1PXWA

Crystal structure of l7ae srnp core protein from pyrococcus abyssii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
b'MEGWMMAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LSU ribosomal protein L7AE
publication title Purification, crystallization and preliminary X-ray diffraction data of L7Ae sRNP core protein from Pyrococcus abyssii.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosome
total genus 43
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1pxwA00
1VQ5F 3NK6A 1VQPF 3VMFB 3NVIB 1W40A 5GAPK 1Q7YH 3CMAF 1VQNF 1K8AH 5A2QM 3VI6A 5DCVA 1Q82H 1KQSF 2OTJF 3GYQA 3V7QA 3RA5A 2HVYD 1YITF 1KD1H 3CXCF 1H7MA 4NUTA 1E7KA 3FFMA 1NMUB 3G6EF 4LCKA 1W2BF 3HJWC 2KG4A 1K73H 3NMUC 1YJNF 3CCJF 3J81M 4X3LA 3I55F 1VQ6F 1YHQF 2QA4F 3CCSF 1QVGF 1XBIA 1VQ8F 2AIFA 2OZBA 5IT9M 3LWOC 1GO0A 5EWRA 2BO1A 3CG6A 4BY9D 3G4SF 2JNBA 4BW0B 3IR9A 1VQLF 3LWQC 3LWVC 1YI2F 1ZWZA 2ALEA 3CCLF 1PXWA 3MCAB 5G4UC 5EO3A 5FJ4C 3SIUA 1GO1A 1W3EX 3CCVF 3PAFA 2KTUA 2I6DA 3WXMB 1Q86H 3CC7F 1DT9A 3PLAC 3NK7A 1SDSA 4C4WC 3LWRC 2KTVA 3OBWA 5G4VC 1Q81H 1X52A 1M90H 5GANK 1RA4A 3N4YA 2OTLF 1YJWF 1M1KH 3RA6A 3CC2F 3CCMF 1VQ7F 3CCEF 4TZZA 1KC8H 3JCMM 3CCUF 1X7PA 3ON1A 1VQKF 5GIPC 3E1YA 3CPWF 3CCQF 3CD6F 1CK2A 3OBYA 5FLXM 2VGMA 1CN7A 1N8RH 3HAXD 3LFOA 1X7OA 2QEXF 2WALA 1NJIH 4X3MA 1T0KB 2QI2A 2VGNA 3SIVA 3J80M 1VQ9F 2OHWA 3CMEF 1W42A 3CC4F 5GINC 2LBXA 1JJ2F 3NVKE 2CZWA 3N4ZA 5GIOC 3AGKA 3OW2F 1RLGA 2LBWA 1YJ9F 3G71F 1VQOF 2FC3A 1VQMF 1QVFF 1K9MH 3CCRF 1GZ0A 1YIJF 3JAMM 3O85A 3E20B 3LWPC 1S72F 3I56F 3V7EA 1VQ4F 3J7AR 3CPQA 1IPAA 1W41A
chains in the Genus database with same CATH superfamily
5JVDB 3HTNA 1TVKA 3R0PA 4DRXB 3NK6A 2HP0B 5AVMA 3NVIB 4B46A 4O4HA 5C8YB 1Q7YH 5A2QM 1Q8RA 3KJJA 3JALB 2B33A 1KD1H 3L7QA 3HKCA 1H7MA 3WJQA 3FFMA 2H6LA 2IAFA 3HJWC 1JY8A 2KG4A 1K73H 1RQ7A 3CCJF 1QD9A 5EIBC 2QA4F 3S0WA 1IV4A 1XBIA 1U3LA 3JASB 1VK3A 5EZYA 1XV2A 3JAWB 2OZBA 5IT9M 3HKDA 3FBAA 3DDNA 3LMEA 2PMPA 5EWRA 5JH7A 5JQGA 3JAKB 4C82A 2BO1A 3CG6A 3I7TA 4BY9D 1XRGA 4G88A 4X20B 3FD5A 4TV9A 3HKBA 4X1IA 4BW0B 4EI8A 1VQLF 4I50B 