1PXWA

Crystal structure of l7ae srnp core protein from pyrococcus abyssii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
MEGWMMAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification, crystallization and preliminary X-ray diffraction data of L7Ae sRNP core protein from Pyrococcus abyssii.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosome
molecule keywords LSU ribosomal protein L7AE
total genus 43
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1pxwA00
1W42A 3VMFB 5EO3A 3AGKA 4X3LA 4X3MA 3CCSF 3CC2F 1KC8H 3CG6A 2AIFA 1W40A 5EWRA 5GINC 1IPAA 1K9MH 3NVIB 3NMUC 3JAMM 3CMEF 3NK7A 3LWOC 3I56F 1VQOF 1VQPF 3G71F 1M1KH 3G4SF 2WALA 2LBXA 1X7OA 1K73H 3LWPC 3CMAF 3CPQA 5FLXM 4TZZA 2OTJF 3PAFA 2KG4A 3J81M 3CXCF 1Q7YH 1RA4A 1VQ4F 3CCMF 1VQ7F 4C4WC 3N4YA 3NVKE 3ON1A 1N8RH 3CCUF 3CCRF 3HAXD 3O85A 3V7QA 1YJNF 1W2BF 3PLAC 2OHWA 1YJ9F 2OZBA 1SDSA 3CC4F 2KTUA 5IT9M 3WXMB 1VQ5F 1VQKF 1NMUB 1ZWZA 1T0KB 1CN7A 2KTVA 3I55F 5GAPK 1VQ8F 2FC3A 3LWVC 3CC7F 3CD6F 3V7EA 2VGNA 1S72F 1E7KA 3CCQF 3OBYA 3CCJF 1Q86H 1K8AH 3RA6A 1M90H 4BY9D 1Q81H 3MCAB 1VQ6F 1W3EX 1YHQF 3RA5A 5A2QM 3E1YA 1QVFF 3LWQC 2BO1A 1VQMF 5FJ4C 2LBWA 3CCVF 1VQ9F 3G6EF 1VQNF 3N4ZA 1YIJF 2QI2A 3IR9A 1GO0A 1CK2A 3CPWF 1RLGA 1KQSF 3J7AR 1YI2F 1Q82H 1NJIH 3SIVA 4BW0B 3E20B 3CCEF 5GANK 1W41A 1X52A 1XBIA 4NUTA 4LCKA 3JCMM 5GIOC 3LFOA 3LWRC 3NK6A 3SIUA 1H7MA 1YITF 3OW2F 3FFMA 2CZWA 1JJ2F 1YJWF 1X7PA 2I6DA 1PXWA 1DT9A 2QA4F 3VI6A 1GZ0A 5G4UC 5GIPC 3GYQA 3J80M 3CCLF 3HJWC 1GO1A 2ALEA 2JNBA 2OTLF 1VQLF 3OBWA 2VGMA 5G4VC 2HVYD 2QEXF 5DCVA 1QVGF 1KD1H
chains in the Genus database with same CATH superfamily
4R40B 1Z5VA 2CHTA 4IHJA 2RHJA 3CG6A 3KE1A 4X20B 2AIFA 4M8IA 3M84A 5GINC 1IPAA 1RQ7A 5JCOA 2Z1TA 3NVIB 1TVKB 3I56F 1NQ3A 4IIJB 2H8CA 1VQPF 3G4SF 4O2AB 5KX5A 5HXZA 4NWOB 1X7OA 4ZI7A 3LWPC 1H47A 3CPQA 4TZZA 4O2AA 3CYQA 4TV8A 4I4TB 3PAFA 4I55B 3CXCF 1RA4A 4O4IB 2PMPA 5LP6A 3HWUA 1N8RH 5CA1A 3CYPB 4BT6A 3HAXD 4F6RA 3IKFA 4O2BB 3V7QA 3WJRA 3PLAC 2OHWA 3VYUC 2OZBA 1SDSA 1UI9A 3CC4F 5IT9M 3WXMB 2B33A 4B62A 2KTVA 3K12A 5GAPK 3CD6F 