA4 A;  3E20 B;  4LCK A;  5FJ4 C;  3WXM B;  2KG4 A;  5G4U C;  5FLX M;  3CPW F;  3G71 F;  1CN7 A;  1VQ4 F;  3G6E F;  3OW2 F;  1IPA A;  1VQL F;  1SDS A;  3LWR C;  3CD6 F;  5GAN K;  1VQ5 F;  1QVF F;  1W2B F;  1YI2 F;  2VGM A;  3N4Z A;  3MCA B;  1VQN F;  3G4S F;  3CCE F;  5EWR A;  1NJI H;  3NMU C;  1Q86 H;  1GZ0 A;  5GAP K;  3HJW C;  3CXC F;  3CCS F;  1KC8 H;  5EO3 A;  5GIO C;  4NUT A;  1M1K H;  1W42 A;  3J7A R;  3CCV F;  1W3E X;  3V7E A;  2OTJ F;  3NVI B;  1W40 A;  3AGK A;  2VGN A;  4BW0 B;  3J80 M;  1VQ7 F;  2HVY D;  1K73 H;  1X7P A;  1DT9 A;  3V7Q A;  3HAX D;  3CCQ F;  3VMF B;  2CZW A;  5GIN C;  2WAL A;  3LFO A;  3I56 F;  3CC2 F;  1NMU B;  3JAM M;  1VQO F;  1E7K A;  1H7M A;  3CC4 F;  1KD1 H;  4BY9 D;  1YHQ F;  3LWV C;  3CG6 A;  1CK2 A;  1YJW F;  2OHW A;  1PXW A;  1K9M H;  1X52 A;  3RA6 A;  3OBY A;  1Q81 H;  3PLA C;  3NVK E;  3SIV A;  5DCV A;  3NK6 A;  1S72 F; 
#chains in the Genus database with same CATH topology
 2F9Z C;  5IJ0 A;  4X1I B;  5MN6 A;  2VXY A;  5EZY A;  2B33 A;  3N2G A;  2Q1X A;  1X7O A;  1VQM F;  5EIB D;  1VHA A;  5KX5 A;  4G4Y A;  4O2B A;  4IIJ A;  5GIP C;  3WPX A;  3CMA F;  1T0K B;  3P4E A;  3S0Y A;  1YIJ F;  1KQS F;  4E6E A;  1Q82 H;  3S0W A;  1TUB B;  5EB0 A;  4TUY A;  5J2T B;  1VQ6 F;  5JCO C;  3C9R A;  1XBI A;  2HS4 A;  1QVG F;  1QU9 A;  3GTZ A;  1VQP F;  2CVL A;  2H8C A;  3E22 B;  3IEQ A;  3KIZ A;  1M90 H;  3HKB B;  1GO0 A;  2R75 1;  2Z1U A;  3KE1 A;  3IEW A;  5EB1 B;  3PAF A;  5LYJ A;  3CCU F;  4FFB A;  2BTQ B;  3IMP A;  2AIF A;  2RHO A;  5JQG B;  5CA0 A;  3LWO C;  1W41 A;  3FFM A;  4X20 B;  4C82 A;  5CB4 B;  2KGW A;  4LCK A;  1W58 1;  1Z5W A;  5HXZ A;  3FPI A;  3BYQ A;  5IJ0 B;  5G4U C;  5LA6 B;  1IV1 A;  1CN7 A;  4X20 A;  3G6E F;  3WJP A;  1OAP A;  1KNK A;  3N2K A;  3HKE A;  3KJJ A;  3WJQ A;  4ERH A;  5GAN K;  5LOV B;  4YJ3 B;  1W2B F;  5ITZ B;  3N4Z A;  4O4I A;  2VAM A;  3NMU C;  3P10 A;  5C8Y A;  3S0H A;  5JH7 A;  2HS0 A;  2IAF A;  4DRX A;  3IKE A;  2CW4 A;  4PWT A;  3GHZ A;  5GIO C;  3I3F A;  2CHT A;  2V9Y A;  4G4X A;  3CCV F;  2ZAU A;  2OTJ F;  3NVI B;  4BW0 B;  3AGK A;  1VQ7 F;  4X1Y A;  4EI7 A;  1DT9 A;  2VAW A;  3V7Q A;  4BVQ A;  3JAT B;  3VTI C;  2Z01 A;  4LNU A;  2N48 A;  5GIN C;  3LFO A;  1NMU