4TV8B 4LNUB 4EB6A 4O4JB 4B45A 2Z1TA 4C8EA 1ZWZA 3V3TA 3Q8HA 1U43A 3MCAB 2UYPA 5EYPB 2H8CA 5EAZA 2RHLA 1JN1A 3RYIB 3U0OA 3S03A 1W3EX 1JD1A 4RQOA 3S06A 3WXMB 3PLAC 1IV1A 3NK7A 3C9RA 3JATA 2K1SA 3ESJA 1IV2A 2N48A 1RQ2A 3C9UA 3D54A 4YJ3A 4ZHQA 1W581 2ZAUA 2RHJA 3HKEA 3F0FA 4KWEA 3RA6A 3CCMF 3F6MA 1CLIA 1VQ7F 3TD5A 1FFXA 3KIZA 1VQKF 3CD6F 3E1YA 5B8FA 1CN7A 1N8RH 2YXZA 2G9IA 3LFOA 1OFUA 4O4IB 3IKFA 5MN5A 1T0KB 2ZOVA 5IJ0B 3CMEF 4FFBB 3RYHA 5GINC 1U40A 4X1YA 3VTIC 4BT6A 4E6EA 3OW2F 1RLGA 3IEQA 2CW4A 4IHJA 1RLUA 2GZLA 2FGYA 2HQSC 5LYJA 2LBWA 2CHSA 4BVTA 3N2GA 1VQMF 4O2AB 1DBFA 3CCRF 1YIJF 3KE1A 1SA0A 4BT3A 4EI7A 3I56F 3V7EA 4I55A 3CPQA 1JFFB 5CA0A 1VQ5F 3MBMA 1TUBA 2Z1FA 2ZODA 1W40A 5HY4A 3N2KA 3P4EA 5DCVA 4U3JA 3C9TA 3TD4A 1Q82H 3JVHA 3V7QA 2HS4A 2HVYD 2UYNB 3E22B 3K0TA 2HX0A 4LCKA 1SZQA 2I6RA 1PF5A 5HXZA 2V9YA 3C8LA 5EB0A 4O4HB 5HY0A 1W5FA 2BTUA 4BVQA 3F0EA 1GX1A 2UZHA 1YHQF 3HWUA 3F0GA 3MQWA 3BYQA 4WBNA 5KMGA 1ONIA 3CCSF 1QVGF 3K12A 2ZVYA 4X1KA 5GONA 3VO8A 4BT7A 3LWOC 2VXYA 5IJ9A 3S0HA 1OAPA 4HNAA 4C8IA 1W5BA 4PWTA 3G4SF 5LP6A 3WJPA 5EZYB 1X25A 1W5AA 4B62A 3HKDB 3ZOPA 5LOVA 5JCOC 2RB9A 2ALEA 3CCLF 5JH7B 5JQGB 5HY1A 4IIJA 1H47A 5EO3A 4TV9B 3HKBB 4X1IB 3UT5B 3CCVF 3SIUA 3RYFA 1Q86H 4O2BA 1DT9A 3KJKA 1SDSA 3LYBA 3WPXA 3OBWA 3T80A 4EB6B 5ITZA 1M90H 2P6YA 3N4YA 1YJWF 3ELCA 3CCEF 5J2UA 3JCMM 1KC8H 1X7PA 3JALA 5JCOA 2IG8A 3CCQF 3CPWF 4G4WA 3CB2A 2LCAA 3JATB 4F6RA 1UI9A 4YJ3B 5FLXM 2VGMA 4M8IA 3WJRA 5HWEA 2AMTA 4ZHWA 3MCQA 2LBTA 1QAHA 1X7OA 2WALA 3HKEB 4G4YA 4C81A 2QEXF 1NJIH 1FFXB 2VAMA 3MDOA 2OHWA 1W42A 2Z1UA 3JASA 3EORA 2EWCA 3AGKA 1COMA 4ZHVA 2W8BC 2AIZP 3G71F 4O4LB 1W59A 1ODEA 1QVFF 4ZHYB 5LXTA 5CB4A 1S72F 3E20B 3LWPC 2F9ZC 3K14A 4X20A 3RYHB 4TV8A 4U39A 4X1YB 4TUYB 4IHJB 3CYPB 2GVIA 4NQ3A 3CMAF 1VQNF 2BTOA 3N2GB 1Z5WA 3VI6A 1K8AH 2KGWA 2HP3A 2OTJF 3WPWA 3GYQA 1SA0B 3RA5A 1QU9A 5FNVA 2R6R1 1YITF 1R1MA 4I55B 4NUTA 1NMUB 3GTZA 2RHOA 1TUBB 1Z5VA 3LDTA 2QTPA 5KX5A 2L26A 3DC2A 3F0DA 3N2KB 3NMUC 2HRUA 5IYZA 4U3JB 3J81M 2HS3A 4X3LA 3I55F 1VQ6F 4G4ZA 2CHTA 1VQ8F 2CVLA 2AIFA 4ZOLA 5BMVA 4BVRA 