3LWVC 2YXZA 1SA0B 3UT5A 2CVLA 4LNUB 1IV1A 1S72F 5J2UA 4G4YA 1E7KA 3CCQF 1Q86H 3F6MA 4BVSA 5IJ0B 4RHAA 2Z1UA 3S06A 1QD9A 3RA5A 1U43A 3E1YA 3CB2A 3V4DA 5GONA 3ZO8A 2BO1A 3KJKA 5LOVA 2LCAA 4ZHQA 3G6EF 3JAKA 1YIJF 2QI2A 3IR9A 3WGJA 5EIBC 3RYHB 3T80A 3P0ZA 2DT4A 1KQSF 4G88A 5LOVB 3J7AR 1W5EA 4DRXA 1XV2A 3K0TA 3BYQA 4BT7A 2AIZP 2GLZA 3CCEF 3VCZA 1W41A 5FNVB 2RHLA 4EI8A 5GIOC 2QTPA 3LFOA 3SIUA 3S0WA 2IG8A 5J2TA 1VK3A 4G4XA 1X7PA 4EI7A 3VI6A 3I3FA 3F0GA 2VXYA 4YJ3B 4X20A 5J2TB 1U3PA 4FFBA 3KJJA 4WBNA 2ALEA 2JNBA 3RYFA 3HKEA 3MCQA 2VGMA 2LBTA 5HWEA 5G4VC 2HRUA 5EO3A 1H48A 2UYPA 1XHOA 3CC2F 4X1KA 2HS3A 2H6LA 3MBMA 5EWRA 5CA0A 1K9MH 3N2KB 4ZK7A 3CMEF 3LWOC 2KGWA 2WALA 3WPWA 4HNAA 3EORA 4O2BA 2ZVYA 3VIUA 3C9UA 4ZHWA 2UYNB 3IEQA 4X1IB 3J81M 1SA0A 3N2GB 2GZLA 3ON1A 5B8FA 3CCUF 3CCRF 3O85A 2AMTA 1COMA 1YJNF 2P6YA 1YJ9F 1VHAA 2KTUA 1CLIA 1VQ5F 3M1XA 4B46A 5IJ9B 4G4ZA 2FC3A 4LNUA 3RYHA 4EI9A 2HP0B 2VGNA 5HY1A 2NMUA 2GVIA 3QHDA 3TD5A 3CCJF 3HKDA 1M90H 2F9ZC 4TV9A 2HRYA 4PWTA 2FGYA 1X25A 1FNKA 4YJ2B 3HKDB 5HP8A 5KMGB 3S0YA 1W5FA 4ZHQB 2LBWA 4TUYB 3ZP4A 1VQNF 4O4LA 1GO0A 5LYJA 1CK2A 3GHZA 3CPWF 2H8EA 1VH8A 5EYPA 2R6R1 5EIBD 3HKBB 3E22B 3ERNA 4C8IA 1YI2F 1Q82H 3JARA 2ZOVA 1W57A 5LXTB 4I50A 3RYIB 4YJ3A 1OAPA 1XBIA 5JCOC 1KNKA 2ZF8A 3RYFB 4BT4A 4E6EA 4B5CA 4EB6A 1JFFB 3KIZA 3KHNA 3K2XA 2I6DA 1TVKA 3FBAA 3DDNA 2QA4F 2ZODA 1W581 5G4UC 3WPXA 5JH7B 5GIPC 3JASB 4B45A 3P10A 3LMEA 3HJWC 4ZI7B 3Q8HA 3K14A 1GO1A 3D00A 3OBWA 5JH7A 1SZQA 2QEXF 3R0PA 1PF5A 1KNJA 3WGNA 1QVGF 5DCVA 2CSLA 3MQWA 4BVTA 1W42A 4I55A 3VMFB 1W55A 4O4IA 4X3LA 4X3MA 5LP6B 3WGMA 4G4WA 3VO8A 2UYNA 5EB1B 1W40A 5CA0B 2EWCA 4NQ3A 3N2KA 3NMUC 3JAMM 3N2GA 2UYKA 1IV3A 2BTUA 4ZHVA 4BVRA 1VQVA 3C8LA 3QTYA 1JN1A 3CMAF 4BT3A 4X1YA 5FLXM 2OTJF 1T0AA 2MQEA 3RYCB 3QUWA 2KG4A 3FPIA 1QAHA 5GONB 1UFYA 1VQ4F 4C4WC 3WJPA 4TV9B 3IEWA 3JAKB 4O4HB 2VAWA 5HY4A 3LYBA 1YGYA 2UYJA 3GTZA 1W2BF 1YQNA 2CHSA 1RLUA 1TUBA 2I6RA 1U40A 2ZVZA 4DRXB 2RHHA 2UZHA 5IJ9A 1T0KB 3FD6A 3JAWB 3CC7F 5KX5B 2VAPA 5LYJB 3ELCA 3U0OA 5MN4A 1FFXA 3OBYA 3RA6A 4BY9D 2VAMA 3JARB 2G9IA 2HP3A 3JATB 