1X25A

Crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
SHMETVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YjgF/YER057c/UK114 family protein from the hyperthermophilic archaeon Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0076 protein ST0811
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1x25A00
2DYYA 3QUWA 4ZK7A 2IG8A 3K0TA 3M4SA 2CSLA 1UI9A 5HP7A 1NQ3A 3K12A 1QAHA 3LYBA 1UFYA 1XRGA 3LMEA 3ZO8A 2UYNB 3KJJA 3MQWA 2EWCA 2OTMA 3KJKA 3ZP7A 1JD1A 2UYPA 3D01A 1X25A 2CVLA 1ONIA 2CHSA 3L7QA 2UYKA 2UYNA 1FNJA 2CHTA 1ODEA 3I3FA 3M1XA 3R0PA 1FNKA 1QD9A 3GTZA 3ZOPA 1XHOA 1DBFA 2CW4A 1QU9A 2B33A 2UYJA 3I7TA 4NWOB 1PF5A 3VCZA 5HP8A 3V4DA 2CWJA 3ZP4A 1J7HA 1COMA
chains in the Genus database with same CATH superfamily
3QUWA 4X20B 2HQSC 3E22A 3NK6A 3S02A 2AMTA 1TVKB 4ZHVA 1YHQF 3TD3A 5MN5A 4I55A 4G4VA 3CB2A 3QHDA 4TV9A 1SZQA 1NJIH 1JD1A 4O4JA 1JFFA 4IHJA 3WJRA 5LXTB 4DRXA 4LNUB 3VOBA 3ZOPA 3CPWF 2ZVZA 5ITZB 3S06A 4EB6A 3CC4F 4C4WC 1RLUA 3EORA 3RYHB 1K8AH 5MN6A 5HXUA 1ZWZA 3VOAA 5GAPK 3VIUA 4I50A 5HY4A 2VAWA 3IKEA 3HKDA 3Q8HA 3F0FA 3JALB 1JN1A 4B46A 5LP6B 3KJKA 3N2KA 3E20B 5JCOA 3G6EF 3WGJA 2VXYA 1IV2A 4IIJA 3CCQF 5B8FA 1IV4A 2VAMA 4M8IA 1U43A 1CLIA 1E7KA 5JQGA 2RB9A 4O4IB 3CC7F 1KNKA 2BO1A 2CSLA 4ZI7A 3LWOC 5FLXM 1QVGF 3ZO8A 4C81A 3J80M 2Q1XA 3JAKA 3MQWA 2EWCA 1W3EX 4TUYA 1X7PA 1RLGA 3RE3A 5CA1A 3LWPC 4E6EA 1CK2A 1ODEA 3M1XA 1QD9A 3WGNA 3S0HA 5CA1B 2OTLF 5FJ4C 1W57A 5AVMA 4TUYB 3NVKE 5LP6C 2JNBA 3JAWA 5EAZA 3K14A 3K0TA 3JCMM 2I6RA 1N8RH 1Q86H 1S72F 1CN7A 3HTNA 3RYCA 3JAMM 4B5CA 5IJ0A 3HJWC 4B45A 2HX0A 4WBNA 4LCKA 3HKCA 1VQ8F 2OTJF 1W40A 1OFUA 2CVLA 3FPIA 4I55B 2RHLA 3TD5A 3L7QA 2N48A 3MCQA 3P10A 4BT2A 3D54A 4EI7A 4ZHWA 4DXDA 5DCVA 3JAKB 1XV2A 5GIOC 1VQ6F 3IKFA 3M4SA 4FFBB 5EYPA 4WBNB 1KQSF 3VYTC 1YQNA 3IEWA 2LBXA 2HRYA 3M84A 3SIVA 3P4EA 2HP3A 2VGNA 1W5FA 3WJQA 4HNAB 2UYNA 5JH7B 3S0YA 4IIJB 1SA0B 4RHAA 1FFXB 3PAFA 5HWEA 3I7TA 3N2KB 3RA6A 4ZHQA 3GHZA 4O4HB 5LYJA 3C8LA 3VO8A 3CG6A 4C8IA 2RHOA 1QAHA 3RYFB 1DT9A 4HNAA 3OBYA 2QA4F 2Z01A 3VTIC 3CMAF 1VQOF 1XBIA 5ITZA 2Z1UA 4ERHA 4U3JB 3CD6F 1X25A 