1PXWA

Crystal structure of l7ae srnp core protein from pyrococcus abyssii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
MEGWMMAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LSU ribosomal protein L7AE
publication title Purification, crystallization and preliminary X-ray diffraction data of L7Ae sRNP core protein from Pyrococcus abyssii.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosome
total genus 43
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1pxwA00
1PXWA 1W41A 3V7QA 4BY9D 1X7PA 3N4ZA 3J80M 1M90H 3FFMA 3CD6F 2VGNA 3WXMB 1XBIA 3CMAF 3NVKE 3N4YA 3RA5A 1YITF 1NJIH 3SIVA 3SIUA 3HAXD 3CCRF 3CCSF 1Q86H 2WALA 2KG4A 2KTVA 3LWRC 5FJ4C 3G4SF 1KC8H 1KQSF 1QVFF 2I6DA 1VQ6F 2OHWA 1CN7A 2LBWA 1W2BF 3J7AR 5G4VC 3CCMF 1VQ9F 4TZZA 1ZWZA 3OW2F 2KTUA 3CXCF 1X7OA 2BO1A 5GINC 3JCMM 3RA6A 1K9MH 2OZBA 1YJWF 3LWVC 3NMUC 1K73H 5G4UC 3CG6A 1E7KA 2CZWA 4X3LA 5GANK 1VQNF 2LBXA 4BW0B 3NK7A 3ON1A 3G6EF 2VGMA 1K8AH 1W3EX 1VQOF 3NVIB 5GIPC 1YHQF 1RLGA 3CC4F 3LWPC 2OTLF 1W42A 3O85A 3CCJF 2QEXF 1IPAA 1X52A 1S72F 2OTJF 3I55F 2FC3A 5EWRA 1YI2F 3CPWF 3CMEF 3GYQA 5DCVA 3IR9A 1VQ4F 3JAMM 3VMFB 3HJWC 4C4WC 2AIFA 1YIJF 3J81M 1YJ9F 3CCQF 1KD1H 1M1KH 1DT9A 1W40A 1Q81H 5GAPK 4LCKA 1VQ8F 5IT9M 3CCVF 1VQPF 2JNBA 3CCLF 3CCUF 1VQ7F 1SDSA 2ALEA 3PLAC 1VQMF 3LWOC 3LFOA 3VI6A 1JJ2F 1VQ5F 1T0KB 3V7EA 1N8RH 3OBYA 5GIOC 1GO1A 1CK2A 3E20B 3PAFA 1VQKF 3AGKA 3CC7F 2QA4F 3MCAB 1GO0A 1VQLF 3G71F 1RA4A 3CC2F 3LWQC 4X3MA 2HVYD 3E1YA 5EO3A 3I56F 1QVGF 3NK6A 5A2QM 1NMUB 1Q82H 1YJNF 3OBWA 2QI2A 1Q7YH 1H7MA 3CCEF 1GZ0A 3CPQA 4NUTA 5FLXM
chains in the Genus database with same CATH superfamily
1PXWA 1U43A 5KX5B 3QTYA 1X7PA 5HXZA 4YJ3A 3J80M 3WJRA 3ZOPA 1JN1A 5EZYB 1XBIA 4LNUB 4X1YB 3N4YA 1NJIH 3SIUA 1NQ3A 5MN5A 4B46A 5LXTA 2ZF8A 4ZHWA 3GTZA 3HKBB 2HS4A 1CN7A 2LBWA 2AMTA 3HWUA 4ZI7B 3J7AR 3C9SA 3MCQA 2YYEA 1VQ9F 1ZWZA 2Q1YA 5GONA 4O4JA 2N48A 1FFXB 1X7OA 3CXCF 4YJ2A 5GINC 3RA6A 1K9MH 2B33A 2CSLA 1U3PA 3JASA 4BT4A 1YJWF 1W5FA 3FBAA 3UT5A 5IJ9B 2BTUA 2F9ZC 3V4DA 3LWVC 3CYPB 2G9IA 3L7QA 1K73H 2KGWA 4ZOLA 1IV4A 5JQGB 