4ERHA 1R1MA 1YHQF 4I50B 4I4TA 5A2QM 2Z1FA 1U3LA 4U39A 1QVFF 2OTMA 5KMGA 4YJ2A 5HY2A 3VOBA 3IKEA 5HP7A 4BVQA 1FSZA 2HS0A 2W8BC 3C9SA 3JATA 4TUYA 3CCVF 1VQ9F 5FJ4C 5CA1B 4ZHYB 5EYPB 3HKBA 1RLGA 5LP6C 5LA6B 1RQ2A 3TD3A 1NJIH 2Z01A 3E20B 5EAZA 5BMVB 2HS4A 1W59A 3JASA 2Z1EA 1X52A 2RHOA 5J2UB 5LA6A 4LCKA 3JCMM 5IJ0A 4X1KB 5CB4B 1W5BA 1JFFA 3LWRC 2YYEA 3V3TA 1YITF 3OW2F 3FFMA 1QU9A 4O4JB 3JALA 1YJWF 3B6NA 1DT9A 2ZAUA 1J7HA 4U3JA 3S03A 2R751 2RB9A 5C8YB 2V9YA 3ZP7A 1VQLF 2CWJA 2HVYD 1IV2A 3HKCB 4BT2A 3VOAA 4C81A 5FNVA 4ZOLA 1KD1H 3AGKA 3MDOA 3CCSF 3F0FA 1KC8H 5IYZA 3F0DA 4IHJB 3P4EA 4DXDA 3RYCA 2L26A 2K1SA 3NK7A 3WGLA 1JY8A 3VTIC 1VQOF 2N48A 3G71F 1M1KH 2PHNA 2IAFA 2LBXA 5EZYB 4WBNB 1Q8RA 1K73H 3WGKA 3D01A 3HKEB 1Z5WA 1TUBB 4X1YB 3LDTA 3JAWA 5EZYA 1Q7YH 2BTOA 1GX1A 3CCMF 3TD4A 3N4YA 4IIJA 1VQ7F 3NVKE 3FD5A 4RQOA 3F0EA 4O4HA 3WJQA 1DBFA 4O4LB 3VYSC 1IV4A 1W5AA 3S02A 3VYTC 1ONIA 3JVHA 4F6RB 5EB0A 3ZOPA 3E22A 1VQKF 1NMUB 1ZWZA 5LXTA 1CN7A 2CW4A 4TV8B 3I55F 1VQ8F 1ODEA 4HNAB 1OFUA 2Q1YA 3V7EA 3D54A 3S0HA 1FFXB 1XRGA 2HQSC 1K8AH 1Q81H 3MCAB 3IMPA 1VQ6F 1W3EX 4X1IA 2DYYA 2IQQA 3M4SA 4EB6B 1FNJA 3LWQC 5MN5A 5ITZB 1VQMF 5MN6A 3N4ZA 3RE3A 5CB4A 3UT5B 3HTNA 5AVMA 5ITZA 3JALB 4O4JA 2BTQB 4C82A 3C9RA 3SIVA 4U3JB 5BMVA 4BW0B 3C9TA 2HP0A 5GANK 2HX0A 3DC2A 4NUTA 5JQGB 5JVDA 4XCQA 4G4VA 3NK6A 1H7MA 2CZWA 5JQGA 1JJ2F 5JVDB 5HY0A 4ZOLB 1PXWA 3L7QA 1GZ0A 3ESJA 4KWEA 5IYZB 3GYQA 1JD1A 5C8YA 3J80M 3CCLF 4C8GA 4FFBB 4BT5A 3OONA 3I7TA 2OTLF 5HXUA 3HKCA 3RYIA 2Q1XA 4C8EA
chains in the Genus database with same CATH topology
1W42A 3VMFB 5EO3A 3AGKA 4X3LA 4X3MA 3CCSF 3CC2F 1KC8H 3CG6A 2AIFA 1W40A 5EWRA 5GINC 1IPAA 4NQ3A 1K9MH 3NVIB 3NMUC 3JAMM 3CMEF 3NK7A 3LWOC 3I56F 1VQOF 1VQPF 3G71F 1M1KH 3G4SF 2WALA 5HXZA 2LBXA 4BVRA 1X7OA 1K73H 3LWPC 3CMAF 3CPQA 5FLXM 4TZZA 2OTJF 3PAFA 2KG4A 3J81M 3CXCF 1Q7YH 1RA4A 1VQ4F 3CCMF 1VQ7F 4C4WC 3N4YA 3NVKE 3ON1A 1N8RH 3CCUF 3CCRF 5HY4A 3HAXD 3O85A 3V7QA 1YJNF 1W2BF 3PLAC 2OHWA 1YJ9F 2OZBA 1SDSA 3CC4F 2KTUA 5IT9M 3WXMB 1VQ5F 1VQKF 1NMUB 1ZWZA 1T0KB 1CN7A 2KTVA 3I55F 5GAPK 1VQ8F 2FC3A 