3D00A 4R40B 2CSLA 1FNKA 4WBNB 5KMGB 4I4TA 2UYJA 3IR9A 5LP6C 4B5CA 4X1KB 3S0YA 1TVKB 3LWVC 1VQVA 3RE3A 5MN4A 3M1XA 2VAPA 1VH8A 4HNAB 5LA6A 2BTQB 5G4UC 1GO1A 3HKCB 2KTUA 2I6DA 2IQQA 2KTVA 1JFFA 2HS0A 5LOVB 1Q81H 5CA1A 3FPIA 3RYCA 5GANK 1RA4A 2NMUA 2Z01A 2VAWA 1M1KH 3B6NA 4YJ2A 3JARA 5J2TA 3ERNA 3K2XA 1FNJA 3ON1A 3M84A 3RYFB 4O2BB 3CCUF 5GIPC 1NQ3A 5ITZB 3HAXD 3C9SA 4X3MA 2VGNA 4ZI7A 5J2UB 3P10A 3SIVA 3VYSC 3J80M 1VQ9F 2CWJA 1JJ2F 2MQEA 4F6RB 3NVKE 2CZWA 3N4ZA 5JVDA 5GIOC 4DRXA 2HP0A 5HXUA 1YJ9F 5C8YA 2UYKA 4EI9A 3I3FA 3O85A 2Q1YA 1VQ4F 3J7AR 3QUWA 4ZHQB 1IPAA 3WGJA 5EB1B 1VQPF 3VMFB 4DXDA 3ZP4A 5GAPK 3OONA 2R751 1KQSF 3WGKA 5LXTB 5CB4B 4G4XA 3P0ZA 3JAWA 3UT5A 3CXCF 1E7KA 1T0AA 3TD3A 3G6EF 1W2BF 4BT5A 2ZVZA 1H48A 3FD6A 5HY2A 3GHZA 1YGYA 3JAKA 1KNJA 1YJNF 3M4SA 4C8GA 3VCZA 5FNVB 1XHOA 3CYQA 3IMPA 4I50A 4LNUA 4O4JA 5LYJB 1GO0A 5KX5B 5IYZB 5EYPA 1KNKA 2DYYA 3V4DA 3WGLA 3RYIA 4G4VA 4ZK7A 1UFYA 2JNBA 1FSZA 5CA0B 2GLZA 3LWQC 3IKEA 4ZOLB 5BMVB 3VYTC 2DT4A 1W55A 1YI2F 3VYUC 3ZO8A 3ZP7A 1PXWA 3QHDA 4O4LA 2PHNA 1IV3A 4BVSA 5FJ4C 4I4TB 2Z1EA 3PAFA 3CC7F 2YYEA 4C4WC 3LWRC 5G4VC 4BT2A 1X52A 2HRYA 4BT4A 4TUYA 2OTLF 4XCQA 4O4IA 2OTMA 3KHNA 5LA6B 3CC2F 5HP8A 3IEWA 3QTYA 3S02A 4TZZA 3WGMA 5GONB 5IJ0A 4FFBA 1CK2A 3OBYA 5IJ9B 4ERHA 3VIUA 5CA1B 3WGNA 3RYCB 2H8EA 3D01A 4O2AA 1W57A 5LP6B 2QI2A 4YJ2B 3JARB 5J2TB 1J7HA 3VOBA 3CC4F 2LBXA 4RHAA 2Q1XA 1VHAA 5HP7A 4NWOB 4IIJB 1VQOF 2FC3A 1K9MH 5MN6A 1GZ0A 3VOAA 3JAMM 4ZI7B 2RHHA 2UYNA 5EIBD 3E22A 1U3PA 2ZF8A 1W5EA 1YQNA 1W41A
chains in the Genus database with same CATH topology
1VQ5F 3NK6A 1VQPF 3VMFB 3NVIB 1W40A 5HY4A 5GAPK 4NQ3A 1Q7YH 3CMAF 1VQNF 1K8AH 5A2QM 3VI6A 5DCVA 1Q82H 1KQSF 2OTJF 3GYQA 3V7QA 3RA5A 2HVYD 1YITF 1KD1H 3CXCF 1H7MA 4NUTA 1E7KA 3FFMA 1NMUB 3G6EF 4LCKA 1W2BF 5HXZA 3HJWC 5HY2A 2KG4A 1K73H 5HY0A 3NMUC 1YJNF 4BVQA 3J81M 3CCJF 4X3LA 3I55F 1VQ6F 1YHQF 2QA4F 3CCSF 1QVGF 1XBIA 1VQ8F 2AIFA 2OZBA 5IT9M 3LWOC 4BVRA 3D00A 1GO0A 5EWRA 2BO1A 3CG6A 4BY9D 3G4SF 2JNBA 4BW0B 4EI8A 3IR9A 1VQLF 2GLZA 3LWQC 3LWVC 1YI2F 1ZWZA 3V3TA 2ALEA 3CCLF 1PXWA 3MCAB 5HY1A 