1PXWA

Crystal structure of l7ae srnp core protein from pyrococcus abyssii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
MEGWMMAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification, crystallization and preliminary X-ray diffraction data of L7Ae sRNP core protein from Pyrococcus abyssii.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Ribosome
molecule keywords LSU ribosomal protein L7AE
total genus 43
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1pxwA00
5DCVA 2FC3A 2QEXF 1H7MA 1PXWA 1N8RH 5G4UC 1VQKF 3NMUC 2OTJF 1Q82H 3GYQA 3CMEF 3CCSF 1RA4A 1CN7A 1GO0A 3OBWA 3LWOC 1KQSF 4NUTA 1KD1H 1GO1A 3E20B 1YITF 5IT9M 1YJ9F 2OHWA 2VGMA 3CG6A 3V7EA 3VI6A 2QA4F 3IR9A 3CCMF 3CCLF 3SIVA 3SIUA 3G71F 1X52A 5GIOC 3WXMB 4X3LA 1DT9A 1W2BF 3PLAC 2HVYD 2KG4A 4LCKA 3CPQA 1CK2A 2WALA 2BO1A 3CPWF 1ZWZA 2LBXA 1W42A 3E1YA 3CC7F 3OBYA 5GIPC 3LWRC 2OZBA 3ON1A 1X7PA 1S72F 1GZ0A 4BY9D 4C4WC 5EWRA 1YI2F 3G6EF 3JCMM 1QVGF 1VQ6F 2VGNA 1VQNF 1YJWF 1VQLF 3NVKE 2QI2A 3LWPC 5A2QM 2I6DA 5G4VC 1VQOF 2AIFA 1W3EX 3CCQF 2OTLF 1E7KA 3VMFB 3CC2F 3CCEF 3CCRF 1W41A 1QVFF 2JNBA 3LFOA 3OW2F 3O85A 1K8AH 5GINC 3CMAF 1T0KB 1KC8H 3N4ZA 1YHQF 3NK6A 1M90H 1YJNF 1W40A 1VQ8F 1VQ4F 3RA5A 3HJWC 5GAPK 3CCVF 3N4YA 1NMUB 3CCUF 1RLGA 1K73H 3PAFA 3V7QA 1VQ9F 3CC4F 1VQMF 3CCJF 1VQ7F 3J7AR 5FJ4C 2LBWA 1Q81H 5GANK 4BW0B 3CXCF 1M1KH 1Q7YH 3NK7A 1Q86H 1K9MH 3CD6F 2KTVA 1VQ5F 3I56F 3LWVC 4TZZA 3LWQC 1JJ2F 2ALEA 3AGKA 3NVIB 3RA6A 3MCAB 3FFMA 5FLXM 3J81M 1SDSA 3G4SF 1IPAA 2CZWA 3J80M 1X7OA 1XBIA 3HAXD 5EO3A 3I55F 4X3MA 3JAMM 1VQPF 1YIJF 2KTUA 1NJIH
chains in the Genus database with same CATH superfamily
2AMTA 3MCQA 2HP0A 2G9IA 3C9UA 4O4HB 5DCVA 4O4HA 3LMEA 2HX0A 2OTJF 2I6RA 5JVDA 5LXTA 1H47A 3CCSF 3HWUA 3CYPB 4KWEA 4NWOB 3E20B 1YITF 1CLIA 5IT9M 3WJQA 1YJ9F 2Z1UA 2Q1XA 3KJJA 3N2GA 3C9SA 3CG6A 3KHNA 2QA4F 4C8EA 1SZQA 3OONA 3K2XA 3VYTC 5GIOC 3WXMB 3M84A 3MDOA 4EB6B 1RQ2A 2WALA 2BO1A 2ZVZA 1Z5VA 4ZK7A 3RYIA 1GX1A 4O4IB 2ZVYA 1W42A 3S02A 2HRUA 1OFUA 2UYNA 3LWRC 4R40B 4BT6A 4C4WC 4NQ3A 1VQVA 3CYQA 1VH8A 1VHAA 3VOBA 2RHJA 1YQNA 