1PXWA

Crystal structure of l7ae srnp core protein from pyrococcus abyssii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
MEGWMMAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords LSU ribosomal protein L7AE
publication title Purification, crystallization and preliminary X-ray diffraction data of L7Ae sRNP core protein from Pyrococcus abyssii.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 43
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1pxwA00
3NVIB 1VQNF 1X7OA 5GINC 3LWPC 3CCVF 1K8AH 5EO3A 3LWOC 3NK6A 1W42A 1Q81H 3J80M 1YJ9F 1YIJF 1VQLF 3PAFA 4NUTA 1RLGA 1N8RH 2OZBA 2KTVA 3PLAC 3CCQF 1W3EX 1S72F 5DCVA 2VGNA 3VI6A 3LWVC 2HVYD 5FJ4C 3OBYA 3LFOA 1K9MH 3J7AR 3N4ZA 3CCRF 2VGMA 5IT9M 3LWRC 1GZ0A 3NMUC 1W41A 3O85A 1CK2A 1NMUB 1VQKF 3NK7A 3CCSF 1QVFF 1E7KA 3WXMB 1CN7A 3RA6A 4BY9D 3ON1A 5G4UC 1T0KB 3V7QA 3AGKA 5G4VC 3CC4F 3CC2F 1VQ7F 3CCMF 3I56F 2LBXA 3E1YA 2WALA 4BW0B 1XBIA 1GO1A 2QEXF 1VQ8F 4LCKA 3LWQC 1NJIH 1X7PA 1DT9A 2LBWA 3HAXD 5GIPC 2QA4F 1M90H 1IPAA 3CMEF 1Q82H 3CG6A 3RA5A 3SIUA 3G6EF 3OW2F 1YI2F 1VQ4F 1M1KH 1VQOF 1SDSA 2BO1A 3E20B 1KD1H 3CMAF 5EWRA 3CCJF 3JCMM 1KQSF 3FFMA 3IR9A 4X3LA 1W2BF 1VQ9F 3I55F 1QVGF 1VQPF 5A2QM 1X52A 5GIOC 3CPWF 1ZWZA 1W40A 3OBWA 1GO0A 5FLXM 2JNBA 1YHQF 3MCAB 2FC3A 1YITF 4X3MA 2I6DA 1YJNF 1RA4A 1Q7YH 1VQ5F 3SIVA 2ALEA 3VMFB 2QI2A 1KC8H 3CD6F 3GYQA 1PXWA 4C4WC 3G71F 2OTLF 3CCEF 1VQMF 5GAPK 2OTJF 5GANK 4TZZA 3CCUF 2KG4A 1Q86H 1JJ2F 3HJWC 3V7EA 2CZWA 3JAMM 2AIFA 3NVKE 3N4YA 1H7MA 3CPQA 2KTUA 3CCLF 2OHWA 3J81M 3G4SF 3CC7F 3CXCF 1VQ6F 1YJWF 1K73H
chains in the Genus database with same CATH superfamily
4IIJA 3NVIB 3VIUA 4TUYB 4ERHA 2Z1UA 3LWOC 3F6MA 1Q81H 3J80M 1VQLF 5KX5B 1S72F 1TVKA 3JATA 1T0AA 2VGNA 2HVYD 3OBYA 2MQEA 4ZHQB 1K9MH 3IEQA 2BTOA 3D01A 2Z1EA 2UYNB 3KIZA 5GONB 5IJ9B 3LWRC 3WPWA 1GZ0A 1QD9A 4BT3A 4ZOLA 5EIBD 5AVMA 4ZK7A 5FNVB 3WJPA 3CCSF 3JAWA 3WXMB 3CB2A 1H48A 3RA6A 5JH7B 1W5BA 4C81A 2DT4A 4BT7A 2NMUA 3T80A 2L26A 3CC2F 3C8LA 3JAKB 5CA0B 3L7QA 5CB4B 2WALA 3GTZA 1RQ2A 4DRXA 4PWTA 4X1YB 2AIZP 3KHNA 3GHZA 4B62A 3MBMA 1IPAA 