B;  3JAM M;  1H47 A;  1JD1 A;  1H7M A;  3WGL A;  3ZO8 A;  2H6L A;  2AMT A;  1KD1 H;  3FBA A;  4RQO A;  2UZH A;  1QAH A;  2K1S A;  3L7Q A;  2UYN A;  5CA1 B;  3IKF A;  1YJW F;  1K9M H;  3HKE B;  1GX1 A;  3N2K B;  3RA6 A;  3NVK E;  3SIV A;  3DDN A;  2EWC A;  1XRG A;  2FC3 A;  1T0A A;  3ON1 A;  3JCM M;  3UT5 A;  4O4H B;  2ALE A;  3LWQ C;  3CCR F;  2QA4 F;  2Z1E A;  3SIU A;  4BVS A;  1X25 A;  3K2X A;  3UT5 B;  2HP3 A;  2JNB A;  5EZY B;  2LBW A;  4TZZ A;  2LBX A;  1U3L A;  2AIZ P;  5BMV A;  3WGK A;  4YJ2 A;  3WGN A;  4ZK7 A;  3JAW A;  4BVR A;  4C4W C;  5ITZ A;  1FSZ A;  2CHS A;  3CYP B;  2UYJ A;  3RYH A;  1PF5 A;  3E22 A;  1YJN F;  5HP8 A;  3VI6 A;  4O4J A;  3LDT A;  3HKB A;  3M84 A;  2DT4 A;  4U39 A;  1K8A H;  1VQK F;  2KTV A;  5HP7 A;  5G4V C;  3I7T A;  4ZHY B;  3WGJ A;  4I4T B;  3F6M A;  4B62 A;  5J2T A;  3I55 F;  1YIT F;  3O85 A;  1FFX B;  1RLG A;  4I50 A;  2KTU A;  3CCL F;  1W55 A;  5IJ9 A;  4WBN A;  3CPQ A;  3CC7 F;  4XCQ A;  5IYZ A;  5LP6 A;  3DC2 A;  3M4S A;  3U0O A;  1KNJ A;  4F6R B;  4G4W A;  1H48 A;  3E20 B;  5FJ4 C;  3VYT C;  3N2G B;  1TVK A;  3LME A;  3CPW F;  3C9U A;  1VQL F;  1SDS A;  1J7H A;  3LWR C;  1IV3 A;  3P0Z A;  5HY4 A;  1VQ5 F;  2ZOD A;  4X1K B;  2YXZ A;  1W5A A;  1VQN F;  4TV9 A;  3CCE F;  5EWR A;  1Q86 H;  4LNU B;  4O4H A;  5IJ9 B;  4O2B B;  3ZP7 A;  2G9I A;  5KX5 B;  5GAP K;  5LA6 A;  5MN5 A;  3WGM A;  3HJW C;  5FNV B;  1W5F A;  1KC8 H;  5EO3 A;  3V3T A;  5HY0 A;  1FNK A;  3C9S A;  2CWJ A;  1W40 A;  3K12 A;  2VGN A;  3J80 M;  1SA0 A;  3MCQ A;  3ZP4 A;  3HAX D;  4U3J A;  3RYC A;  3CCQ F;  2RHJ A;  3VMF B;  2CZW A;  4ZHQ A;  4EI8 A;  3CC2 F;  2RHL A;  1E7K A;  3ELC A;  4U3J B;  3CC4 F;  3C8L A;  2ZF8 A;  5JVD B;  3VOA A;  5EYP A;  5EAZ A;  3LWV C;  4BVT A;  5KMG B;  4X1Y B;  2Z1T A;  1X52 A;  4G4Z A;  3ESJ A;  3OBY A;  5GON A;  3PLA C;  1R1M A;  1U40 A;  1S72 F;  4DRX B;  4NQ3 A;  1U3P A;  1JFF B;  2QEX F;  4IIJ B;  2QI2 A;  5C8Y B;  3KHN A;  3N4Y A;  4O2A B;  1VQ9 F;  2MQE A;  3HTN A;  4TV8 B;  3IR9 A;  3K0T A;  5IT9 M;  1YJ9 F;  4X1I A;  2OTL F;  4O4I B;  1JJ2 F;  3D00 A;  5A2Q M;  2R6R 1;  3CB2 A;  4B46 A;  1IV4 A;  3NK7 A;  3JAL A;  3ERN A;  3CYQ A;  2LCA A;  1VQV A;  2IQQ A;  3KJK A;  3CME F;  4I55 