1X25A

Crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
SHMETVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0076 protein ST0811
publication title Crystal structure of the YjgF/YER057c/UK114 family protein from the hyperthermophilic archaeon Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1x25A00
2EWCA 1PF5A 3I7TA 3M1XA 1UI9A 3K0TA 3ZOPA 4ZK7A 1UFYA 2UYKA 3KJKA 3ZP7A 3R0PA 3ZO8A 2UYPA 1QAHA 5HP7A 3QUWA 4NWOB 1XRGA 2UYJA 3K12A 1ONIA 1X25A 1DBFA 1NQ3A 2IG8A 2DYYA 3LMEA 1FNJA 1XHOA 2CHTA 2CWJA 3L7QA 2CHSA 3MQWA 2CSLA 3ZP4A 2CW4A 3D01A 1FNKA 1QU9A 2B33A 2UYNA 3LYBA 5HP8A 3I3FA 3V4DA 3VCZA 1ODEA 1QD9A 2OTMA 2CVLA 1COMA 1J7HA 3GTZA 2UYNB 3KJJA 3M4SA 1JD1A
chains in the Genus database with same CATH superfamily
4WBNA 4BY9D 3K2XA 3M1XA 3CCJF 3KJKA 2KG4A 3JCMM 1R1MA 2UYPA 3E20B 3M84A 4NWOB 3JASB 3K12A 2HRUA 2CZWA 5FLXM 3OONA 3LDTA 2I6DA 2IG8A 4G4XA 4ERHA 5HXUA 4BVRA 1RQ2A 3VIUA 4I4TB 1S72F 2BTUA 4RHAA 2PMPA 4O4IB 4G4VA 3LWRC 4X20B 4I55B 4X1KB 5EIBC 3HJWC 3F0DA 3WJPA 4TV9A 3OBWA 2UYNB 3NMUC 3SIUA 5JCOC 4FFBB 3HWUA 1SA0B 3RE3A 4EB6A 5LXTA 1H7MA 3VYUC 1NJIH 1JN1A 4E6EA 2BTOA 1JJ2F 4X3MA 4O4JA 3C9RA 1GZ0A 2I6RA 4G88A 2DYYA 4O4LB 3LWQC 2GZLA 3HKEB 3GYQA 2WALA 1FFXA 3D01A 4LCKA 3N2KB 3GHZA 5J2UB 2HVYD 4M8IA 1GX1A 1Z5VA 3HKDB 1X52A 5C8YB 3N4ZA 3M4SA 3IEQA 3KHNA 4U3JA 5IJ0B 3NK7A 4U39A 3LWPC 3K0TA 3ZO8A 1U3LA 3VMFB 2UYJA 3MBMA 1IV3A 2VXYA 3ELCA 1OAPA 3FBAA 3N2GB 1NQ3A 1T0AA 2G9IA 1VQ6F 4G4ZA 2HS4A 3VYTC 3HKCB 5LOVA 2UZHA 3J7AR 5JQGA 3ERNA 3K14A 5HP8A 5JCOA 1Q81H 4IIJB 5FNVB 2VAWA 4LNUB 3CCEF 3VI6A 3GTZA 1N8RH 3F0FA 1SZQA 2RB9A 3E22B 3WGLA 3JASA 4ZK7A 1VQMF 1H48A 1W57A 3S03A 3EORA 3JAKB 1ONIA 3FD5A 3FD6A 1NMUB 4YJ2B 1U3PA 4EB6B 2QTPA 4I4TA 3WGMA 3I55F 1DT9A 2K1SA 2CHTA 5MN5A 4O4IA 2CHSA 4I55A 4X1KA 3P0ZA 2UYNA 2RHOA 3CB2A 3I3FA 3S06A 1QD9A 4ZHVA 3ESJA 4FFBA 1FSZA 1SA0A 2YYEA 2OTJF 3CYPB 5EYPB 1UI9A 3WGNA 3CPWF 3IMPA 3IKFA 1PXWA 2IQQA 1XRGA 1XV2A 4ZHWA 1JY8A 1YI2F 2MQEA 5EB1B 4O4LA 1W3EX 3NK6A 3HKEA 2HP0B 1Q86H 1W5EA 2ZODA 3AGKA 3V7QA 3N2KA 5G4UC 4I50B 5J2UA 2RHLA 3OW2F 3OBYA 3HKDA 1FNKA 5C8YA 2N48A 