1PXWA

Crystal structure of l7ae srnp core protein from pyrococcus abyssii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
b'MEGWMMAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LSU ribosomal protein L7AE
publication title Purification, crystallization and preliminary X-ray diffraction data of L7Ae sRNP core protein from Pyrococcus abyssii.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosome
total genus 43
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1pxwA00
3J80M 3PAFA 3MCAB 4BY9D 2VGNA 3CXCF 3ON1A 2HVYD 1GO1A 3G4SF 5GIOC 1NMUB 3CCRF 1S72F 5GAPK 3CCUF 2ALEA 1DT9A 1CK2A 1XBIA 2KTUA 1NJIH 3CG6A 1VQ7F 5GANK 3NVKE 5GIPC 1Q81H 5FJ4C 2OTLF 3CC7F 1Q7YH 5DCVA 1YJWF 3LWOC 2LBXA 2BO1A 3GYQA 3VI6A 1SDSA 3CPWF 3CMEF 1E7KA 2VGMA 2KTVA 3N4YA 3G6EF 3NVIB 3LWVC 1W3EX 3OW2F 3IR9A 5EO3A 5G4VC 2OZBA 1H7MA 3NK7A 1KC8H 3JAMM 1W42A 3OBYA 3I56F 1RLGA 1GZ0A 1VQ9F 3N4ZA 5G4UC 1T0KB 1PXWA 2KG4A 1W41A 4TZZA 2CZWA 2QI2A 1N8RH 3PLAC 2AIFA 5GINC 5FLXM 2QA4F 3I55F 1W2BF 5EWRA 1VQ6F 1RA4A 1Q86H 3CC4F 1VQNF 3HAXD 2OHWA 3G71F 3CCMF 3J81M 3NK6A 3CPQA 3CCSF 3CCJF 3CCQF 3CCLF 3RA5A 3OBWA 4BW0B 5IT9M 1ZWZA 1K73H 1X7PA 3E20B 2QEXF 1VQPF 1K8AH 1KD1H 3LFOA 1CN7A 1YJ9F 1M90H 3LWQC 2I6DA 1VQ5F 1VQMF 4C4WC 1GO0A 4LCKA 1YI2F 3CCVF 1VQKF 5A2QM 3CMAF 1VQOF 1W40A 1VQLF 1X7OA 3WXMB 3VMFB 1YIJF 3LWPC 1VQ8F 1YHQF 1M1KH 1X52A 3NMUC 2WALA 3FFMA 3CCEF 3CD6F 3V7QA 3JCMM 1KQSF 3HJWC 1K9MH 3O85A 1YITF 3SIVA 2FC3A 2JNBA 4NUTA 3LWRC 1VQ4F 1JJ2F 1QVFF 1Q82H 2LBWA 1IPAA 3E1YA 3RA6A 2OTJF 1QVGF 3AGKA 4X3LA 3SIUA 1YJNF 4X3MA 3V7EA 3J7AR 3CC2F
chains in the Genus database with same CATH superfamily
5J2UB 1VK3A 3HKBA 3MCAB 4BY9D 2HVYD 3G4SF 3OONA 1NMUB 3FBAA 4I55A 2Q1YA 3CCUF 3DC2A 2ALEA 4G4XA 3VCZA 1NJIH 2K1SA 5KX5A 3NVKE 5HP8A 1U3LA 4BT2A 3KIZA 1PF5A 2OTLF 3RYHA 3QTYA 2DT4A 4G88A 2I6RA 5JH7A 3C9SA 4B45A 1SDSA 4IIJB 3IKEA 3CMEF 3CPWF 1W5EA 1E7KA 2VGMA 3S06A 1CLIA 4O4LA 5IJ9A 2OZBA 1H7MA 1IV3A 5MN5A 4X1KB 5LYJB 1RLGA 1W57A 2DYYA 4TUYB 2HQSC 3LYBA 3N4ZA 1JY8A 4IHJB 1ONIA 3JARB 4BT7A 4TZZA 4BVRA 2QI2A 4ZHYB 1N8RH 4O4JA 