3NVIB 2HS0A 5JCOC 3QHDA 1VH8A 4FFBA 2OTLF 1W42A 3IEWA 3WPWA 2ZAUA 2QEXF 1S72F 3R0PA 3I55F 2FC3A 1X25A 5EWRA 1YI2F 3CPWF 5DCVA 3IR9A 3K12A 3RYCB 4X1IA 1VQ4F 4DRXB 1SA0A 5B8FA 5IJ0B 1W57A 3HKDB 3IEQA 3J81M 3QUWA 1YJ9F 4C8GA 5IYZA 1KD1H 3E22A 4LCKA 2GVIA 4NQ3A 3CCVF 5LOVA 3VOBA 2JNBA 3CCLF 2ALEA 4C8IA 3PLAC 5HXUA 3LFOA 2VXYA 1T0KB 5LP6B 4RHAA 5JCOA 3V7EA 1N8RH 4I50A 3K2XA 2ZOVA 3JALA 3JAWB 4O4IB 3JAKB 3RYFA 1RQ2A 5KMGA 3S0YA 5LYJB 1W5AA 4O2BA 5HWEA 1VK3A 3JARB 3C9TA 4X20B 5EB1B 5FNVA 5CA1B 2UZHA 3M84A 4ZHQA 1J7HA 2GLZA 5MN6A 4IIJB 2HVYD 3E1YA 3JVHA 1U3LA 3NK6A 1R1MA 1Q82H 3OBWA 3OONA 4ZHVA 1H7MA 3CPQA 1FNJA 3MQWA 1JD1A 3V7QA 3Q8HA 1ODEA 3TD5A 3DC2A 2BTQB 2CWJA 2UYJA 3K0TA 4EB6B 1FNKA 4TV9A 4U3JA 5HY1A 2L26A 1W5BA 4O4LB 3K14A 3LDTA 3TD3A 3SIVA 3M4SA 4IHJA 1IV2A 3CCRF 4I55A 4F6RB 2KG4A 3LWRC 3BYQA 3VYSC 3S0HA 3N2KA 2HQSC 2OHWA 1KNKA 1QAHA 4EI7A 3F0EA 1OAPA 4I4TB 3OW2F 4O4JB 4TUYA 3LMEA 2H8CA 4M8IA 2IG8A 1UI9A 2CHTA 2CVLA 3NMUC 3CG6A 4X3LA 3MDOA 5GANK 2LBXA 3ON1A 1K8AH 5MN4A 1UFYA 3EORA 1YQNA 3WGKA 2QTPA 1TVKB 2R751 1YHQF 4HNAA 2NMUA 3CC4F 1TUBB 4X1KB 3O85A 3CCJF 2HP3A 2OTJF 2CHSA 1ONIA 2UYNB 2HP0B 3GYQA 3VMFB 2W8BC 3D54A 3HJWC 1FSZA 2AIFA 5HY0A 5J2UB 5EB0A 5EYPA 5IYZB 5JVDA 1W40A 2CW4A 3FD5A 3HKCB 4BT7A 1VQPF 1SDSA 3CCUF 2HS3A 2OTMA 4O4HA 4G4VA 1JFFA 2RB9A 5C8YA 5BMVA 4O2AB 4B45A 2LBTA 3VI6A 3LWOC 2GZLA 1YGYA 2Z01A 2HRUA 5KX5A 3KIZA 3OBYA 3C9UA 1GO1A 3E20B 3CC7F 3AGKA 3VOAA 3FPIA 3V3TA 1GO0A 5J2TB 3RYFB 5EZYA 1VQLF 3G71F 4BVSA 4KWEA 4LNUA 5HY2A 4X1YA 3CC2F 2ZVZA 3RYHB 1XRGA 2DYYA 3DDNA 4ZHQB 5CA0B 3F6MA 5EIBC 3HKBA 1QVGF 2UYPA 4ZI7A 3CCEF 3WGMA 4NUTA 4BT2A 1FFXA 1W41A 3VCZA 4WBNA 5JH7A 4BY9D 4G4YA 1IV3A 2VAMA 3N4ZA 5IJ9A 3S06A 1M90H 4ZHYB 3FFMA 3N2GB 4G88A 3CD6F 2VGNA 5LA6A 4TV9B 2EWCA 3WXMB 4U3JB 4BT5A 1DBFA 1XHOA 4C81A 3NVKE 2RHHA 4C8EA 2YXZA 3F0DA 2PMPA 2PHNA 1Q86H 5AVMA 5JQGA 2KTVA 5FJ4C 4RQOA 3FD6A 5LP6C 2I6DA 2RHLA 4G4WA 2P6YA 2IQQA 3VTIC 3S02A 3CCMF 1RLUA 1CLIA 3ERNA 3CB2A 3RYCA 2BO1A 2VAPA 4DRXA 3JCMM 4EI8A 5IJ0A 3RYIA 2LCAA 2OZBA 4YJ3B 5HP8A 3P0ZA 2I6RA 3HKEA 3LYBA 3HTNA 1JY8A 