5JVDB 3C9SA 1W5AA 1VQNF 3IR9A 2CHTA 3I3FA 1K73H 1FNKA 2Q1YA 1YJ9F 3I56F 1H7MA 3IMPA 4YJ3B 5EIBC 5EZYA 3CC2F 2Z1TA 3FD6A 4X1IB 3LWQC 3WGMA 5IJ9B 3JALA 5A2QM 1Q7YH 4RQOA 1VQ5F 1IV1A 1RQ2A 2OHWA 3CCJF 2OTMA 1X52A 3S0WA 4O4HA 4ZHQB 5HY2A 3F0DA 5FNVB 4EB6B 1U40A 5C8YA 2AIZP 4KWEA 1VHAA 2AIFA 2HRUA 3N2GA 1Z5VA 3JASB 1QU9A 2B33A 1YGYA 2K1SA 1J7HA 3S03A 1GO1A 2GZLA 3V7EA 3WXMB 2ALEA 1W5BA 3JVHA 1YI2F 1NMUB 5FNVA 4F6RB 5LOVB 5G4VC 1YJNF 3OBWA 4FFBA 5EYPB 3OONA 2YXZA 1VQ4F 3IEQA 1VQ7F 2H8EA 1GZ0A 2PHNA 1VK3A 2LCAA 1RQ7A 2UYKA 1GO0A 3WGLA 1W55A 1W581 5IJ9A 4BT7A 4X1IA 4BVRA 4F6RA 1H47A 3AGKA 3BYQA 1T0KB 3D00A 3G4SF 3NK7A 2WALA 5KMGB 5HY1A 3UT5B 5JVDA 2IQQA 5IJ0B 1YJWF 4BT5A 4NUTA 1M90H 2ZF8A 4NQ3A 3NVIB 3OW2F 4ZOLB 4BVQA 2V9YA 4O2BB 2F9ZC 4DRXB 3RYIB 5MN4A 3E1YA 5LYJB 1ONIA 5IT9M 2FC3A 3V3TA 5LOVA 4U39A 4G4WA 3HKCB 1Q82H 1PF5A 3ELCA 3RYCB 1FSZA 1SA0A 2IG8A 5GONA 4I4TA 4O2BA 4YJ3A 5HP7A 4YJ2B 2KG4A 2BTOA 3F0GA 2CZWA 5C8YB 5LXTA 5J2TB 2L26A 3J7AR 3KJJA 2PMPA 2UYPA 3C9UA 3D01A 2W8BC 5JQGB 2HP0A 1JJ2F 4BY9D 1K9MH 3K2XA 2HVYD 2CW4A 3MBMA 4O4LB 5EWRA 5KX5A 3V4DA 1COMA 3N4YA 3LWVC 1VQPF 2HS4A 5HY0A 4ZHYB 1PXWA 3K12A 2ZODA 3U0OA 2RHJA 3SIUA 2UYNB 5JH7A 2ZAUA 3RYHA 3ZP7A 3JAWB 3CPQA 3CCLF 1IPAA 2Z1EA 1U3LA 3JASA 2QEXF 2QI2A 1FNJA 3CCUF 3RYFA 3MDOA 4TV8A 4X3MA 3ZP4A 4O4JB 4TV9B 3WGKA 1Q81H 3KIZA 4ZK7A 3HKEA 2LBWA 2R6R1 2MQEA 1T0AA 1NQ3A 1FFXA 2GVIA 1R1MA 2KTVA 5EIBD 2Z1FA 1QVFF 1TUBA 4BW0B 2RHHA 4X20A 3G71F 2OZBA 2YYEA 2IAFA 1KNJA 5EB0A 5EZYB 2HS3A 2CHSA 2QTPA 3HKBA 4X1KA 3J81M 1YIJF 3C9TA 5BMVB 5GINC 4ZI7B 4IHJB 2ZOVA 3VYSC 5HXZA 4G4YA 1KC8H 2GLZA 3FD5A 5GANK 1W59A 4C82A 4X1YA 1VQKF 5JCOC 2P6YA 5BMVA 3KHNA 3TD4A 2KGWA 3HAXD 3V7QA 3WPXA 2DT4A 3QTYA 1VQVA 1GX1A 2VAPA 5KX5B 1M1KH 1VQLF 2R751 1YITF 3RA5A 3C9RA 5LA6B 3LWRC 5J2UB 1SDSA 2KTUA 4I50B 3CMEF 1OAPA 1Z5WA 3R0PA 4X3LA 4C8GA 4G4XA 1DBFA 1W42A 5CB4B 3MCAB 3VI6A 3GTZA 3KE1A 5CA0A 4BT4A 2H8CA 4TZZA 4EI8A 3CCVF 3NMUC 2BTQB 2HS0A 3LYBA 5GONB 3GYQA 1JFFB 3T80A 5J2UA 5IYZB 3CCMF 1JY8A 4G4ZA 1IV3A 2H6LA 2UZHA 3DC2A 5LP6A 1TVKA 4O4LA 4B62A 4BT6A 3LFOA 2LBTA 1W2BF 2ZVYA 4XCQA 