1X25A

Crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
SHMETVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0076 protein ST0811
publication title Crystal structure of the YjgF/YER057c/UK114 family protein from the hyperthermophilic archaeon Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1x25A00
2CVLA 5HP8A 1COMA 2IG8A 3LYBA 2B33A 3M4SA 3KJKA 3R0PA 3ZO8A 2CHSA 2UYNA 3L7QA 1QAHA 1UI9A 3QUWA 2CW4A 1NQ3A 2CHTA 3K0TA 2UYNB 2UYJA 2CWJA 2OTMA 1ODEA 1XRGA 3V4DA 1QD9A 3I7TA 3GTZA 5HP7A 4ZK7A 3D01A 1JD1A 1UFYA 4NWOB 3ZP4A 1J7HA 3KJJA 1XHOA 2CSLA 3M1XA 2DYYA 3ZP7A 1FNJA 1DBFA 3MQWA 1X25A 1PF5A 2EWCA 3K12A 1QU9A 3ZOPA 2UYKA 1ONIA 2UYPA 3I3FA 3VCZA 1FNKA 3LMEA
chains in the Genus database with same CATH superfamily
4O4IA 3S03A 2RHLA 2KG4A 2LBTA 1T0AA 3JCMM 4BY9D 2HP0B 2YXZA 1GO1A 2CW4A 4C8IA 4LCKA 2CHTA 1VK3A 2VGMA 2OTMA 1JY8A 1OAPA 4HNAB 2Q1XA 5EIBD 1XBIA 4KWEA 3CD6F 4X1IB 1YJWF 5EYPA 3ZP7A 1FNJA 3M84A 3U0OA 5G4UC 3FFMA 3WGLA 1NJIH 4IIJB 1VQNF 3LFOA 1SZQA 1VQ8F 1PXWA 5IJ0B 3LWPC 1IV4A 5HY1A 3MDOA 1W55A 4BVRA 5IJ9A 2HX0A 3IEWA 3RA6A 2H6LA 5LA6B 4ZHWA 3QUWA 2ALEA 2R751 3VI6A 3FD5A 3NK7A 4BT5A 3WPWA 2MQEA 2WALA 3Q8HA 4X20B 1K73H 2VAPA 2HVYD 5JH7A 1Q8RA 1VQ9F 5HXZA 3LWVC 3M1XA 4C8EA 5CA0B 4B62A 1X25A 5JCOC 4DRXB 1W5AA 4NUTA 1VQ6F 1W3EX 3VCZA 5EIBC 1SA0B 3E22B 1FFXA 1OFUA 1IPAA 3J80M 2F9ZC 5J2TA 5HXUA 3G4SF 3LWRC 1VQ4F 5EZYB 3CMAF 2K1SA 5JQGB 2OTJF 3D00A 1JD1A 2KTVA 1J7HA 2BTOA 3RYHA 3MQWA 2V9YA 3S0WA 2LBXA 4G4ZA 4U3JB 5MN6A 3JARA 3OBWA 2UYPA 3HKDB 4G4YA 3OBYA 3HKCA 3OONA 4X1KB 3WJPA 2L26A 3WJQA 1M90H 3JAWB 1YQNA 2R6R1 5FLXM 3CC2F 4ZI7B 3VOBA 3IKFA 1TVKA 4O4HA 3HJWC 3NK6A 4ZHQB 1SDSA 2GVIA 3HTNA 4X1YA 5LOVB 5IT9M 5BMVA 1W57A 1PF5A 2RHJA 1VQLF 2PMPA 1VQ5F 3CCSF 5ITZA 3R0PA 2CHSA 3S0HA 1M1KH 2KGWA 2LBWA 2UYNB 1E7KA 4LNUB 3I56F 2UYJA 5C8YA 1ODEA 2UZHA 2OTLF 3I7TA 3JALB 4BW0B 2HRYA 3N2GB 5IYZA 3RYIA 3RYCA 2LCAA 5LP6B 4EI9A 3JATA 5KX5B 2IQQA 1KNKA 2HP3A 1ONIA 4EI8A 3N4YA 3HKBA 5LP6C 2CVLA 2PHNA 3AGKA 3CC4F 3LYBA 1W581 3J7AR 4O2BA 3P10A 2RHHA 1QAHA 4FFBA 4EB6B 4YJ2A 1YHQF 3S0YA 1RA4A 3FPIA 1NMUB 3D01A 