1X25A

Crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
SHMETVFTEKAPKPVGPYSQAIKVGNTLYVSGQIPIDPRTNEIVKGDIKVQTRQVLDNIKEIVKAAGFSLSDVAMAFVFLKDMNMFNDFNSVYAEYFKDKPPARVTVEVSRLPKDALIEIAVICSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YjgF/YER057c/UK114 family protein from the hyperthermophilic archaeon Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0076 protein ST0811
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1x25A00
1FNKA 1NQ3A 2UYJA 3I7TA 3ZO8A 2CW4A 3LMEA 1XRGA 1DBFA 3D01A 2B33A 2UYKA 3K0TA 2CWJA 2CHTA 3M1XA 3K12A 2UYPA 3LYBA 2DYYA 1UI9A 1ONIA 5HP8A 1UFYA 1QAHA 2CVLA 2IG8A 2UYNA 3KJKA 2UYNB 1QD9A 1J7HA 3GTZA 2CSLA 1FNJA 3L7QA 4ZK7A 1COMA 1QU9A 3ZOPA 3MQWA 2OTMA 5HP7A 1X25A 1JD1A 3V4DA 1XHOA 3VCZA 3M4SA 3I3FA 3ZP4A 1ODEA 2CHSA 3KJJA 1PF5A 3QUWA 3R0PA 2EWCA 3ZP7A 4NWOB
chains in the Genus database with same CATH superfamily
4LNUA 3E1YA 3CCMF 3CCUF 4EI7A 2HS4A 3CPWF 1RQ7A 3D54A 2Z1TA 5HY0A 5CB4B 5LOVB 3GYQA 4IIJA 1W5EA 3N2GA 3VI6A 4DXDA 1VK3A 2DT4A 1Z5VA 3VOBA 1JN1A 2RHLA 3VYUC 1VQMF 1W3EX 1OFUA 1X7OA 3WGKA 3T80A 2VAMA 1VQNF 4X1KA 3G4SF 4TV9A 3CC2F 1W41A 1T0AA 2GZLA 2VGNA 3N2KB 3ZP7A 3G6EF 4RQOA 3I7TA 3HTNA 4X1IB 1IV3A 2P6YA 2HS0A 3P0ZA 1KNJA 1H7MA 3SIVA 3CPQA 1VQ5F 2G9IA 4HNAB 3O85A 1UI9A 3CCQF 1Q81H 5MN6A 1IV4A 1IV2A 4O4LA 3IKFA 1OAPA 5EZYB 3CB2A 1GO1A 1XBIA 1QU9A 3UT5B 3E22B 4I55B 5HXUA 3PAFA 2OTLF 1JD1A 5CA0A 1NMUB 3K14A 5FJ4C 3KJJA 1KD1H 3FD6A 3RYHA 3VOAA 2ZVYA 3J80M 2EWCA 1GZ0A 4O4HB 4O4JA 4X3LA 3DDNA 5EWRA 2QEXF 3S06A 1VQVA 3E22A 2K1SA 3WGJA 5EB0A 1DT9A 1ONIA 5HP8A 1UFYA 3HWUA 1VH8A 5GAPK 1W57A 2UYNB 3TD5A 4I50A 4O4JB 1Z5WA 5JH7B 3AGKA 2NMUA 3KIZA 3CCRF 5CA0B 1XHOA 5EAZA 3J81M 4ZI7A 2IQQA 4BT4A 1RLUA 3TD3A 1PF5A 4B5CA 1TUBA 2ZF8A 5BMVA 5HY2A 1E7KA 3S02A 3V7QA 2B33A 1CLIA 4G4VA 3S0YA 2CHTA 5CB4A 2QTPA 1U3PA 4BW0B 2VAWA 2UYNA 4U3JA 3N2GB 1M1KH 1QVGF 1SZQA 5C8YA 2KTUA 3VCZA 3LWOC 3HKCB 3P10A 4IHJA 3FBAA 2I6RA 1YJWF 3CXCF 3KE1A 3CG6A 4FFBA 3RE3A 4NWOB 3WGLA 3KHNA 1VQ4F 3F0GA 3LMEA 1XRGA 3C9UA 2R751 3F0EA 4F6RB 3JALA 3LYBA 3NVIB 1JFFB 2Z01A 3FPIA 5LOVA 3QHDA 1IPAA 3S0WA 1SA0B 4X1YA 3JAWA 5AVMA 