3VCZA 4NWOB 2HP0B 3B6NA 3VYUC 5HP8A 3RYIA 3PLAC 4BVSA 2DYYA 4O2AB 3ERNA 1UI9A 1U3PA 1Q8RA 1H48A 4TV8B 1UFYA 2VGMA 4PWTA 3FFMA 3UT5A 1KD1H 3FBAA 5KMGA 3CYPB 3JATB 3P0ZA 3JARA 4BVTA 1TUBB 3N2GB 3LDTA 5G4UC 2FGYA 4YJ2A 3HKDB 2NMUA 3CCRF 4I4TB 3VMFB 3HKEB 3I55F 3HWUA 2UYJA 3DDNA 5LA6A 2BTUA 5IYZA 1W5EA 3JARB 2I6DA 3ON1A 1RA4A 4C8EA 1X7OA 3JATA 2G9IA 3LMEA 1XRGA 5EO3A 3O85A 4LNUA 3CCEF 4EI9A 5CA0B 4X1YB 3F0EA 1VQ9F 4R40B 5CB4A 5GIPC 1W41A 4O2AA 4O4IA 4ZOLA 1VH8A 5EB1B 5J2TA 3CYQA 3WPWA 3WJPA 1XHOA 3HKBB 3ESJA 3N4ZA 4X1KB 4BT3A 3CCSF 3CXCF 3E22B 4G88A 1VQMF 3F6MA 4U3JA 2CWJA
chains in the Genus database with same CATH topology
2DYYA 3QUWA 4ZK7A 2IG8A 3K0TA 3M4SA 2CSLA 1UI9A 5HP7A 1NQ3A 3K12A 1QAHA 3LYBA 1UFYA 1XRGA 3LMEA 3ZO8A 2UYNB 3KJJA 3MQWA 2EWCA 2OTMA 3KJKA 3ZP7A 1JD1A 2UYPA 3D01A 1X25A 2CVLA 1ONIA 2CHSA 3L7QA 2UYKA 2UYNA 1FNJA 2CHTA 1ODEA 3I3FA 3M1XA 3R0PA 1FNKA 1QD9A 3GTZA 3ZOPA 1XHOA 1DBFA 2CW4A 1QU9A 2B33A 2UYJA 3I7TA 4NWOB 1PF5A 3VCZA 5HP8A 3V4DA 2CWJA 3ZP4A 1J7HA 1COMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYY A;  3QUW A;  4ZK7 A;  2IG8 A;  3K0T A;  3M4S A;  2CSL A;  1UI9 A;  5HP7 A;  1NQ3 A;  3K12 A;  1QAH A;  3LYB A;  1UFY A;  1XRG A;  3LME A;  3ZO8 A;  2UYN B;  3KJJ A;  3MQW A;  2EWC A;  2OTM A;  3KJK A;  3ZP7 A;  1JD1 A;  2UYP A;  3D01 A;  1X25 A;  2CVL A;  1ONI A;  2CHS A;  3L7Q A;  2UYK A;  2UYN A;  1FNJ A;  2CHT A;  1ODE A;  3I3F A;  3M1X A;  3R0P A;  1FNK A;  1QD9 A;  3GTZ A;  3ZOP A;  1XHO A;  1DBF A;  2CW4 A;  1QU9 A;  2B33 A;  2UYJ A;  3I7T A;  4NWO B;  1PF5 A;  3VCZ A;  5HP8 A;  3V4D A;  2CWJ A;  3ZP4 A;  1J7H A;  1COM A; 
#chains in the Genus database with same CATH topology
 3QUW A;  4X20 B;  2HQS C;  3E22 A;  3NK6 A;  3S02 A;  2AMT A;  1TVK B;  4ZHV A;  1YHQ F;  3TD3 A;  5MN5 A;  4I55 A;  4G4V A;  3CB2 A;  3QHD A;  4TV9 A;  1SZQ A;  1NJI H;  1JD1 A;  4O4J A;  1JFF A;  4IHJ A;  3WJR A;  5LXT B;  4DRX A;  4LNU B;  3VOB A;  3ZOP A;  3CPW F;  2ZVZ A;  5ITZ B;  3S06 A;  4EB6 A;  3CC4 F;  4C4W C;  1RLU A;  3EOR A;  3RYH B;  1K8A H;  5MN6 A;  5HXU A;  1ZWZ A;  3VOA A;  5GAP