5G4UC 5EO3A 5FJ4C 4BVSA 3SIUA 1GO1A 1W3EX 3CCVF 3PAFA 2KTUA 2I6DA 3WXMB 1Q86H 3CC7F 1DT9A 3PLAC 3NK7A 1SDSA 4C4WC 3LWRC 2KTVA 3OBWA 5G4VC 1Q81H 1X52A 1M90H 5GANK 1RA4A 3N4YA 4XCQA 2OTLF 1YJWF 1M1KH 3RA6A 3CC2F 3CCMF 1VQ7F 3CCEF 4TZZA 1KC8H 3JCMM 3CCUF 1X7PA 3ON1A 1VQKF 5GIPC 3E1YA 3CPWF 3CCQF 3CD6F 1CK2A 3OBYA 5FLXM 2VGMA 1CN7A 1N8RH 3HAXD 5HWEA 3LFOA 1X7OA 2QEXF 2WALA 1NJIH 4X3MA 1T0KB 2QI2A 2VGNA 3SIVA 3J80M 1VQ9F 2OHWA 3CMEF 1W42A 3CC4F 5GINC 2LBXA 1JJ2F 3NVKE 2CZWA 3N4ZA 5GIOC 3AGKA 3OW2F 1RLGA 5HXUA 2FGYA 2LBWA 1YJ9F 3G71F 4BVTA 1VQOF 2FC3A 1VQMF 1QVFF 1K9MH 3CCRF 1GZ0A 4EI9A 1YIJF 3JAMM 3O85A 3E20B 3LWPC 1S72F 2F9ZC 4EI7A 3I56F 3V7EA 1VQ4F 3J7AR 3CPQA 1IPAA 1W41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 F;  3NK6 A;  1VQP F;  3VMF B;  3NVI B;  1W40 A;  5GAP K;  1Q7Y H;  3CMA F;  1VQN F;  1K8A H;  5A2Q M;  3VI6 A;  5DCV A;  1Q82 H;  1KQS F;  2OTJ F;  3GYQ A;  3V7Q A;  3RA5 A;  2HVY D;  1YIT F;  1KD1 H;  3CXC F;  1H7M A;  4NUT A;  1E7K A;  3FFM A;  1NMU B;  3G6E F;  4LCK A;  1W2B F;  3HJW C;  2KG4 A;  1K73 H;  3NMU C;  1YJN F;  3CCJ F;  3J81 M;  4X3L A;  3I55 F;  1VQ6 F;  1YHQ F;  2QA4 F;  3CCS F;  1QVG F;  1XBI A;  1VQ8 F;  2AIF A;  2OZB A;  5IT9 M;  3LWO C;  1GO0 A;  5EWR A;  2BO1 A;  3CG6 A;  4BY9 D;  3G4S F;  2JNB A;  4BW0 B;  3IR9 A;  1VQL F;  3LWQ C;  3LWV C;  1YI2 F;  1ZWZ A;  2ALE A;  3CCL F;  1PXW A;  3MCA B;  5G4U C;  5EO3 A;  5FJ4 C;  3SIU A;  1GO1 A;  1W3E X;  3CCV F;  3PAF A;  2KTU A;  2I6D A;  3WXM B;  1Q86 H;  3CC7 F;  1DT9 A;  3PLA C;  3NK7 A;  1SDS A;  4C4W C;  3LWR C;  2KTV A;  3OBW A;  5G4V C;  1Q81 H;  1X52 A;  1M90 H;  5GAN K;  1RA4 A;  3N4Y A;  2OTL F;  1YJW F;  1M1K H;  3RA6 A;  3CC2 F;  3CCM F;  1VQ7 F;  3CCE F;  4TZZ A;  1KC8 H;  3JCM M;  3CCU F;  1X7P A;  3ON1 A;  1VQK F;  5GIP C;  3E1Y A;  3CPW F;  3CCQ F;  3CD6 F;  1CK2 A;  3OBY A;  5FLX M;  2VGM A;  1CN7 A;  1N8R H;  3HAX D;  3LFO A;  1X7O A;  2QEX F;  2WAL A;  1NJI H;  4X3M A;  1T0K B;  2QI2 A;  2VGN A;  3SIV A;  3J80 M;  1VQ9 F;  2OHW A;  3CME F;  1W42 A;  3CC4 F;  5GIN C;  2LBX A;  1JJ2 F;  3NVK E;  2CZW A;  3N4Z A;  5GIO C;  3AGK A;  3OW2 F;  1RLG A;  2LBW A;  1YJ9 F;  3G71 F;  1VQO F;  2FC3 A;  1VQM F;  1QVF F;  1K9M H;  3CCR F;  1GZ0 A;  1YIJ F;  3JAM M;  3O85 A;  3E20 B;  3LWP C;  1S72 F;  3I56 F;  3V7E A;  1VQ4 F;  3J7A R;  3CPQ A;  1IPA A;  1W41 A; 