3K2XA 3N4ZA 4YJ2A 4ZHQA 2OTMA 3UT5A 3NK6A 3M4SA 4BVQA 3ON1A 1X7PA 3IR9A 4O2AB 3WGNA 5KMGA 4BVTA 3CCJF 1FNKA 1IV1A 3JATA 4ZHVA 4X20A 3JCMM 2F9ZC 3S0HA 1Q86H 3U0OA 3RA5A 1YITF 2BTUA 4I4TA 3EORA 4G4YA 5J2TB 3VYTC 3S03A 3WPWA 3LWPC 1YI2F 4TUYA 3HKBA 3MBMA 3ZP4A 3LWRC 3HKDA 4C8GA 2FC3A 4I55A 1YJ9F 3I55F 2HP0B 2LCAA 1YJNF 3P4EA 4U3JB 1K8AH 1DBFA 4PWTA 1FFXB 2Q1XA 4BY9D 5MN4A 3GHZA 5G4VC 2DYYA 1YQNA 2OHWA 3WGMA 2OZBA 5J2TA 5JCOC 5IT9M 2QI2A 2CSLA 2AIFA 3ZOPA 4FFBB 5LP6B 2HQSC 4YJ3A 1JY8A 3RYCB 1W40A 2VGMA 3HKCA 2I6DA 2QA4F 4G88A 1YGYA 1W5BA 3R0PA 1H48A 4F6RA 1FSZA 1JFFA 2HRYA 2V9YA 2RB9A 1TUBB 2Q1YA 2HRUA 3OBWA 1YHQF 5LP6A 4RHAA 3CYPB 5IJ0B 2VXYA 1RLGA 1H47A 2KGWA 1PXWA 3CCVF 4X1YB 1COMA 1RA4A 4O2BB 5HWEA 3IEQA 3VTIC 3RYCA 4BT3A 4O4IB 4U39A 4ZOLB 3FD5A 5IJ0A 1W2BF 5GONA 5ITZB 4G4XA 4TV8A 2ZAUA 1W59A 3IKEA 3RYFB 3K0TA 3WXMB 3CMEF 3SIUA 5LA6B 2WALA 3G71F 1JJ2F 2UZHA 3CC4F 4C8EA 3RYIA 3WJPA 1KC8H 3HKDB 4ZK7A 3C8LA 1VQLF 1W42A 2W8BC 3JARA 5HP7A 4TV9B 4C8IA 4TUYB 2CHSA 1VQOF 4TV8B 1FFXA 3FFMA 5LXTB 3CCLF 3NK7A 3RYIB 2HP0A 3JAKA 5FNVB 2UYJA 1SDSA 3MDOA 4R40B 3ZO8A 1ZWZA 2CW4A 5J2UA 5LYJA 4ZHQB 5LA6A 3VO8A 1YIJF 3D00A 3ERNA 4O4LB 3CMAF 4LNUB 3JAMM 3KJKA 3M84A 4HNAA 3LWVC 2HX0A 5LP6C 3GTZA 2LBWA 3E20B 3L7QA 3JAKB 5FNVA 3HAXD 4IIJB 4NUTA 3I56F 4X20B 1W5AA 5EB1B 2RHJA 2H6LA 5CA1A 4BT5A 4ZHYB 3DC2A 3CYQA 2HP3A 3HKEB 5LYJB 1Q7YH 3CC7F 4M8IA 1Q82H 3LDTA 2ZOVA 3K12A 2KG4A 2UYPA 2H8EA 1QVFF 2Z1UA 1J7HA 4BT7A 5JCOA 3JASA 1U3LA 3RYFA 3VIUA 5IYZA 3I3FA 3N4YA 4O4IA 3QUWA 4YJ3B 1KQSF 4XCQA 5EYPB 1VQ9F 5JQGB 1K73H 4B45A 1Q8RA 3HKEA 4EI8A 4BVRA 4C81A 5A2QM 1VQ8F 5B8FA 5JVDA 4EB6B 1VQKF 3V3TA 3JARB 1N8RH 1KNKA 5C8YB 2FGYA 4BT6A 1FNJA 2KTVA 5LXTA 2RHOA 3MQWA 5IYZB 4NQ3A 1VHAA 3JATB 3CCSF 5JQGA 3C9RA 3V7EA 4ZOLA 5EO3A 5GONB 4G4WA 3D01A 4I4TB 1W5FA 2ZVZA 1SA0A 4ZHWA 3JAWB 3LFOA 5IJ9B 2R6R1 3RA6A 1VQ6F 4C82A 2JNBA 4DRXB 3WPXA 3B6NA 5CA1B 5HY4A 2Z1FA 3CD6F 1TVKA 1X25A 4O2AA 1VQ7F 5KX5B 5IJ9A 5FLXM 2GVIA 1M90H 2MQEA 3OW2F 4IHJB 2LBXA 3WJRA 5KMGB 3VMFB 2H8CA 2BTQB 1TVKB 2ZODA 2PHNA 5J2UB 2N48A 3HJWC 1QAHA 1T0KB 1CK2A 5DCVA 5G4UC 4DRXA 4WBNA 5HXZA 3HKBB 