K;  3VIU A;  4I50 A;  5HY4 A;  2VAW A;  3IKE A;  3HKD A;  3Q8H A;  3F0F A;  3JAL B;  1JN1 A;  4B46 A;  5LP6 B;  3KJK A;  3N2K A;  3E20 B;  5JCO A;  3G6E F;  3WGJ A;  2VXY A;  1IV2 A;  4IIJ A;  3CCQ F;  5B8F A;  1IV4 A;  2VAM A;  4M8I A;  1U43 A;  1CLI A;  1E7K A;  5JQG A;  2RB9 A;  4O4I B;  3CC7 F;  1KNK A;  2BO1 A;  2CSL A;  4ZI7 A;  3LWO C;  5FLX M;  1QVG F;  3ZO8 A;  4C81 A;  3J80 M;  2Q1X A;  3JAK A;  3MQW A;  2EWC A;  1W3E X;  4TUY A;  1X7P A;  1RLG A;  3RE3 A;  5CA1 A;  3LWP C;  4E6E A;  1CK2 A;  1ODE A;  3M1X A;  1QD9 A;  3WGN A;  3S0H A;  5CA1 B;  2OTL F;  5FJ4 C;  1W57 A;  5AVM A;  4TUY B;  3NVK E;  5LP6 C;  2JNB A;  3JAW A;  5EAZ A;  3K14 A;  3K0T A;  3JCM M;  2I6R A;  1N8R H;  1Q86 H;  1S72 F;  1CN7 A;  3HTN A;  3RYC A;  3JAM M;  4B5C A;  5IJ0 A;  3HJW C;  4B45 A;  2HX0 A;  4WBN A;  4LCK A;  3HKC A;  1VQ8 F;  2OTJ F;  1W40 A;  1OFU A;  2CVL A;  3FPI A;  4I55 B;  2RHL A;  3TD5 A;  3L7Q A;  2N48 A;  3MCQ A;  3P10 A;  4BT2 A;  3D54 A;  4EI7 A;  4ZHW A;  4DXD A;  5DCV A;  3JAK B;  1XV2 A;  5GIO C;  1VQ6 F;  3IKF A;  3M4S A;  4FFB B;  5EYP A;  4WBN B;  1KQS F;  3VYT C;  1YQN A;  3IEW A;  2LBX A;  2HRY A;  3M84 A;  3SIV A;  3P4E A;  2HP3 A;  2VGN A;  1W5F A;  3WJQ A;  4HNA B;  2UYN A;  5JH7 B;  3S0Y A;  4IIJ B;  1SA0 B;  4RHA A;  1FFX B;  3PAF A;  5HWE A;  3I7T A;  3N2K B;  3RA6 A;  4ZHQ A;  3GHZ A;  4O4H B;  5LYJ A;  3C8L A;  3VO8 A;  3CG6 A;  4C8I A;  2RHO A;  1QAH A;  3RYF B;  1DT9 A;  4HNA A;  3OBY A;  2QA4 F;  2Z01 A;  3VTI C;  3CMA F;  1VQO F;  1XBI A;  5ITZ A;  2Z1U A;  4ERH A;  4U3J B;  3CD6 F;  1X25 A;  5JVD B;  3C9S A;  1W5A A;  1VQN F;  3IR9 A;  2CHT A;  3I3F A;  1K73 H;  1FNK A;  2Q1Y A;  1YJ9 F;  3I56 F;  1H7M A;  3IMP A;  4YJ3 B;  5EIB C;  5EZY A;  3CC2 F;  2Z1T A;  3FD6 A;  4X1I B;  3LWQ C;  3WGM A;  5IJ9 B;  3JAL A;  5A2Q M;  1Q7Y H;  4RQO A;  1VQ5 F;  1IV1 A;  1RQ2 A;  2OHW A;  3CCJ F;  2OTM A;  1X52 A;  3S0W A;  4O4H A;  4ZHQ B;  5HY2 A;  3F0D A;  5FNV B;  4EB6 B;  1U40 A;  5C8Y A;  2AIZ P;  4KWE A;  1VHA A;  2AIF A;  2HRU A;  3N2G A;  1Z5V A;  3JAS B;  1QU9 A;  2B33 A;  1YGY