1UFYA 2H8CA 1Q81H 2N48A 2DYYA 3GHZA 3E20B 4G4WA 3ZOPA 3CCJF 1X7PA 3FBAA 5CA1A 3PLAC 1TUBA 3JASA 5EYPB 1QVFF 1W5EA 1CK2A 3MBMA 5GIPC 4PWTA 2CZWA 2B33A 1N8RH 4U39A 1VQ7F 1UI9A 2BTQB 3V7QA 3E1YA 1W40A 5GONA 3QTYA 2CWJA 1XRGA 4YJ3A 2HS3A 5IJ9B 3KJJA 1YGYA 4F6RA 1DBFA 3EORA 5LXTA 3CCUF 5LYJA 4TUYA 1KQSF 3V7EA 2HS0A 3GYQA 1VQOF 5JH7B 3CG6A 5CB4A 4TZZA 2Z1EA 3HAXD 1RQ7A 4ERHA 3C9TA 2VAWA 1T0KB 4IHJA 2IG8A 1W41A 4I4TA 5JVDA 3CCQF 2AIFA 3G6EF 3WJRA 3N2KA 1JFFA 1X7OA 4O4JA 4B5CA 5EO3A 2ZVZA 5AVMA 2OHWA 5HWEA 1QVGF 2FC3A 3NVIB 3WGKA 3CB2A 3WGJA 5J2TB 1YI2F 4B45A 1W42A 5HY0A 3NVKE 3WXMB 1K8AH 4ZHVA 1GX1A 3IEQA 5GANK 2ZOVA 1FNKA 3K2XA 3TD5A 2G9IA 3RYHB 5MN5A 1CLIA 1R1MA 4ZOLA 1RQ2A 3JARB 3L7QA 4O4LA 2RB9A 2GLZA 3RYFA 2ZODA 1Z5WA 3ERNA 3HKCB 3GTZA 3JAKA 3HKDA 2P6YA 1W59A 2RHOA 3VTIC 2CSLA 2QTPA 2ZAUA 1U40A 3N4ZA 1TVKB 3KIZA 4O4HB 4TV8A 5HY4A 5GAPK 4I50A 4M8IA 4O2AA 1KD1H 4X3LA 3BYQA 1YJNF 2VGNA 5EWRA 2Z1UA 2VXYA 4X1YB 3P4EA 3VMFB 5EAZA 5HP8A 5BMVB 4ZHQA 3M4SA 4C82A 5DCVA 2AIZP 1JN1A 3VO8A 1VQKF 5ITZB 3CPQA 4DXDA 4ZK7A 4RHAA 1IV3A 4XCQA 1U3PA 2KTUA 5J2UA 1IV1A 3MCQA 5KMGA 3CC7F 3CCEF 1ZWZA 3CMEF 5C8YB 3NMUC 1K9MH 3K12A 3VYUC 3VYSC 1YITF 3UT5A 2JNBA 4BT4A 5IYZB 1U3LA 3RYCB 5HY2A 2OZBA 4BT7A 2ZF8A 3JATB 4TV9A 3HKBB 4I55A 3HKEA 3C9RA 4G88A 2Z01A 4R40B 2Z1FA 1QD9A 4O4IB 5FNVA 4BT3A 4WBNA 2GZLA 3KHNA 4NWOB 3DDNA 3ZP4A 3LWOC 4O2BB 3CCVF 4FFBB 1GO0A 4YJ2B 3K14A 4BVTA 2HP0A 1H48A 2UYKA 3CCMF 2BO1A 1YIJF 4HNAA 5EB1B 3FD6A 1U43A 3V3TA 1VQMF 4X1IA 5CA1B 1TUBB 3IR9A 3JASB 1W2BF 4IIJA 1CN7A 3PAFA 5IJ0A 3TD3A 4BVSA 1Q7YH 3WPXA 3TD4A 3C9SA 4C8GA 5GONB 1DT9A 4RQOA 5LA6A 4YJ3B 4G4XA 1VQVA 4F6RB 4X3MA 2FGYA 5LXTB 5JCOA 4X20A 5LYJB 4TUYB 3J81M 2HRUA 3CYPB 5CA0A 3P0ZA 2QI2A 4BT6A 1X52A 1VQPF 5CB4B 4DRXA 4C4WC 3HWUA 4IHJB 4EI7A 5HP7A 3S02A 1RLUA 5A2QM 1GZ0A 3WGMA 3G71F 4I4TB 3JVHA 5JVDB 1FFXB 1SA0A 3E22A 3KE1A 3N2KB 2W8BC 1JFFB 1KNJA 2ZVYA 4C81A 3JAMM 3VIUA 4O4JB 2AMTA 1VHAA 1QU9A 3CYQA 3CCRF 3ELCA 3CCLF 3LMEA 5EZYA 3SIUA 5JQGA 4E6EA 3CXCF 2IAFA 1Q86H 5MN4A 3V4DA 4U3JA 2HQSC 3S06A 2QEXF 3RA5A 5FJ4C 2QA4F 4ZOLB 3MCAB 1XHOA 2H8EA 4O4LB 