1X25A

Crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
b'SHMETVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0076 protein ST0811
publication title Crystal structure of the YjgF/YER057c/UK114 family protein from the hyperthermophilic archaeon Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1x25A00
3M4SA 3L7QA 3M1XA 4NWOB 5HP7A 4ZK7A 1J7HA 1NQ3A 2UYJA 2IG8A 3QUWA 3I3FA 1FNJA 2CWJA 3R0PA 3V4DA 3MQWA 3ZOPA 2UYNA 1QD9A 1QU9A 3LYBA 1PF5A 1XHOA 1FNKA 2B33A 3LMEA 1XRGA 1ONIA 1UI9A 1ODEA 2DYYA 2CSLA 3KJKA 5HP8A 3ZO8A 2OTMA 3ZP4A 3VCZA 3D01A 2CVLA 3I7TA 2CHTA 1QAHA 3GTZA 2UYPA 1X25A 3K0TA 2CHSA 2CW4A 2UYNB 3ZP7A 3KJJA 1DBFA 2EWCA 1COMA 1JD1A 1UFYA 2UYKA 3K12A
chains in the Genus database with same CATH superfamily
5MN5A 5IT9M 4YJ3A 4NWOB 3RYCB 3S06A 2K1SA 3QUWA 4YJ2B 5GIOC 5CB4A 5J2UB 3S0HA 3D00A 3VYTC 1QU9A 1W41A 1S72F 1DT9A 4O2BB 3KHNA 3VIUA 1TUBB 3CC2F 1W42A 3IKFA 3F0FA 3JAKB 3WGKA 3CYQA 1OFUA 3CYPB 3RYCA 1U3PA 4YJ2A 3LFOA 3RA6A 1DBFA 5CA1B 5J2UA 3MBMA 3CC4F 3K12A 3J80M 2OHWA 2QEXF 1W5BA 3GYQA 3J81M 3SIUA 2KGWA 3JARB 2VGMA 5B8FA 3J7AR 3V7QA 3WJRA 4IIJB 3CCUF 5CA1A 1PF5A 1XHOA 1KNJA 3LDTA 4TV9B 2CZWA 3C9UA 5A2QM 3ELCA 2V9YA 3I7TA 1CLIA 1QAHA 3K0TA 5EIBD 5IJ9B 3ZP7A 5HY4A 4IIJA 2H6LA 1JD1A 1UFYA 1XBIA 3TD3A 1K73H 4ZI7A 5LP6C 1KQSF 3P10A 4TV9A 1VQ4F 2RB9A 1RLUA 2BTQB 4X1KA 3CCSF 3R0PA 3Q8HA 1SZQA 2Z1FA 1FNKA 3NVIB 4O4LA 1Z5WA 4X1IB 5LOVA 4C81A 3FD5A 2KG4A 5AVMA 2IQQA 2LCAA 3LWQC 3VTIC 4HNAB 3V7EA 5HXZA 2QTPA 1VQOF 1W55A 1YQNA 3MCAB 4IHJB 5HP7A 3JAWB 3CC7F 4X1IA 4F6RB 3FD6A 1YJ9F 3GHZA 3OW2F 3RYFA 4BT7A 1NQ3A 3JVHA 1KD1H 2I6RA 3JAMM 4O4IB 2CWJA 3V4DA 1KNKA 2P6YA 4O4JB 4BVQA 4X3LA 2FGYA 3KE1A 3CB2A 4LNUB 4IHJA 1OAPA 4G4WA 4F6RA 4DXDA 4I4TB 4KWEA 2OTJF 3WJQA 1YJNF 2UYNB 2QI2A 5C8YB 2R751 4O4IA 3AGKA 4BY9D 4EI8A 4ZHVA 3IEWA 2UYKA 5EB0A 1YJWF 1E7KA 3L7QA 2HP0B 4LNUA 1J7HA 2HS3A 1KC8H 5LYJB 3NK6A 4I4TA 3I3FA 2Z01A 2UYNA 4BVSA 5C8YA 3RYHB 2LBWA 1VH8A 1X7OA 1K9MH 4BT6A 4EI9A 4BT2A 4B62A 4EB6B 1CN7A 3CMAF 3IEQA 3G6EF 4C82A 1VQKF 5G4VC 1TVKA 5JVDB 4TZZA 5GAPK 3EORA 2LBXA 1W3EX 3P0ZA 4M8IA 3IMPA 5BMVB 