#chains in the Genus database with same CATH topology
 5JVD B;  3HTN A;  1TVK A;  3R0P A;  4DRX B;  3NK6 A;  2HP0 B;  5AVM A;  3NVI B;  4B46 A;  4O4H A;  5C8Y B;  1Q7Y H;  5A2Q M;  1Q8R A;  3KJJ A;  3JAL B;  2B33 A;  1KD1 H;  3L7Q A;  3HKC A;  1H7M A;  3WJQ A;  3FFM A;  2H6L A;  2IAF A;  3HJW C;  1JY8 A;  2KG4 A;  1K73 H;  1RQ7 A;  3CCJ F;  1QD9 A;  5EIB C;  2QA4 F;  3S0W A;  1IV4 A;  1XBI A;  1U3L A;  3JAS B;  1VK3 A;  5EZY A;  1XV2 A;  3JAW B;  2OZB A;  5IT9 M;  3HKD A;  3FBA A;  3DDN A;  3LME A;  2PMP A;  5EWR A;  5JH7 A;  5JQG A;  3JAK B;  4C82 A;  2BO1 A;  3CG6 A;  3I7T A;  4BY9 D;  1XRG A;  4G88 A;  4X20 B;  3FD5 A;  4TV9 A;  3HKB A;  4X1I A;  4BW0 B;  4EI8 A;  1VQL F;  4I50 B;  4TV8 B;  4LNU B;  4EB6 A;  4O4J B;  4B45 A;  2Z1T A;  4C8E A;  1ZWZ A;  3V3T A;  3Q8H A;  1U43 A;  3MCA B;  2UYP A;  5EYP B;  2H8C A;  5EAZ A;  2RHL A;  1JN1 A;  3RYI B;  3U0O A;  3S03 A;  1W3E X;  1JD1 A;  4RQO A;  3S06 A;  3WXM B;  3PLA C;  1IV1 A;  3NK7 A;  3C9R A;  3JAT A;  2K1S A;  3ESJ A;  1IV2 A;  2N48 A;  1RQ2 A;  3C9U A;  3D54 A;  4YJ3 A;  4ZHQ A;  1W58 1;  2ZAU A;  2RHJ A;  3HKE A;  3F0F A;  4KWE A;  3RA6 A;  3CCM F;  3F6M A;  1CLI A;  1VQ7 F;  3TD5 A;  1FFX A;  3KIZ A;  1VQK F;  3CD6 F;  3E1Y A;  5B8F A;  1CN7 A;  1N8R H;  2YXZ A;  2G9I A;  3LFO A;  1OFU A;  4O4I B;  3IKF A;  5MN5 A;  1T0K B;  2ZOV A;  5IJ0 B;  3CME F;  4FFB B;  3RYH A;  5GIN C;  1U40 A;  4X1Y A;  3VTI C;  4BT6 A;  4E6E A;  3OW2 F;  1RLG A;  3IEQ A;  2CW4 A;  4IHJ A;  1RLU A;  2GZL A;  2FGY A;  2HQS C;  5LYJ A;  2LBW A;  2CHS A;  4BVT A;  3N2G A;  1VQM F;  4O2A B;  1DBF A;  3CCR F;  1YIJ F;  3KE1 A;  1SA0 A;  4BT3 A;  4EI7 A;  3I56 F;  3V7E A;  4I55 A;  3CPQ A;  1JFF B;  5CA0 A;  1VQ5 F;  3MBM A;  1TUB A;  2Z1F A;  2ZOD A;  1W40 A;  5HY4 A;  3N2K