2CZWA 1U40A 3I7TA 4BW0B 5CB4A 3GHZA 3G6EF 2RHJA 2VGMA 3VIUA 2HRYA 2Z1TA 1VQOF 5LP6A 3RE3A 1W5EA 5LXTB 1RLGA 3S0WA 4BT6A 3JAKA 1Z5WA 2MQEA 1IPAA 5GONB 5LYJA 2Z1FA 4YJ2B 4C4WC 3JARA 3T80A 3ZP7A 3JASB 3S03A 5CA1A 3CCQF 1M1KH 1RQ7A 3UT5B 5EYPB 5GAPK 2R6R1 1T0AA 4IIJA 3P4EA 2VAWA 5HP7A 1VQ7F 4ZOLB 3I3FA 3C9RA 4U39A 5ITZA 4TV8A 3C8LA 1JFFB 3VO8A 5C8YB 1VQ5F 1XV2A 5GIOC 1VQKF 3PAFA 1CK2A 1QU9A 3CYQA 3MCAB 4FFBB 4ZK7A 3IKEA 4EB6A 4XCQA 4O4LA 1W59A 4X1IB 1RA4A 1SA0B 1VHAA 4BVQA 3LWQC 4F6RA 2DT4A 3IMPA 3E22B 3JATA 4X3MA 3I56F 5LOVB 5A2QM 4PWTA 1NMUB 1YJNF 2QI2A 3KJJA 1Q7YH 5FLXM 4I4TA 4BVRA 5JH7B 2Q1XA 4WBNB 4I50B 1COMA 3JALB 4BVTA 1PF5A 3WGNA 5KMGB 1Z5VA 1GX1A 3ESJA 5LA6B 4DXDA 3CMAF 4O2BB 1W581 3RA5A 1YITF 5FNVB 3D00A 3CCSF 2AIZP 2WALA 3G4SF 1KC8H 1KQSF 1QVFF 1TVKA 1VQ6F 1TUBA 3P10A 4X1KA 1KNJA 1W2BF 3F0FA 5G4VC 4TZZA 2UYNA 2HP0A 2KTUA 4EI9A 2K1SA 4NWOB 3TD4A 5J2UA 2Z1UA 3IKFA 3RYIB 5EAZA 3U0OA 3B6NA 3WJQA 1Q8RA 5G4UC 3HKCA 3M1XA 3HKEB 3WGJA 5HY4A 1E7KA 1VQNF 3NK7A 2HX0A 5CB4B 3ZO8A 2IAFA 4IHJB 4O2AA 3WPXA 1W3EX 4I55B 5EIBD 5GIPC 1OFUA 2H8EA 1W55A 3N2KB 3LWPC 2BTOA 2FGYA 5J2TA 1X52A 4BT3A 3WGLA 3CMEF 4G4ZA 2ZODA 4TUYB 3JAMM 3RYHA 3HKDA 1YIJF 2UYKA 1SZQA 1DT9A 2V9YA 5CA0A 1Q81H 3WJPA 3ELCA 1VQ8F 5IT9M 3VYUC 2H6LA 4G4XA 4ERHA 1VQMF 3VYTC 2RHOA 4C82A 5ITZB 4TV8B 1JJ2F 3D01A 3HAXD 4HNAB 3JAWA 4O4IA 3MBMA 2QA4F 4B62A 3F0GA 3N2GA 4R40B 4E6EA 3KJKA 1H48A 4X20A 3ZP4A 2Z1EA 5JVDB 3KE1A 5EO3A 3JATB 1QD9A 3KHNA 1VQVA 1H47A 2ZVYA 4O4HB 1GZ0A 1IV1A 5BMVB 4B5CA
chains in the Genus database with same CATH topology
1PXWA 1W41A 3V7QA 4BVRA 4BY9D 1X7PA 5HXZA 3N4ZA 4BVTA 3J80M 1M90H 3FFMA 3CD6F 5HY1A 2VGNA 3WXMB 1XBIA 3CMAF 3NVKE 3N4YA 3RA5A 1YITF 1NJIH 3SIVA 3SIUA 3D00A 3HAXD 3CCRF 3CCSF 1Q86H 2WALA 2KG4A 2KTVA 3LWRC 5FJ4C 3G4SF 1KC8H 1KQSF 1QVFF 2I6DA 1VQ6F 2OHWA 1CN7A 2LBWA 1W2BF 4EI7A 3J7AR 5G4VC 3CCMF 1VQ9F 4TZZA 1ZWZA 3OW2F 2KTUA 3CXCF 1X7OA 4EI9A 2BO1A 5GINC 3JCMM 4EI8A 3RA6A 1K9MH 2OZBA 1YJWF 2F9ZC 3LWVC 3NMUC 1K73H 5G4UC 3CG6A 1E7KA 5HY4A 2CZWA 4X3LA 5GANK 1VQNF 2LBXA 4BW0B 3NK7A 3ON1A 3G6EF 