3N2GA 1Q82H 2Z1TA 2ZVZA 3CG6A 1FFXA 2CWJA 3ESJA 1CLIA 5J2UA 1M1KH 1VK3A 2BO1A 1Q8RA 2AMTA 5HY2A 2GLZA 2VAMA 1H47A 1UI9A 2HP0B 3K0TA 1Z5WA 3VOBA 4NQ3A 3HKEB 2EWCA 5ITZA 3C9RA 3S03A 4BVTA 1GO0A 1RLUA 2LCAA 2VAPA 3JALA 2JNBA 3Q8HA 2VXYA 3VOAA 3ZP7A 1YITF 1YJNF 2DYYA 2RHHA 4RQOA 3SIVA 5MN6A 1KNJA 5J2TA 2Z01A 3WJQA 4XCQA 1KC8H 1W5FA 3N2GB 2UYPA 5HY1A 3M84A 1VQMF 3RYHB 3FD6A 4TZZA 4TUYA 1SA0B 2KG4A 4X1IB 5EB0A 1Z5VA 3P10A 3ZO8A 4E6EA 1JJ2F 3N4YA 1H7MA 1JY8A 2KTUA 3KE1A 3C9UA 5KMGB 1JD1A 1YJWF 4YJ2A 5IJ0A 5LXTB 3QUWA 5KX5A 1X7OA 1VQNF 1U43A 5ITZB 2VAWA 4EI9A 3CCVF 4C8GA 4ZHQA 1VQVA 3WJRA 5EO3A 1VH8A 5IJ9A 2IQQA 4NUTA 1RLGA 2OZBA 4BT4A 2UYJA 1W3EX 2Q1YA 4EB6A 2HQSC 4BVQA 4B5CA 2G9IA 3VI6A 5FJ4C 3N4ZA 5JH7A 2R751 3CCRF 1XHOA 3VYUC 4ZHVA 4HNAA 5HXUA 2H6LA 3JAKA 2CVLA 5CB4A 4X1YA 5EYPB 1W5EA 1E7KA 1QVFF 4X20A 1CN7A 2FGYA 4U3JA 2CHSA 1T0KB 4FFBB 3AGKA 4RHAA 3K14A 4I50B 3CC4F 3JASB 4YJ2B 2PHNA 5IJ0B 3I56F 2ZOVA 3CCMF 4BW0B 3LYBA 2ZODA 1W57A 1VQ8F 1IV4A 2LBTA 1X7PA 3F0GA 2QA4F 1M90H 2HP0A 3RYCB 4I4TB 3HKEA 3SIUA 4EB6B 3E20B 3FD5A 2YYEA 3V4DA 3JARA 3ERNA 3IR9A 1ODEA 1FSZA 4HNAB 4X3LA 1YGYA 4G88A 1VQPF 2HS4A 1FNKA 1ZWZA 3OBWA 1IV1A 4X20B 2W8BC 5FLXM 1IV3A 3IKFA 3MCQA 4U3JB 1GX1A 2FC3A 3F0DA 1SZQA 1NQ3A 2R6R1 4LNUA 3RYIB 3TD3A 5EZYB 3RYHA 4BVSA 5JVDB 1SA0A 4X1IA 4C4WC 3LMEA 5HY0A 5C8YB 5KMGA 2ZF8A 3G71F 3ZOPA 2OTLF 2N48A 3CCEF 5LXTA 3S06A 3DC2A 4I55A 3HTNA 1Q86H 3HJWC 2Q1XA 3V7EA 2CZWA 3S0YA 3QHDA 1W55A 3CPQA 3CCLF 3TD5A 3J81M 3G4SF 3CC7F 1VQ6F 5LP6C 2B33A 1W59A 3JARB 4X1KA 1JFFB 4BVRA 3HKBB 5MN4A 1UFYA 5GINC 2V9YA 3ZP4A 1K8AH 3E22A 1W42A 5EB1B 1YJ9F 3PAFA 4ZHYB 1N8RH 2KTVA 3PLAC 2IAFA 4LNUB 5DCVA 1YQNA 5HP8A 2KGWA 4O4HB 4O4IB 3UT5B 3P4EA 5LP6B 3LWVC 4KWEA 2PMPA 5EYPA 3LFOA 2F9ZC 3RYFB 4ZI7B 2OTMA 5IT9M 4FFBA 1KNKA 5EIBC 3NMUC 4I50A 3JASA 1W41A 3O85A 1W581 2K1SA 1VQKF 3NK7A 4O2AB 1U40A 4I55B 3IMPA 4BY9D 5G4UC 3B6NA 5MN5A 3V7QA 3HWUA 3RYCA 4X1KB 5JCOC 1IV2A 4I4TA 2IG8A 4R40B 4BT2A 4BT6A 1U3PA 4O4LB 4G4VA 1GO1A 3TD4A 3ELCA 3VO8A 5LYJB 2QEXF 4LCKA 1NJIH 4TV9B 3E22B 2LBWA 3HAXD 5GIPC 4O2BA 4ZHWA 