3LWVC 3CC7F 3CD6F 4EI9A 3V7EA 2VGNA 5HY1A 1S72F 1E7KA 3CCQF 3OBYA 3CCJF 1Q86H 1K8AH 3RA6A 1M90H 4BY9D 1Q81H 2F9ZC 3MCAB 4BVSA 1VQ6F 1W3EX 1YHQF 3RA5A 5A2QM 3E1YA 2FGYA 1QVFF 3LWQC 5HY2A 2BO1A 4BVQA 1VQMF 5FJ4C 2LBWA 3CCVF 1VQ9F 3G6EF 1VQNF 3N4ZA 1YIJF 2QI2A 3IR9A 1GO0A 1CK2A 3CPWF 1RLGA 1KQSF 3J7AR 1YI2F 1Q82H 1NJIH 3SIVA 4BW0B 3E20B 2GLZA 3CCEF 5GANK 1W41A 1X52A 1XBIA 4NUTA 4EI8A 4LCKA 3JCMM 5GIOC 4XCQA 3LFOA 3LWRC 3NK6A 3SIUA 1H7MA 3V3TA 1YITF 3OW2F 3FFMA 2CZWA 1JJ2F 1YJWF 5HY0A 1X7PA 2I6DA 1PXWA 1DT9A 4EI7A 2QA4F 3VI6A 1GZ0A 5G4UC 5GIPC 3GYQA 3J80M 3CCLF 3HJWC 1GO1A 2ALEA 2JNBA 3D00A 5HXUA 1VQLF 2OTLF 3OBWA 5HWEA 2VGMA 5G4VC 2HVYD 2QEXF 5DCVA 1QVGF 4BVTA 1KD1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W42 A;  3VMF B;  5EO3 A;  3AGK A;  4X3L A;  4X3M A;  3CCS F;  3CC2 F;  1KC8 H;  3CG6 A;  2AIF A;  1W40 A;  5EWR A;  5GIN C;  1IPA A;  1K9M H;  3NVI B;  3NMU C;  3JAM M;  3CME F;  3NK7 A;  3LWO C;  3I56 F;  1VQO F;  1VQP F;  3G71 F;  1M1K H;  3G4S F;  2WAL A;  2LBX A;  1X7O A;  1K73 H;  3LWP C;  3CMA F;  3CPQ A;  5FLX M;  4TZZ A;  2OTJ F;  3PAF A;  2KG4 A;  3J81 M;  3CXC F;  1Q7Y H;  1RA4 A;  1VQ4 F;  3CCM F;  1VQ7 F;  4C4W C;  3N4Y A;  3NVK E;  3ON1 A;  1N8R H;  3CCU F;  3CCR F;  3HAX D;  3O85 A;  3V7Q A;  1YJN F;  1W2B F;  3PLA C;  2OHW A;  1YJ9 F;  2OZB A;  1SDS A;  3CC4 F;  2KTU A;  5IT9 M;  3WXM B;  1VQ5 F;  1VQK F;  1NMU B;  1ZWZ A;  1T0K B;  1CN7 A;  2KTV A;  3I55 F;  5GAP K;  1VQ8 F;  2FC3 A;  3LWV C;  3CC7 F;  3CD6 F;  3V7E A;  2VGN A;  1S72 F;  1E7K A;  3CCQ F;  3OBY A;  3CCJ F;  1Q86 H;  1K8A H;  3RA6 A;  1M90 H;  4BY9 D;  1Q81 H;  3MCA B;  1VQ6 F;  1W3E X;  1YHQ F;  3RA5 A;  5A2Q M;  3E1Y A;  1QVF F;  3LWQ C;  2BO1 A;  1VQM F;  5FJ4 C;  2LBW A;  3CCV F;  1VQ9 F;  3G6E F;  1VQN F;  3N4Z A;  1YIJ F;  2QI2 A;  3IR9 A;  1GO0 A;  1CK2 A;  3CPW F;  1RLG A;  1KQS F;  3J7A R;  1YI2 F;  1Q82 H;  1NJI H;  3SIV A;  4BW0 B;  3E20 B;  3CCE F;  5GAN K;  1W41 A;  1X52 A;  1XBI A;  4NUT A;  4LCK A;  3JCM M;  5GIO C;  3LFO A;  3LWR C;  3NK6 A;  3SIU A;  1H7M A;  1YIT F;  3OW2 F;  3FFM A;  2CZW A;  1JJ2 F;  1YJW F;  1X7P A;  2I6D A;  1PXW A;  1DT9 A;  2QA4 F;  3VI6 A;  1GZ0 A;  5G4U C;  5GIP C;  3GYQ A;  3J80 M;  3CCL F;  3HJW C;  1GO1 A;  2ALE A;  2JNB A;  2OTL F;  1VQL F;  3OBW A;  2VGM A;  5G4V C;  2HVY D;  2QEX F;  5DCV A;  1QVG F;  1KD1 H; 