A;  2K1S A;  1J7H A;  3S03 A;  1GO1 A;  2GZL A;  3V7E A;  3WXM B;  2ALE A;  1W5B A;  3JVH A;  1YI2 F;  1NMU B;  5FNV A;  4F6R B;  5LOV B;  5G4V C;  1YJN F;  3OBW A;  4FFB A;  5EYP B;  3OON A;  2YXZ A;  1VQ4 F;  3IEQ A;  1VQ7 F;  2H8E A;  1GZ0 A;  2PHN A;  1VK3 A;  2LCA A;  1RQ7 A;  2UYK A;  1GO0 A;  3WGL A;  1W55 A;  1W58 1;  5IJ9 A;  4BT7 A;  4X1I A;  4BVR A;  4F6R A;  1H47 A;  3AGK A;  3BYQ A;  1T0K B;  3D00 A;  3G4S F;  3NK7 A;  2WAL A;  5KMG B;  5HY1 A;  3UT5 B;  5JVD A;  2IQQ A;  5IJ0 B;  1YJW F;  4BT5 A;  4NUT A;  1M90 H;  2ZF8 A;  4NQ3 A;  3NVI B;  3OW2 F;  4ZOL B;  4BVQ A;  2V9Y A;  4O2B B;  2F9Z C;  4DRX B;  3RYI B;  5MN4 A;  3E1Y A;  5LYJ B;  1ONI A;  5IT9 M;  2FC3 A;  3V3T A;  5LOV A;  4U39 A;  4G4W A;  3HKC B;  1Q82 H;  1PF5 A;  3ELC A;  3RYC B;  1FSZ A;  1SA0 A;  2IG8 A;  5GON A;  4I4T A;  4O2B A;  4YJ3 A;  5HP7 A;  4YJ2 B;  2KG4 A;  2BTO A;  3F0G A;  2CZW A;  5C8Y B;  5LXT A;  5J2T B;  2L26 A;  3J7A R;  3KJJ A;  2PMP A;  2UYP A;  3C9U A;  3D01 A;  2W8B C;  5JQG B;  2HP0 A;  1JJ2 F;  4BY9 D;  1K9M H;  3K2X A;  2HVY D;  2CW4 A;  3MBM A;  4O4L B;  5EWR A;  5KX5 A;  3V4D A;  1COM A;  3N4Y A;  3LWV C;  1VQP F;  2HS4 A;  5HY0 A;  4ZHY B;  1PXW A;  3K12 A;  2ZOD A;  3U0O A;  2RHJ A;  3SIU A;  2UYN B;  5JH7 A;  2ZAU A;  3RYH A;  3ZP7 A;  3JAW B;  3CPQ A;  3CCL F;  1IPA A;  2Z1E A;  1U3L A;  3JAS A;  2QEX F;  2QI2 A;  1FNJ A;  3CCU F;  3RYF A;  3MDO A;  4TV8 A;  4X3M A;  3ZP4 A;  4O4J B;  4TV9 B;  3WGK A;  1Q81 H;  3KIZ A;  4ZK7 A;  3HKE A;  2LBW A;  2R6R 1;  2MQE A;  1T0A A;  1NQ3 A;  1FFX A;  2GVI A;  1R1M A;  2KTV A;  5EIB D;  2Z1F A;  1QVF F;  1TUB A;  4BW0 B;  2RHH A;  4X20 A;  3G71 F;  2OZB A;  2YYE A;  2IAF A;  1KNJ A;  5EB0 A;  5EZY B;  2HS3 A;  2CHS A;  2QTP A;  3HKB A;  4X1K A;  3J81 M;  1YIJ F;  3C9T A;  5BMV B;  5GIN C;  4ZI7 B;  4IHJ B;  2ZOV A;  3VYS C;  5HXZ A;  4G4Y A;  1KC8 H;  2GLZ A;  3FD5 A;  5GAN K;  1W59 A;  4C82 A;  4X1Y A;  1VQK F;  5JCO C;  2P6Y A;  5BMV A;  3KHN A;  3TD4 A;  2KGW A;  3HAX D;  3V7Q A;  3WPX A;  2DT4 A;  3QTY A;  1VQV A;  1GX1 A;  2VAP A;  5KX5 B;  1M1K