3PLAC 5GINC 4I50A 5FLXM 5JCOA 2QA4F 3KJJA 3CYQA 2YYEA 5EWRA 4HNAA 5LP6C 5LA6B 4FFBB 2R751 2BTOA 2OHWA 5IJ0B 1OAPA 3RYFB 1SZQA 2L26A 3CCJF 5CA0A 3MBMA 5IT9M 3M1XA 3I3FA 1SA0A 2RHJA 4O4HA 3KJKA 3LFOA 5CA1B 1M90H 4O2AB 4WBNB 3S0YA 4C4WC 4NWOB 3FPIA 1UFYA 4LCKA 1W40A 2QTPA 3MDOA 3JATA 4RQOA 2Q1XA 4O4IA 3HKBB 3CCEF 3HKDA 3O85A 3SIVA 3RE3A 1QU9A 1QAHA 5J2TA 4BT3A 4NQ3A 2V9YA 4I55B 2VAPA 1Q82H 3JAWA 2Z1EA 5C8YA 5KX5B 4B62A 2R6R1 3SIUA 3F0FA 1YJNF 2HS0A 4PWTA 3V7EA 2GVIA 3BYQA 3RYHB 3J7AR 4DRXA 3J80M 5JH7B 3C9UA 3ON1A 4C8GA 2AIZP 2Z1FA 1S72F 3F0DA 2HRYA 3RYCA 1JN1A 3JASA 4O4LB 5IJ9B 1YQNA 5B8FA 2LBTA 4U39A 3CG6A 1J7HA 5FJ4C 4F6RA 3WJQA 3GHZA 3FD5A 5DCVA 1Z5WA 1YJWF 4C82A 3N2GA 3GYQA 2W8BC 3HTNA 2HP3A 1W5BA 2KTVA 3NVIB 3WPWA 1X25A 5KMGA 1W3EX 4I50B 3OW2F 3NK7A 1KC8H 3I56F 1W42A 3OBYA 3KE1A 1GZ0A 2RHOA 4HNAB 2MQEA 2ZVYA 4X1YA 1JFFA 5HY1A 1T0KB 1PXWA 3N2KA 2KG4A 5CA0B 3S0HA 4B5CA 1W5AA 5EZYA 3MQWA 5AVMA 4EB6A 1SA0B 4O4HB 3K14A 5CB4A 2HS4A 4U3JA 1W5FA 1R1MA 4G4WA 2G9IA 4ZOLA 3UT5A 5FNVA 2FGYA 1COMA 2EWCA 2ZODA 1QD9A 1VH8A 2VAWA 3HAXD 1FSZA 2HRUA 3DDNA 3G71F 3J81M 3Q8HA 3CPQA 3CCSF 3CCLF 3RA5A 1ZWZA 3JATB 2BTQB 5HP7A 1T0AA 3C8LA 4O4IB 3C9TA 1K73H 1X7PA 3HKDB 2QEXF 1RLUA 3VYSC 4O2BA 2I6DA 2N48A 5J2TB 1VQMF 3JAWB 1W59A 5C8YB 3CCVF 1VQKF 5A2QM 3CMAF 5HY2A 4B46A 1VQLF 4BT5A 3VMFB 3ZOPA 1YIJF 3U0OA 5MN6A 1VQ8F 4DRXB 1YHQF 1M1KH 3JAKA 3NMUC 1XRGA 3FFMA 3CD6F 2B33A 2GZLA 3P4EA 1FNJA 1K9MH 2UYJA 2Z1UA 1H48A 3HKEA 2JNBA 2Z1TA 2VAMA 1U3PA 3I7TA 3K0TA 3LWRC 1JJ2F 5HXZA 3E1YA 3RYCB 3JASB 2ZAUA 5HXUA 3LDTA 1UI9A 3AGKA 3IMPA 4ERHA 4X3MA 4F6RB 5BMVA 2LCAA 5IYZA 2VGNA 3VO8A 5MN4A 1GO1A 1VHAA 3T80A 3TD5A 4BT4A 5KMGB 1U40A 3LMEA 1DT9A 1CK2A 4RHAA 3R0PA 5GANK 5GIPC 1DBFA 1Q81H 3CC7F 1XHOA 2RB9A 4KWEA 4X1YB 4IIJA 2RHHA 1JFFB 3GTZA 5EYPA 4BVSA 3N2KB 1Q7YH 3F0GA 3P0ZA 2LBXA 3HKCA 4ZHWA 3ESJA 3QUWA 2CVLA 5EZYB 3VI6A 4ZHVA 4EB6B 2HP0A 3N4YA 5CB4B 2ZOVA 4LNUA 4X1IA 4U3JB 4C8EA 4I4TA 3IR9A 3TD3A 5G4VC 2Z01A 3D54A 3UT5B 2UYNA 5LP6A 5FNVB 4ZI7A 5EIBD 4BVQA 2F9ZC 1FFXA 1W41A 3CB2A 3WGJA 2AIFA 5JVDA 2CHTA 2P6YA 5LOVA 