2VGMA 1K8AH 1W3EX 1VQOF 3NVIB 5GIPC 1YHQF 1RLGA 3CC4F 3LWPC 2OTLF 2FGYA 1W42A 3O85A 3CCJF 2QEXF 1IPAA 1X52A 1S72F 2OTJF 3I55F 2FC3A 5EWRA 1YI2F 3CPWF 3CMEF 3GYQA 5DCVA 3IR9A 1VQ4F 3JAMM 3VMFB 3HJWC 4C4WC 2AIFA 1YIJF 5HY0A 3J81M 1YJ9F 3CCQF 1KD1H 1M1KH 1DT9A 1W40A 1Q81H 5GAPK 4LCKA 1VQ8F 5IT9M 4NQ3A 3CCVF 1VQPF 2JNBA 3CCLF 3CCUF 1VQ7F 1SDSA 2ALEA 3PLAC 1VQMF 5HXUA 3LWOC 3LFOA 3VI6A 1JJ2F 1VQ5F 1T0KB 3V7EA 1N8RH 3OBYA 5GIOC 1GO1A 1CK2A 3E20B 3PAFA 1VQKF 3AGKA 3CC7F 2QA4F 3MCAB 3V3TA 1GO0A 1VQLF 3G71F 4BVSA 4XCQA 5HWEA 5HY2A 1RA4A 3CC2F 4BVQA 3LWQC 2GLZA 4X3MA 2HVYD 3E1YA 5EO3A 3I56F 1QVGF 3NK6A 5A2QM 1NMUB 1Q82H 1YJNF 3OBWA 2QI2A 1Q7YH 1H7MA 3CCEF 1GZ0A 3CPQA 4NUTA 5FLXM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXW A;  1W41 A;  3V7Q A;  4BY9 D;  1X7P A;  3N4Z A;  3J80 M;  1M90 H;  3FFM A;  3CD6 F;  2VGN A;  3WXM B;  1XBI A;  3CMA F;  3NVK E;  3N4Y A;  3RA5 A;  1YIT F;  1NJI H;  3SIV A;  3SIU A;  3HAX D;  3CCR F;  3CCS F;  1Q86 H;  2WAL A;  2KG4 A;  2KTV A;  3LWR C;  5FJ4 C;  3G4S F;  1KC8 H;  1KQS F;  1QVF F;  2I6D A;  1VQ6 F;  2OHW A;  1CN7 A;  2LBW A;  1W2B F;  3J7A R;  5G4V C;  3CCM F;  1VQ9 F;  4TZZ A;  1ZWZ A;  3OW2 F;  2KTU A;  3CXC F;  1X7O A;  2BO1 A;  5GIN C;  3JCM M;  3RA6 A;  1K9M H;  2OZB A;  1YJW F;  3LWV C;  3NMU C;  1K73 H;  5G4U C;  3CG6 A;  1E7K A;  2CZW A;  4X3L A;  5GAN K;  1VQN F;  2LBX A;  4BW0 B;  3NK7 A;  3ON1 A;  3G6E F;  2VGM A;  1K8A H;  1W3E X;  1VQO F;  3NVI B;  5GIP C;  1YHQ F;  1RLG A;  3CC4 F;  3LWP C;  2OTL F;  1W42 A;  3O85 A;  3CCJ F;  2QEX F;  1IPA A;  1X52 A;  1S72 F;  2OTJ F;  3I55 F;  2FC3 A;  5EWR A;  1YI2 F;  3CPW F;  3CME F;  3GYQ A;  5DCV A;  3IR9 A;  1VQ4 F;  3JAM M;  3VMF B;  3HJW C;  4C4W C;  2AIF A;  1YIJ F;  3J81 M;  1YJ9 F;  3CCQ F;  1KD1 H;  1M1K H;  1DT9 A;  1W40 A;  1Q81 H;  5GAP K;  4LCK A;  1VQ8 F;  5IT9 M;  3CCV F;  1VQP F;  2JNB A;  3CCL F;  3CCU F;  1VQ7 F;  1SDS A;  2ALE A;  3PLA C;  1VQM F;  3LWO C;  3LFO A;  3VI6 A;  1JJ2 F;  1VQ5 F;  1T0K B;  3V7E A;  1N8R H;  3OBY A;  5GIO C;  1GO1 A;  1CK2 A;  3E20 B;  3PAF A;  1VQK F;  3AGK A;  3CC7 F;  2QA4 F;  3MCA B;  1GO0 A;  1VQL F;  3G71 F;  1RA4 A;  3CC2 F;  3LWQ C;  4X3M A;  2HVY D;  3E1Y A;  5EO3 A;  3I56 F;  1QVG F;  3NK6 A;  5A2Q M;  1NMU B;  1Q82 H;  1YJN F;  3OBW A;  2QI2 A;  1Q7Y H;  1H7M A;  3CCE F;  1GZ0 A;  3CPQ A;  4NUT A;  5FLX M; 