3JCMM 1YJWF 3NVKE 1YGYA 2QI2A 4B46A 1W581 3LWPC 1H48A 4I50B 2I6DA 5G4VC 3VCZA 5EYPA 5IJ0A 3JATB 2ZODA 2OTLF 3CC2F 3JATA 2MQEA 3JAKB 5MN4A 3CCEF 2GLZA 3LFOA 3GTZA 3HKEA 3VIUA 1T0KB 1X25A 2GVIA 5MN5A 3NK6A 1IV3A 4DRXB 2KGWA 3F6MA 3IKEA 2CHSA 5GAPK 1NMUB 3VO8A 3FD6A 3QHDA 3RE3A 3S06A 5HY0A 3D54A 1VQMF 2RHHA 1TUBA 5GANK 4BW0B 3CXCF 1M1KH 4X1KA 5EIBD 1Q86H 3CD6F 3JVHA 4G4WA 3E22B 1KNKA 1IV1A 2UYKA 3LWQC 3WJPA 5ITZA 1JJ2F 1W5FA 4M8IA 4G4XA 4FFBB 3WPXA 1R1MA 4BT7A 3JASB 3ZP4A 4FFBA 1X7OA 4TV8A 4EI7A 4F6RA 3JAMM 1YIJF 1IV4A 2HS4A 4C8GA 2FC3A 1H7MA 2ZOVA 4TUYA 4WBNA 5HWEA 1N8RH 1W57A 5HP7A 4BVTA 3JARA 3GYQA 1KQSF 2Z01A 3WJRA 3K14A 4B45A 5LYJB 2OHWA 3QTYA 3WGNA 1RLUA 3VI6A 3V3TA 3SIVA 1X52A 2NMUA 5EB0A 4X3LA 2UYJA 4LCKA 2IG8A 3CPQA 1CK2A 1ONIA 1ZWZA 5LA6A 1JFFA 1FFXA 4O4IA 3ELCA 4I55B 4C82A 5GIPC 3ON1A 1X7PA 3FD5A 4I55A 4BY9D 2VXYA 5CB4B 1PF5A 3G6EF 1QVGF 5CB4A 4RHAA 2VGNA 5JCOA 3ERNA 1VQ6F 1FNJA 4DRXA 3M4SA 5KX5B 5JH7A 4BT4A 2CVLA 1VQOF 3V4DA 3HKDB 2H8CA 5C8YB 3CCQF 3VMFB 4LNUA 2BTQB 2CSLA 1W41A 5HY2A 1QVFF 2JNBA 3JALA 3MBMA 3JAKA 3TD3A 4X1KB 3HKEB 1Q8RA 4O4LB 2P6YA 3RYCA 1KC8H 5JCOC 4O4LA 3C9TA 2HS3A 4YJ2B 5IYZB 1VQ4F 2DT4A 5IJ9A 4RQOA 5GONA 5JQGA 3CCUF 1U43A 1T0AA 1RLGA 3S0YA 3S0WA 3V7QA 3L7QA 4G4YA 3Q8HA 3RYHB 1FNKA 2OTMA 1W5BA 4WBNB 4C81A 4O2BA 3NK7A 1Q7YH 4EI8A 3WGKA 2CHTA 3GHZA 4O2BB 3TD4A 3WGLA 3S0HA 3BYQA 2ALEA 3QUWA 3NVIB 1TVKB 3M1XA 2AIZP 2CWJA 3N2KB 3RA6A 3FFMA 4ZI7A 5LYJA 3N2GB 1RQ7A 3KJKA 1IPAA 4DXDA 3J80M 1KNJA 3RYFB 1OAPA 1VK3A 4X3MA 4ZOLB 2IQQA 1NJIH 4F6RB 2QEXF 2RB9A 5LP6A 1PXWA 5G4UC 4G88A 1JY8A 1VQKF 4BVRA 2ZAUA 5LP6B 3NMUC 1U40A 1RA4A 1FFXB 3OBWA 2IAFA 3LWOC 4NUTA 3LYBA 1GO1A 3VOAA 4X1YA 2VGMA 4ZHVA 3P4EA 1J7HA 3IR9A 4IIJB 3CCLF 2YYEA 3SIUA 3G71F 2PHNA 3K12A 2UYPA 1DT9A 2KG4A 4IHJB 2PMPA 5JH7B 3CPWF 5AVMA 3FPIA 1XHOA 3P10A 4I50A 5B8FA 5IJ0B 5LXTB 4YJ3B 3D01A 3ZO8A 4LNUB 4E6EA 3JALB 1S72F 2K1SA 1UFYA 5EWRA 3VYUC 3RYCB 3F0DA 1W5AA 3HKBB 1VQNF 3B6NA 5IYZA 3HKBA 4BT2A 4TV9A 3I7TA 4BVQA 4ZHQA 1VQLF 5KMGB 5IJ9B 3F0EA 1QU9A 2VAWA 2W8BC 5KX5A 1IV2A 4O2AA 5HY1A 1E7KA 2L26A 3HKCB 