3V3TA 3JALA 4E6EA 5IJ0A 4O2BB 3I55F 2H6LA 1W2BF 2AMTA 3S0WA 4O4JB 4TV8A 5GONA 1RA4A 3NK6A 5CA1A 1U43A 4BW0B 2H8CA 3JAKB 4G4YA 1H47A 3S03A 3E20B 4YJ3A 1K8AH 1KD1H 1CN7A 3HKEB 4YJ2A 5EB1B 1VQ5F 1GO0A 3D00A 4X20A 4ZK7A 2IG8A 2CHSA 1KNKA 3WXMB 5BMVB 5IYZB 4DXDA 3E22A 1OFUA 1XV2A 2IQQA 3IKFA 5LXTA 1YITF 3WPXA 2BTUA 3K2XA 4TV9A 2FC3A 3RYIA 4ZHQA 1VQVA 4G4VA 4NUTA 2HS3A 1VQ4F 3ERNA 5ITZA 1QVFF 1IPAA 4C8IA 5HY4A 3P10A 2UYKA 2OTJF 1TUBA 4M8IA 2VXYA 1Z5VA 3VOAA 5HWEA 1TVKA 3HWUA 4R40B 3V4DA 5EYPB 3CC2F 3K12A 2YXZA 3PAFA 5JQGA 2KGWA 3HKCB 3CXCF 3ZP4A 2CW4A 5GIOC 3TD4A 3CCRF 1IV2A 2HP0B 4LNUB 4X1IB 5EIBC 5GAPK 4BVTA 5EB0A 4I4TB 3VYTC 1XBIA 2KTUA 1VQ7F 2UYNB 5LP6B 4EI9A 4ZI7B 3M84A 1NQ3A 4EI8A 2OTMA 5J2UA 2RHLA 3KHNA 3ZO8A 3LWOC 2BO1A 3VOBA 1FFXB 3S02A 1ODEA 3D01A 1W581 5EAZA 1YGYA 1IV1A 3JVHA 3G6EF 3LWVC 5JVDB 3IEQA 5LOVB 3JALB 5EO3A 3VIUA 3N2GB 1FNKA 3F0EA 3JAMM 4TV8B 5GONB 2ZVZA 1VQ9F 5G4UC 3ELCA 3CYPB 2ZF8A 1GX1A 2NMUA 2CZWA 2GLZA 1W55A 4YJ3B 4XCQA 4YJ2B 3QHDA 4X1KA 5LYJA 3WGKA 3ZP7A 1VQ6F 1Q8RA 3WJRA 4TUYA 1Q86H 4X20B 2HX0A 3CC4F 1VQNF 4IHJA 3CCMF 4ZOLB 3JARA 3CCQF 3WGMA 3OBWA 2H8EA 2CWJA 3E22B 1KNJA 5LXTB 1VQPF 4ZHQB 4TV9B 3B6NA 3RYIB 1YJ9F 1IV4A 2PMPA 3LWQC 3WGNA 5ITZB 5LA6A 1YI2F 4FFBA 1VQOF 3EORA 1RQ7A 3RYFA 1TUBB 1X7OA 4C81A 1TVKB 3LWPC 3IEWA 3WGLA 1X52A 2UYPA 2WALA 4G4ZA 3HJWC 3V7QA 3JCMM 5JQGB 1KQSF 3WJPA 3C9RA 4O2AA 4WBNA 2LBWA 3FD6A 4BT6A 1JD1A 3RA6A 4EI7A 2UZHA 2IAFA 3MCQA 1QVGF 2PHNA 1RQ2A 3L7QA 3VYUC 2CSLA 4X3LA 3VTIC 5HY0A 5JCOC 3M4SA 3F6MA
chains in the Genus database with same CATH topology
3J80M 3PAFA 3MCAB 4BY9D 2VGNA 3CXCF 3ON1A 2HVYD 1GO1A 3G4SF 5GIOC 1NMUB 3CCRF 1S72F 5GAPK 3CCUF 4BVTA 2ALEA 1DT9A 1CK2A 1XBIA 2KTUA 1NJIH 3CG6A 1VQ7F 5GANK 3NVKE 5GIPC 4EI9A 1Q81H 5FJ4C 2OTLF 3CC7F 4EI8A 4BVSA 1Q7YH 5DCVA 1YJWF 3LWOC 2LBXA 2BO1A 3GYQA 3VI6A 1SDSA 3CPWF 3CMEF 1E7KA 2VGMA 2KTVA 3N4YA 3G6EF 3NVIB 3LWVC 1W3EX 3OW2F 3IR9A 5EO3A 5G4VC 2OZBA 1H7MA 3NK7A 1KC8H 3JAMM 1W42A 3OBYA 3I56F 1RLGA 1GZ0A 1VQ9F 3N4ZA 5G4UC 5HY1A 1T0KB 1PXWA 4BVQA 2KG4A 2F9ZC 1W41A 4TZZA 4BVRA 2CZWA 2QI2A 