2BTUA 5B8FA 3RYFB 4BVQA 4X1KA 3CPWF 3F0GA 3JAKB 3JAWA 3I3FA 5GINC 3LDTA 3O85A 4ZI7A 3I55F 1JJ2F 3C9UA 1Z5VA 3VYTC 2DT4A 1W5FA 1H7MA 2VAMA 4TV8B 2YYEA 3ZO8A 4I50B 4O2AB 5LOVA 1Q82H 3B6NA 3K0TA 3F6MA 3VOAA 3ESJA 3ON1A 1S72F 2Z1TA 4ZHYB 1YJ9F 3F0EA 1KC8H 3IMPA 3RE3A 5GIOC 3F0FA 4G4VA 1XV2A 3IKEA 4B46A 1FSZA 2UYNA 4LNUA 3RYIB 5J2UB 3DC2A 3QHDA 1COMA 3JALA 3F0DA 5KMGB 5G4VC 1RLGA 3N2GA 3D54A 3KJKA 1W5BA 4BT2A 3UT5B 5LP6A 2NMUA 1NQ3A 5EB0A 1IV2A 3SIVA 2Q1YA 5KX5A 4NQ3A 2I6RA 3LWQC 3C8LA 4TV9B 1VH8A 2I6DA 1H47A 4I55B 3WGNA 3HKEB 3OW2F 4WBNB 2EWCA 5FNVB 3T80A 4EB6A 2HS4A
chains in the Genus database with same CATH topology
2CVLA 5HP8A 1COMA 2IG8A 3LYBA 2B33A 3M4SA 3KJKA 3R0PA 3ZO8A 2CHSA 2UYNA 3L7QA 1QAHA 1UI9A 3QUWA 2CW4A 1NQ3A 2CHTA 3K0TA 2UYNB 2UYJA 2CWJA 2OTMA 1ODEA 1XRGA 3V4DA 1QD9A 3I7TA 3GTZA 5HP7A 4ZK7A 3D01A 1JD1A 1UFYA 4NWOB 3ZP4A 1J7HA 3KJJA 1XHOA 2CSLA 3M1XA 2DYYA 3ZP7A 1FNJA 1DBFA 3MQWA 1X25A 1PF5A 2EWCA 3K12A 1QU9A 3ZOPA 2UYKA 1ONIA 2UYPA 3I3FA 3VCZA 1FNKA 3LMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVL A;  5HP8 A;  1COM A;  2IG8 A;  3LYB A;  2B33 A;  3M4S A;  3KJK A;  3R0P A;  3ZO8 A;  2CHS A;  2UYN A;  3L7Q A;  1QAH A;  1UI9 A;  3QUW A;  2CW4 A;  1NQ3 A;  2CHT A;  3K0T A;  2UYN B;  2UYJ A;  2CWJ A;  2OTM A;  1ODE A;  1XRG A;  3V4D A;  1QD9 A;  3I7T A;  3GTZ A;  5HP7 A;  4ZK7 A;  3D01 A;  1JD1 A;  1UFY A;  4NWO B;  3ZP4 A;  1J7H A;  3KJJ A;  1XHO A;  2CSL A;  3M1X A;  2DYY A;  3ZP7 A;  1FNJ A;  1DBF A;  3MQW A;  1X25 A;  1PF5 A;  2EWC A;  3K12 A;  1QU9 A;  3ZOP A;  2UYK A;  1ONI A;  2UYP A;  3I3F A;  3VCZ A;  1FNK A;  3LME A; 
#chains in the Genus database with same CATH topology
 4O4I A;  3S03 A;  2RHL A;  2KG4 A;  2LBT A;  1T0A A;  3JCM M;  4BY9 D;  2HP0 B;  2YXZ A;  1GO1 A;  2CW4 A;  4C8I A;  4LCK A;  2CHT A;  1VK3 A;  2VGM A;  2OTM A;  1JY8 A;  1OAP A;  4HNA B;  2Q1X A;  5EIB D;  1XBI A;  4KWE A;  3CD6 F;  4X1I B;  1YJW F;  5EYP A;  3ZP7 A;  1FNJ A;  3M84 A;  3U0O A;  5G4U C;  3FFM A;  3WGL A;  1NJI H;  4IIJ B;  1VQN F;  3LFO A;  1SZQ A;  1VQ8 F;  1PXW A;  5IJ0 B;  3LWP C;  