1QVFF 2R6R1 1Q8RA 5IJ0A 5ITZB 3PLAC 2RHHA 1JD1A 1VQNF 5JVDB 5GAPK 3HTNA 5BMVB 3HAXD 4G4WA 3N2GA 1RLUA 5MN6A 3HKCA 3F0EA 4IIJA 1XHOA 5FNVA 4LNUA 3CCLF 2L26A 3E22A 1M1KH 1YHQF 4BVTA 3G6EF 1VQOF 4RQOA 5CB4B 3JAKA 1KC8H 3J80M 1UFYA 3JALB 4YJ2A 1RQ7A 2PHNA 5HP7A 4TUYB 1IV2A 5LA6B 3P10A 1X25A 1DBFA 2RHJA 2VGMA 5FJ4C 4BT3A 3LMEA 5CA0B 3RA5A 4C8GA 5AVMA 1W581 2AIZP 5CA1B 1VQ7F 5EYPA 5KMGB 3S0YA 5IJ9B 3QHDA 3T80A 1PF5A 3JARB 3VTIC 4IHJB 3J81M 5GIOC 2HP0A 1IV4A 5J2TB 5IYZB 1TVKB 3RYIB 3DDNA 4BT7A 5IT9M 4I50A 4O4HB 1VK3A 1VQPF 5HWEA 1FNJA 1TUBB 1KNKA 1W5FA 2ZAUA 5ITZA 3C9TA 1GO0A 4O2BB 4B45A 3NVKE 4HNAB 2Z1TA 3WPXA 5HY1A 5JVDA 3WJQA 4EI8A 5BMVA 1J7HA 1VQVA 3SIVA 4O2AB 3CG6A 5LYJB 4G4YA 1YJNF 3RA6A 3U0OA 2H8EA 3QUWA 3CCUF 5EO3A 3V7EA 2Z1FA 3C9UA 4C82A 2W8BC 1XBIA 3LFOA 3D54A 2LBWA 4C81A 3I56F 1K73H 4C4WC 1M90H 4ZHYB 5EWRA 1QU9A 3TD4A 3MCQA 3CC7F 1YJWF 5EZYB 5A2QM 5CB4A 2Q1XA 3KE1A 3WGKA 1W42A 3JALA 1GO1A 5HY4A 4KWEA 2F9ZC 4TUYA 1YITF 3C8LA 3P4EA 5LA6A 2UYKA 3RYHB 1VQ4F 1Z5WA 4X1YB 1YIJF 1ZWZA 2YXZA 2Q1YA 2H8CA 1X7OA 5CA0A 1Q82H 4ZHQB 5CA1A 5LP6B 5KMGA 2B33A 4F6RB 3S0WA 1VQKF 3CC2F 5GANK 5IJ9A 3HKBA 1VQ5F 3JARA 4DRXB 1IPAA 1COMA 4IHJA 1YQNA 3RYFA 4BW0B 3S02A 3CCQF 2EWCA 5IYZA 1TVKA 3RYIA 5J2TA 3G4SF 4O4HA 2VAPA 3FPIA 4ZI7B 5JH7B 2KTVA 3F0GA 2AMTA 3IKEA 3UT5B 2JNBA 1JFFB 2HQSC 3JATB 1TUBA 1Q7YH 2ZF8A 1U43A 3N4YA 1KD1H 4O2BA 1IV1A 1SDSA 3L7QA 4HNAA 2Z1UA 3CCMF 1VQ9F 1RA4A 2NMUA 2CW4A 1KQSF 5GIPC 3JAWB 4O2AA 5HY2A 5LP6C 5LYJA 3WJRA 1W41A 2QA4F 3TD5A 4X1IB 2FC3A 3JAMM 3VO8A 2V9YA 5EB0A 4NQ3A 3R0PA 5EAZA 1RLGA 1OFUA 1YGYA 3CMAF 4BT5A 2ZOVA 3RYCB 3WGJA 4ZOLB 3CXCF 2Z1EA 1X7PA 5EZYA 5MN4A 4NUTA 2HS0A 2IAFA 2KGWA 4TV8B 4YJ3B 3CPQA 1U40A 2CVLA 3C9SA 3RYHA 4B5CA 2Z01A 2LBXA 2HP3A 4X1YA 3HKBB 3I7TA 1W55A 4BT2A 4TZZA 3PAFA 3NVIB 2ZVYA 3RYFB 4ZHQA 3E1YA 5LP6A 4F6RA 1VQLF 1W40A 3QTYA 5HY0A 3VOAA 4DXDA 2GVIA 3MQWA 2FGYA 4EI9A 4DRXA 3CMEF 4PWTA 5GINC 3LYBA 3B6NA 3VCZA 3G71F 5G4VC 1ODEA 2OTLF 2GLZA 4ZI7A 5KX5B 3KJJA 5JH7A 3CC4F 1CK2A 3UT5A 3O85A 5GONB 1JFFA 2ALEA 3JATA 3ON1A 1VH8A 2H6LA 2R751 1QAHA 4WBNB 4XCQA 3CCRF 1CN7A 3WPWA 