1N8RH 2GLZA 3PLAC 2AIFA 5GINC 5FLXM 4XCQA 3V3TA 2QA4F 3I55F 1W2BF 2FGYA 5EWRA 1VQ6F 1RA4A 1Q86H 3CC4F 1VQNF 3HAXD 2OHWA 3G71F 3CCMF 3J81M 3NK6A 3CPQA 3CCSF 3CCJF 3CCQF 3CCLF 3RA5A 3OBWA 4BW0B 5IT9M 1ZWZA 1K73H 1X7PA 3E20B 2QEXF 1VQPF 1K8AH 1KD1H 3LFOA 1CN7A 1YJ9F 1M90H 3LWQC 2I6DA 1VQ5F 1VQMF 4C4WC 1GO0A 4LCKA 1YI2F 3CCVF 3D00A 1VQKF 5A2QM 3CMAF 1VQOF 5HY2A 1W40A 1VQLF 1X7OA 3WXMB 3VMFB 1YIJF 3LWPC 1VQ8F 1YHQF 1M1KH 1X52A 3NMUC 2WALA 3FFMA 3CCEF 3CD6F 3V7QA 3JCMM 1KQSF 3HJWC 1K9MH 3O85A 1YITF 3SIVA 2FC3A 2JNBA 4NUTA 3LWRC 1VQ4F 1JJ2F 1QVFF 1Q82H 4NQ3A 1IPAA 2LBWA 5HXZA 3E1YA 5HY4A 3RA6A 4EI7A 2OTJF 1QVGF 5HXUA 3AGKA 4X3LA 5HY0A 3SIUA 1YJNF 4X3MA 5HWEA 3V7EA 3J7AR 3CC2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 M;  3PAF A;  3MCA B;  4BY9 D;  2VGN A;  3CXC F;  3ON1 A;  2HVY D;  1GO1 A;  3G4S F;  5GIO C;  1NMU B;  3CCR F;  1S72 F;  5GAP K;  3CCU F;  2ALE A;  1DT9 A;  1CK2 A;  1XBI A;  2KTU A;  1NJI H;  3CG6 A;  1VQ7 F;  5GAN K;  3NVK E;  5GIP C;  1Q81 H;  5FJ4 C;  2OTL F;  3CC7 F;  1Q7Y H;  5DCV A;  1YJW F;  3LWO C;  2LBX A;  2BO1 A;  3GYQ A;  3VI6 A;  1SDS A;  3CPW F;  3CME F;  1E7K A;  2VGM A;  2KTV A;  3N4Y A;  3G6E F;  3NVI B;  3LWV C;  1W3E X;  3OW2 F;  3IR9 A;  5EO3 A;  5G4V C;  2OZB A;  1H7M A;  3NK7 A;  1KC8 H;  3JAM M;  1W42 A;  3OBY A;  3I56 F;  1RLG A;  1GZ0 A;  1VQ9 F;  3N4Z A;  5G4U C;  1T0K B;  1PXW A;  2KG4 A;  1W41 A;  4TZZ A;  2CZW A;  2QI2 A;  1N8R H;  3PLA C;  2AIF A;  5GIN C;  5FLX M;  2QA4 F;  3I55 F;  1W2B F;  5EWR A;  1VQ6 F;  1RA4 A;  1Q86 H;  3CC4 F;  1VQN F;  3HAX D;  2OHW A;  3G71 F;  3CCM F;  3J81 M;  3NK6 A;  3CPQ A;  3CCS F;  3CCJ F;  3CCQ F;  3CCL F;  3RA5 A;  3OBW A;  4BW0 B;  5IT9 M;  1ZWZ A;  1K73 H;  1X7P A;  3E20 B;  2QEX F;  1VQP F;  1K8A H;  1KD1 H;  3LFO A;  1CN7 A;  1YJ9 F;  1M90 H;  3LWQ C;  2I6D A;  1VQ5 F;  1VQM F;  4C4W C;  1GO0 A;  4LCK A;  1YI2 F;  3CCV F;  1VQK F;  5A2Q M;  3CMA F;  1VQO F;  1W40 A;  1VQL F;  1X7O A;  3WXM B;  3VMF B;  1YIJ F;  3LWP C;  1VQ8 F;  1YHQ F;  1M1K H;  1X52 A;  3NMU C;  2WAL A;  3FFM A;  3CCE F;  3CD6 F;  3V7Q A;  3JCM M;  1KQS F;  3HJW C;  1K9M H;  3O85 A;  1YIT F;  3SIV A;  2FC3 A;  2JNB A;  4NUT A;  3LWR C;  1VQ4 F;  1JJ2 F;  1QVF F;  1Q82 H;  2LBW A;  1IPA A;  3E1Y A;  3RA6 A;  2OTJ F;  1QVG F;  3AGK A;  4X3L A;  3SIU A;  1YJN F;  4X3M A;  3V7E A;  3J7A R;  3CC2 F; 