#chains in the Genus database with same CATH topology
 4R40 B;  1Z5V A;  2CHT A;  4IHJ A;  2RHJ A;  3CG6 A;  3KE1 A;  4X20 B;  2AIF A;  4M8I A;  3M84 A;  5GIN C;  1IPA A;  1RQ7 A;  5JCO A;  2Z1T A;  3NVI B;  1TVK B;  3I56 F;  1NQ3 A;  4IIJ B;  2H8C A;  1VQP F;  3G4S F;  4O2A B;  5KX5 A;  5HXZ A;  4NWO B;  1X7O A;  4ZI7 A;  3LWP C;  1H47 A;  3CPQ A;  4TZZ A;  4O2A A;  3CYQ A;  4TV8 A;  4I4T B;  3PAF A;  4I55 B;  3CXC F;  1RA4 A;  4O4I B;  2PMP A;  5LP6 A;  3HWU A;  1N8R H;  5CA1 A;  3CYP B;  4BT6 A;  3HAX D;  4F6R A;  3IKF A;  4O2B B;  3V7Q A;  3WJR A;  3PLA C;  2OHW A;  3VYU C;  2OZB A;  1SDS A;  1UI9 A;  3CC4 F;  5IT9 M;  3WXM B;  2B33 A;  4B62 A;  2KTV A;  3K12 A;  5GAP K;  3CD6 F;  3LWV C;  2YXZ A;  1SA0 B;  3UT5 A;  2CVL A;  4LNU B;  1IV1 A;  1S72 F;  5J2U A;  4G4Y A;  1E7K A;  3CCQ F;  1Q86 H;  3F6M A;  4BVS A;  5IJ0 B;  4RHA A;  2Z1U A;  3S06 A;  1QD9 A;  3RA5 A;  1U43 A;  3E1Y A;  3CB2 A;  3V4D A;  5GON A;  3ZO8 A;  2BO1 A;  3KJK A;  5LOV A;  2LCA A;  4ZHQ A;  3G6E F;  3JAK A;  1YIJ F;  2QI2 A;  3IR9 A;  3WGJ A;  5EIB C;  3RYH B;  3T80 A;  3P0Z A;  2DT4 A;  1KQS F;  4G88 A;  5LOV B;  3J7A R;  1W5E A;  4DRX A;  1XV2 A;  3K0T A;  3BYQ A;  4BT7 A;  2AIZ P;  2GLZ A;  3CCE F;  3VCZ A;  1W41 A;  5FNV B;  2RHL A;  4EI8 A;  5GIO C;  2QTP A;  3LFO A;  3SIU A;  3S0W A;  2IG8 A;  5J2T A;  1VK3 A;  4G4X A;  1X7P A;  4EI7 A;  3VI6 A;  3I3F A;  3F0G A;  2VXY A;  4YJ3 B;  4X20 A;  5J2T B;  1U3P A;  4FFB A;  3KJJ A;  4WBN A;  2ALE A;  2JNB A;  3RYF A;  3HKE A;  3MCQ A;  2VGM A;  2LBT A;  5HWE A;  5G4V C;  2HRU A;  5EO3 A;  1H48 A;  2UYP A;  1XHO A;  3CC2 F;  4X1K A;  2HS3 A;  2H6L A;  3MBM A;  5EWR A;  5CA0 A;  1K9M H;  3N2K B;  4ZK7 A;  3CME F;  3LWO C;  2KGW A;  2WAL A;  3WPW A;  4HNA A;  3EOR A;  4O2B A;  2ZVY