#chains in the Genus database with same CATH topology
 1PXW A;  1U43 A;  5KX5 B;  3QTY A;  1X7P A;  5HXZ A;  4YJ3 A;  3J80 M;  3WJR A;  3ZOP A;  1JN1 A;  5EZY B;  1XBI A;  4LNU B;  4X1Y B;  3N4Y A;  1NJI H;  3SIU A;  1NQ3 A;  5MN5 A;  4B46 A;  5LXT A;  2ZF8 A;  4ZHW A;  3GTZ A;  3HKB B;  2HS4 A;  1CN7 A;  2LBW A;  2AMT A;  3HWU A;  4ZI7 B;  3J7A R;  3C9S A;  3MCQ A;  2YYE A;  1VQ9 F;  1ZWZ A;  2Q1Y A;  5GON A;  4O4J A;  2N48 A;  1FFX B;  1X7O A;  3CXC F;  4YJ2 A;  5GIN C;  3RA6 A;  1K9M H;  2B33 A;  2CSL A;  1U3P A;  3JAS A;  4BT4 A;  1YJW F;  1W5F A;  3FBA A;  3UT5 A;  5IJ9 B;  2BTU A;  2F9Z C;  3V4D A;  3LWV C;  3CYP B;  2G9I A;  3L7Q A;  1K73 H;  2KGW A;  4ZOL A;  1IV4 A;  5JQG B;  3NVI B;  2HS0 A;  5JCO C;  3QHD A;  1VH8 A;  4FFB A;  2OTL F;  1W42 A;  3IEW A;  3WPW A;  2ZAU A;  2QEX F;  1S72 F;  3R0P A;  3I55 F;  2FC3 A;  1X25 A;  5EWR A;  1YI2 F;  3CPW F;  5DCV A;  3IR9 A;  3K12 A;  3RYC B;  4X1I A;  1VQ4 F;  4DRX B;  1SA0 A;  5B8F A;  5IJ0 B;  1W57 A;  3HKD B;  3IEQ A;  3J81 M;  3QUW A;  1YJ9 F;  4C8G A;  5IYZ A;  1KD1 H;  3E22 A;  4LCK A;  2GVI A;  4NQ3 A;  3CCV F;  5LOV A;  3VOB A;  2JNB A;  3CCL F;  2ALE A;  4C8I A;  3PLA C;  5HXU A;  3LFO A;  2VXY A;  1T0K B;  5LP6 B;  4RHA A;  5JCO A;  3V7E A;  1N8R H;  4I50 A;  3K2X A;  2ZOV A;  3JAL A;  3JAW B;  4O4I B;  3JAK B;  3RYF A;  1RQ2 A;  5KMG A;  3S0Y A;  5LYJ B;  1W5A A;  4O2B A;  5HWE A;  1VK3 A;  3JAR B;  3C9T A;  4X20 B;  5EB1 B;  5FNV A;  5CA1 B;  2UZH A;  3M84 A;  4ZHQ A;  1J7H A;  2GLZ A;  5MN6 A;  4IIJ B;  2HVY D;  3E1Y A;  3JVH A;  1U3L A;  3NK6 A;  1R1M A;  1Q82 H;  3OBW A;  3OON A;  4ZHV A;  1H7M A;  3CPQ A;  1FNJ A;  3MQW A;  1JD1 A;  3V7Q A;  3Q8H A;  1ODE A;  3TD5 A;  3DC2 A;  2BTQ B;  2CWJ A;  2UYJ A;  3K0T A;  4EB6 B;  1FNK A;  4TV9 A;  