#chains in the Genus database with same CATH topology
 5J2U B;  1VK3 A;  3HKB A;  3MCA B;  4BY9 D;  2HVY D;  3G4S F;  3OON A;  1NMU B;  3FBA A;  4I55 A;  2Q1Y A;  3CCU F;  3DC2 A;  2ALE A;  4G4X A;  3VCZ A;  1NJI H;  2K1S A;  5KX5 A;  3NVK E;  5HP8 A;  1U3L A;  4BT2 A;  3KIZ A;  1PF5 A;  2OTL F;  3RYH A;  3QTY A;  2DT4 A;  4G88 A;  2I6R A;  5JH7 A;  3C9S A;  4B45 A;  1SDS A;  4IIJ B;  3IKE A;  3CME F;  3CPW F;  1W5E A;  1E7K A;  2VGM A;  3S06 A;  1CLI A;  4O4L A;  5IJ9 A;  2OZB A;  1H7M A;  1IV3 A;  5MN5 A;  4X1K B;  5LYJ B;  1RLG A;  1W57 A;  2DYY A;  4TUY B;  2HQS C;  3LYB A;  3N4Z A;  1JY8 A;  4IHJ B;  1ONI A;  3JAR B;  4BT7 A;  4TZZ A;  4BVR A;  2QI2 A;  4ZHY B;  1N8R H;  4O4J A;  3PLA C;  5GIN C;  4I50 A;  5FLX M;  5JCO A;  2QA4 F;  3KJJ A;  3CYQ A;  2YYE A;  5EWR A;  4HNA A;  5LP6 C;  5LA6 B;  4FFB B;  2R75 1;  2BTO A;  2OHW A;  5IJ0 B;  1OAP A;  3RYF B;  1SZQ A;  2L26 A;  3CCJ F;  5CA0 A;  3MBM A;  5IT9 M;  3M1X A;  3I3F A;  1SA0 A;  2RHJ A;  4O4H A;  3KJK A;  3LFO A;  5CA1 B;  1M90 H;  4O2A B;  4WBN B;  3S0Y A;  4C4W C;  4NWO B;  3FPI A;  1UFY A;  4LCK A;  1W40 A;  2QTP A;  3MDO A;  3JAT A;  4RQO A;  2Q1X A;  4O4I A;  3HKB B;  3CCE F;  3HKD A;  3O85 A;  3SIV A;  3RE3 A;  1QU9 A;  1QAH A;  5J2T A;  4BT3 A;  4NQ3 A;  2V9Y A;  4I55 B;  2VAP A;  1Q82 H;  3JAW A;  2Z1E A;  5C8Y A;  5KX5 B;  4B62 A;  2R6R 1;  3SIU A;  3F0F A;  1YJN F;  2HS0 A;  4PWT A;  3V7E A;  2GVI A;  3BYQ A;  3RYH B;  3J7A R;  4DRX A;  3J80 M;  5JH7 B;  3C9U A;  3ON1 A;  4C8G A;  2AIZ P;  2Z1F A;  1S72 F;  3F0D A;  2HRY A;  3RYC A;  1JN1 A;  3JAS A;  4O4L B;  5IJ9 B;  1YQN A;  5B8F A;  2LBT A;  4U39 A;  3CG6 A;  1J7H A;  5FJ4 C;  4F6R A;  3WJQ A;  3GHZ A;  3FD5 A;  5DCV A;  1Z5W A;  1YJW F;  4C82 A;  3N2G A;  3GYQ A;  2W8B C;  3HTN