3CCRF 3KE1A 3RYHA 2UYNB 1TUBB 3HKCA 1QAHA 2EWCA 4BT5A 2QTPA 4BT3A 3E22A 2R6R1 4BVSA 1M90H 2HP3A 3JAWB 1YJNF 1VQ8F 1TVKA 3ESJA 2F9ZC 4YJ2A 3HJWC 4ZI7B 3WGJA 3MQWA 3TD5A 3UT5A 3DC2A 4PWTA 5EYPB 5HY4A 5JQGB 2RHLA 3PAFA 1K73H 2LCAA 1VQ7F 1NQ3A 5FNVB 5FJ4C 5CA1B 2LBWA 2R751 3C8LA 4G4ZA 3WGMA 3HTNA 1U3PA 3LDTA 2UZHA 4TUYB 5CA1A 2RHOA 1K9MH 3DDNA 5BMVA 3T80A 1VQ5F 2BTOA 2DYYA 4U3JA 4X20A 3AGKA 2N48A 3MCAB 2V9YA 5FLXM 3G4SF 3N2KA 3HAXD 3I55F 4B62A 1DBFA 2Q1YA 4ZOLA 1UI9A 2LBTA 2BTUA 1COMA 4HNAA 1Q82H 5LA6B 3CMEF 1CN7A 1GO0A 5ITZB 1SA0B 1KD1H 3ZOPA 3CB2A 1SA0A 5MN6A 3I3FA 3JASA 3V7EA 4TV8B 4X1YB 4G4VA 2ZF8A 3CCMF 2H6LA 4X1IB 3P0ZA 4O4JB 4ZHYB 5EZYB 4IIJA 4ERHA 4X1IA 3ZP7A 5LP6C 1W2BF 3PLAC 4TV9B 4ZHQB 2HVYD 2HQSC 5LOVB 2VAMA 4IHJA 5J2UA 2H8EA 5JVDB 2LBXA 4O2AB 3JARB 5C8YA 1W55A 3E1YA 5J2UB 5LOVA 3CC7F 4YJ3A 3OBYA 1Z5WA 2OZBA 3D00A 1GZ0A 3FBAA 1FSZA 5HXUA 5HXZA 1YI2F 2VAPA 2CW4A 3JAWA 1XRGA 3VTIC 3EORA 2KTUA 4EB6A 5A2QM 2Z1FA 1W59A 5GONB 3RYIB 3IMPA 1QD9A 2AIFA 1W3EX 3UT5B 2Z1EA 5KMGA 4I4TB 1JFFB 3S03A 4I4TA 1W5EA 2FGYA 3OW2F 3O85A 5EIBC 1K8AH 5GINC 3CMAF 4XCQA 3KIZA 1JN1A 3N4ZA 2GZLA 1YHQF 1W40A 3U0OA 5CA0A 1XV2A 5EAZA 3RA5A 3F0FA 1ODEA 4U39A 5CA0B 3CCVF 5J2TB 3N4YA 2Z1TA 1U3LA 3HKDA 4EI9A 3RYFA 5J2TA 3C9RA 3WPWA 1VQ9F 4B5CA 3CC4F 2YXZA 3CCJF 3J7AR 3IEQA 2HRYA 1Q81H 5FNVA 2HS0A 3VYSC 5HP8A 2KTVA 4HNAB 3K0TA 5BMVB 3I56F 1JD1A 4TZZA 3LWVC 4C8IA 5EB1B 2B33A 4U3JB 4X20B 3F0GA 3J81M 1SDSA 4ZHWA 3IKFA 2CZWA 3IEWA 1XBIA 5EO3A 2HP0B 1VQPF 3R0PA 4O4JA 5EZYA
chains in the Genus database with same CATH topology
5DCVA 2FC3A 2QEXF 1H7MA 1PXWA 5HWEA 1N8RH 5G4UC 1VQKF 4BVRA 3NMUC 2OTJF 1Q82H 4BVTA 3GYQA 3CMEF 3CCSF 1RA4A 1CN7A 1GO0A 3OBWA 3LWOC 1KQSF 4NUTA 1KD1H 1GO1A 3E20B 1YITF 5IT9M 1YJ9F 2OHWA 2VGMA 3CG6A 3V7EA 3VI6A 2QA4F 3V3TA 3IR9A 3CCMF 3CCLF 3SIVA 3SIUA 3G71F 1X52A 5GIOC 3WXMB 4X3LA 1DT9A 1W2BF 3PLAC 2HVYD 2KG4A 4LCKA 3CPQA 1CK2A 2WALA 2BO1A 3CPWF 1ZWZA 2LBXA 1W42A 3E1YA 3CC7F 3OBYA 5GIPC 3LWRC 2OZBA 3D00A 3ON1A 1X7PA 1S72F 1GZ0A 4BY9D 4C4WC 5HXUA 5EWRA 5HXZA 4NQ3A 1YI2F 3G6EF 3JCMM 1QVGF 