3RYHA 5EO3A 2KTVA 3WGMA 1YGYA 1X7PA 3FPIA 5EZYB 4G4ZA 1FNJA 5LP6A 3HJWC 2MQEA 5JVDA 4I55B 1VQVA 2Z1UA 2WALA 3N2KB 3LYBA 5HWEA 2B33A 2W8BC 1W5EA 3JATB 1U3LA 2BTUA 5BMVA 3F0EA 1W581 2VAMA 2ZVYA 3K2XA 1IV2A 1Q8RA 1RQ7A 5EZYA 3WPXA 2CW4A 1XV2A 4I55A 3C9TA 2KTUA 3N2KA 3NK7A 2BO1A 3JATA 3M1XA 4O2BA 3WXMB 3LWOC 4G88A 2IG8A 1TUBA 5CA0B 3JAKA 1VQ6F 2IAFA 4FFBB 3CCLF 1FSZA 3LWPC 2H8EA 3CPQA 3JCMM 3ZP4A 3VCZA 4U39A 1IV4A 4ZHYB 2CVLA 2CHTA 2YYEA 1Q86H 3JARA 2HVYD 2PMPA 1K8AH 2AIFA 3T80A 3V3TA 4FFBA 3HWUA 3RE3A 4B45A 5MN4A 3HKCB 4O4HB 2ZODA 1GO1A 2RHLA 5IJ0B 5IJ9A 3KIZA 1XRGA 3KJKA 3ERNA 4BW0B 3TD4A 3ZO8A 1VQ9F 5GINC 3MCQA 3D01A 5GONB 4PWTA 5FNVB 4X1YB 3GTZA 1VQNF 3M84A 5FLXM 1H7MA 1IV1A 4WBNB 3C9RA 2AIZP 2VAWA 1H47A 5IJ0A 1QVGF 4ZHQB 3IR9A 1QVFF 4B46A 3NMUC 4R40B 2GLZA 3S02A 5GONA 1RA4A 2DT4A 5FNVA 3CCMF 4X1YA 3TD5A 3N2GB 4BVRA 4C8IA 4WBNA 2GVIA 4HNAA 4BT3A 4RQOA 5IYZB 1H48A 1ONIA 2DYYA 3WGLA 2HRYA 4ZHQA 3JAWA 3HAXD 1JY8A 5GANK 2PHNA 4C8GA 1IV3A 5JQGB 3F0DA 4EI7A 1JJ2F 3DDNA 2RHJA 3OONA 3I55F 3KJJA 3G71F 3N2GA 3HKDB 3CCJF 2HRUA 2ZAUA 3E20B 3CCVF 1Q81H 5IYZA 4O4JA 2ZVZA 2NMUA 5GIPC 3HTNA 1GO0A 5J2TB 4C4WC 3VYUC 3N4ZA 3JALB 5G4UC 4TV8B 5KX5B 3RA5A 3HKDA 2VXYA 3B6NA 2I6DA 1W2BF 1Q7YH 1VQ8F 3SIVA 1PXWA 2FC3A 2HP0A 5J2TA 3WPWA 4LCKA 3OBWA 1SA0B 2CHSA 3HKEB 5LYJA 4TV8A 1W40A 4DRXB 5HY0A 3O85A 3CXCF 3U0OA 3M4SA 1VK3A 3LWVC 1IPAA 4BT5A 5KMGB 2H8CA 1W59A 4G4VA 4EB6A 2F9ZC 3CPWF 2BTOA 5EIBC 5HXUA 3CMEF 5ITZB 1QD9A 4YJ3B 2GZLA 2Z1TA 4DRXA 1ODEA 1RLGA 2OTMA 1VQMF 3F0GA 5CB4B 1VQ7F 2ALEA 4O2AB 3I56F 2N48A 2VGNA 3S03A 3S0YA 4I50B 2RHHA 2Q1YA 3CD6F 1M1KH 3QTYA 4ERHA 4X3MA 4ZHWA 2VAPA 4ZOLB 4O2AA 3G4SF 2OZBA 2R6R1 4I50A 5MN6A 1T0KB 1JFFB 4B5CA 4C8EA 1VHAA 4E6EA 5HY1A 3K14A 3CCQF 1W5AA 4X20B 4ZOLA 5CA0A 1T0AA 1W5FA 3VMFB 2HP3A 3LWRC 1JFFA 3QHDA 1VQPF 1CK2A 1N8RH 1W57A 3VOAA 3C8LA 2Q1XA 4X20A 5DCVA 1GZ0A 4ZI7B 2YXZA 3S0WA 5JH7B 2JNBA 2L26A 1R1MA 4X1KB 2Z1EA 2HX0A 3HKCA 4O4HA 1X25A 3DC2A 4BT4A 1SDSA 2QA4F 1U43A 3OBYA 1X52A 4O4LB 2EWCA 1COMA 1JN1A 5LOVB 4G4YA 1VQLF 3P4EA 5JH7A 4ZK7A 1YIJF 1M90H 5LA6B 4XCQA 2HS4A 2ZOVA 4U3JB 3MQWA 