A;  2HP3 A;  1W5B A;  2KTV A;  3NVI B;  3WPW A;  1X25 A;  5KMG A;  1W3E X;  4I50 B;  3OW2 F;  3NK7 A;  1KC8 H;  3I56 F;  1W42 A;  3OBY A;  3KE1 A;  1GZ0 A;  2RHO A;  4HNA B;  2MQE A;  2ZVY A;  4X1Y A;  1JFF A;  5HY1 A;  1T0K B;  1PXW A;  3N2K A;  2KG4 A;  5CA0 B;  3S0H A;  4B5C A;  1W5A A;  5EZY A;  3MQW A;  5AVM A;  4EB6 A;  1SA0 B;  4O4H B;  3K14 A;  5CB4 A;  2HS4 A;  4U3J A;  1W5F A;  1R1M A;  4G4W A;  2G9I A;  4ZOL A;  3UT5 A;  5FNV A;  2FGY A;  1COM A;  2EWC A;  2ZOD A;  1QD9 A;  1VH8 A;  2VAW A;  3HAX D;  1FSZ A;  2HRU A;  3DDN A;  3G71 F;  3J81 M;  3Q8H A;  3CPQ A;  3CCS F;  3CCL F;  3RA5 A;  1ZWZ A;  3JAT B;  2BTQ B;  5HP7 A;  1T0A A;  3C8L A;  4O4I B;  3C9T A;  1K73 H;  1X7P A;  3HKD B;  2QEX F;  1RLU A;  3VYS C;  4O2B A;  2I6D A;  2N48 A;  5J2T B;  1VQM F;  3JAW B;  1W59 A;  5C8Y B;  3CCV F;  1VQK F;  5A2Q M;  3CMA F;  5HY2 A;  4B46 A;  1VQL F;  4BT5 A;  3VMF B;  3ZOP A;  1YIJ F;  3U0O A;  5MN6 A;  1VQ8 F;  4DRX B;  1YHQ F;  1M1K H;  3JAK A;  3NMU C;  1XRG A;  3FFM A;  3CD6 F;  2B33 A;  2GZL A;  3P4E A;  1FNJ A;  1K9M H;  2UYJ A;  2Z1U A;  1H48 A;  3HKE A;  2JNB A;  2Z1T A;  2VAM A;  1U3P A;  3I7T A;  3K0T A;  3LWR C;  1JJ2 F;  5HXZ A;  3E1Y A;  3RYC B;  3JAS B;  2ZAU A;  5HXU A;  3LDT A;  1UI9 A;  3AGK A;  3IMP A;  4ERH A;  4X3M A;  4F6R B;  5BMV A;  2LCA A;  5IYZ A;  2VGN A;  3VO8 A;  5MN4 A;  1GO1 A;  1VHA A;  3T80 A;  3TD5 A;  4BT4 A;  5KMG B;  1U40 A;  3LME A;  1DT9 A;  1CK2 A;  4RHA A;  3R0P A;  5GAN K;  5GIP C;  1DBF A;  1Q81 H;  3CC7 F;  1XHO A;  2RB9 A;  4KWE A;  4X1Y B;  4IIJ A;  2RHH A;  1JFF B;  3GTZ A;  5EYP A;  4BVS A;  3N2K B;  1Q7Y H;  3F0G A;  3P0Z A;  2LBX A;  3HKC A;  4ZHW A;  3ESJ A;  3QUW A;  2CVL A;  5EZY B;  3VI6 A;  4ZHV A;  4EB6 B;  2HP0 A;  3N4Y A;  5CB4 B;  2ZOV A;  4LNU A;  4X1I A;  4U3J B;  4C8E A;  4I4T A;  3IR9 A;  3TD3 A;  5G4V C;  2Z01 A;  3D54 A;  3UT5 B;  2UYN A;  5LP6 A;  5FNV B;  4ZI7 A;  5EIB D;  4BVQ A;  2F9Z C;  1FFX A;  1W41 A;  3CB2 A;  3WGJ A;  2AIF A;  5JVD A;  2CHT A;  2P6Y A;  5LOV A;  3V3T A;  3JAL A;  4E6E A;  5IJ0 A;  4O2B