1VQ6F 2VGNA 1VQNF 1YJWF 4BVQA 1VQLF 3NVKE 2QI2A 3LWPC 5A2QM 2I6DA 5G4VC 1VQOF 2AIFA 1W3EX 5HY1A 3CCQF 2OTLF 1E7KA 3VMFB 3CC2F 3CCEF 3CCRF 5HY2A 1W41A 2GLZA 1QVFF 2JNBA 3LFOA 2FGYA 3OW2F 3O85A 1K8AH 5GINC 3CMAF 1T0KB 1KC8H 4XCQA 3N4ZA 4BVSA 1YHQF 3NK6A 1M90H 1YJNF 1W40A 1VQ8F 1VQ4F 2F9ZC 3RA5A 3HJWC 5GAPK 3CCVF 3N4YA 1NMUB 3CCUF 4EI9A 5HY4A 1RLGA 1K73H 3PAFA 5HY0A 3V7QA 1VQ9F 3CC4F 1VQMF 3CCJF 1VQ7F 3J7AR 5FJ4C 2LBWA 1Q81H 5GANK 4BW0B 3CXCF 1M1KH 1YIJF 1Q7YH 3NK7A 1Q86H 1K9MH 3CD6F 4EI8A 2KTVA 1VQ5F 3I56F 3LWVC 4TZZA 3LWQC 1JJ2F 2ALEA 3AGKA 3NVIB 3RA6A 3MCAB 3FFMA 5FLXM 3J81M 1SDSA 3G4SF 1IPAA 2CZWA 3J80M 1X7OA 1XBIA 3HAXD 5EO3A 3I55F 4X3MA 4EI7A 3JAMM 1VQPF 2KTUA 1NJIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCV A;  2FC3 A;  2QEX F;  1H7M A;  1PXW A;  1N8R H;  5G4U C;  1VQK F;  3NMU C;  2OTJ F;  1Q82 H;  3GYQ A;  3CME F;  3CCS F;  1RA4 A;  1CN7 A;  1GO0 A;  3OBW A;  3LWO C;  1KQS F;  4NUT A;  1KD1 H;  1GO1 A;  3E20 B;  1YIT F;  5IT9 M;  1YJ9 F;  2OHW A;  2VGM A;  3CG6 A;  3V7E A;  3VI6 A;  2QA4 F;  3IR9 A;  3CCM F;  3CCL F;  3SIV A;  3SIU A;  3G71 F;  1X52 A;  5GIO C;  3WXM B;  4X3L A;  1DT9 A;  1W2B F;  3PLA C;  2HVY D;  2KG4 A;  4LCK A;  3CPQ A;  1CK2 A;  2WAL A;  2BO1 A;  3CPW F;  1ZWZ A;  2LBX A;  1W42 A;  3E1Y A;  3CC7 F;  3OBY A;  5GIP C;  3LWR C;  2OZB A;  3ON1 A;  1X7P A;  1S72 F;  1GZ0 A;  4BY9 D;  4C4W C;  5EWR A;  1YI2 F;  3G6E F;  3JCM M;  1QVG F;  1VQ6 F;  2VGN A;  1VQN F;  1YJW F;  1VQL F;  3NVK E;  2QI2 A;  3LWP C;  5A2Q M;  2I6D A;  5G4V C;  1VQO F;  2AIF A;  1W3E X;  3CCQ F;  2OTL F;  1E7K A;  3VMF B;  3CC2 F;  3CCE F;  3CCR F;  1W41 A;  1QVF F;  2JNB A;  3LFO A;  3OW2 F;  3O85 A;  1K8A H;  5GIN C;  3CMA F;  1T0K B;  1KC8 H;  3N4Z A;  1YHQ F;  3NK6 A;  1M90 H;  1YJN F;  1W40 A;  1VQ8 F;  1VQ4 F;  3RA5 A;  3HJW C;  5GAP K;  3CCV F;  3N4Y A;  1NMU B;  3CCU F;  1RLG A;  1K73 H;  3PAF A;  3V7Q A;  1VQ9 F;  3CC4 F;  1VQM F;  3CCJ F;  1VQ7 F;  3J7A R;  5FJ4 C;  2LBW A;  1Q81 H;  5GAN K;  4BW0 B;  3CXC F;  1M1K H;  1Q7Y H;  3NK7 A;  1Q86 H;  1K9M H;  3CD6 F;  2KTV A;  1VQ5 F;  3I56 F;  3LWV C;  4TZZ A;  3LWQ C;  1JJ2 F;  2ALE A;  3AGK A;  3NVI B;  3RA6 A;  3MCA B;  3FFM A;  5FLX M;  3J81 M;  1SDS A;  3G4S F;  1IPA A;  2CZW A;  3J80 M;  1X7O A;  1XBI A;  3HAX D;  5EO3 A;  3I55 F;  4X3M A;  3JAM M;  1VQP F;  1YIJ F;  2KTU A;  1NJI H; 