3CYQA 3F6MA 3JAWA 3JVHA 5HXZA 3ZP7A 1K9MH 2HX0A 4X1IA 4R40B 3V4DA 2VAMA 4EI7A 2ZVZA 3FFMA 3CD6F 1K8AH 2KTUA 2LCAA 3RYCA 3ZOPA 4TV9B 2P6YA 4ZOLA 4BVQA 3Q8HA 5EIBD 3VYSC 4B62A 2AIFA 5LXTB 1E7KA 4BT4A 3S0HA 4C8IA 1T0KB 1W2BF 4TV8A 4X20A 4YJ3A 3V3TA 2CSLA 2DT4A 3ZP4A 4O4JB 1VHAA 3BYQA 2OTMA 2VGNA 3WXMB 4C8EA 1FFXB 3CCSF 1KNJA 1H47A 3LWVC 5DCVA 2BTQB 2OHWA 2QI2A 2BO1A 3DC2A 1W5AA 1CLIA 3KIZA 3VOBA 4U3JB 3IR9A 3CCVF 3MCAB 1QVGF 2QEXF 3D00A 2CWJA 5B8FA 4BT6A 3LWOC 5KX5A 4B46A 1W5BA 2HRYA 1W59A 4X3LA 4BVSA 2OZBA 2HS3A 5GONA 5LOVB 1YJ9F 2LBTA 5JQGB 1VQ8F 3TD3A 3MDOA 3IEWA
chains in the Genus database with same CATH topology
2EWCA 1PF5A 3I7TA 3M1XA 1UI9A 3K0TA 3ZOPA 4ZK7A 1UFYA 2UYKA 3KJKA 3ZP7A 3R0PA 3ZO8A 2UYPA 1QAHA 5HP7A 3QUWA 4NWOB 1XRGA 2UYJA 3K12A 1ONIA 1X25A 1DBFA 1NQ3A 2IG8A 2DYYA 3LMEA 1FNJA 1XHOA 2CHTA 2CWJA 3L7QA 2CHSA 3MQWA 2CSLA 3ZP4A 2CW4A 3D01A 1FNKA 1QU9A 2B33A 2UYNA 3LYBA 5HP8A 3I3FA 3V4DA 3VCZA 1ODEA 1QD9A 2OTMA 2CVLA 1COMA 1J7HA 3GTZA 2UYNB 3KJJA 3M4SA 1JD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWC A;  1PF5 A;  3I7T A;  3M1X A;  1UI9 A;  3K0T A;  3ZOP A;  4ZK7 A;  1UFY A;  2UYK A;  3KJK A;  3ZP7 A;  3R0P A;  3ZO8 A;  2UYP A;  1QAH A;  5HP7 A;  3QUW A;  4NWO B;  1XRG A;  2UYJ A;  3K12 A;  1ONI A;  1X25 A;  1DBF A;  1NQ3 A;  2IG8 A;  2DYY A;  3LME A;  1FNJ A;  1XHO A;  2CHT A;  2CWJ A;  3L7Q A;  2CHS A;  3MQW A;  2CSL A;  3ZP4 A;  2CW4 A;  3D01 A;  1FNK A;  1QU9 A;  2B33 A;  2UYN A;  3LYB A;  5HP8 A;  3I3F A;  3V4D A;  3VCZ A;  1ODE A;  1QD9 A;  2OTM A;  2CVL A;  1COM A;  1J7H A;  3GTZ A;  2UYN B;  3KJJ A;  3M4S A;  1JD1 A; 
#chains in the Genus database with same CATH topology
 4WBN A;  4BY9 D;  3K2X A;  3M1X A;  3CCJ F;  3KJK A;  2KG4 A;  3JCM M;  1R1M A;  2UYP A;  3E20 B;  3M84 A;  4NWO B;  3JAS B;  3K12 A;  2HRU A;  2CZW A;  5FLX M;  3OON A;  3LDT A;  2I6D A;  2IG8 A;  4G4X A;  4ERH A;  5HXU A;  4BVR A;  1RQ2 A;  3VIU A;  4I4T B;  1S72 F;  2BTU A;  4RHA A;  2PMP A;  4O4I B;  4G4V A;  3LWR C;  4X20 B;  4I55 B;  4X1K B;  5EIB C;  3HJW C;  3F0D A;  3WJP A;  4TV9 A;  3OBW A;  