2UZHA 2HS0A 1FFXB 1RQ2A 5EWRA 1UI9A 3PLAC 3RYFB 1Z5VA 5HP8A 1NJIH 1YHQF 3D54A 3E22B 3ON1A 3HKBB 3VOBA 3FFMA 3CCEF 2UYPA 4NUTA 3VI6A 5LA6A 1U40A 3N4YA 4U3JA 3WJPA 4RHAA 3WGJA 1FFXA 1Q82H 5FJ4C 5JCOA 3WGNA 3VYSC 5HY2A 3E22A 3HKBA 1VQ5F 3ESJA 3C9SA 3BYQA 3ZOPA 5JQGA 3UT5B 5LXTB 5EB1B 2LBTA 2CSLA 3RYIB 3JASB 3F6MA 1GX1A 1YITF 2AMTA 3JALA 2HQSC 3UT5A 5LXTA 5KX5A 2RHOA 5EYPB 3FBAA 3CCRF 1NMUB 2ZF8A 1TVKB 1ZWZA 2UYJA 4G4XA 3RYIA 3E1YA 3JASA 3CG6A 3IKEA 1SA0A 3HKEA 4TUYB 3LMEA 1YI2F 2OTLF 3NVKE 3PAFA 5EYPA 5EAZA 5LP6B 5KMGA 2G9IA 4NQ3A 3MDOA 4BVTA 5JCOC 3VO8A 4TUYA 5ITZA
chains in the Genus database with same CATH topology
3M4SA 3L7QA 3M1XA 4NWOB 5HP7A 4ZK7A 1J7HA 1NQ3A 2UYJA 2IG8A 3QUWA 3I3FA 1FNJA 2CWJA 3R0PA 3V4DA 3MQWA 3ZOPA 2UYNA 1QD9A 1QU9A 3LYBA 1PF5A 1XHOA 1FNKA 2B33A 3LMEA 1XRGA 1ONIA 1UI9A 1ODEA 2DYYA 2CSLA 3KJKA 5HP8A 3ZO8A 2OTMA 3ZP4A 3VCZA 3D01A 2CVLA 3I7TA 2CHTA 1QAHA 3GTZA 2UYPA 1X25A 3K0TA 2CHSA 2CW4A 2UYNB 3ZP7A 3KJJA 1DBFA 2EWCA 1COMA 1JD1A 1UFYA 2UYKA 3K12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4S A;  3L7Q A;  3M1X A;  4NWO B;  5HP7 A;  4ZK7 A;  1J7H A;  1NQ3 A;  2UYJ A;  2IG8 A;  3QUW A;  3I3F A;  1FNJ A;  2CWJ A;  3R0P A;  3V4D A;  3MQW A;  3ZOP A;  2UYN A;  1QD9 A;  1QU9 A;  3LYB A;  1PF5 A;  1XHO A;  1FNK A;  2B33 A;  3LME A;  1XRG A;  1ONI A;  1UI9 A;  1ODE A;  2DYY A;  2CSL A;  3KJK A;  5HP8 A;  3ZO8 A;  2OTM A;  3ZP4 A;  3VCZ A;  3D01 A;  2CVL A;  3I7T A;  2CHT A;  1QAH A;  3GTZ A;  2UYP A;  1X25 A;  3K0T A;  2CHS A;  2CW4 A;  2UYN B;  3ZP7 A;  3KJJ A;  1DBF A;  2EWC A;  1COM A;  1JD1 A;  1UFY A;  2UYK A;  3K12 A; 
#chains in the Genus database with same CATH topology
 5MN5 A;  5IT9 M;  4YJ3 A;  4NWO B;  3RYC B;  3S06 A;  2K1S A;  3QUW A;  4YJ2 B;  5GIO C;  5CB4 A;  5J2U B;  3S0H A;  3D00 A;  3VYT C;  1QU9 A;  1W41 A;  1S72 F;  1DT9 A;  4O2B B;  3KHN A;  3VIU A;  1TUB B;  3CC2 F;  1W42 A;  3IKF A;  3F0F A;  3JAK B;  3WGK A;  3CYQ A;  1OFU A;  3CYP B;  3RYC A;  1U3P A;  4YJ2 A;  3LFO A;  3RA6 A;  1DBF A;  5CA1 B;  5J2U A;  3MBM A;  3CC4 F;  3K12 A;  3J80 M;  2OHW A;  