A;  3P4E A;  5DCV A;  4U3J A;  3C9T A;  3TD4 A;  1Q82 H;  3JVH A;  3V7Q A;  2HS4 A;  2HVY D;  2UYN B;  3E22 B;  3K0T A;  2HX0 A;  4LCK A;  1SZQ A;  2I6R A;  1PF5 A;  5HXZ A;  2V9Y A;  3C8L A;  5EB0 A;  4O4H B;  5HY0 A;  1W5F A;  2BTU A;  4BVQ A;  3F0E A;  1GX1 A;  2UZH A;  1YHQ F;  3HWU A;  3F0G A;  3MQW A;  3BYQ A;  4WBN A;  5KMG A;  1ONI A;  3CCS F;  1QVG F;  3K12 A;  2ZVY A;  4X1K A;  5GON A;  3VO8 A;  4BT7 A;  3LWO C;  2VXY A;  5IJ9 A;  3S0H A;  1OAP A;  4HNA A;  4C8I A;  1W5B A;  4PWT A;  3G4S F;  5LP6 A;  3WJP A;  5EZY B;  1X25 A;  1W5A A;  4B62 A;  3HKD B;  3ZOP A;  5LOV A;  5JCO C;  2RB9 A;  2ALE A;  3CCL F;  5JH7 B;  5JQG B;  5HY1 A;  4IIJ A;  1H47 A;  5EO3 A;  4TV9 B;  3HKB B;  4X1I B;  3UT5 B;  3CCV F;  3SIU A;  3RYF A;  1Q86 H;  4O2B A;  1DT9 A;  3KJK A;  1SDS A;  3LYB A;  3WPX A;  3OBW A;  3T80 A;  4EB6 B;  5ITZ A;  1M90 H;  2P6Y A;  3N4Y A;  1YJW F;  3ELC A;  3CCE F;  5J2U A;  3JCM M;  1KC8 H;  1X7P A;  3JAL A;  5JCO A;  2IG8 A;  3CCQ F;  3CPW F;  4G4W A;  3CB2 A;  2LCA A;  3JAT B;  4F6R A;  1UI9 A;  4YJ3 B;  5FLX M;  2VGM A;  4M8I A;  3WJR A;  5HWE A;  2AMT A;  4ZHW A;  3MCQ A;  2LBT A;  1QAH A;  1X7O A;  2WAL A;  3HKE B;  4G4Y A;  4C81 A;  2QEX F;  1NJI H;  1FFX B;  2VAM A;  3MDO A;  2OHW A;  1W42 A;  2Z1U A;  3JAS A;  3EOR A;  2EWC A;  3AGK A;  1COM A;  4ZHV A;  2W8B C;  2AIZ P;  3G71 F;  4O4L B;  1W59 A;  1ODE A;  1QVF F;  4ZHY B;  5LXT A;  5CB4 A;  1S72 F;  3E20 B;  3LWP C;  2F9Z C;  3K14 A;  4X20 A;  3RYH B;  4TV8 A;  4U39 A;  4X1Y B;  4TUY B;  4IHJ B;  3CYP B;  2GVI A;  4NQ3 A;  3CMA F;  1VQN F;  2BTO A;  3N2G B;  1Z5W A;  3VI6 A;  1K8A H;  2KGW A;  2HP3 A;  2OTJ F;  3WPW A;  3GYQ A;  1SA0 B;  3RA5 A;  1QU9 A;  5FNV A;  2R6R 1;  1YIT F;  1R1M A;  4I55 B;  4NUT A;  1NMU B;  3GTZ A;  2RHO A;  1TUB B;  1Z5V A;  3LDT A;  2QTP A;  5KX5 A;  2L26 A;  3DC2 A;  3F0D A;  3N2K B;  3NMU C;  2HRU A;  5IYZ A;  4U3J B;  3J81 M;  2HS3 A;  4X3L A;  3I55 F;  1VQ6 F;  4G4Z A;  2CHT A;  1VQ8 F;  2CVL A;  2AIF A;  4ZOL A;  5BMV A;  4BVR A;  3D00 A;  4R40 B;  2CSL A;  1FNK A;  4WBN