#chains in the Genus database with same CATH topology
 2AMT A;  3MCQ A;  2HP0 A;  2G9I A;  3C9U A;  4O4H B;  5DCV A;  4O4H A;  3LME A;  2HX0 A;  2OTJ F;  2I6R A;  5JVD A;  5LXT A;  1H47 A;  3CCS F;  3HWU A;  3CYP B;  4KWE A;  4NWO B;  3E20 B;  1YIT F;  1CLI A;  5IT9 M;  3WJQ A;  1YJ9 F;  2Z1U A;  2Q1X A;  3KJJ A;  3N2G A;  3C9S A;  3CG6 A;  3KHN A;  2QA4 F;  4C8E A;  1SZQ A;  3OON A;  3K2X A;  3VYT C;  5GIO C;  3WXM B;  3M84 A;  3MDO A;  4EB6 B;  1RQ2 A;  2WAL A;  2BO1 A;  2ZVZ A;  1Z5V A;  4ZK7 A;  3RYI A;  1GX1 A;  4O4I B;  2ZVY A;  1W42 A;  3S02 A;  2HRU A;  1OFU A;  2UYN A;  3LWR C;  4R40 B;  4BT6 A;  4C4W C;  4NQ3 A;  1VQV A;  3CYQ A;  1VH8 A;  1VHA A;  3VOB A;  2RHJ A;  1YQN A;  3JCM M;  1YJW F;  3NVK E;  1YGY A;  2QI2 A;  4B46 A;  1W58 1;  3LWP C;  1H48 A;  4I50 B;  2I6D A;  5G4V C;  3VCZ A;  5EYP A;  5IJ0 A;  3JAT B;  2ZOD A;  2OTL F;  3CC2 F;  3JAT A;  2MQE A;  3JAK B;  5MN4 A;  3CCE F;  2GLZ A;  3LFO A;  3GTZ A;  3HKE A;  3VIU A;  1T0K B;  1X25 A;  2GVI A;  5MN5 A;  3NK6 A;  1IV3 A;  4DRX B;  2KGW A;  3F6M A;  3IKE A;  2CHS A;  5GAP K;  1NMU B;  3VO8 A;  3FD6 A;  3QHD A;  3RE3 A;  3S06 A;  5HY0 A;  3D54 A;  1VQM F;  2RHH A;  1TUB A;  5GAN K;  4BW0 B;  3CXC F;  1M1K H;  4X1K A;  5EIB D;  1Q86 H;  3CD6 F;  3JVH A;  4G4W A;  3E22 B;  1KNK A;  1IV1 A;  2UYK A;  3LWQ C;  3WJP A;  5ITZ A;  1JJ2 F;  1W5F A;  4M8I A;  4G4X A;  4FFB B;  3WPX A;  1R1M A;  4BT7 A;  3JAS B;  3ZP4 A;  4FFB A;  1X7O A;  4TV8 A;  4EI7 A;  4F6R A;  3JAM M;  1YIJ F;  1IV4 A;  2HS4 A;  4C8G A;  2FC3 A;  1H7M A;  2ZOV A;  4TUY A;  4WBN A;  5HWE A;  1N8R H;  1W57 A;  5HP7 A;  4BVT A;  3JAR A;  3GYQ A;  1KQS F;  2Z01 A;  3WJR A;  3K14 A;  4B45 A;  5LYJ B;  2OHW A;  3QTY A;  3WGN A;  1RLU A;  3VI6 A;  3V3T A;  3SIV A;  1X52 A;  2NMU