3I7TA 5CA1A 3VYTC 5EAZA 3CMEF 4DXDA 3K12A 2HP3A 1U3LA 5HY4A 4C8IA 1YI2F 1VQ4F 2Z1FA 3D54A 2YXZA 1KD1H 3CMAF 2HS3A 1KQSF 3S0HA 3R0PA 4O4JB 4G4XA 1VQ9F 3RYIA 5EZYA 5GIOC 3CPWF 3F0FA 2CHTA 5JVDA 1OAPA 3WGKA 1DBFA 3MCAB 1ONIA 5C8YA 4X3MA 1RA4A 2GZLA 2RHOA 2QI2A 3M4SA 1TUBB 1W5AA 4YJ3A 3FPIA 4WBNA 1VHAA 3KJJA 3I3FA 3GYQA 2HS0A 3CD6F 4G4YA 4O2BB 3S0WA 3WGMA 5CA1B 1JFFA 5HWEA 3HKBA 3WGLA 5GAPK 4G4WA 2CW4A 3OONA 5GANK 3CCUF 2OTJF 3JAMM 2OHWA 1QAHA 3CXCF 1QVGF 2RHLA 1K73H 3N2KA 5HXZA 2H8CA 3C9TA 4F6RB 3LWPC 4IHJB 4O4IA 4O4HA 3UT5A 5JQGA 5LP6A 3HKCB 1FNJA 3RYFA 4ZI7A 5LOVB 5LA6B 3NK6A 1YIJF 4IIJB 3CCQF 2GVIA 3F0EA 4O2AA 3J7AR 4G4ZA 4YJ3B 4WBNB 4C8EA 2VGMA 4U39A 2P6YA 5IYZA 3WGNA 3U0OA 5BMVA 2HRUA 1TVKB 3JATB 1CK2A 1NMUB 2BTUA 5B8FA 4O4LA 5LYJA 3ON1A 3CYPB 4B45A 3VYSC 4TV9A 4ZOLB 5G4VC 1VQ7F 4M8IA 3BYQA 3IKEA 3N2KB 2CSLA 2LBXA 3E1YA 1XV2A 3D00A 4NWOB 3WPXA 1XBIA 1R1MA 3JAWB 3WGJA 5JQGB 1JN1A 5JCOA 3LWQC 4C82A 1DT9A 3JVHA 4O4JA 4TV8A 3RA5A 3P0ZA 3G6EF 3OW2F 4DRXB 4EI7A 1VQOF 3HKDA 1SDSA 3MDOA 3VTIC 1X25A 1QU9A 2BTQB 2H8EA 5EWRA 3CCJF 3JCMM 3VCZA 3FFMA 5IYZB 1OFUA 2QTPA 1FFXB 3QTYA 5BMVB 3C9SA 3I55F 1W2BF 4B46A 1X52A 5J2UB 5A2QM 3V3TA 2ZAUA 1W40A 1TUBA 1PF5A 4BT5A 2RHJA 3K2XA 3CYQA 1COMA 1YHQF 2ZVYA 3IEWA 1J7HA 1RQ7A 2RB9A 2I6DA 3RE3A 1Q7YH 3EORA 1VQ5F 2ALEA 3VMFB 2UYKA 2HRYA 3M1XA 2I6RA 3KJKA 3FBAA 2HX0A 3JALB 2UYNA 5GONA 1PXWA 2UZHA 3S02A 4TV8B 5J2TB 3DDNA 4F6RA 5FNVA 4IHJA 3HKDB 5HP7A 3HKCA 2AIFA 3NVKE 3MQWA 5LOVA 1XRGA 4EI8A 5LA6A 5CA0A 3LDTA
chains in the Genus database with same CATH topology
5HXZA 3NVIB 1VQNF 1X7OA 5GINC 3LWPC 4EI9A 3CCVF 1K8AH 5EO3A 3LWOC 3NK6A 1W42A 1Q81H 3J80M 1YJ9F 1YIJF 1VQLF 3PAFA 4NUTA 1RLGA 1N8RH 2OZBA 2KTVA 3PLAC 3CCQF 1W3EX 1S72F 5DCVA 4BVQA 2VGNA 3VI6A 3LWVC 2HVYD 5FJ4C 3OBYA 3LFOA 1K9MH 3J7AR 3N4ZA 2F9ZC 3CCRF 2VGMA 5IT9M 3LWRC 1GZ0A 3NMUC 5HXUA 1W41A 3O85A 1CK2A 1NMUB 1VQKF 3NK7A 3CCSF 1QVFF 1E7KA 3WXMB 1CN7A 3RA6A 2FGYA 4BY9D 3ON1A 5G4UC 1T0KB 3V7QA 3AGKA 5G4VC 3CC4F 3CC2F 1VQ7F 3CCMF 3I56F 2LBXA 3E1YA 2WALA 3D00A 4BW0B 1XBIA 1GO1A 2QEXF 1VQ8F 4LCKA 