B;  5KMG B;  4I4T A;  2UYJ A;  3IR9 A;  5LP6 C;  4B5C A;  4X1K B;  3S0Y A;  1TVK B;  3LWV C;  1VQV A;  3RE3 A;  5MN4 A;  3M1X A;  2VAP A;  1VH8 A;  4HNA B;  5LA6 A;  2BTQ B;  5G4U C;  1GO1 A;  3HKC B;  2KTU A;  2I6D A;  2IQQ A;  2KTV A;  1JFF A;  2HS0 A;  5LOV B;  1Q81 H;  5CA1 A;  3FPI A;  3RYC A;  5GAN K;  1RA4 A;  2NMU A;  2Z01 A;  2VAW A;  1M1K H;  3B6N A;  4YJ2 A;  3JAR A;  5J2T A;  3ERN A;  3K2X A;  1FNJ A;  3ON1 A;  3M84 A;  3RYF B;  4O2B B;  3CCU F;  5GIP C;  1NQ3 A;  5ITZ B;  3HAX D;  3C9S A;  4X3M A;  2VGN A;  4ZI7 A;  5J2U B;  3P10 A;  3SIV A;  3VYS C;  3J80 M;  1VQ9 F;  2CWJ A;  1JJ2 F;  2MQE A;  4F6R B;  3NVK E;  2CZW A;  3N4Z A;  5JVD A;  5GIO C;  4DRX A;  2HP0 A;  5HXU A;  1YJ9 F;  5C8Y A;  2UYK A;  4EI9 A;  3I3F A;  3O85 A;  2Q1Y A;  1VQ4 F;  3J7A R;  3QUW A;  4ZHQ B;  1IPA A;  3WGJ A;  5EB1 B;  1VQP F;  3VMF B;  4DXD A;  3ZP4 A;  5GAP K;  3OON A;  2R75 1;  1KQS F;  3WGK A;  5LXT B;  5CB4 B;  4G4X A;  3P0Z A;  3JAW A;  3UT5 A;  3CXC F;  1E7K A;  1T0A A;  3TD3 A;  3G6E F;  1W2B F;  4BT5 A;  2ZVZ A;  1H48 A;  3FD6 A;  5HY2 A;  3GHZ A;  1YGY A;  3JAK A;  1KNJ A;  1YJN F;  3M4S A;  4C8G A;  3VCZ A;  5FNV B;  1XHO A;  3CYQ A;  3IMP A;  4I50 A;  4LNU A;  4O4J A;  5LYJ B;  1GO0 A;  5KX5 B;  5IYZ B;  5EYP A;  1KNK A;  2DYY A;  3V4D A;  3WGL A;  3RYI A;  4G4V A;  4ZK7 A;  1UFY A;  2JNB A;  1FSZ A;  5CA0 B;  2GLZ A;  3LWQ C;  3IKE A;  4ZOL B;  5BMV B;  3VYT C;  2DT4 A;  1W55 A;  1YI2 F;  3VYU C;  3ZO8 A;  3ZP7 A;  1PXW A;  3QHD A;  4O4L A;  2PHN A;  1IV3 A;  4BVS A;  5FJ4 C;  4I4T B;  2Z1E A;  3PAF A;  3CC7 F;  2YYE A;  4C4W C;  3LWR C;  5G4V C;  4BT2 A;  1X52 A;  2HRY A;  4BT4 A;  4TUY A;  2OTL F;  4XCQ A;  4O4I A;  2OTM A;  3KHN A;  5LA6 B;  3CC2 F;  5HP8 A;  3IEW A;  3QTY A;  3S02 A;  4TZZ A;  3WGM A;  5GON B;  5IJ0 A;  4FFB A;  1CK2 A;  3OBY A;  5IJ9 B;  4ERH A;  3VIU A;  5CA1 B;  3WGN A;  3RYC B;  2H8E A;  3D01 A;  4O2A A;  1W57 A;  5LP6 B;  2QI2 A;  4YJ2 B;  3JAR B;  5J2T B;  1J7H A;  3VOB A;  3CC4 F;  2LBX A;  4RHA A;  2Q1X A;  1VHA A;  5HP7 A;  4NWO B;  4IIJ B;  1VQO F;  2FC3 A;  1K9M H;  5MN6 A;  1GZ0 A;  3VOA A;  3JAM M;  4ZI7 B;  2RHH A;  2UYN A;  5EIB D;  3E22 A;  1U3P A;  2ZF8 A;  1W5E A;  1YQN A;  1W41 A; 