4U3J A;  5HY1 A;  2L26 A;  1W5B A;  4O4L B;  3K14 A;  3LDT A;  3TD3 A;  3SIV A;  3M4S A;  4IHJ A;  1IV2 A;  3CCR F;  4I55 A;  4F6R B;  2KG4 A;  3LWR C;  3BYQ A;  3VYS C;  3S0H A;  3N2K A;  2HQS C;  2OHW A;  1KNK A;  1QAH A;  4EI7 A;  3F0E A;  1OAP A;  4I4T B;  3OW2 F;  4O4J B;  4TUY A;  3LME A;  2H8C A;  4M8I A;  2IG8 A;  1UI9 A;  2CHT A;  2CVL A;  3NMU C;  3CG6 A;  4X3L A;  3MDO A;  5GAN K;  2LBX A;  3ON1 A;  1K8A H;  5MN4 A;  1UFY A;  3EOR A;  1YQN A;  3WGK A;  2QTP A;  1TVK B;  2R75 1;  1YHQ F;  4HNA A;  2NMU A;  3CC4 F;  1TUB B;  4X1K B;  3O85 A;  3CCJ F;  2HP3 A;  2OTJ F;  2CHS A;  1ONI A;  2UYN B;  2HP0 B;  3GYQ A;  3VMF B;  2W8B C;  3D54 A;  3HJW C;  1FSZ A;  2AIF A;  5HY0 A;  5J2U B;  5EB0 A;  5EYP A;  5IYZ B;  5JVD A;  1W40 A;  2CW4 A;  3FD5 A;  3HKC B;  4BT7 A;  1VQP F;  1SDS A;  3CCU F;  2HS3 A;  2OTM A;  4O4H A;  4G4V A;  1JFF A;  2RB9 A;  5C8Y A;  5BMV A;  4O2A B;  4B45 A;  2LBT A;  3VI6 A;  3LWO C;  2GZL A;  1YGY A;  2Z01 A;  2HRU A;  5KX5 A;  3KIZ A;  3OBY A;  3C9U A;  1GO1 A;  3E20 B;  3CC7 F;  3AGK A;  3VOA A;  3FPI A;  3V3T A;  1GO0 A;  5J2T B;  3RYF B;  5EZY A;  1VQL F;  3G71 F;  4BVS A;  4KWE A;  4LNU A;  5HY2 A;  4X1Y A;  3CC2 F;  2ZVZ A;  3RYH B;  1XRG A;  2DYY A;  3DDN A;  4ZHQ B;  5CA0 B;  3F6M A;  5EIB C;  3HKB A;  1QVG F;  2UYP A;  4ZI7 A;  3CCE F;  3WGM A;  4NUT A;  4BT2 A;  1FFX A;  1W41 A;  3VCZ A;  4WBN A;  5JH7 A;  4BY9 D;  4G4Y A;  1IV3 A;  2VAM A;  3N4Z A;  5IJ9 A;  3S06 A;  1M90 H;  4ZHY B;  3FFM A;  3N2G B;  4G88 A;  3CD6 F;  2VGN A;  5LA6 A;  4TV9 B;  2EWC A;  3WXM B;  4U3J B;  4BT5 A;  1DBF A;  1XHO A;  4C81 A;  3NVK E;  2RHH A;  4C8E A;  2YXZ A;  3F0D A;  2PMP A;  2PHN A;  1Q86 H;  5AVM A;  5JQG A;  2KTV A;  5FJ4 C;  4RQO A;  3FD6 A;  5LP6 C;  2I6D A;  2RHL A;  4G4W A;  2P6Y A;  2IQQ A;  3VTI C;  3S02 A;  3CCM F;  1RLU A;  1CLI A;  3ERN A;  3CB2 A;  3RYC A;  2BO1 A;  2VAP A;  4DRX A;  3JCM M;  4EI8 A;  5IJ0 A;  3RYI A;  2LCA A;  2OZB A;  4YJ3 B;  5HP8 A;  3P0Z A;  2I6R A;  3HKE A;  3LYB A;  3HTN A;  1JY8 A;  2CZW A;  1U40 A;  3I7T A;  4BW0 