B;  3I55 F;  2H6L A;  1W2B F;  2AMT A;  3S0W A;  4O4J B;  4TV8 A;  5GON A;  1RA4 A;  3NK6 A;  5CA1 A;  1U43 A;  4BW0 B;  2H8C A;  3JAK B;  4G4Y A;  1H47 A;  3S03 A;  3E20 B;  4YJ3 A;  1K8A H;  1KD1 H;  1CN7 A;  3HKE B;  4YJ2 A;  5EB1 B;  1VQ5 F;  1GO0 A;  3D00 A;  4X20 A;  4ZK7 A;  2IG8 A;  2CHS A;  1KNK A;  3WXM B;  5BMV B;  5IYZ B;  4DXD A;  3E22 A;  1OFU A;  1XV2 A;  2IQQ A;  3IKF A;  5LXT A;  1YIT F;  3WPX A;  2BTU A;  3K2X A;  4TV9 A;  2FC3 A;  3RYI A;  4ZHQ A;  1VQV A;  4G4V A;  4NUT A;  2HS3 A;  1VQ4 F;  3ERN A;  5ITZ A;  1QVF F;  1IPA A;  4C8I A;  5HY4 A;  3P10 A;  2UYK A;  2OTJ F;  1TUB A;  4M8I A;  2VXY A;  1Z5V A;  3VOA A;  5HWE A;  1TVK A;  3HWU A;  4R40 B;  3V4D A;  5EYP B;  3CC2 F;  3K12 A;  2YXZ A;  3PAF A;  5JQG A;  2KGW A;  3HKC B;  3CXC F;  3ZP4 A;  2CW4 A;  5GIO C;  3TD4 A;  3CCR F;  1IV2 A;  2HP0 B;  4LNU B;  4X1I B;  5EIB C;  5GAP K;  4BVT A;  5EB0 A;  4I4T B;  3VYT C;  1XBI A;  2KTU A;  1VQ7 F;  2UYN B;  5LP6 B;  4EI9 A;  4ZI7 B;  3M84 A;  1NQ3 A;  4EI8 A;  2OTM A;  5J2U A;  2RHL A;  3KHN A;  3ZO8 A;  3LWO C;  2BO1 A;  3VOB A;  1FFX B;  3S02 A;  1ODE A;  3D01 A;  1W58 1;  5EAZ A;  1YGY A;  1IV1 A;  3JVH A;  3G6E F;  3LWV C;  5JVD B;  3IEQ A;  5LOV B;  3JAL B;  5EO3 A;  3VIU A;  3N2G B;  1FNK A;  3F0E A;  3JAM M;  4TV8 B;  5GON B;  2ZVZ A;  1VQ9 F;  5G4U C;  3ELC A;  3CYP B;  2ZF8 A;  1GX1 A;  2NMU A;  2CZW A;  2GLZ A;  1W55 A;  4YJ3 B;  4XCQ A;  4YJ2 B;  3QHD A;  4X1K A;  5LYJ A;  3WGK A;  3ZP7 A;  1VQ6 F;  1Q8R A;  3WJR A;  4TUY A;  1Q86 H;  4X20 B;  2HX0 A;  3CC4 F;  1VQN F;  4IHJ A;  3CCM F;  4ZOL B;  3JAR A;  3CCQ F;  3WGM A;  3OBW A;  2H8E A;  2CWJ A;  3E22 B;  1KNJ A;  5LXT B;  1VQP F;  4ZHQ B;  4TV9 B;  3B6N A;  3RYI B;  1YJ9 F;  1IV4 A;  2PMP A;  3LWQ C;  3WGN A;  5ITZ B;  5LA6 A;  1YI2 F;  4FFB A;  1VQO F;  3EOR A;  1RQ7 A;  3RYF A;  1TUB B;  1X7O A;  4C81 A;  1TVK B;  3LWP C;  3IEW A;  3WGL A;  1X52 A;  2UYP A;  2WAL A;  4G4Z A;  3HJW C;  3V7Q A;  3JCM M;  5JQG B;  1KQS F;  3WJP A;  3C9R A;  4O2A A;  4WBN A;  2LBW A;  3FD6 A;  4BT6 A;  1JD1 A;  3RA6 A;  4EI7 A;  2UZH A;  2IAF A;  3MCQ A;  1QVG F;  2PHN A;  1RQ2 A;  3L7Q A;  3VYU C;  2CSL A;  4X3L A;  3VTI C;  5HY0 A;  5JCO C;  3M4S A;  3F6M A; 