1IV4 A;  5HY1 A;  3MDO A;  1W55 A;  4BVR A;  5IJ9 A;  2HX0 A;  3IEW A;  3RA6 A;  2H6L A;  5LA6 B;  4ZHW A;  3QUW A;  2ALE A;  2R75 1;  3VI6 A;  3FD5 A;  3NK7 A;  4BT5 A;  3WPW A;  2MQE A;  2WAL A;  3Q8H A;  4X20 B;  1K73 H;  2VAP A;  2HVY D;  5JH7 A;  1Q8R A;  1VQ9 F;  5HXZ A;  3LWV C;  3M1X A;  4C8E A;  5CA0 B;  4B62 A;  1X25 A;  5JCO C;  4DRX B;  1W5A A;  4NUT A;  1VQ6 F;  1W3E X;  3VCZ A;  5EIB C;  1SA0 B;  3E22 B;  1FFX A;  1OFU A;  1IPA A;  3J80 M;  2F9Z C;  5J2T A;  5HXU A;  3G4S F;  3LWR C;  1VQ4 F;  5EZY B;  3CMA F;  2K1S A;  5JQG B;  2OTJ F;  3D00 A;  1JD1 A;  2KTV A;  1J7H A;  2BTO A;  3RYH A;  3MQW A;  2V9Y A;  3S0W A;  2LBX A;  4G4Z A;  4U3J B;  5MN6 A;  3JAR A;  3OBW A;  2UYP A;  3HKD B;  4G4Y A;  3OBY A;  3HKC A;  3OON A;  4X1K B;  3WJP A;  2L26 A;  3WJQ A;  1M90 H;  3JAW B;  1YQN A;  2R6R 1;  5FLX M;  3CC2 F;  4ZI7 B;  3VOB A;  3IKF A;  1TVK A;  4O4H A;  3HJW C;  3NK6 A;  4ZHQ B;  1SDS A;  2GVI A;  3HTN A;  4X1Y A;  5LOV B;  5IT9 M;  5BMV A;  1W57 A;  1PF5 A;  2RHJ A;  1VQL F;  2PMP A;  1VQ5 F;  3CCS F;  5ITZ A;  3R0P A;  2CHS A;  3S0H A;  1M1K H;  2KGW A;  2LBW A;  2UYN B;  1E7K A;  4LNU B;  3I56 F;  2UYJ A;  5C8Y A;  1ODE A;  2UZH A;  2OTL F;  3I7T A;  3JAL B;  4BW0 B;  2HRY A;  3N2G B;  5IYZ A;  3RYI A;  3RYC A;  2LCA A;  5LP6 B;  4EI9 A;  3JAT A;  5KX5 B;  2IQQ A;  1KNK A;  2HP3 A;  1ONI A;  4EI8 A;  3N4Y A;  3HKB A;  5LP6 C;  2CVL A;  2PHN A;  3AGK A;  3CC4 F;  3LYB A;  1W58 1;  3J7A R;  4O2B A;  3P10 A;  2RHH A;  1QAH A;  4FFB A;  4EB6 B;  4YJ2 A;  1YHQ F;  3S0Y A;  1RA4 A;  3FPI A;  1NMU B;  3D01 A;  1UFY A;  2H8C A;  1Q81 H;  2N48 A;  2DYY A;  3GHZ A;  3E20 B;  4G4W A;  3ZOP A;  3CCJ F;  1X7P A;  3FBA A;  5CA1 A;  3PLA C;  1TUB A;  3JAS A;  5EYP B;  1QVF F;  1W5E A;  1CK2 A;  3MBM A;  5GIP C;  4PWT A;  2CZW A;  2B33 A;  1N8R H;  4U39 A;  1VQ7 F;  1UI9 A;  2BTQ B;  3V7Q A;  3E1Y A;  1W40 A;  5GON A;  3QTY A;  2CWJ A;  1XRG A;  4YJ3 A;  2HS3 A;  5IJ9 B;  3KJJ A;  1YGY A;  4F6R A;  1DBF A;  3EOR A;  5LXT A;  3CCU F;  5LYJ A;  4TUY A;  1KQS F;  3V7E A;  2HS0 A;  3GYQ A;  1VQO F;  