B;  5CB4 A;  3GHZ A;  3G6E F;  2RHJ A;  2VGM A;  3VIU A;  2HRY A;  2Z1T A;  1VQO F;  5LP6 A;  3RE3 A;  1W5E A;  5LXT B;  1RLG A;  3S0W A;  4BT6 A;  3JAK A;  1Z5W A;  2MQE A;  1IPA A;  5GON B;  5LYJ A;  2Z1F A;  4YJ2 B;  4C4W C;  3JAR A;  3T80 A;  3ZP7 A;  3JAS B;  3S03 A;  5CA1 A;  3CCQ F;  1M1K H;  1RQ7 A;  3UT5 B;  5EYP B;  5GAP K;  2R6R 1;  1T0A A;  4IIJ A;  3P4E A;  2VAW A;  5HP7 A;  1VQ7 F;  4ZOL B;  3I3F A;  3C9R A;  4U39 A;  5ITZ A;  4TV8 A;  3C8L A;  1JFF B;  3VO8 A;  5C8Y B;  1VQ5 F;  1XV2 A;  5GIO C;  1VQK F;  3PAF A;  1CK2 A;  1QU9 A;  3CYQ A;  3MCA B;  4FFB B;  4ZK7 A;  3IKE A;  4EB6 A;  4XCQ A;  4O4L A;  1W59 A;  4X1I B;  1RA4 A;  1SA0 B;  1VHA A;  4BVQ A;  3LWQ C;  4F6R A;  2DT4 A;  3IMP A;  3E22 B;  3JAT A;  4X3M A;  3I56 F;  5LOV B;  5A2Q M;  4PWT A;  1NMU B;  1YJN F;  2QI2 A;  3KJJ A;  1Q7Y H;  5FLX M;  4I4T A;  4BVR A;  5JH7 B;  2Q1X A;  4WBN B;  4I50 B;  1COM A;  3JAL B;  4BVT A;  1PF5 A;  3WGN A;  5KMG B;  1Z5V A;  1GX1 A;  3ESJ A;  5LA6 B;  4DXD A;  3CMA F;  4O2B B;  1W58 1;  3RA5 A;  1YIT F;  5FNV B;  3D00 A;  3CCS F;  2AIZ P;  2WAL A;  3G4S F;  1KC8 H;  1KQS F;  1QVF F;  1TVK A;  1VQ6 F;  1TUB A;  3P10 A;  4X1K A;  1KNJ A;  1W2B F;  3F0F A;  5G4V C;  4TZZ A;  2UYN A;  2HP0 A;  2KTU A;  4EI9 A;  2K1S A;  4NWO B;  3TD4 A;  5J2U A;  2Z1U A;  3IKF A;  3RYI B;  5EAZ A;  3U0O A;  3B6N A;  3WJQ A;  1Q8R A;  5G4U C;  3HKC A;  3M1X A;  3HKE B;  3WGJ A;  5HY4 A;  1E7K A;  1VQN F;  3NK7 A;  2HX0 A;  5CB4 B;  3ZO8 A;  2IAF A;  4IHJ B;  4O2A A;  3WPX A;  1W3E X;  4I55 B;  5EIB D;  5GIP C;  1OFU A;  2H8E A;  1W55 A;  3N2K B;  3LWP C;  2BTO A;  2FGY A;  5J2T A;  1X52 A;  4BT3 A;  3WGL A;  3CME F;  4G4Z A;  2ZOD A;  4TUY B;  3JAM M;  3RYH A;  3HKD A;  1YIJ F;  2UYK A;  1SZQ A;  1DT9 A;  2V9Y A;  5CA0 A;  1Q81 H;  3WJP A;  3ELC A;  1VQ8 F;  5IT9 M;  3VYU C;  2H6L A;  4G4X A;  4ERH A;  1VQM F;  3VYT C;  2RHO A;  4C82 A;  5ITZ B;  4TV8 B;  1JJ2 F;  3D01 A;  3HAX D;  4HNA B;  3JAW A;  4O4I A;  3MBM A;  2QA4 F;  4B62 A;  3F0G A;  3N2G A;  4R40 B;  4E6E A;  3KJK A;  1H48 A;  4X20 A;  3ZP4 A;  2Z1E A;  5JVD B;  3KE1 A;  5EO3 A;  3JAT B;  1QD9 A;  3KHN A;  1VQV A;  1H47 A;  2ZVY A;  4O4H B;  1GZ0 A;  1IV1 A;  5BMV B;  4B5C A; 