3LWQC 1NJIH 1X7PA 1DT9A 2LBWA 3HAXD 5GIPC 2QA4F 1M90H 1IPAA 3CMEF 1Q82H 3CG6A 3RA5A 5HY4A 3SIUA 3G6EF 3OW2F 1YI2F 1VQ4F 1M1KH 4EI7A 1VQOF 1SDSA 2BO1A 3E20B 5HY2A 1KD1H 3CMAF 2GLZA 5EWRA 3CCJF 3JCMM 1KQSF 3FFMA 3IR9A 4X3LA 4NQ3A 1W2BF 1VQ9F 3I55F 1QVGF 1VQPF 5A2QM 1X52A 5GIOC 3V3TA 3CPWF 1ZWZA 1W40A 3OBWA 4BVTA 1GO0A 2JNBA 5FLXM 1YHQF 3MCAB 2FC3A 1YITF 4X3MA 2I6DA 1YJNF 1RA4A 1Q7YH 1VQ5F 3SIVA 2ALEA 3VMFB 2QI2A 4BVSA 4XCQA 1KC8H 3CD6F 3GYQA 1PXWA 5HY0A 4C4WC 3G71F 2OTLF 5HWEA 5HY1A 3CCEF 1VQMF 5GAPK 2OTJF 5GANK 4TZZA 3CCUF 2KG4A 1Q86H 1JJ2F 3HJWC 3V7EA 2CZWA 3JAMM 2AIFA 3NVKE 3N4YA 1H7MA 3CPQA 2KTUA 3CCLF 2OHWA 3J81M 4EI8A 3G4SF 3CC7F 3CXCF 1VQ6F 1YJWF 1K73H 4BVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVI B;  1VQN F;  1X7O A;  5GIN C;  3LWP C;  3CCV F;  1K8A H;  5EO3 A;  3LWO C;  3NK6 A;  1W42 A;  1Q81 H;  3J80 M;  1YJ9 F;  1YIJ F;  1VQL F;  3PAF A;  4NUT A;  1RLG A;  1N8R H;  2OZB A;  2KTV A;  3PLA C;  3CCQ F;  1W3E X;  1S72 F;  5DCV A;  2VGN A;  3VI6 A;  3LWV C;  2HVY D;  5FJ4 C;  3OBY A;  3LFO A;  1K9M H;  3J7A R;  3N4Z A;  3CCR F;  2VGM A;  5IT9 M;  3LWR C;  1GZ0 A;  3NMU C;  1W41 A;  3O85 A;  1CK2 A;  1NMU B;  1VQK F;  3NK7 A;  3CCS F;  1QVF F;  1E7K A;  3WXM B;  1CN7 A;  3RA6 A;  4BY9 D;  3ON1 A;  5G4U C;  1T0K B;  3V7Q A;  3AGK A;  5G4V C;  3CC4 F;  3CC2 F;  1VQ7 F;  3CCM F;  3I56 F;  2LBX A;  3E1Y A;  2WAL A;  4BW0 B;  1XBI A;  1GO1 A;  2QEX F;  1VQ8 F;  4LCK A;  3LWQ C;  1NJI H;  1X7P A;  1DT9 A;  2LBW A;  3HAX D;  5GIP C;  2QA4 F;  1M90 H;  1IPA A;  3CME F;  1Q82 H;  3CG6 A;  3RA5 A;  3SIU A;  3G6E F;  3OW2 F;  1YI2 F;  1VQ4 F;  1M1K H;  1VQO F;  1SDS A;  2BO1 A;  3E20 B;  1KD1 H;  3CMA F;  5EWR A;  3CCJ F;  3JCM M;  1KQS F;  3FFM A;  3IR9 A;  4X3L A;  1W2B F;  1VQ9 F;  3I55 F;  1QVG F;  1VQP F;  5A2Q M;  1X52 A;  5GIO C;  3CPW F;  1ZWZ A;  1W40 A;  3OBW A;  1GO0 A;  5FLX M;  2JNB A;  1YHQ F;  3MCA B;  2FC3 A;  1YIT F;  4X3M A;  2I6D A;  1YJN F;  1RA4 A;  1Q7Y H;  1VQ5 F;  3SIV A;  2ALE A;  3VMF B;  2QI2 A;  1KC8 H;  3CD6 F;  3GYQ A;  1PXW A;  4C4W C;  3G71 F;  2OTL F;  3CCE F;  1VQM F;  5GAP K;  2OTJ F;  5GAN K;  4TZZ A;  3CCU F;  2KG4 A;  1Q86 H;  1JJ2 F;  3HJW C;  3V7E A;  2CZW A;  3JAM M;  2AIF A;  3NVK E;  3N4Y A;  1H7M A;  3CPQ A;  2KTU A;  3CCL F;  2OHW A;  3J81 M;  3G4S F;  3CC7 F;  3CXC F;  1VQ6 F;  1YJW F;  1K73 H; 