2UYN B;  3NMU C;  3SIU A;  5JCO C;  4FFB B;  3HWU A;  1SA0 B;  3RE3 A;  4EB6 A;  5LXT A;  1H7M A;  3VYU C;  1NJI H;  1JN1 A;  4E6E A;  2BTO A;  1JJ2 F;  4X3M A;  4O4J A;  3C9R A;  1GZ0 A;  2I6R A;  4G88 A;  2DYY A;  4O4L B;  3LWQ C;  2GZL A;  3HKE B;  3GYQ A;  2WAL A;  1FFX A;  3D01 A;  4LCK A;  3N2K B;  3GHZ A;  5J2U B;  2HVY D;  4M8I A;  1GX1 A;  1Z5V A;  3HKD B;  1X52 A;  5C8Y B;  3N4Z A;  3M4S A;  3IEQ A;  3KHN A;  4U3J A;  5IJ0 B;  3NK7 A;  4U39 A;  3LWP C;  3K0T A;  3ZO8 A;  1U3L A;  3VMF B;  2UYJ A;  3MBM A;  1IV3 A;  2VXY A;  3ELC A;  1OAP A;  3FBA A;  3N2G B;  1NQ3 A;  1T0A A;  2G9I A;  1VQ6 F;  4G4Z A;  2HS4 A;  3VYT C;  3HKC B;  5LOV A;  2UZH A;  3J7A R;  5JQG A;  3ERN A;  3K14 A;  5HP8 A;  5JCO A;  1Q81 H;  4IIJ B;  5FNV B;  2VAW A;  4LNU B;  3CCE F;  3VI6 A;  3GTZ A;  1N8R H;  3F0F A;  1SZQ A;  2RB9 A;  3E22 B;  3WGL A;  3JAS A;  4ZK7 A;  1VQM F;  1H48 A;  1W57 A;  3S03 A;  3EOR A;  3JAK B;  1ONI A;  3FD5 A;  3FD6 A;  1NMU B;  4YJ2 B;  1U3P A;  4EB6 B;  2QTP A;  4I4T A;  3WGM A;  3I55 F;  1DT9 A;  2K1S A;  2CHT A;  5MN5 A;  4O4I A;  2CHS A;  4I55 A;  4X1K A;  3P0Z A;  2UYN A;  2RHO A;  3CB2 A;  3I3F A;  3S06 A;  1QD9 A;  4ZHV A;  3ESJ A;  4FFB A;  1FSZ A;  1SA0 A;  2YYE A;  2OTJ F;  3CYP B;  5EYP B;  1UI9 A;  3WGN A;  3CPW F;  3IMP A;  3IKF A;  1PXW A;  2IQQ A;  1XRG A;  1XV2 A;  4ZHW A;  1JY8 A;  1YI2 F;  2MQE A;  5EB1 B;  4O4L A;  1W3E X;  3NK6 A;  3HKE A;  2HP0 B;  1Q86 H;  1W5E A;  2ZOD A;  3AGK A;  3V7Q A;  3N2K A;  5G4U C;  4I50 B;  5J2U A;  2RHL A;  3OW2 F;  3OBY A;  3HKD A;  1FNK A;  5C8Y A;  2N48 A;  1QVF F;  2R6R 1;  1Q8R A;  5IJ0 A;  5ITZ B;  3PLA C;  2RHH A;  1JD1 A;  1VQN F;  5JVD B;  5GAP K;  3HTN A;  5BMV B;  3HAX D;  4G4W A;  3N2G A;  1RLU A;  5MN6 A;  3HKC A;  3F0E A;  4IIJ A;  1XHO A;  5FNV A;  4LNU A;  3CCL F;  2L26 A;  3E22 A;  1M1K H;  1YHQ F;  4BVT A;  3G6E F;  1VQO F;  4RQO A;  5CB4 B;  3JAK A;  1KC8 H;  3J80 M;  1UFY A;  3JAL B;  4YJ2 A;  1RQ7 A;  2PHN A;  5HP7 A;  4TUY B;  1IV2 A;  5LA6 B;  3P10 A;  1X25 A;  1DBF A;  2RHJ A;  2VGM A;  5FJ4 C;  4BT3 A;  3LME A;  