A;  5EB0 A;  4X3L A;  2UYJ A;  4LCK A;  2IG8 A;  3CPQ A;  1CK2 A;  1ONI A;  1ZWZ A;  5LA6 A;  1JFF A;  1FFX A;  4O4I A;  3ELC A;  4I55 B;  4C82 A;  5GIP C;  3ON1 A;  1X7P A;  3FD5 A;  4I55 A;  4BY9 D;  2VXY A;  5CB4 B;  1PF5 A;  3G6E F;  1QVG F;  5CB4 A;  4RHA A;  2VGN A;  5JCO A;  3ERN A;  1VQ6 F;  1FNJ A;  4DRX A;  3M4S A;  5KX5 B;  5JH7 A;  4BT4 A;  2CVL A;  1VQO F;  3V4D A;  3HKD B;  2H8C A;  5C8Y B;  3CCQ F;  3VMF B;  4LNU A;  2BTQ B;  2CSL A;  1W41 A;  5HY2 A;  1QVF F;  2JNB A;  3JAL A;  3MBM A;  3JAK A;  3TD3 A;  4X1K B;  3HKE B;  1Q8R A;  4O4L B;  2P6Y A;  3RYC A;  1KC8 H;  5JCO C;  4O4L A;  3C9T A;  2HS3 A;  4YJ2 B;  5IYZ B;  1VQ4 F;  2DT4 A;  5IJ9 A;  4RQO A;  5GON A;  5JQG A;  3CCU F;  1U43 A;  1T0A A;  1RLG A;  3S0Y A;  3S0W A;  3V7Q A;  3L7Q A;  4G4Y A;  3Q8H A;  3RYH B;  1FNK A;  2OTM A;  1W5B A;  4WBN B;  4C81 A;  4O2B A;  3NK7 A;  1Q7Y H;  4EI8 A;  3WGK A;  2CHT A;  3GHZ A;  4O2B B;  3TD4 A;  3WGL A;  3S0H A;  3BYQ A;  2ALE A;  3QUW A;  3NVI B;  1TVK B;  3M1X A;  2AIZ P;  2CWJ A;  3N2K B;  3RA6 A;  3FFM A;  4ZI7 A;  5LYJ A;  3N2G B;  1RQ7 A;  3KJK A;  1IPA A;  4DXD A;  3J80 M;  1KNJ A;  3RYF B;  1OAP A;  1VK3 A;  4X3M A;  4ZOL B;  2IQQ A;  1NJI H;  4F6R B;  2QEX F;  2RB9 A;  5LP6 A;  1PXW A;  5G4U C;  4G88 A;  1JY8 A;  1VQK F;  4BVR A;  2ZAU A;  5LP6 B;  3NMU C;  1U40 A;  1RA4 A;  1FFX B;  3OBW A;  2IAF A;  3LWO C;  4NUT A;  3LYB A;  1GO1 A;  3VOA A;  4X1Y A;  2VGM A;  4ZHV A;  3P4E A;  1J7H A;  3IR9 A;  4IIJ B;  3CCL F;  2YYE A;  3SIU A;  3G71 F;  2PHN A;  3K12 A;  2UYP A;  1DT9 A;  2KG4 A;  4IHJ B;  2PMP A;  5JH7 B;  3CPW F;  5AVM A;  3FPI A;  1XHO A;  3P10 A;  4I50 A;  5B8F A;  5IJ0 B;  5LXT B;  4YJ3 B;  3D01 A;  3ZO8 A;  4LNU B;  4E6E A;  3JAL B;  1S72 F;  2K1S A;  1UFY A;  5EWR A;  3VYU C;  3RYC B;  3F0D A;  1W5A A;  3HKB B;  1VQN F;  3B6N A;  5IYZ A;  3HKB A;  4BT2 A;  4TV9 A;  3I7T A;  4BVQ A;  4ZHQ A;  1VQL F;  5KMG B;  5IJ9 B;  3F0E A;  1QU9 A;  2VAW A;  2W8B C;  5KX5 A;  1IV2 A;  4O2A A;  5HY1 A;  1E7K A;  2L26 A;  3HKC B;  3CCR F;  3KE1 A;  3RYH A;  2UYN