#chains in the Genus database with same CATH topology
 4IIJ A;  3NVI B;  3VIU A;  4TUY B;  4ERH A;  2Z1U A;  3LWO C;  3F6M A;  1Q81 H;  3J80 M;  1VQL F;  5KX5 B;  1S72 F;  1TVK A;  3JAT A;  1T0A A;  2VGN A;  2HVY D;  3OBY A;  2MQE A;  4ZHQ B;  1K9M H;  3IEQ A;  2BTO A;  3D01 A;  2Z1E A;  2UYN B;  3KIZ A;  5GON B;  5IJ9 B;  3LWR C;  3WPW A;  1GZ0 A;  1QD9 A;  4BT3 A;  4ZOL A;  5EIB D;  5AVM A;  4ZK7 A;  5FNV B;  3WJP A;  3CCS F;  3JAW A;  3WXM B;  3CB2 A;  1H48 A;  3RA6 A;  5JH7 B;  1W5B A;  4C81 A;  2DT4 A;  4BT7 A;  2NMU A;  3T80 A;  2L26 A;  3CC2 F;  3C8L A;  3JAK B;  5CA0 B;  3L7Q A;  5CB4 B;  2WAL A;  3GTZ A;  1RQ2 A;  4DRX A;  4PWT A;  4X1Y B;  2AIZ P;  3KHN A;  3GHZ A;  4B62 A;  3MBM A;  1IPA A;  3N2G A;  1Q82 H;  2Z1T A;  2ZVZ A;  3CG6 A;  1FFX A;  2CWJ A;  3ESJ A;  1CLI A;  5J2U A;  1M1K H;  1VK3 A;  2BO1 A;  1Q8R A;  2AMT A;  5HY2 A;  2GLZ A;  2VAM A;  1H47 A;  1UI9 A;  2HP0 B;  3K0T A;  1Z5W A;  3VOB A;  4NQ3 A;  3HKE B;  2EWC A;  5ITZ A;  3C9R A;  3S03 A;  4BVT A;  1GO0 A;  1RLU A;  2LCA A;  2VAP A;  3JAL A;  2JNB A;  3Q8H A;  2VXY A;  3VOA A;  3ZP7 A;  1YIT F;  1YJN F;  2DYY A;  2RHH A;  4RQO A;  3SIV A;  5MN6 A;  1KNJ A;  5J2T A;  2Z01 A;  3WJQ A;  4XCQ A;  1KC8 H;  1W5F A;  3N2G B;  2UYP A;  5HY1 A;  3M84 A;  1VQM F;  3RYH B;  3FD6 A;  4TZZ A;  4TUY A;  1SA0 B;  2KG4 A;  4X1I B;  5EB0 A;  1Z5V A;  3P10 A;  3ZO8 A;  4E6E A;  1JJ2 F;  3N4Y A;  1H7M A;  1JY8 A;  2KTU A;  3KE1 A;  3C9U A;  5KMG B;  1JD1 A;  1YJW F;  4YJ2 A;  5IJ0 A;  5LXT B;  3QUW A;  5KX5 A;  1X7O A;  1VQN F;  1U43 A;  5ITZ B;  2VAW A;  4EI9 A;  3CCV F;  4C8G A;  4ZHQ A;  1VQV A;  3WJR A;  5EO3 A;  1VH8 A;  5IJ9 A;  2IQQ A;  4NUT A;  1RLG A;  2OZB A;  4BT4 A;  2UYJ A;  1W3E X;  2Q1Y A;  4EB6 A;  2HQS C;  4BVQ A;  4B5C A;  2G9I A;  