2QEX F;  1W5B A;  3GYQ A;  3J81 M;  3SIU A;  2KGW A;  3JAR B;  2VGM A;  5B8F A;  3J7A R;  3V7Q A;  3WJR A;  4IIJ B;  3CCU F;  5CA1 A;  1PF5 A;  1XHO A;  1KNJ A;  3LDT A;  4TV9 B;  2CZW A;  3C9U A;  5A2Q M;  3ELC A;  2V9Y A;  3I7T A;  1CLI A;  1QAH A;  3K0T A;  5EIB D;  5IJ9 B;  3ZP7 A;  5HY4 A;  4IIJ A;  2H6L A;  1JD1 A;  1UFY A;  1XBI A;  3TD3 A;  1K73 H;  4ZI7 A;  5LP6 C;  1KQS F;  3P10 A;  4TV9 A;  1VQ4 F;  2RB9 A;  1RLU A;  2BTQ B;  4X1K A;  3CCS F;  3R0P A;  3Q8H A;  1SZQ A;  2Z1F A;  1FNK A;  3NVI B;  4O4L A;  1Z5W A;  4X1I B;  5LOV A;  4C81 A;  3FD5 A;  2KG4 A;  5AVM A;  2IQQ A;  2LCA A;  3LWQ C;  3VTI C;  4HNA B;  3V7E A;  5HXZ A;  2QTP A;  1VQO F;  1W55 A;  1YQN A;  3MCA B;  4IHJ B;  5HP7 A;  3JAW B;  3CC7 F;  4X1I A;  4F6R B;  3FD6 A;  1YJ9 F;  3GHZ A;  3OW2 F;  3RYF A;  4BT7 A;  1NQ3 A;  3JVH A;  1KD1 H;  2I6R A;  3JAM M;  4O4I B;  2CWJ A;  3V4D A;  1KNK A;  2P6Y A;  4O4J B;  4BVQ A;  4X3L A;  2FGY A;  3KE1 A;  3CB2 A;  4LNU B;  4IHJ A;  1OAP A;  4G4W A;  4F6R A;  4DXD A;  4I4T B;  4KWE A;  2OTJ F;  3WJQ A;  1YJN F;  2UYN B;  2QI2 A;  5C8Y B;  2R75 1;  4O4I A;  3AGK A;  4BY9 D;  4EI8 A;  4ZHV A;  3IEW A;  2UYK A;  5EB0 A;  1YJW F;  1E7K A;  3L7Q A;  2HP0 B;  4LNU A;  1J7H A;  2HS3 A;  1KC8 H;  5LYJ B;  3NK6 A;  4I4T A;  3I3F A;  2Z01 A;  2UYN A;  4BVS A;  5C8Y A;  3RYH B;  2LBW A;  1VH8 A;  1X7O A;  1K9M H;  4BT6 A;  4EI9 A;  4BT2 A;  4B62 A;  4EB6 B;  1CN7 A;  3CMA F;  3IEQ A;  3G6E F;  4C82 A;  1VQK F;  5G4V C;  1TVK A;  5JVD B;  4TZZ A;  5GAP K;  3EOR A;  2LBX A;  1W3E X;  3P0Z A;  4M8I A;  3IMP A;  5BMV B;  3RYH A;  5EO3 A;  2KTV A;  3WGM A;  1YGY A;  1X7P A;  3FPI A;  5EZY B;  4G4Z A;  1FNJ A;  5LP6 A;  3HJW C;  2MQE A;  5JVD A;  4I55 B;  1VQV A;  2Z1U A;  2WAL A;  3N2K B;  3LYB A;  5HWE A;  2B33 A;  2W8B C;  1W5E A;  3JAT B;  1U3L A;  2BTU A;  5BMV A;  3F0E A;  1W58 1;  2VAM A;  2ZVY A;  3K2X A;  1IV2 A;  1Q8R A;  1RQ7 A;  5EZY A;  3WPX A;  2CW4 A;  1XV2 A;  4I55 A;  3C9T A;  2KTU A;  3N2K A;  3NK7 A;  2BO1 A;  3JAT A;  3M1X A;  4O2B A;  3WXM B;  3LWO C;  4G88 A;  2IG8 A;  1TUB A;  