A;  3VIU A;  3C9U A;  4ZHW A;  2UYN B;  3IEQ A;  4X1I B;  3J81 M;  1SA0 A;  3N2G B;  2GZL A;  3ON1 A;  5B8F A;  3CCU F;  3CCR F;  3O85 A;  2AMT A;  1COM A;  1YJN F;  2P6Y A;  1YJ9 F;  1VHA A;  2KTU A;  1CLI A;  1VQ5 F;  3M1X A;  4B46 A;  5IJ9 B;  4G4Z A;  2FC3 A;  4LNU A;  3RYH A;  4EI9 A;  2HP0 B;  2VGN A;  5HY1 A;  2NMU A;  2GVI A;  3QHD A;  3TD5 A;  3CCJ F;  3HKD A;  1M90 H;  2F9Z C;  4TV9 A;  2HRY A;  4PWT A;  2FGY A;  1X25 A;  1FNK A;  4YJ2 B;  3HKD B;  5HP8 A;  5KMG B;  3S0Y A;  1W5F A;  4ZHQ B;  2LBW A;  4TUY B;  3ZP4 A;  1VQN F;  4O4L A;  1GO0 A;  5LYJ A;  1CK2 A;  3GHZ A;  3CPW F;  2H8E A;  1VH8 A;  5EYP A;  2R6R 1;  5EIB D;  3HKB B;  3E22 B;  3ERN A;  4C8I A;  1YI2 F;  1Q82 H;  3JAR A;  2ZOV A;  1W57 A;  5LXT B;  4I50 A;  3RYI B;  4YJ3 A;  1OAP A;  1XBI A;  5JCO C;  1KNK A;  2ZF8 A;  3RYF B;  4BT4 A;  4E6E A;  4B5C A;  4EB6 A;  1JFF B;  3KIZ A;  3KHN A;  3K2X A;  2I6D A;  1TVK A;  3FBA A;  3DDN A;  2QA4 F;  2ZOD A;  1W58 1;  5G4U C;  3WPX A;  5JH7 B;  5GIP C;  3JAS B;  4B45 A;  3P10 A;  3LME A;  3HJW C;  4ZI7 B;  3Q8H A;  3K14 A;  1GO1 A;  3D00 A;  3OBW A;  5JH7 A;  1SZQ A;  2QEX F;  3R0P A;  1PF5 A;  1KNJ A;  3WGN A;  1QVG F;  5DCV A;  2CSL A;  3MQW A;  4BVT A;  1W42 A;  4I55 A;  3VMF B;  1W55 A;  4O4I A;  4X3L A;  4X3M A;  5LP6 B;  3WGM A;  4G4W A;  3VO8 A;  2UYN A;  5EB1 B;  1W40 A;  5CA0 B;  2EWC A;  4NQ3 A;  3N2K A;  3NMU C;  3JAM M;  3N2G A;  2UYK A;  1IV3 A;  2BTU A;  4ZHV A;  4BVR A;  1VQV A;  3C8L A;  3QTY A;  1JN1 A;  3CMA F;  4BT3 A;  4X1Y A;  5FLX M;  2OTJ F;  1T0A A;  2MQE A;  3RYC B;  3QUW A;  2KG4 A;  3FPI A;  1QAH A;  5GON B;  1UFY A;  1VQ4 F;  4C4W C;  3WJP A;  4TV9 B;  3IEW A;  3JAK B;  4O4H B;  2VAW A;  5HY4 A;  3LYB A;  1YGY A;  2UYJ A;  3GTZ A;  1W2B F;  1YQN A;  2CHS A;  1RLU A;  1TUB A;  2I6R A;  1U40 A;  2ZVZ A;  4DRX B;  2RHH A;  2UZH A;  5IJ9 A;  1T0K B;  3FD6 A;  3JAW B;  3CC7 F;  5KX5 B;  2VAP A;  5LYJ B;  3ELC A;  3U0O A;  5MN4 A;  1FFX A;  3OBY A;  3RA6 A;  4BY9 D;  2VAM A;  3JAR B;  2G9I A;  2HP3 A;  3JAT B;  4ERH A;  1R1M A;  1YHQ F;  4I50 