3VI6 A;  5FJ4 C;  3N4Z A;  5JH7 A;  2R75 1;  3CCR F;  1XHO A;  3VYU C;  4ZHV A;  4HNA A;  5HXU A;  2H6L A;  3JAK A;  2CVL A;  5CB4 A;  4X1Y A;  5EYP B;  1W5E A;  1E7K A;  1QVF F;  4X20 A;  1CN7 A;  2FGY A;  4U3J A;  2CHS A;  1T0K B;  4FFB B;  3AGK A;  4RHA A;  3K14 A;  4I50 B;  3CC4 F;  3JAS B;  4YJ2 B;  2PHN A;  5IJ0 B;  3I56 F;  2ZOV A;  3CCM F;  4BW0 B;  3LYB A;  2ZOD A;  1W57 A;  1VQ8 F;  1IV4 A;  2LBT A;  1X7P A;  3F0G A;  2QA4 F;  1M90 H;  2HP0 A;  3RYC B;  4I4T B;  3HKE A;  3SIU A;  4EB6 B;  3E20 B;  3FD5 A;  2YYE A;  3V4D A;  3JAR A;  3ERN A;  3IR9 A;  1ODE A;  1FSZ A;  4HNA B;  4X3L A;  1YGY A;  4G88 A;  1VQP F;  2HS4 A;  1FNK A;  1ZWZ A;  3OBW A;  1IV1 A;  4X20 B;  2W8B C;  5FLX M;  1IV3 A;  3IKF A;  3MCQ A;  4U3J B;  1GX1 A;  2FC3 A;  3F0D A;  1SZQ A;  1NQ3 A;  2R6R 1;  4LNU A;  3RYI B;  3TD3 A;  5EZY B;  3RYH A;  4BVS A;  5JVD B;  1SA0 A;  4X1I A;  4C4W C;  3LME A;  5HY0 A;  5C8Y B;  5KMG A;  2ZF8 A;  3G71 F;  3ZOP A;  2OTL F;  2N48 A;  3CCE F;  5LXT A;  3S06 A;  3DC2 A;  4I55 A;  3HTN A;  1Q86 H;  3HJW C;  2Q1X A;  3V7E A;  2CZW A;  3S0Y A;  3QHD A;  1W55 A;  3CPQ A;  3CCL F;  3TD5 A;  3J81 M;  3G4S F;  3CC7 F;  1VQ6 F;  5LP6 C;  2B33 A;  1W59 A;  3JAR B;  4X1K A;  1JFF B;  4BVR A;  3HKB B;  5MN4 A;  1UFY A;  5GIN C;  2V9Y A;  3ZP4 A;  1K8A H;  3E22 A;  1W42 A;  5EB1 B;  1YJ9 F;  3PAF A;  4ZHY B;  1N8R H;  2KTV A;  3PLA C;  2IAF A;  4LNU B;  5DCV A;  1YQN A;  5HP8 A;  2KGW A;  4O4H B;  4O4I B;  3UT5 B;  3P4E A;  5LP6 B;  3LWV C;  4KWE A;  2PMP A;  5EYP A;  3LFO A;  2F9Z C;  3RYF B;  4ZI7 B;  2OTM A;  5IT9 M;  4FFB A;  1KNK A;  5EIB C;  3NMU C;  4I50 A;  3JAS A;  1W41 A;  3O85 A;  1W58 1;  2K1S A;  1VQK F;  3NK7 A;  4O2A B;  1U40 A;  4I55 B;  3IMP A;  4BY9 D;  5G4U C;  3B6N A;  5MN5 A;  3V7Q A;  3HWU A;  3RYC A;  4X1K B;  5JCO C;  1IV2 A;  4I4T A;  2IG8 A;  4R40 B;  4BT2 A;  4BT6 A;  1U3P A;  4O4L B;  4G4V A;  1GO1 A;  3TD4 A;  3ELC A;  3VO8 A;  5LYJ B;  2QEX F;  4LCK A;  1NJI H;  4TV9 B;  3E22 B;  2LBW A;  3HAX D;  5GIP C;  4O2B A;  4ZHW A;  3I7T A;  5CA1 A;  3VYT