H;  1VQL F;  2R75 1;  1YIT F;  3RA5 A;  3C9R A;  5LA6 B;  3LWR C;  5J2U B;  1SDS A;  2KTU A;  4I50 B;  3CME F;  1OAP A;  1Z5W A;  3R0P A;  4X3L A;  4C8G A;  4G4X A;  1DBF A;  1W42 A;  5CB4 B;  3MCA B;  3VI6 A;  3GTZ A;  3KE1 A;  5CA0 A;  4BT4 A;  2H8C A;  4TZZ A;  4EI8 A;  3CCV F;  3NMU C;  2BTQ B;  2HS0 A;  3LYB A;  5GON B;  3GYQ A;  1JFF B;  3T80 A;  5J2U A;  5IYZ B;  3CCM F;  1JY8 A;  4G4Z A;  1IV3 A;  2H6L A;  2UZH A;  3DC2 A;  5LP6 A;  1TVK A;  4O4L A;  4B62 A;  4BT6 A;  3LFO A;  2LBT A;  1W2B F;  2ZVY A;  4XCQ A;  3VCZ A;  4NWO B;  2HP0 B;  3B6N A;  3VYU C;  5HP8 A;  3RYI A;  3PLA C;  4BVS A;  2DYY A;  4O2A B;  3ERN A;  1UI9 A;  1U3P A;  1Q8R A;  1H48 A;  4TV8 B;  1UFY A;  2VGM A;  4PWT A;  3FFM A;  3UT5 A;  1KD1 H;  3FBA A;  5KMG A;  3CYP B;  3JAT B;  3P0Z A;  3JAR A;  4BVT A;  1TUB B;  3N2G B;  3LDT A;  5G4U C;  2FGY A;  4YJ2 A;  3HKD B;  2NMU A;  3CCR F;  4I4T B;  3VMF B;  3HKE B;  3I55 F;  3HWU A;  2UYJ A;  3DDN A;  5LA6 A;  2BTU A;  5IYZ A;  1W5E A;  3JAR B;  2I6D A;  3ON1 A;  1RA4 A;  4C8E A;  1X7O A;  3JAT A;  2G9I A;  3LME A;  1XRG A;  5EO3 A;  3O85 A;  4LNU A;  3CCE F;  4EI9 A;  5CA0 B;  4X1Y B;  3F0E A;  1VQ9 F;  4R40 B;  5CB4 A;  5GIP C;  1W41 A;  4O2A A;  4O4I A;  4ZOL A;  1VH8 A;  5EB1 B;  5J2T A;  3CYQ A;  3WPW A;  3WJP A;  1XHO A;  3HKB B;  3ESJ A;  3N4Z A;  4X1K B;  4BT3 A;  3CCS F;  3CXC F;  3E22 B;  4G88 A;  1VQM F;  3F6M A;  4U3J A;  2CWJ A; 
#chains in the Genus database with same CATH homology
 2DYY A;  3QUW A;  4ZK7 A;  2IG8 A;  3K0T A;  3M4S A;  2CSL A;  1UI9 A;  5HP7 A;  1NQ3 A;  3K12 A;  1QAH A;  3LYB A;  1UFY A;  1XRG A;  3LME A;  3ZO8 A;  2UYN B;  3KJJ A;  3MQW A;  2EWC A;  2OTM A;  3KJK A;  3ZP7 A;  1JD1 A;  2UYP A;  3D01 A;  1X25 A;  2CVL A;  1ONI A;  2CHS A;  3L7Q A;  2UYK A;  2UYN A;  1FNJ A;  2CHT A;  1ODE A;  3I3F A;  3M1X A;  3R0P A;  1FNK A;  1QD9 A;  3GTZ A;  3ZOP A;  1XHO A;  1DBF A;  2CW4 A;  1QU9 A;  2B33 A;  2UYJ A;  3I7T A;  4NWO B;  1PF5 A;  3VCZ A;  5HP8 A;  3V4D A;  2CWJ A;  3ZP4 A;  1J7H A;  1COM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...