5CA0 B;  3RA5 A;  4C8G A;  5AVM A;  1W58 1;  2AIZ P;  5CA1 B;  1VQ7 F;  5EYP A;  5KMG B;  3S0Y A;  5IJ9 B;  3QHD A;  3T80 A;  1PF5 A;  3JAR B;  3VTI C;  4IHJ B;  3J81 M;  5GIO C;  2HP0 A;  1IV4 A;  5J2T B;  5IYZ B;  1TVK B;  3RYI B;  3DDN A;  4BT7 A;  5IT9 M;  4I50 A;  4O4H B;  1VK3 A;  1VQP F;  5HWE A;  1FNJ A;  1TUB B;  1KNK A;  1W5F A;  2ZAU A;  5ITZ A;  3C9T A;  1GO0 A;  4O2B B;  4B45 A;  3NVK E;  4HNA B;  2Z1T A;  3WPX A;  5HY1 A;  5JVD A;  3WJQ A;  4EI8 A;  5BMV A;  1J7H A;  1VQV A;  3SIV A;  4O2A B;  3CG6 A;  5LYJ B;  4G4Y A;  1YJN F;  3RA6 A;  3U0O A;  2H8E A;  3QUW A;  3CCU F;  5EO3 A;  3V7E A;  2Z1F A;  3C9U A;  4C82 A;  2W8B C;  1XBI A;  3LFO A;  3D54 A;  2LBW A;  4C81 A;  3I56 F;  1K73 H;  4C4W C;  1M90 H;  4ZHY B;  5EWR A;  1QU9 A;  3TD4 A;  3MCQ A;  3CC7 F;  1YJW F;  5EZY B;  5A2Q M;  5CB4 A;  2Q1X A;  3KE1 A;  3WGK A;  1W42 A;  3JAL A;  1GO1 A;  5HY4 A;  4KWE A;  2F9Z C;  4TUY A;  1YIT F;  3C8L A;  3P4E A;  5LA6 A;  2UYK A;  3RYH B;  1VQ4 F;  1Z5W A;  4X1Y B;  1YIJ F;  1ZWZ A;  2YXZ A;  2Q1Y A;  2H8C A;  1X7O A;  5CA0 A;  1Q82 H;  4ZHQ B;  5CA1 A;  5LP6 B;  5KMG A;  2B33 A;  4F6R B;  3S0W A;  1VQK F;  3CC2 F;  5GAN K;  5IJ9 A;  3HKB A;  1VQ5 F;  3JAR A;  4DRX B;  1IPA A;  1COM A;  4IHJ A;  1YQN A;  3RYF A;  4BW0 B;  3S02 A;  3CCQ F;  2EWC A;  5IYZ A;  1TVK A;  3RYI A;  5J2T A;  3G4S F;  4O4H A;  2VAP A;  3FPI A;  4ZI7 B;  5JH7 B;  2KTV A;  3F0G A;  2AMT A;  3IKE A;  3UT5 B;  2JNB A;  1JFF B;  2HQS C;  3JAT B;  1TUB A;  1Q7Y H;  2ZF8 A;  1U43 A;  3N4Y A;  1KD1 H;  4O2B A;  1IV1 A;  1SDS A;  3L7Q A;  4HNA A;  2Z1U A;  3CCM F;  1VQ9 F;  1RA4 A;  2NMU A;  2CW4 A;  1KQS F;  5GIP C;  3JAW B;  4O2A A;  5HY2 A;  5LP6 C;  5LYJ A;  3WJR A;  1W41 A;  2QA4 F;  3TD5 A;  4X1I B;  2FC3 A;  3JAM M;  3VO8 A;  2V9Y A;  5EB0 A;  4NQ3 A;  3R0P A;  5EAZ A;  1RLG A;  1OFU A;  1YGY A;  3CMA F;  4BT5 A;  2ZOV A;  3RYC B;  3WGJ A;  4ZOL B;  3CXC F;  2Z1E A;  1X7P A;  5EZY A;  5MN4 A;  4NUT A;  2HS0 A;  2IAF A;  2KGW A;  4TV8 B;  4YJ3 B;  3CPQ A;  1U40 A;  2CVL A;  3C9S A;  3RYH A;  4B5C A;  2Z01 A;  2LBX A;  