#chains in the Genus database with same CATH homology
 1VQ5 F;  3NK6 A;  1VQP F;  3VMF B;  3NVI B;  1W40 A;  5HY4 A;  5GAP K;  4NQ3 A;  1Q7Y H;  3CMA F;  1VQN F;  1K8A H;  5A2Q M;  3VI6 A;  5DCV A;  1Q82 H;  1KQS F;  2OTJ F;  3GYQ A;  3V7Q A;  3RA5 A;  2HVY D;  1YIT F;  1KD1 H;  3CXC F;  1H7M A;  4NUT A;  1E7K A;  3FFM A;  1NMU B;  3G6E F;  4LCK A;  1W2B F;  5HXZ A;  3HJW C;  5HY2 A;  2KG4 A;  1K73 H;  5HY0 A;  3NMU C;  1YJN F;  4BVQ A;  3J81 M;  3CCJ F;  4X3L A;  3I55 F;  1VQ6 F;  1YHQ F;  2QA4 F;  3CCS F;  1QVG F;  1XBI A;  1VQ8 F;  2AIF A;  2OZB A;  5IT9 M;  3LWO C;  4BVR A;  3D00 A;  1GO0 A;  5EWR A;  2BO1 A;  3CG6 A;  4BY9 D;  3G4S F;  2JNB A;  4BW0 B;  4EI8 A;  3IR9 A;  1VQL F;  2GLZ A;  3LWQ C;  3LWV C;  1YI2 F;  1ZWZ A;  3V3T A;  2ALE A;  3CCL F;  1PXW A;  3MCA B;  5HY1 A;  5G4U C;  5EO3 A;  5FJ4 C;  4BVS A;  3SIU A;  1GO1 A;  1W3E X;  3CCV F;  3PAF A;  2KTU A;  2I6D A;  3WXM B;  1Q86 H;  3CC7 F;  1DT9 A;  3PLA C;  3NK7 A;  1SDS A;  4C4W C;  3LWR C;  2KTV A;  3OBW A;  5G4V C;  1Q81 H;  1X52 A;  1M90 H;  5GAN K;  1RA4 A;  3N4Y A;  4XCQ A;  2OTL F;  1YJW F;  1M1K H;  3RA6 A;  3CC2 F;  3CCM F;  1VQ7 F;  3CCE F;  4TZZ A;  1KC8 H;  3JCM M;  3CCU F;  1X7P A;  3ON1 A;  1VQK F;  5GIP C;  3E1Y A;  3CPW F;  3CCQ F;  3CD6 F;  1CK2 A;  3OBY A;  5FLX M;  2VGM A;  1CN7 A;  1N8R H;  3HAX D;  5HWE A;  3LFO A;  1X7O A;  2QEX F;  2WAL A;  1NJI H;  4X3M A;  1T0K B;  2QI2 A;  2VGN A;  3SIV A;  3J80 M;  1VQ9 F;  2OHW A;  3CME F;  1W42 A;  3CC4 F;  5GIN C;  2LBX A;  1JJ2 F;  3NVK E;  2CZW A;  3N4Z A;  5GIO C;  3AGK A;  3OW2 F;  1RLG A;  5HXU A;  2FGY A;  2LBW A;  1YJ9 F;  3G71 F;  4BVT A;  1VQO F;  2FC3 A;  1VQM F;  1QVF F;  1K9M H;  3CCR F;  1GZ0 A;  4EI9 A;  1YIJ F;  3JAM M;  3O85 A;  3E20 B;  3LWP C;  1S72 F;  2F9Z C;  4EI7 A;  3I56 F;  3V7E A;  1VQ4 F;  3J7A R;  3CPQ A;  1IPA A;  1W41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...