4X3MA 4BVSA 2AMTA 3JALB 2IAFA 2CZWA 3RYHB 3V4DA 5GANK 3IEWA 1ODEA 4KWEA 5GIPC 5KX5A 3N2KA 3Q8HA 4YJ2B 4EB6A 2PMPA 1NQ3A 4G4ZA 5EIBD 1NJIH 1W55A 3NVKE 4X1KB 2UYKA 1K9MH 2OTJF 3ESJA 3MCAB 2BTOA 3TD4A 4E6EA 2RHHA 3M1XA 3WJQA 5MN5A 3LWQC 4I50B 3J7AR 3CCEF 1U40A 4B62A 5JH7A 2CVLA 2IG8A 4X1IA 2L26A 3BYQA 5BMVB 2GLZA 4WBNB 1W581 2HVYD 1GO0A 1QD9A 4TZZA 3IMPA 3PLAC 1CN7A 1U43A 4ZI7B 3F0DA 3OONA 3NMUC 2YXZA 4EI9A 2Z1EA 2BO1A 4BT2A 1VQPF 3ELCA 2AIZP 3JASB 5EZYA 1GX1A 4O4HA 2ALEA 2LBTA 3OBYA 4LCKA 5GINC 2YYEA 2VAPA 5EYPA 1RQ2A 1X52A 2CWJA 3VYSC 1XV2A 3JVHA 3C9TA 5EIBC 3C9SA 5JVDB 5GIOC 1S72F 2HS3A 1R1MA 4B46A 5HY1A 3F0FA 3QTYA 3F6MA 4ERHA 5ITZA 4C4WC 3MCQA 4O2BA
chains in the Genus database with same CATH topology
1FNKA 1NQ3A 2UYJA 3I7TA 3ZO8A 2CW4A 3LMEA 1XRGA 1DBFA 3D01A 2B33A 2UYKA 3K0TA 2CWJA 2CHTA 3M1XA 3K12A 2UYPA 3LYBA 2DYYA 1UI9A 1ONIA 5HP8A 1UFYA 1QAHA 2CVLA 2IG8A 2UYNA 3KJKA 2UYNB 1QD9A 1J7HA 3GTZA 2CSLA 1FNJA 3L7QA 4ZK7A 1COMA 1QU9A 3ZOPA 3MQWA 2OTMA 5HP7A 1X25A 1JD1A 3V4DA 1XHOA 3VCZA 3M4SA 3I3FA 3ZP4A 1ODEA 2CHSA 3KJJA 1PF5A 3QUWA 3R0PA 2EWCA 3ZP7A 4NWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNK A;  1NQ3 A;  2UYJ A;  3I7T A;  3ZO8 A;  2CW4 A;  3LME A;  1XRG A;  1DBF A;  3D01 A;  2B33 A;  2UYK A;  3K0T A;  2CWJ A;  2CHT A;  3M1X A;  3K12 A;  2UYP A;  3LYB A;  2DYY A;  1UI9 A;  1ONI A;  5HP8 A;  1UFY A;  1QAH A;  2CVL A;  2IG8 A;  2UYN A;  3KJK A;  2UYN B;  1QD9 A;  1J7H A;  3GTZ A;  2CSL A;  1FNJ A;  3L7Q A;  4ZK7 A;  1COM A;  1QU9 A;  3ZOP A;  3MQW A;  2OTM A;  5HP7 A;  1X25 A;  1JD1 A;  3V4D A;  1XHO A;  3VCZ A;  3M4S A;  3I3F A;  3ZP4 A;  1ODE A;  2CHS A;  3KJJ A;  1PF5 A;  3QUW A;  3R0P A;  2EWC A;  3ZP7 A;  4NWO B; 
#chains in the Genus database with same CATH topology
 4LNU A;  3E1Y A;  3CCM F;  3CCU F;  4EI7 A;  2HS4 A;  3CPW F;  1RQ7 A;  3D54 A;  2Z1T A;  5HY0 A;  5CB4 B;  5LOV B;  3GYQ A;  4IIJ A;  1W5E A;  3N2G A;  3VI6 A;  4DXD A;  1VK3 A;  2DT4 A;  1Z5V A;  3VOB A;  1JN1 A;  2RHL A;  3VYU C;  1VQM F;  1W3E X;  1OFU A;  1X7O A;  3WGK A;  3T80 A;  2VAM A;  1VQN F;  4X1K A;  3G4S F;  4TV9 A;  3CC2 F;  