C;  5EAZ A;  3CME F;  4DXD A;  3K12 A;  2HP3 A;  1U3L A;  5HY4 A;  4C8I A;  1YI2 F;  1VQ4 F;  2Z1F A;  3D54 A;  2YXZ A;  1KD1 H;  3CMA F;  2HS3 A;  1KQS F;  3S0H A;  3R0P A;  4O4J B;  4G4X A;  1VQ9 F;  3RYI A;  5EZY A;  5GIO C;  3CPW F;  3F0F A;  2CHT A;  5JVD A;  1OAP A;  3WGK A;  1DBF A;  3MCA B;  1ONI A;  5C8Y A;  4X3M A;  1RA4 A;  2GZL A;  2RHO A;  2QI2 A;  3M4S A;  1TUB B;  1W5A A;  4YJ3 A;  3FPI A;  4WBN A;  1VHA A;  3KJJ A;  3I3F A;  3GYQ A;  2HS0 A;  3CD6 F;  4G4Y A;  4O2B B;  3S0W A;  3WGM A;  5CA1 B;  1JFF A;  5HWE A;  3HKB A;  3WGL A;  5GAP K;  4G4W A;  2CW4 A;  3OON A;  5GAN K;  3CCU F;  2OTJ F;  3JAM M;  2OHW A;  1QAH A;  3CXC F;  1QVG F;  2RHL A;  1K73 H;  3N2K A;  5HXZ A;  2H8C A;  3C9T A;  4F6R B;  3LWP C;  4IHJ B;  4O4I A;  4O4H A;  3UT5 A;  5JQG A;  5LP6 A;  3HKC B;  1FNJ A;  3RYF A;  4ZI7 A;  5LOV B;  5LA6 B;  3NK6 A;  1YIJ F;  4IIJ B;  3CCQ F;  2GVI A;  3F0E A;  4O2A A;  3J7A R;  4G4Z A;  4YJ3 B;  4WBN B;  4C8E A;  2VGM A;  4U39 A;  2P6Y A;  5IYZ A;  3WGN A;  3U0O A;  5BMV A;  2HRU A;  1TVK B;  3JAT B;  1CK2 A;  1NMU B;  2BTU A;  5B8F A;  4O4L A;  5LYJ A;  3ON1 A;  3CYP B;  4B45 A;  3VYS C;  4TV9 A;  4ZOL B;  5G4V C;  1VQ7 F;  4M8I A;  3BYQ A;  3IKE A;  3N2K B;  2CSL A;  2LBX A;  3E1Y A;  1XV2 A;  3D00 A;  4NWO B;  3WPX A;  1XBI A;  1R1M A;  3JAW B;  3WGJ A;  5JQG B;  1JN1 A;  5JCO A;  3LWQ C;  4C82 A;  1DT9 A;  3JVH A;  4O4J A;  4TV8 A;  3RA5 A;  3P0Z A;  3G6E F;  3OW2 F;  4DRX B;  4EI7 A;  1VQO F;  3HKD A;  1SDS A;  3MDO A;  3VTI C;  1X25 A;  1QU9 A;  2BTQ B;  2H8E A;  5EWR A;  3CCJ F;  3JCM M;  3VCZ A;  3FFM A;  5IYZ B;  1OFU A;  2QTP A;  1FFX B;  3QTY A;  5BMV B;  3C9S A;  3I55 F;  1W2B F;  4B46 A;  1X52 A;  5J2U B;  5A2Q M;  3V3T A;  2ZAU A;  1W40 A;  1TUB A;  1PF5 A;  4BT5 A;  2RHJ A;  3K2X A;  3CYQ A;  1COM A;  1YHQ F;  2ZVY A;  3IEW A;  1J7H A;  1RQ7 A;  2RB9 A;  2I6D A;  3RE3 A;  1Q7Y H;  3EOR A;  1VQ5 F;  2ALE A;  3VMF B;  2UYK A;  2HRY A;  3M1X A;  2I6R A;  3KJK A;  3FBA A;  2HX0 A;  3JAL B;  2UYN A;  5GON A;  1PXW A;  2UZH A;  3S02 A;  4TV8 B;  5J2T B;  3DDN A;  4F6R A;  5FNV A;  4IHJ A;  3HKD B;  5HP7 A;  3HKC A;  2AIF A;  3NVK E;  3MQW A;  5LOV A;  1XRG A;  4EI8 A;  5LA6 A;  5CA0 A;  3LDT A; 