B;  1TUB B;  3HKC A;  1QAH A;  2EWC A;  4BT5 A;  2QTP A;  4BT3 A;  3E22 A;  2R6R 1;  4BVS A;  1M90 H;  2HP3 A;  3JAW B;  1YJN F;  1VQ8 F;  1TVK A;  3ESJ A;  2F9Z C;  4YJ2 A;  3HJW C;  4ZI7 B;  3WGJ A;  3MQW A;  3TD5 A;  3UT5 A;  3DC2 A;  4PWT A;  5EYP B;  5HY4 A;  5JQG B;  2RHL A;  3PAF A;  1K73 H;  2LCA A;  1VQ7 F;  1NQ3 A;  5FNV B;  5FJ4 C;  5CA1 B;  2LBW A;  2R75 1;  3C8L A;  4G4Z A;  3WGM A;  3HTN A;  1U3P A;  3LDT A;  2UZH A;  4TUY B;  5CA1 A;  2RHO A;  1K9M H;  3DDN A;  5BMV A;  3T80 A;  1VQ5 F;  2BTO A;  2DYY A;  4U3J A;  4X20 A;  3AGK A;  2N48 A;  3MCA B;  2V9Y A;  5FLX M;  3G4S F;  3N2K A;  3HAX D;  3I55 F;  4B62 A;  1DBF A;  2Q1Y A;  4ZOL A;  1UI9 A;  2LBT A;  2BTU A;  1COM A;  4HNA A;  1Q82 H;  5LA6 B;  3CME F;  1CN7 A;  1GO0 A;  5ITZ B;  1SA0 B;  1KD1 H;  3ZOP A;  3CB2 A;  1SA0 A;  5MN6 A;  3I3F A;  3JAS A;  3V7E A;  4TV8 B;  4X1Y B;  4G4V A;  2ZF8 A;  3CCM F;  2H6L A;  4X1I B;  3P0Z A;  4O4J B;  4ZHY B;  5EZY B;  4IIJ A;  4ERH A;  4X1I A;  3ZP7 A;  5LP6 C;  1W2B F;  3PLA C;  4TV9 B;  4ZHQ B;  2HVY D;  2HQS C;  5LOV B;  2VAM A;  4IHJ A;  5J2U A;  2H8E A;  5JVD B;  2LBX A;  4O2A B;  3JAR B;  5C8Y A;  1W55 A;  3E1Y A;  5J2U B;  5LOV A;  3CC7 F;  4YJ3 A;  3OBY A;  1Z5W A;  2OZB A;  3D00 A;  1GZ0 A;  3FBA A;  1FSZ A;  5HXU A;  5HXZ A;  1YI2 F;  2VAP A;  2CW4 A;  3JAW A;  1XRG A;  3VTI C;  3EOR A;  2KTU A;  4EB6 A;  5A2Q M;  2Z1F A;  1W59 A;  5GON B;  3RYI B;  3IMP A;  1QD9 A;  2AIF A;  1W3E X;  3UT5 B;  2Z1E A;  5KMG A;  4I4T B;  1JFF B;  3S03 A;  4I4T A;  1W5E A;  2FGY A;  3OW2 F;  3O85 A;  5EIB C;  1K8A H;  5GIN C;  3CMA F;  4XCQ A;  3KIZ A;  1JN1 A;  3N4Z A;  2GZL A;  1YHQ F;  1W40 A;  3U0O A;  5CA0 A;  1XV2 A;  5EAZ A;  3RA5 A;  3F0F A;  1ODE A;  4U39 A;  5CA0 B;  3CCV F;  5J2T B;  3N4Y A;  2Z1T A;  1U3L A;  3HKD A;  4EI9 A;  3RYF A;  5J2T A;  3C9R A;  3WPW A;  1VQ9 F;  4B5C A;  3CC4 F;  2YXZ A;  3CCJ F;  3J7A R;  3IEQ A;  2HRY A;  1Q81 H;  5FNV A;  2HS0 A;  3VYS C;  5HP8 A;  2KTV A;  4HNA B;  3K0T A;  5BMV B;  3I56 F;  1JD1 A;  4TZZ A;  3LWV C;  4C8I A;  5EB1 B;  2B33 A;  4U3J B;  4X20 B;  3F0G A;  3J81 M;  1SDS A;  4ZHW A;  3IKF A;  2CZW A;  3IEW A;  1XBI A;  5EO3 A;  2HP0 B;  1VQP F;  3R0P A;  4O4J A;  5EZY A; 