1W41 A;  1T0A A;  2GZL A;  2VGN A;  3N2K B;  3ZP7 A;  3G6E F;  4RQO A;  3I7T A;  3HTN A;  4X1I B;  1IV3 A;  2P6Y A;  2HS0 A;  3P0Z A;  1KNJ A;  1H7M A;  3SIV A;  3CPQ A;  1VQ5 F;  2G9I A;  4HNA B;  3O85 A;  1UI9 A;  3CCQ F;  1Q81 H;  5MN6 A;  1IV4 A;  1IV2 A;  4O4L A;  3IKF A;  1OAP A;  5EZY B;  3CB2 A;  1GO1 A;  1XBI A;  1QU9 A;  3UT5 B;  3E22 B;  4I55 B;  5HXU A;  3PAF A;  2OTL F;  1JD1 A;  5CA0 A;  1NMU B;  3K14 A;  5FJ4 C;  3KJJ A;  1KD1 H;  3FD6 A;  3RYH A;  3VOA A;  2ZVY A;  3J80 M;  2EWC A;  1GZ0 A;  4O4H B;  4O4J A;  4X3L A;  3DDN A;  5EWR A;  2QEX F;  3S06 A;  1VQV A;  3E22 A;  2K1S A;  3WGJ A;  5EB0 A;  1DT9 A;  1ONI A;  5HP8 A;  1UFY A;  3HWU A;  1VH8 A;  5GAP K;  1W57 A;  2UYN B;  3TD5 A;  4I50 A;  4O4J B;  1Z5W A;  5JH7 B;  3AGK A;  2NMU A;  3KIZ A;  3CCR F;  5CA0 B;  1XHO A;  5EAZ A;  3J81 M;  4ZI7 A;  2IQQ A;  4BT4 A;  1RLU A;  3TD3 A;  1PF5 A;  4B5C A;  1TUB A;  2ZF8 A;  5BMV A;  5HY2 A;  1E7K A;  3S02 A;  3V7Q A;  2B33 A;  1CLI A;  4G4V A;  3S0Y A;  2CHT A;  5CB4 A;  2QTP A;  1U3P A;  4BW0 B;  2VAW A;  2UYN A;  4U3J A;  3N2G B;  1M1K H;  1QVG F;  1SZQ A;  5C8Y A;  2KTU A;  3VCZ A;  3LWO C;  3HKC B;  3P10 A;  4IHJ A;  3FBA A;  2I6R A;  1YJW F;  3CXC F;  3KE1 A;  3CG6 A;  4FFB A;  3RE3 A;  4NWO B;  3WGL A;  3KHN A;  1VQ4 F;  3F0G A;  3LME A;  1XRG A;  3C9U A;  2R75 1;  3F0E A;  4F6R B;  3JAL A;  3LYB A;  3NVI B;  1JFF B;  2Z01 A;  3FPI A;  5LOV A;  3QHD A;  1IPA A;  3S0W A;  1SA0 B;  4X1Y A;  3JAW A;  5AVM A;  3K2X A;  3N4Z A;  4YJ2 A;  4ZHQ A;  2OTM A;  3UT5 A;  3NK6 A;  3M4S A;  4BVQ A;  3ON1 A;  1X7P A;  3IR9 A;  4O2A B;  3WGN A;  5KMG A;  4BVT A;  3CCJ F;  1FNK A;  1IV1 A;  3JAT A;  4ZHV A;  4X20 A;  3JCM M;  2F9Z C;  3S0H A;  1Q86 H;  3U0O A;  3RA5 A;  1YIT F;  2BTU A;  4I4T A;  3EOR A;  4G4Y A;  5J2T B;  3VYT C;  3S03 A;  3WPW A;  3LWP C;  1YI2 F;  4TUY A;  3HKB A;  3MBM A;  3ZP4 A;  3LWR C;  3HKD A;  4C8G A;  2FC3 A;  4I55 A;  1YJ9 F;  3I55 F;  2HP0 B;  2LCA A;  1YJN F;  3P4E A;  4U3J B;  1K8A H;  1DBF A;  4PWT A;  1FFX B;  2Q1X A;  4BY9 D;  5MN4 A;  3GHZ A;  5G4V C;  2DYY A;  1YQN A;  2OHW A;  