5CA0 B;  3JAK A;  1VQ6 F;  2IAF A;  4FFB B;  3CCL F;  1FSZ A;  3LWP C;  2H8E A;  3CPQ A;  3JCM M;  3ZP4 A;  3VCZ A;  4U39 A;  1IV4 A;  4ZHY B;  2CVL A;  2CHT A;  2YYE A;  1Q86 H;  3JAR A;  2HVY D;  2PMP A;  1K8A H;  2AIF A;  3T80 A;  3V3T A;  4FFB A;  3HWU A;  3RE3 A;  4B45 A;  5MN4 A;  3HKC B;  4O4H B;  2ZOD A;  1GO1 A;  2RHL A;  5IJ0 B;  5IJ9 A;  3KIZ A;  1XRG A;  3KJK A;  3ERN A;  4BW0 B;  3TD4 A;  3ZO8 A;  1VQ9 F;  5GIN C;  3MCQ A;  3D01 A;  5GON B;  4PWT A;  5FNV B;  4X1Y B;  3GTZ A;  1VQN F;  3M84 A;  5FLX M;  1H7M A;  1IV1 A;  4WBN B;  3C9R A;  2AIZ P;  2VAW A;  1H47 A;  5IJ0 A;  1QVG F;  4ZHQ B;  3IR9 A;  1QVF F;  4B46 A;  3NMU C;  4R40 B;  2GLZ A;  3S02 A;  5GON A;  1RA4 A;  2DT4 A;  5FNV A;  3CCM F;  4X1Y A;  3TD5 A;  3N2G B;  4BVR A;  4C8I A;  4WBN A;  2GVI A;  4HNA A;  4BT3 A;  4RQO A;  5IYZ B;  1H48 A;  1ONI A;  2DYY A;  3WGL A;  2HRY A;  4ZHQ A;  3JAW A;  3HAX D;  1JY8 A;  5GAN K;  2PHN A;  4C8G A;  1IV3 A;  5JQG B;  3F0D A;  4EI7 A;  1JJ2 F;  3DDN A;  2RHJ A;  3OON A;  3I55 F;  3KJJ A;  3G71 F;  3N2G A;  3HKD B;  3CCJ F;  2HRU A;  2ZAU A;  3E20 B;  3CCV F;  1Q81 H;  5IYZ A;  4O4J A;  2ZVZ A;  2NMU A;  5GIP C;  3HTN A;  1GO0 A;  5J2T B;  4C4W C;  3VYU C;  3N4Z A;  3JAL B;  5G4U C;  4TV8 B;  5KX5 B;  3RA5 A;  3HKD A;  2VXY A;  3B6N A;  2I6D A;  1W2B F;  1Q7Y H;  1VQ8 F;  3SIV A;  1PXW A;  2FC3 A;  2HP0 A;  5J2T A;  3WPW A;  4LCK A;  3OBW A;  1SA0 B;  2CHS A;  3HKE B;  5LYJ A;  4TV8 A;  1W40 A;  4DRX B;  5HY0 A;  3O85 A;  3CXC F;  3U0O A;  3M4S A;  1VK3 A;  3LWV C;  1IPA A;  4BT5 A;  5KMG B;  2H8C A;  1W59 A;  4G4V A;  4EB6 A;  2F9Z C;  3CPW F;  2BTO A;  5EIB C;  5HXU A;  3CME F;  5ITZ B;  1QD9 A;  4YJ3 B;  2GZL A;  2Z1T A;  4DRX A;  1ODE A;  1RLG A;  2OTM A;  1VQM F;  3F0G A;  5CB4 B;  1VQ7 F;  2ALE A;  4O2A B;  3I56 F;  2N48 A;  2VGN A;  3S03 A;  3S0Y A;  4I50 B;  2RHH A;  2Q1Y A;  3CD6 F;  1M1K H;  3QTY A;  4ERH A;  4X3M A;  4ZHW A;  2VAP A;  4ZOL B;  4O2A A;  3G4S F;  2OZB A;  2R6R 1;  4I50 A;  5MN6 A;  1T0K B;  1JFF B;  4B5C A;  4C8E A;  1VHA A;  4E6E A;  5HY1 A;  3K14 A;  3CCQ F;  