5JH7 B;  3CG6 A;  5CB4 A;  4TZZ A;  2Z1E A;  3HAX D;  1RQ7 A;  4ERH A;  3C9T A;  2VAW A;  1T0K B;  4IHJ A;  2IG8 A;  1W41 A;  4I4T A;  5JVD A;  3CCQ F;  2AIF A;  3G6E F;  3WJR A;  3N2K A;  1JFF A;  1X7O A;  4O4J A;  4B5C A;  5EO3 A;  2ZVZ A;  5AVM A;  2OHW A;  5HWE A;  1QVG F;  2FC3 A;  3NVI B;  3WGK A;  3CB2 A;  3WGJ A;  5J2T B;  1YI2 F;  4B45 A;  1W42 A;  5HY0 A;  3NVK E;  3WXM B;  1K8A H;  4ZHV A;  1GX1 A;  3IEQ A;  5GAN K;  2ZOV A;  1FNK A;  3K2X A;  3TD5 A;  2G9I A;  3RYH B;  5MN5 A;  1CLI A;  1R1M A;  4ZOL A;  1RQ2 A;  3JAR B;  3L7Q A;  4O4L A;  2RB9 A;  2GLZ A;  3RYF A;  2ZOD A;  1Z5W A;  3ERN A;  3HKC B;  3GTZ A;  3JAK A;  3HKD A;  2P6Y A;  1W59 A;  2RHO A;  3VTI C;  2CSL A;  2QTP A;  2ZAU A;  1U40 A;  3N4Z A;  1TVK B;  3KIZ A;  4O4H B;  4TV8 A;  5HY4 A;  5GAP K;  4I50 A;  4M8I A;  4O2A A;  1KD1 H;  4X3L A;  3BYQ A;  1YJN F;  2VGN A;  5EWR A;  2Z1U A;  2VXY A;  4X1Y B;  3P4E A;  3VMF B;  5EAZ A;  5HP8 A;  5BMV B;  4ZHQ A;  3M4S A;  4C82 A;  5DCV A;  2AIZ P;  1JN1 A;  3VO8 A;  1VQK F;  5ITZ B;  3CPQ A;  4DXD A;  4ZK7 A;  4RHA A;  1IV3 A;  4XCQ A;  1U3P A;  2KTU A;  5J2U A;  1IV1 A;  3MCQ A;  5KMG A;  3CC7 F;  3CCE F;  1ZWZ A;  3CME F;  5C8Y B;  3NMU C;  1K9M H;  3K12 A;  3VYU C;  3VYS C;  1YIT F;  3UT5 A;  2JNB A;  4BT4 A;  5IYZ B;  1U3L A;  3RYC B;  5HY2 A;  2OZB A;  4BT7 A;  2ZF8 A;  3JAT B;  4TV9 A;  3HKB B;  4I55 A;  3HKE A;  3C9R A;  4G88 A;  2Z01 A;  4R40 B;  2Z1F A;  1QD9 A;  4O4I B;  5FNV A;  4BT3 A;  4WBN A;  2GZL A;  3KHN A;  4NWO B;  3DDN A;  3ZP4 A;  3LWO C;  4O2B B;  3CCV F;  4FFB B;  1GO0 A;  4YJ2 B;  3K14 A;  4BVT A;  2HP0 A;  1H48 A;  2UYK A;  3CCM F;  2BO1 A;  1YIJ F;  4HNA A;  5EB1 B;  3FD6 A;  1U43 A;  3V3T A;  1VQM F;  4X1I A;  5CA1 B;  1TUB B;  3IR9 A;  3JAS B;  1W2B F;  4IIJ A;  1CN7 A;  3PAF A;  5IJ0 A;  3TD3 A;  4BVS A;  1Q7Y H;  3WPX A;  3TD4 A;  3C9S A;  4C8G A;  5GON B;  1DT9 A;  4RQO A;  5LA6 A;  4YJ3 B;  4G4X A;  1VQV A;  4F6R B;  4X3M A;  2FGY A;  5LXT B;  5JCO A;  4X20 A;  5LYJ B;  4TUY B;  3J81 M;  2HRU A;  3CYP B;  5CA0 A;  3P0Z A;  2QI2 A;  4BT6 A;  1X52 A;  