3WGM A;  2OZB A;  5J2T A;  5JCO C;  5IT9 M;  2QI2 A;  2CSL A;  2AIF A;  3ZOP A;  4FFB B;  5LP6 B;  2HQS C;  4YJ3 A;  1JY8 A;  3RYC B;  1W40 A;  2VGM A;  3HKC A;  2I6D A;  2QA4 F;  4G88 A;  1YGY A;  1W5B A;  3R0P A;  1H48 A;  4F6R A;  1FSZ A;  1JFF A;  2HRY A;  2V9Y A;  2RB9 A;  1TUB B;  2Q1Y A;  2HRU A;  3OBW A;  1YHQ F;  5LP6 A;  4RHA A;  3CYP B;  5IJ0 B;  2VXY A;  1RLG A;  1H47 A;  2KGW A;  1PXW A;  3CCV F;  4X1Y B;  1COM A;  1RA4 A;  4O2B B;  5HWE A;  3IEQ A;  3VTI C;  3RYC A;  4BT3 A;  4O4I B;  4U39 A;  4ZOL B;  3FD5 A;  5IJ0 A;  1W2B F;  5GON A;  5ITZ B;  4G4X A;  4TV8 A;  2ZAU A;  1W59 A;  3IKE A;  3RYF B;  3K0T A;  3WXM B;  3CME F;  3SIU A;  5LA6 B;  2WAL A;  3G71 F;  1JJ2 F;  2UZH A;  3CC4 F;  4C8E A;  3RYI A;  3WJP A;  1KC8 H;  3HKD B;  4ZK7 A;  3C8L A;  1VQL F;  1W42 A;  2W8B C;  3JAR A;  5HP7 A;  4TV9 B;  4C8I A;  4TUY B;  2CHS A;  1VQO F;  4TV8 B;  1FFX A;  3FFM A;  5LXT B;  3CCL F;  3NK7 A;  3RYI B;  2HP0 A;  3JAK A;  5FNV B;  2UYJ A;  1SDS A;  3MDO A;  4R40 B;  3ZO8 A;  1ZWZ A;  2CW4 A;  5J2U A;  5LYJ A;  4ZHQ B;  5LA6 A;  3VO8 A;  1YIJ F;  3D00 A;  3ERN A;  4O4L B;  3CMA F;  4LNU B;  3JAM M;  3KJK A;  3M84 A;  4HNA A;  3LWV C;  2HX0 A;  5LP6 C;  3GTZ A;  2LBW A;  3E20 B;  3L7Q A;  3JAK B;  5FNV A;  3HAX D;  4IIJ B;  4NUT A;  3I56 F;  4X20 B;  1W5A A;  5EB1 B;  2RHJ A;  2H6L A;  5CA1 A;  4BT5 A;  4ZHY B;  3DC2 A;  3CYQ A;  2HP3 A;  3HKE B;  5LYJ B;  1Q7Y H;  3CC7 F;  4M8I A;  1Q82 H;  3LDT A;  2ZOV A;  3K12 A;  2KG4 A;  2UYP A;  2H8E A;  1QVF F;  2Z1U A;  1J7H A;  4BT7 A;  5JCO A;  3JAS A;  1U3L A;  3RYF A;  3VIU A;  5IYZ A;  3I3F A;  3N4Y A;  4O4I A;  3QUW A;  4YJ3 B;  1KQS F;  4XCQ A;  5EYP B;  1VQ9 F;  5JQG B;  1K73 H;  4B45 A;  1Q8R A;  3HKE A;  4EI8 A;  4BVR A;  4C81 A;  5A2Q M;  1VQ8 F;  5B8F A;  5JVD A;  4EB6 B;  1VQK F;  3V3T A;  3JAR B;  1N8R H;  1KNK A;  5C8Y B;  2FGY A;  4BT6 A;  1FNJ A;  2KTV A;  5LXT A;  2RHO A;  3MQW A;  5IYZ B;  4NQ3 A;  1VHA A;  3JAT B;  3CCS F;  5JQG A;  3C9R A;  3V7E A;  4ZOL A;  5EO3 A;  5GON B;  4G4W A;  3D01 A;  4I4T B;  1W5F A;  2ZVZ A;  1SA0 A;  4ZHW A;  3JAW B;  3LFO