#chains in the Genus database with same CATH homology
 1PXW A;  1W41 A;  3V7Q A;  4BVR A;  4BY9 D;  1X7P A;  5HXZ A;  3N4Z A;  4BVT A;  3J80 M;  1M90 H;  3FFM A;  3CD6 F;  5HY1 A;  2VGN A;  3WXM B;  1XBI A;  3CMA F;  3NVK E;  3N4Y A;  3RA5 A;  1YIT F;  1NJI H;  3SIV A;  3SIU A;  3D00 A;  3HAX D;  3CCR F;  3CCS F;  1Q86 H;  2WAL A;  2KG4 A;  2KTV A;  3LWR C;  5FJ4 C;  3G4S F;  1KC8 H;  1KQS F;  1QVF F;  2I6D A;  1VQ6 F;  2OHW A;  1CN7 A;  2LBW A;  1W2B F;  4EI7 A;  3J7A R;  5G4V C;  3CCM F;  1VQ9 F;  4TZZ A;  1ZWZ A;  3OW2 F;  2KTU A;  3CXC F;  1X7O A;  4EI9 A;  2BO1 A;  5GIN C;  3JCM M;  4EI8 A;  3RA6 A;  1K9M H;  2OZB A;  1YJW F;  2F9Z C;  3LWV C;  3NMU C;  1K73 H;  5G4U C;  3CG6 A;  1E7K A;  5HY4 A;  2CZW A;  4X3L A;  5GAN K;  1VQN F;  2LBX A;  4BW0 B;  3NK7 A;  3ON1 A;  3G6E F;  2VGM A;  1K8A H;  1W3E X;  1VQO F;  3NVI B;  5GIP C;  1YHQ F;  1RLG A;  3CC4 F;  3LWP C;  2OTL F;  2FGY A;  1W42 A;  3O85 A;  3CCJ F;  2QEX F;  1IPA A;  1X52 A;  1S72 F;  2OTJ F;  3I55 F;  2FC3 A;  5EWR A;  1YI2 F;  3CPW F;  3CME F;  3GYQ A;  5DCV A;  3IR9 A;  1VQ4 F;  3JAM M;  3VMF B;  3HJW C;  4C4W C;  2AIF A;  1YIJ F;  5HY0 A;  3J81 M;  1YJ9 F;  3CCQ F;  1KD1 H;  1M1K H;  1DT9 A;  1W40 A;  1Q81 H;  5GAP K;  4LCK A;  1VQ8 F;  5IT9 M;  4NQ3 A;  3CCV F;  1VQP F;  2JNB A;  3CCL F;  3CCU F;  1VQ7 F;  1SDS A;  2ALE A;  3PLA C;  1VQM F;  5HXU A;  3LWO C;  3LFO A;  3VI6 A;  1JJ2 F;  1VQ5 F;  1T0K B;  3V7E A;  1N8R H;  3OBY A;  5GIO C;  1GO1 A;  1CK2 A;  3E20 B;  3PAF A;  1VQK F;  3AGK A;  3CC7 F;  2QA4 F;  3MCA B;  3V3T A;  1GO0 A;  1VQL F;  3G71 F;  4BVS A;  4XCQ A;  5HWE A;  5HY2 A;  1RA4 A;  3CC2 F;  4BVQ A;  3LWQ C;  2GLZ A;  4X3M A;  2HVY D;  3E1Y A;  5EO3 A;  3I56 F;  1QVG F;  3NK6 A;  5A2Q M;  1NMU B;  1Q82 H;  1YJN F;  3OBW A;  2QI2 A;  1Q7Y H;  1H7M A;  3CCE F;  1GZ0 A;  3CPQ A;  4NUT A;  5FLX M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...