1W5A A;  4X20 B;  4ZOL A;  5CA0 A;  1T0A A;  1W5F A;  3VMF B;  2HP3 A;  3LWR C;  1JFF A;  3QHD A;  1VQP F;  1CK2 A;  1N8R H;  1W57 A;  3VOA A;  3C8L A;  2Q1X A;  4X20 A;  5DCV A;  1GZ0 A;  4ZI7 B;  2YXZ A;  3S0W A;  5JH7 B;  2JNB A;  2L26 A;  1R1M A;  4X1K B;  2Z1E A;  2HX0 A;  3HKC A;  4O4H A;  1X25 A;  3DC2 A;  4BT4 A;  1SDS A;  2QA4 F;  1U43 A;  3OBY A;  1X52 A;  4O4L B;  2EWC A;  1COM A;  1JN1 A;  5LOV B;  4G4Y A;  1VQL F;  3P4E A;  5JH7 A;  4ZK7 A;  1YIJ F;  1M90 H;  5LA6 B;  4XCQ A;  2HS4 A;  2ZOV A;  4U3J B;  3MQW A;  2UZH A;  2HS0 A;  1FFX B;  1RQ2 A;  5EWR A;  1UI9 A;  3PLA C;  3RYF B;  1Z5V A;  5HP8 A;  1NJI H;  1YHQ F;  3D54 A;  3E22 B;  3ON1 A;  3HKB B;  3VOB A;  3FFM A;  3CCE F;  2UYP A;  4NUT A;  3VI6 A;  5LA6 A;  1U40 A;  3N4Y A;  4U3J A;  3WJP A;  4RHA A;  3WGJ A;  1FFX A;  1Q82 H;  5FJ4 C;  5JCO A;  3WGN A;  3VYS C;  5HY2 A;  3E22 A;  3HKB A;  1VQ5 F;  3ESJ A;  3C9S A;  3BYQ A;  3ZOP A;  5JQG A;  3UT5 B;  5LXT B;  5EB1 B;  2LBT A;  2CSL A;  3RYI B;  3JAS B;  3F6M A;  1GX1 A;  1YIT F;  2AMT A;  3JAL A;  2HQS C;  3UT5 A;  5LXT A;  5KX5 A;  2RHO A;  5EYP B;  3FBA A;  3CCR F;  1NMU B;  2ZF8 A;  1TVK B;  1ZWZ A;  2UYJ A;  4G4X A;  3RYI A;  3E1Y A;  3JAS A;  3CG6 A;  3IKE A;  1SA0 A;  3HKE A;  4TUY B;  3LME A;  1YI2 F;  2OTL F;  3NVK E;  3PAF A;  5EYP A;  5EAZ A;  5LP6 B;  5KMG A;  2G9I A;  4NQ3 A;  3MDO A;  4BVT A;  5JCO C;  3VO8 A;  4TUY A;  5ITZ A; 
#chains in the Genus database with same CATH homology
 3M4S A;  3L7Q A;  3M1X A;  4NWO B;  5HP7 A;  4ZK7 A;  1J7H A;  1NQ3 A;  2UYJ A;  2IG8 A;  3QUW A;  3I3F A;  1FNJ A;  2CWJ A;  3R0P A;  3V4D A;  3MQW A;  3ZOP A;  2UYN A;  1QD9 A;  1QU9 A;  3LYB A;  1PF5 A;  1XHO A;  1FNK A;  2B33 A;  3LME A;  1XRG A;  1ONI A;  1UI9 A;  1ODE A;  2DYY A;  2CSL A;  3KJK A;  5HP8 A;  3ZO8 A;  2OTM A;  3ZP4 A;  3VCZ A;  3D01 A;  2CVL A;  3I7T A;  2CHT A;  1QAH A;  3GTZ A;  2UYP A;  1X25 A;  3K0T A;  2CHS A;  2CW4 A;  2UYN B;  3ZP7 A;  3KJJ A;  1DBF A;  2EWC A;  1COM A;  1JD1 A;  1UFY A;  2UYK A;  3K12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...