A;  5IJ9 B;  2R6R 1;  3RA6 A;  1VQ6 F;  4C82 A;  2JNB A;  4DRX B;  3WPX A;  3B6N A;  5CA1 B;  5HY4 A;  2Z1F A;  3CD6 F;  1TVK A;  1X25 A;  4O2A A;  1VQ7 F;  5KX5 B;  5IJ9 A;  5FLX M;  2GVI A;  1M90 H;  2MQE A;  3OW2 F;  4IHJ B;  2LBX A;  3WJR A;  5KMG B;  3VMF B;  2H8C A;  2BTQ B;  1TVK B;  2ZOD A;  2PHN A;  5J2U B;  2N48 A;  3HJW C;  1QAH A;  1T0K B;  1CK2 A;  5DCV A;  5G4U C;  4DRX A;  4WBN A;  5HXZ A;  3HKB B;  4X3M A;  4BVS A;  2AMT A;  3JAL B;  2IAF A;  2CZW A;  3RYH B;  3V4D A;  5GAN K;  3IEW A;  1ODE A;  4KWE A;  5GIP C;  5KX5 A;  3N2K A;  3Q8H A;  4YJ2 B;  4EB6 A;  2PMP A;  1NQ3 A;  4G4Z A;  5EIB D;  1NJI H;  1W55 A;  3NVK E;  4X1K B;  2UYK A;  1K9M H;  2OTJ F;  3ESJ A;  3MCA B;  2BTO A;  3TD4 A;  4E6E A;  2RHH A;  3M1X A;  3WJQ A;  5MN5 A;  3LWQ C;  4I50 B;  3J7A R;  3CCE F;  1U40 A;  4B62 A;  5JH7 A;  2CVL A;  2IG8 A;  4X1I A;  2L26 A;  3BYQ A;  5BMV B;  2GLZ A;  4WBN B;  1W58 1;  2HVY D;  1GO0 A;  1QD9 A;  4TZZ A;  3IMP A;  3PLA C;  1CN7 A;  1U43 A;  4ZI7 B;  3F0D A;  3OON A;  3NMU C;  2YXZ A;  4EI9 A;  2Z1E A;  2BO1 A;  4BT2 A;  1VQP F;  3ELC A;  2AIZ P;  3JAS B;  5EZY A;  1GX1 A;  4O4H A;  2ALE A;  2LBT A;  3OBY A;  4LCK A;  5GIN C;  2YYE A;  2VAP A;  5EYP A;  1RQ2 A;  1X52 A;  2CWJ A;  3VYS C;  1XV2 A;  3JVH A;  3C9T A;  5EIB C;  3C9S A;  5JVD B;  5GIO C;  1S72 F;  2HS3 A;  1R1M A;  4B46 A;  5HY1 A;  3F0F A;  3QTY A;  3F6M A;  4ERH A;  5ITZ A;  4C4W C;  3MCQ A;  4O2B A; 
#chains in the Genus database with same CATH homology
 1FNK A;  1NQ3 A;  2UYJ A;  3I7T A;  3ZO8 A;  2CW4 A;  3LME A;  1XRG A;  1DBF A;  3D01 A;  2B33 A;  2UYK A;  3K0T A;  2CWJ A;  2CHT A;  3M1X A;  3K12 A;  2UYP A;  3LYB A;  2DYY A;  1UI9 A;  1ONI A;  5HP8 A;  1UFY A;  1QAH A;  2CVL A;  2IG8 A;  2UYN A;  3KJK A;  2UYN B;  1QD9 A;  1J7H A;  3GTZ A;  2CSL A;  1FNJ A;  3L7Q A;  4ZK7 A;  1COM A;  1QU9 A;  3ZOP A;  3MQW A;  2OTM A;  5HP7 A;  1X25 A;  1JD1 A;  3V4D A;  1XHO A;  3VCZ A;  3M4S A;  3I3F A;  3ZP4 A;  1ODE A;  2CHS A;  3KJJ A;  1PF5 A;  3QUW A;  3R0P A;  2EWC A;  3ZP7 A;  4NWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...