B;  4I4T A;  5A2Q M;  2Z1F A;  1U3L A;  4U39 A;  1QVF F;  2OTM A;  5KMG A;  4YJ2 A;  5HY2 A;  3VOB A;  3IKE A;  5HP7 A;  4BVQ A;  1FSZ A;  2HS0 A;  2W8B C;  3C9S A;  3JAT A;  4TUY A;  3CCV F;  1VQ9 F;  5FJ4 C;  5CA1 B;  4ZHY B;  5EYP B;  3HKB A;  1RLG A;  5LP6 C;  5LA6 B;  1RQ2 A;  3TD3 A;  1NJI H;  2Z01 A;  3E20 B;  5EAZ A;  5BMV B;  2HS4 A;  1W59 A;  3JAS A;  2Z1E A;  1X52 A;  2RHO A;  5J2U B;  5LA6 A;  4LCK A;  3JCM M;  5IJ0 A;  4X1K B;  5CB4 B;  1W5B A;  1JFF A;  3LWR C;  2YYE A;  3V3T A;  1YIT F;  3OW2 F;  3FFM A;  1QU9 A;  4O4J B;  3JAL A;  1YJW F;  3B6N A;  1DT9 A;  2ZAU A;  1J7H A;  4U3J A;  3S03 A;  2R75 1;  2RB9 A;  5C8Y B;  2V9Y A;  3ZP7 A;  1VQL F;  2CWJ A;  2HVY D;  1IV2 A;  3HKC B;  4BT2 A;  3VOA A;  4C81 A;  5FNV A;  4ZOL A;  1KD1 H;  3AGK A;  3MDO A;  3CCS F;  3F0F A;  1KC8 H;  5IYZ A;  3F0D A;  4IHJ B;  3P4E A;  4DXD A;  3RYC A;  2L26 A;  2K1S A;  3NK7 A;  3WGL A;  1JY8 A;  3VTI C;  1VQO F;  2N48 A;  3G71 F;  1M1K H;  2PHN A;  2IAF A;  2LBX A;  5EZY B;  4WBN B;  1Q8R A;  1K73 H;  3WGK A;  3D01 A;  3HKE B;  1Z5W A;  1TUB B;  4X1Y B;  3LDT A;  3JAW A;  5EZY A;  1Q7Y H;  2BTO A;  1GX1 A;  3CCM F;  3TD4 A;  3N4Y A;  4IIJ A;  1VQ7 F;  3NVK E;  3FD5 A;  4RQO A;  3F0E A;  4O4H A;  3WJQ A;  1DBF A;  4O4L B;  3VYS C;  1IV4 A;  1W5A A;  3S02 A;  3VYT C;  1ONI A;  3JVH A;  4F6R B;  5EB0 A;  3ZOP A;  3E22 A;  1VQK F;  1NMU B;  1ZWZ A;  5LXT A;  1CN7 A;  2CW4 A;  4TV8 B;  3I55 F;  1VQ8 F;  1ODE A;  4HNA B;  1OFU A;  2Q1Y A;  3V7E A;  3D54 A;  3S0H A;  1FFX B;  1XRG A;  2HQS C;  1K8A H;  1Q81 H;  3MCA B;  3IMP A;  1VQ6 F;  1W3E X;  4X1I A;  2DYY A;  2IQQ A;  3M4S A;  4EB6 B;  1FNJ A;  3LWQ C;  5MN5 A;  5ITZ B;  1VQM F;  5MN6 A;  3N4Z A;  3RE3 A;  5CB4 A;  3UT5 B;  3HTN A;  5AVM A;  5ITZ A;  3JAL B;  4O4J A;  2BTQ B;  4C82 A;  3C9R A;  3SIV A;  4U3J B;  5BMV A;  4BW0 B;  3C9T A;  2HP0 A;  5GAN K;  2HX0 A;  3DC2 A;  4NUT A;  5JQG B;  5JVD A;  4XCQ A;  4G4V A;  3NK6 A;  1H7M A;  2CZW A;  5JQG A;  1JJ2 F;  5JVD B;  5HY0 A;  4ZOL B;  1PXW A;  3L7Q A;  1GZ0 A;  3ESJ A;  4KWE A;  5IYZ B;  3GYQ A;  1JD1 A;  5C8Y A;  3J80 M;  3CCL F;  4C8G A;  4FFB B;  4BT5 A;  3OON A;  3I7T A;  2OTL F;  5HXU A;  3HKC A;  3RYI A;  2Q1X A;  4C8E A; 