1VQP F;  5CB4 B;  4DRX A;  4C4W C;  3HWU A;  4IHJ B;  4EI7 A;  5HP7 A;  3S02 A;  1RLU A;  5A2Q M;  1GZ0 A;  3WGM A;  3G71 F;  4I4T B;  3JVH A;  5JVD B;  1FFX B;  1SA0 A;  3E22 A;  3KE1 A;  3N2K B;  2W8B C;  1JFF B;  1KNJ A;  2ZVY A;  4C81 A;  3JAM M;  3VIU A;  4O4J B;  2AMT A;  1VHA A;  1QU9 A;  3CYQ A;  3CCR F;  3ELC A;  3CCL F;  3LME A;  5EZY A;  3SIU A;  5JQG A;  4E6E A;  3CXC F;  2IAF A;  1Q86 H;  5MN4 A;  3V4D A;  4U3J A;  2HQS C;  3S06 A;  2QEX F;  3RA5 A;  5FJ4 C;  2QA4 F;  4ZOL B;  3MCA B;  1XHO A;  2H8E A;  4O4L B;  2BTU A;  5B8F A;  3RYF B;  4BVQ A;  4X1K A;  3CPW F;  3F0G A;  3JAK B;  3JAW A;  3I3F A;  5GIN C;  3LDT A;  3O85 A;  4ZI7 A;  3I55 F;  1JJ2 F;  3C9U A;  1Z5V A;  3VYT C;  2DT4 A;  1W5F A;  1H7M A;  2VAM A;  4TV8 B;  2YYE A;  3ZO8 A;  4I50 B;  4O2A B;  5LOV A;  1Q82 H;  3B6N A;  3K0T A;  3F6M A;  3VOA A;  3ESJ A;  3ON1 A;  1S72 F;  2Z1T A;  4ZHY B;  1YJ9 F;  3F0E A;  1KC8 H;  3IMP A;  3RE3 A;  5GIO C;  3F0F A;  4G4V A;  1XV2 A;  3IKE A;  4B46 A;  1FSZ A;  2UYN A;  4LNU A;  3RYI B;  5J2U B;  3DC2 A;  3QHD A;  1COM A;  3JAL A;  3F0D A;  5KMG B;  5G4V C;  1RLG A;  3N2G A;  3D54 A;  3KJK A;  1W5B A;  4BT2 A;  3UT5 B;  5LP6 A;  2NMU A;  1NQ3 A;  5EB0 A;  1IV2 A;  3SIV A;  2Q1Y A;  5KX5 A;  4NQ3 A;  2I6R A;  3LWQ C;  3C8L A;  4TV9 B;  1VH8 A;  2I6D A;  1H47 A;  4I55 B;  3WGN A;  3HKE B;  3OW2 F;  4WBN B;  2EWC A;  5FNV B;  3T80 A;  4EB6 A;  2HS4 A; 
#chains in the Genus database with same CATH homology
 2CVL A;  5HP8 A;  1COM A;  2IG8 A;  3LYB A;  2B33 A;  3M4S A;  3KJK A;  3R0P A;  3ZO8 A;  2CHS A;  2UYN A;  3L7Q A;  1QAH A;  1UI9 A;  3QUW A;  2CW4 A;  1NQ3 A;  2CHT A;  3K0T A;  2UYN B;  2UYJ A;  2CWJ A;  2OTM A;  1ODE A;  1XRG A;  3V4D A;  1QD9 A;  3I7T A;  3GTZ A;  5HP7 A;  4ZK7 A;  3D01 A;  1JD1 A;  1UFY A;  4NWO B;  3ZP4 A;  1J7H A;  3KJJ A;  1XHO A;  2CSL A;  3M1X A;  2DYY A;  3ZP7 A;  1FNJ A;  1DBF A;  3MQW A;  1X25 A;  1PF5 A;  2EWC A;  3K12 A;  1QU9 A;  3ZOP A;  2UYK A;  1ONI A;  2UYP A;  3I3F A;  3VCZ A;  1FNK A;  3LME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...