B;  2DYY A;  4TUY B;  1W5B A;  1JY8 A;  3C9T A;  1VH8 A;  2HRU A;  3GYQ A;  2BO1 A;  1W5E A;  3Q8H A;  3RYF B;  3JAS B;  2OTM A;  1NQ3 A;  3K14 A;  5LP6 C;  3LWP C;  3F0G A;  2GLZ A;  4WBN B;  3HWU A;  2I6D A;  3OON A;  4X1K A;  5LYJ B;  3OBW A;  4FFB B;  2BTU A;  3S02 A;  4G4V A;  3MQW A;  2VAP A;  4C81 A;  3D54 A;  3WXM B;  4IHJ A;  4KWE A;  4BT3 A;  3RYC B;  1JFF A;  3JAT A;  4NWO B;  5FLX M;  3G71 F;  4C8I A;  3TD5 A;  1VQ4 F;  1IPA A;  5MN4 A;  1OFU A;  4EB6 B;  5HWE A;  5LP6 B;  1YI2 F;  3RYI A;  2VGM A;  5EYP B;  2PMP A;  5HY2 A;  1FFX A;  1GZ0 A;  3VYU C;  4I4T A;  4C8E A;  1XV2 A;  3VYS C;  2LBT A;  4BT7 A;  3HKD B;  4NUT A;  1W42 A;  3RYH B;  3J7A R;  2HP0 A;  4HNA B;  3V7E A;  2UYN B;  4ZI7 B;  2YYE A;  2HVY D;  3S06 A;  1VK3 A;  3M1X A;  1K73 H;  4BT4 A;  5AVM A;  1FNJ A;  1TVK B;  3EOR A;  4YJ2 B;  5BMV B;  2WAL A;  3JAR B;  3I56 F;  4B45 A;  4ZHW A;  2L26 A;  2UYP A;  3JAR A;  4BY9 D;  1YQN A;  1YHQ F;  3CG6 A;  1CK2 A;  1RQ7 A;  2I6R A;  2OHW A;  2H8E A;  5J2U B;  1SZQ A;  1Q8R A;  3TD3 A;  4BT5 A;  4I50 B;  5KMG A;  1Q81 H;  4R40 B;  2NMU A;  5DCV A;  3NK6 A;  2RHH A;  4M8I A;  2P6Y A;  5CA1 A;  3F0D A;  3D01 A;  4IHJ B;  4G88 A;  3V4D A;  2OZB A;  4RHA A;  3CCM F;  5HXU A;  3LYB A;  3ZOP A;  3S03 A;  3B6N A;  1W59 A;  4C8G A;  3RYI B;  4B5C A;  5GON B;  2HRY A;  3F0E A;  3WPW A;  2HX0 A;  3E1Y A;  4ZOL A;  4ZHV A;  4I55 A;  1VQ8 F;  2BTO A;  2W8B C;  3CCJ F;  3JVH A;  1GO1 A;  1W57 A;  1ZWZ A;  2GVI A;  4X3L A;  1N8R H;  1JN1 A;  2HQS C;  3J81 M;  4ZOL B;  3RA5 A;  4BT2 A;  3T80 A;  3QUW A;  1ONI A;  3FD6 A;  3VCZ A;  2Q1Y A;  1RQ2 A;  3HKC A;  2RB9 A;  4X3M A;  4O4L B;  1Q7Y H;  3JAW B;  3RE3 A;  1QD9 A;  2ZVY A;  4YJ3 A;  3HKC B;  1U43 A;  4BT6 A;  5EIB C;  4O2A A;  1UI9 A;  2HP0 B;  1RA4 A;  3VIU A;  3QHD A;  2HS3 A;  3WJR A;  2KG4 A;  5FNV A;  2ZOV A;  1COM A;  2UYK A;  5B8F A;  4F6R A;  3OW2 F;  1TUB A;  3JAL B;  3QTY A;  2Z1F A;  5J2U A;  3CD6 F;  1RLU A;  4TV9 B;  5CA0 B;  1QVF F;  4EI9 A;  5JQG A;  3MCA B;  5JVD A;  1XHO A;  2QTP A;  3G4S F;  1NJI H;  5JH7 B;  2CSL A;  4TV8 A;  4ZHQ B;  3MBM A;  3VO8 A;  1DBF A;  3R0P A;  3CXC F;  3CCS F;  1M1K H;  1ODE A;  1SA0 B;  1Z5V A;  5LOV A;  5LXT A;  1YGY A;  1W3E X;  3HKD A;  2GZL A;  2FGY A;  5HY1 A;  1X7P A;  3F0F A;  5IYZ B;  2ZVZ A;  1UFY A;  3RYF A;  5CB4 A;  3FD5 A;  1VQO F;  4DXD A;  2PHN A;  2IG8 A;  3JAK B;  3JAS A;  4O4J B;  1CLI A;  3TD4 A;  4O4L A;  3VOB A;  1IV2 A;  4EB6 A;  4HNA A;  5LXT B;  1PXW A;  4ZI7 A;  3MDO A;  3JAK A;  5JCO A; 