#chains in the Genus database with same CATH homology
 1W42 A;  3VMF B;  5EO3 A;  3AGK A;  4X3L A;  4X3M A;  3CCS F;  3CC2 F;  1KC8 H;  3CG6 A;  2AIF A;  1W40 A;  5EWR A;  5GIN C;  1IPA A;  4NQ3 A;  1K9M H;  3NVI B;  3NMU C;  3JAM M;  3CME F;  3NK7 A;  3LWO C;  3I56 F;  1VQO F;  1VQP F;  3G71 F;  1M1K H;  3G4S F;  2WAL A;  5HXZ A;  2LBX A;  4BVR A;  1X7O A;  1K73 H;  3LWP C;  3CMA F;  3CPQ A;  5FLX M;  4TZZ A;  2OTJ F;  3PAF A;  2KG4 A;  3J81 M;  3CXC F;  1Q7Y H;  1RA4 A;  1VQ4 F;  3CCM F;  1VQ7 F;  4C4W C;  3N4Y A;  3NVK E;  3ON1 A;  1N8R H;  3CCU F;  3CCR F;  5HY4 A;  3HAX D;  3O85 A;  3V7Q A;  1YJN F;  1W2B F;  3PLA C;  2OHW A;  1YJ9 F;  2OZB A;  1SDS A;  3CC4 F;  2KTU A;  5IT9 M;  3WXM B;  1VQ5 F;  1VQK F;  1NMU B;  1ZWZ A;  1T0K B;  1CN7 A;  2KTV A;  3I55 F;  5GAP K;  1VQ8 F;  2FC3 A;  3LWV C;  3CC7 F;  3CD6 F;  4EI9 A;  3V7E A;  2VGN A;  5HY1 A;  1S72 F;  1E7K A;  3CCQ F;  3OBY A;  3CCJ F;  1Q86 H;  1K8A H;  3RA6 A;  1M90 H;  4BY9 D;  1Q81 H;  2F9Z C;  3MCA B;  4BVS A;  1VQ6 F;  1W3E X;  1YHQ F;  3RA5 A;  5A2Q M;  3E1Y A;  2FGY A;  1QVF F;  3LWQ C;  5HY2 A;  2BO1 A;  4BVQ A;  1VQM F;  5FJ4 C;  2LBW A;  3CCV F;  1VQ9 F;  3G6E F;  1VQN F;  3N4Z A;  1YIJ F;  2QI2 A;  3IR9 A;  1GO0 A;  1CK2 A;  3CPW F;  1RLG A;  1KQS F;  3J7A R;  1YI2 F;  1Q82 H;  1NJI H;  3SIV A;  4BW0 B;  3E20 B;  2GLZ A;  3CCE F;  5GAN K;  1W41 A;  1X52 A;  1XBI A;  4NUT A;  4EI8 A;  4LCK A;  3JCM M;  5GIO C;  4XCQ A;  3LFO A;  3LWR C;  3NK6 A;  3SIU A;  1H7M A;  3V3T A;  1YIT F;  3OW2 F;  3FFM A;  2CZW A;  1JJ2 F;  1YJW F;  5HY0 A;  1X7P A;  2I6D A;  1PXW A;  1DT9 A;  4EI7 A;  2QA4 F;  3VI6 A;  1GZ0 A;  5G4U C;  5GIP C;  3GYQ A;  3J80 M;  3CCL F;  3HJW C;  1GO1 A;  2ALE A;  2JNB A;  3D00 A;  5HXU A;  1VQL F;  2OTL F;  3OBW A;  5HWE A;  2VGM A;  5G4V C;  2HVY D;  2QEX F;  5DCV A;  1QVG F;  4BVT A;  1KD1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...