#chains in the Genus database with same CATH homology
 3J80 M;  3PAF A;  3MCA B;  4BY9 D;  2VGN A;  3CXC F;  3ON1 A;  2HVY D;  1GO1 A;  3G4S F;  5GIO C;  1NMU B;  3CCR F;  1S72 F;  5GAP K;  3CCU F;  4BVT A;  2ALE A;  1DT9 A;  1CK2 A;  1XBI A;  2KTU A;  1NJI H;  3CG6 A;  1VQ7 F;  5GAN K;  3NVK E;  5GIP C;  4EI9 A;  1Q81 H;  5FJ4 C;  2OTL F;  3CC7 F;  4EI8 A;  4BVS A;  1Q7Y H;  5DCV A;  1YJW F;  3LWO C;  2LBX A;  2BO1 A;  3GYQ A;  3VI6 A;  1SDS A;  3CPW F;  3CME F;  1E7K A;  2VGM A;  2KTV A;  3N4Y A;  3G6E F;  3NVI B;  3LWV C;  1W3E X;  3OW2 F;  3IR9 A;  5EO3 A;  5G4V C;  2OZB A;  1H7M A;  3NK7 A;  1KC8 H;  3JAM M;  1W42 A;  3OBY A;  3I56 F;  1RLG A;  1GZ0 A;  1VQ9 F;  3N4Z A;  5G4U C;  5HY1 A;  1T0K B;  1PXW A;  4BVQ A;  2KG4 A;  2F9Z C;  1W41 A;  4TZZ A;  4BVR A;  2CZW A;  2QI2 A;  1N8R H;  2GLZ A;  3PLA C;  2AIF A;  5GIN C;  5FLX M;  4XCQ A;  3V3T A;  2QA4 F;  3I55 F;  1W2B F;  2FGY A;  5EWR A;  1VQ6 F;  1RA4 A;  1Q86 H;  3CC4 F;  1VQN F;  3HAX D;  2OHW A;  3G71 F;  3CCM F;  3J81 M;  3NK6 A;  3CPQ A;  3CCS F;  3CCJ F;  3CCQ F;  3CCL F;  3RA5 A;  3OBW A;  4BW0 B;  5IT9 M;  1ZWZ A;  1K73 H;  1X7P A;  3E20 B;  2QEX F;  1VQP F;  1K8A H;  1KD1 H;  3LFO A;  1CN7 A;  1YJ9 F;  1M90 H;  3LWQ C;  2I6D A;  1VQ5 F;  1VQM F;  4C4W C;  1GO0 A;  4LCK A;  1YI2 F;  3CCV F;  3D00 A;  1VQK F;  5A2Q M;  3CMA F;  1VQO F;  5HY2 A;  1W40 A;  1VQL F;  1X7O A;  3WXM B;  3VMF B;  1YIJ F;  3LWP C;  1VQ8 F;  1YHQ F;  1M1K H;  1X52 A;  3NMU C;  2WAL A;  3FFM A;  3CCE F;  3CD6 F;  3V7Q A;  3JCM M;  1KQS F;  3HJW C;  1K9M H;  3O85 A;  1YIT F;  3SIV A;  2FC3 A;  2JNB A;  4NUT A;  3LWR C;  1VQ4 F;  1JJ2 F;  1QVF F;  1Q82 H;  4NQ3 A;  1IPA A;  2LBW A;  5HXZ A;  3E1Y A;  5HY4 A;  3RA6 A;  4EI7 A;  2OTJ F;  1QVG F;  5HXU A;  3AGK A;  4X3L A;  5HY0 A;  3SIU A;  1YJN F;  4X3M A;  5HWE A;  3V7E A;  3J7A R;  3CC2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...