#chains in the Genus database with same CATH homology
 4NQ3 A;  2F9Z C;  2FC3 A;  3ON1 A;  2QEX F;  3JCM M;  1X7O A;  2QI2 A;  2ALE A;  3LWQ C;  3CCR F;  2QA4 F;  1VQM F;  3SIU A;  3N4Y A;  1VQ9 F;  2OZB A;  3CCM F;  4BVS A;  3IR9 A;  5HXU A;  5GIP C;  2LBW A;  2JNB A;  1YJ9 F;  4TZZ A;  5IT9 M;  2LBX A;  2OTL F;  3CMA F;  1JJ2 F;  1T0K B;  4BVR A;  3D00 A;  5A2Q M;  1YIJ F;  4C4W C;  1KQS F;  1Q82 H;  3E1Y A;  1VQ8 F;  1VQ6 F;  3NK7 A;  1YJN F;  1XBI A;  3VI6 A;  3CCJ F;  1GO1 A;  1ZWZ A;  3CME F;  1QVG F;  1K8A H;  1VQK F;  2KTV A;  4X3L A;  5G4V C;  1VQP F;  1N8R H;  1M90 H;  3J81 M;  1GO0 A;  1YIT F;  3I55 F;  3RA5 A;  3GYQ A;  3O85 A;  2BO1 A;  3PAF A;  1RLG A;  2KTU A;  3CCL F;  3LWP C;  4X3M A;  2GLZ A;  3CPQ A;  3CCU F;  2AIF A;  1Q7Y H;  3CC7 F;  4XCQ A;  2I6D A;  3LWO C;  3OBW A;  1W41 A;  2HVY D;  3FFM A;  1RA4 A;  3E20 B;  4LCK A;  5FJ4 C;  3WXM B;  5HXZ A;  2KG4 A;  5G4U C;  5FLX M;  3CPW F;  3G71 F;  1CN7 A;  1VQ4 F;  3G6E F;  3OW2 F;  1IPA A;  1VQL F;  1SDS A;  3LWR C;  5HWE A;  3CD6 F;  5HY4 A;  5GAN K;  1VQ5 F;  1QVF F;  1W2B F;  4EI9 A;  1YI2 F;  2VGM A;  3N4Z A;  3MCA B;  1VQN F;  3G4S F;  3CCE F;  5EWR A;  1NJI H;  5HY2 A;  3NMU C;  1Q86 H;  1GZ0 A;  5GAP K;  3HJW C;  3CXC F;  3CCS F;  1KC8 H;  5EO3 A;  3V3T A;  5GIO C;  4NUT A;  1M1K H;  1W42 A;  5HY0 A;  3J7A R;  3CCV F;  1W3E X;  3V7E A;  2OTJ F;  3NVI B;  1W40 A;  3AGK A;  2FGY A;  2VGN A;  4BW0 B;  4EI7 A;  3J80 M;  1K73 H;  5HY1 A;  1X7P A;  1DT9 A;  1VQ7 F;  3V7Q A;  4BVQ A;  3HAX D;  3CCQ F;  3VMF B;  2CZW A;  5GIN C;  2WAL A;  4EI8 A;  3LFO A;  3I56 F;  3CC2 F;  1NMU B;  3JAM M;  1VQO F;  1E7K A;  1H7M A;  3CC4 F;  1KD1 H;  4BY9 D;  1YHQ F;  3LWV C;  3CG6 A;  1CK2 A;  4BVT A;  1YJW F;  2OHW A;  1PXW A;  1K9M H;  1X52 A;  3RA6 A;  3OBY A;  1Q81 H;  3PLA C;  3NVK E;  3SIV A;  5DCV A;  3NK6 A;  1S72 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...