2HP3 A;  4X1Y A;  3HKB B;  3I7T A;  1W55 A;  4BT2 A;  4TZZ A;  3PAF A;  3NVI B;  2ZVY A;  3RYF B;  4ZHQ A;  3E1Y A;  5LP6 A;  4F6R A;  1VQL F;  1W40 A;  3QTY A;  5HY0 A;  3VOA A;  4DXD A;  2GVI A;  3MQW A;  2FGY A;  4EI9 A;  4DRX A;  3CME F;  4PWT A;  5GIN C;  3LYB A;  3B6N A;  3VCZ A;  3G71 F;  5G4V C;  1ODE A;  2OTL F;  2GLZ A;  4ZI7 A;  5KX5 B;  3KJJ A;  5JH7 A;  3CC4 F;  1CK2 A;  3UT5 A;  3O85 A;  5GON B;  1JFF A;  2ALE A;  3JAT A;  3ON1 A;  1VH8 A;  2H6L A;  2R75 1;  1QAH A;  4WBN B;  4XCQ A;  3CCR F;  1CN7 A;  3WPW A;  3CYQ A;  3F6M A;  3JAW A;  3JVH A;  5HXZ A;  3ZP7 A;  1K9M H;  2HX0 A;  4X1I A;  4R40 B;  3V4D A;  2VAM A;  4EI7 A;  2ZVZ A;  3FFM A;  3CD6 F;  1K8A H;  2KTU A;  2LCA A;  3RYC A;  3ZOP A;  4TV9 B;  2P6Y A;  4ZOL A;  4BVQ A;  3Q8H A;  5EIB D;  3VYS C;  4B62 A;  2AIF A;  5LXT B;  1E7K A;  4BT4 A;  3S0H A;  4C8I A;  1T0K B;  1W2B F;  4TV8 A;  4X20 A;  4YJ3 A;  3V3T A;  2CSL A;  2DT4 A;  3ZP4 A;  4O4J B;  1VHA A;  3BYQ A;  2OTM A;  2VGN A;  3WXM B;  4C8E A;  1FFX B;  3CCS F;  1KNJ A;  1H47 A;  3LWV C;  5DCV A;  2BTQ B;  2OHW A;  2QI2 A;  2BO1 A;  3DC2 A;  1W5A A;  1CLI A;  3KIZ A;  3VOB A;  4U3J B;  3IR9 A;  3CCV F;  3MCA B;  1QVG F;  2QEX F;  3D00 A;  2CWJ A;  5B8F A;  4BT6 A;  3LWO C;  5KX5 A;  4B46 A;  1W5B A;  2HRY A;  1W59 A;  4X3L A;  4BVS A;  2OZB A;  2HS3 A;  5GON A;  5LOV B;  1YJ9 F;  2LBT A;  5JQG B;  1VQ8 F;  3TD3 A;  3MDO A;  3IEW A; 
#chains in the Genus database with same CATH homology
 2EWC A;  1PF5 A;  3I7T A;  3M1X A;  1UI9 A;  3K0T A;  3ZOP A;  4ZK7 A;  1UFY A;  2UYK A;  3KJK A;  3ZP7 A;  3R0P A;  3ZO8 A;  2UYP A;  1QAH A;  5HP7 A;  3QUW A;  4NWO B;  1XRG A;  2UYJ A;  3K12 A;  1ONI A;  1X25 A;  1DBF A;  1NQ3 A;  2IG8 A;  2DYY A;  3LME A;  1FNJ A;  1XHO A;  2CHT A;  2CWJ A;  3L7Q A;  2CHS A;  3MQW A;  2CSL A;  3ZP4 A;  2CW4 A;  3D01 A;  1FNK A;  1QU9 A;  2B33 A;  2UYN A;  3LYB A;  5HP8 A;  3I3F A;  3V4D A;  3VCZ A;  1ODE A;  1QD9 A;  2OTM A;  2CVL A;  1COM A;  1J7H A;  3GTZ A;  2UYN B;  3KJJ A;  3M4S A;  1JD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...