#chains in the Genus database with same CATH homology
 5HXZ A;  3NVI B;  1VQN F;  1X7O A;  5GIN C;  3LWP C;  4EI9 A;  3CCV F;  1K8A H;  5EO3 A;  3LWO C;  3NK6 A;  1W42 A;  1Q81 H;  3J80 M;  1YJ9 F;  1YIJ F;  1VQL F;  3PAF A;  4NUT A;  1RLG A;  1N8R H;  2OZB A;  2KTV A;  3PLA C;  3CCQ F;  1W3E X;  1S72 F;  5DCV A;  4BVQ A;  2VGN A;  3VI6 A;  3LWV C;  2HVY D;  5FJ4 C;  3OBY A;  3LFO A;  1K9M H;  3J7A R;  3N4Z A;  2F9Z C;  3CCR F;  2VGM A;  5IT9 M;  3LWR C;  1GZ0 A;  3NMU C;  5HXU A;  1W41 A;  3O85 A;  1CK2 A;  1NMU B;  1VQK F;  3NK7 A;  3CCS F;  1QVF F;  1E7K A;  3WXM B;  1CN7 A;  3RA6 A;  2FGY A;  4BY9 D;  3ON1 A;  5G4U C;  1T0K B;  3V7Q A;  3AGK A;  5G4V C;  3CC4 F;  3CC2 F;  1VQ7 F;  3CCM F;  3I56 F;  2LBX A;  3E1Y A;  2WAL A;  3D00 A;  4BW0 B;  1XBI A;  1GO1 A;  2QEX F;  1VQ8 F;  4LCK A;  3LWQ C;  1NJI H;  1X7P A;  1DT9 A;  2LBW A;  3HAX D;  5GIP C;  2QA4 F;  1M90 H;  1IPA A;  3CME F;  1Q82 H;  3CG6 A;  3RA5 A;  5HY4 A;  3SIU A;  3G6E F;  3OW2 F;  1YI2 F;  1VQ4 F;  1M1K H;  4EI7 A;  1VQO F;  1SDS A;  2BO1 A;  3E20 B;  5HY2 A;  1KD1 H;  3CMA F;  2GLZ A;  5EWR A;  3CCJ F;  3JCM M;  1KQS F;  3FFM A;  3IR9 A;  4X3L A;  4NQ3 A;  1W2B F;  1VQ9 F;  3I55 F;  1QVG F;  1VQP F;  5A2Q M;  1X52 A;  5GIO C;  3V3T A;  3CPW F;  1ZWZ A;  1W40 A;  3OBW A;  4BVT A;  1GO0 A;  2JNB A;  5FLX M;  1YHQ F;  3MCA B;  2FC3 A;  1YIT F;  4X3M A;  2I6D A;  1YJN F;  1RA4 A;  1Q7Y H;  1VQ5 F;  3SIV A;  2ALE A;  3VMF B;  2QI2 A;  4BVS A;  4XCQ A;  1KC8 H;  3CD6 F;  3GYQ A;  1PXW A;  5HY0 A;  4C4W C;  3G71 F;  2OTL F;  5HWE A;  5HY1 A;  3CCE F;  1VQM F;  5GAP K;  2OTJ F;  5GAN K;  4TZZ A;  3CCU F;  2KG4 A;  1Q86 H;  1JJ2 F;  3HJW C;  3V7E A;  2CZW A;  3JAM M;  2AIF A;  3NVK E;  3N4Y A;  1H7M A;  3CPQ A;  2KTU A;  3CCL F;  2OHW A;  3J81 M;  4EI8 A;  3G4S F;  3CC7 F;  3CXC F;  1VQ6 F;  1YJW F;  1K73 H;  4BVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...