#chains in the Genus database with same CATH homology
 5DCV A;  2FC3 A;  2QEX F;  1H7M A;  1PXW A;  5HWE A;  1N8R H;  5G4U C;  1VQK F;  4BVR A;  3NMU C;  2OTJ F;  1Q82 H;  4BVT A;  3GYQ A;  3CME F;  3CCS F;  1RA4 A;  1CN7 A;  1GO0 A;  3OBW A;  3LWO C;  1KQS F;  4NUT A;  1KD1 H;  1GO1 A;  3E20 B;  1YIT F;  5IT9 M;  1YJ9 F;  2OHW A;  2VGM A;  3CG6 A;  3V7E A;  3VI6 A;  2QA4 F;  3V3T A;  3IR9 A;  3CCM F;  3CCL F;  3SIV A;  3SIU A;  3G71 F;  1X52 A;  5GIO C;  3WXM B;  4X3L A;  1DT9 A;  1W2B F;  3PLA C;  2HVY D;  2KG4 A;  4LCK A;  3CPQ A;  1CK2 A;  2WAL A;  2BO1 A;  3CPW F;  1ZWZ A;  2LBX A;  1W42 A;  3E1Y A;  3CC7 F;  3OBY A;  5GIP C;  3LWR C;  2OZB A;  3D00 A;  3ON1 A;  1X7P A;  1S72 F;  1GZ0 A;  4BY9 D;  4C4W C;  5HXU A;  5EWR A;  5HXZ A;  4NQ3 A;  1YI2 F;  3G6E F;  3JCM M;  1QVG F;  1VQ6 F;  2VGN A;  1VQN F;  1YJW F;  4BVQ A;  1VQL F;  3NVK E;  2QI2 A;  3LWP C;  5A2Q M;  2I6D A;  5G4V C;  1VQO F;  2AIF A;  1W3E X;  5HY1 A;  3CCQ F;  2OTL F;  1E7K A;  3VMF B;  3CC2 F;  3CCE F;  3CCR F;  5HY2 A;  1W41 A;  2GLZ A;  1QVF F;  2JNB A;  3LFO A;  2FGY A;  3OW2 F;  3O85 A;  1K8A H;  5GIN C;  3CMA F;  1T0K B;  1KC8 H;  4XCQ A;  3N4Z A;  4BVS A;  1YHQ F;  3NK6 A;  1M90 H;  1YJN F;  1W40 A;  1VQ8 F;  1VQ4 F;  2F9Z C;  3RA5 A;  3HJW C;  5GAP K;  3CCV F;  3N4Y A;  1NMU B;  3CCU F;  4EI9 A;  5HY4 A;  1RLG A;  1K73 H;  3PAF A;  5HY0 A;  3V7Q A;  1VQ9 F;  3CC4 F;  1VQM F;  3CCJ F;  1VQ7 F;  3J7A R;  5FJ4 C;  2LBW A;  1Q81 H;  5GAN K;  4BW0 B;  3CXC F;  1M1K H;  1YIJ F;  1Q7Y H;  3NK7 A;  1Q86 H;  1K9M H;  3CD6 F;  4EI8 A;  2KTV A;  1VQ5 F;  3I56 F;  3LWV C;  4TZZ A;  3LWQ C;  1JJ2 F;  2ALE A;  3AGK A;  3NVI B;  3RA6 A;  3MCA B;  3FFM A;  5FLX M;  3J81 M;  1SDS A;  3G4S F;  1IPA A;  2CZW A;  3J80 M;  1X7O A;  1XBI A;  3HAX D;  5EO3 A;  3I55 F;  4X3M A;  4EI7 A;  3JAM M;  1VQP F;  2KTU A;  1NJI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...