3JALB

Cryo-em structure of gmpcpp-microtubule co-polymerized with eb3
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 150
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jalB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jalB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jalB01
4O4JB 3E22A 5EYPB 4X20A 5FNVA 4TV9B 3UT5A 5CA0B 3ZBPA 3R4VA 1FSZA 5EIBC 5IJ9A 4I4TA 4O2BB 4WBNA 5JCOC 4I50B 5LOVA 4ZI7B 3RYHA 5LA6B 3RYFB 4F6RA 3N2GB 4FFBB 3JAKA 1TUBB 4TUYA 2Q1XA 3RYCB 1OFUA 4ZOLA 4O4IA 5BMVB 5CB4A 5JQGB 5MN5A 5KX5B 3VOBA 3HKEA 2XKAA 4EI7A 1FFXA 5J2UB 5CA1A 2RHLA 5J2TB 5MN4A 4U39A 4DRXB 3HKDA 3HKBA 5LYJA 4X1KB 1JFFA 1W5EA 4O2AB 5LP6A 3RYIB 2VXYA 3JALB 5IYZB 5KMGA 3JARA 2XKBA 4ZHQB 3HKCA 5EZYA 3CB2A 3ZIDA 2BTQA 1W5BA 5C8YB 4KWEA 4O4LA 3E22B 4O4HA 5IJ0A 4X20B 2VAWA 4TV8A 2Q1YA 4HNAA 3UT5B 4X1YA 3ZBQA 3RB8A 1W59A 3V3TA 5IJ9B 1TVKA 4I4TB 4WBNB 5MN6A 3WGMA 5LOVB 1W581 1W5FA 2RHJA 4EB6A 3RYHB 5LXTA 4F6RB 4IIJA 4TUYB 5GONA 3JAKB 5ITZA 5JVDA 4ZOLB 4O4IB 5EIBD 5CB4B 3M89A 5M7EA 4E6EA 4EI8A 1Z5VA 4X1IA 3HKEB 1FFXB 5CA1B 2R751 4IHJA 3WGNA 3HKDB 3RYFA 3HKBB 1W5AA 3N2GA 5LYJB 3RYCA 3N2KA 1JFFB 5LP6B 3JAWA 1SA0B 1Z5WA 5JH7A 4M8IA 3JASA 5KMGB 4B45A 3HKCB 4YJ3A 4DRXA 4LNUA 4I55A 4U3JA 5EZYB 5FNVB 1RLUA 4X1KA 4DXDA 2BTQB 4YJ2A 4O2AA 4O4LB 3RYIA 2RHHA 5IYZA 3JATA 4O4JA 4O4HB 5EYPA 5IJ0B 4TV8B 4HNAB 4X1YB 3VO8A 4TV9A 3M8KA 5CA0A 3WGLA 3WGKA 4O2BA 5LP6C 4I50A 4EB6B 4ZI7A 5LXTB 3VPAA 4IIJB 5JVDB 5GONB 5ITZB 5LA6A 1RQ7A 3WGJA 4FFBA 1TUBA 3VOAA 1RQ2A 5BMVA 5JQGA 4X1IB 4EI9A 5JCOA 5KX5A 3C8LA 2RHOA 2R6R1 3JARB 4IHJB 5J2UA 5J2TA 4B46A 2BTOA 3N2KB 2VAMA 2VAPA 3VO9A 3JAWB 4XCQA 5JH7B 3JASB 2GVIA 3JALA 4YJ3B 4LNUB 4I55B 4U3JB 4ZHQA 4YJ2B 1SA0A 5C8YA 1TVKB 3JATB
chains in the Genus database with same CATH superfamily
3TQFA 4B76A 1E4VA 3GIWA 4Y2YA 2FFRA 1E0KA 3LBYA 2ZB8A 2EBHX 4GX5A 3IDSA 3I62A 1ISSA 3V7EA 1CQIB 5ICCA 2EEZA 3JPWA 2NW6A 2JJ1D 3QEJA 5KBYA 3EZYA 2NUPA 2HJ9A 1PJQA 5TNXA 2C4VA 4J3FA 1I0ZA 4Z4GA 2FW8A 4OFWA 1GZ4A 5CNKA 3H4MA 4WRRA 3KEQA 2XJ9A 3IVRA 4KOAA 3T3NA 3MPOA 4DIOA 3R6LA 4GWKA 4B6EA 1QNMA 2VA9A 5HYVA 3LPAA 2XA9A 2ZIWB 4JZYA 4BQNA 3JWPA 1XMPA 4N3AA 1VECA 2XITA 3R74A 1BQ3A 1QU7A 2J5QA 3TW8B 2QS9A 4A0RA 4BX9A 3OHPA 4ZARA 2GR9A 4O2BA 2H51A 4YQZA 3A6PC 3IE0A 5KJ1A 3LDAA 3BMQA 2E4AA 4WFJA 2YJ4A 1RXWA 1QKKA 3HY4A 1IEXA 1CF2O 2Z95A 4CFSA 1HE2A 1FFBA 2HUNA 1XEWY 1VQLF 1CRZA 4AQ7A 3A1UA 4UARA 4BNVA 4RKQA 5JFGA 2UDPA 2PZMA 3IEPA 4FS3A 2O4CA 2W6IG 3RYHA 2A3NA 4PYIA 1D2EA 3UGJA 2ZRAA 1Y4SA 2EIMC 4PC6A 1T2AA 4WJLA 2UVPB 1AB5A 1HTTA 1EZ4A 5EZYA 4BGVA 2V65A 5BSWA 3C9RA 2QRLA 4BMOB 2MOKA 3RK0A 3WK8A 4WY2A 3F3KA 4TXJA 1SQGA 3I4FA 1BWQA 1UH5A 3DLAA 4GL2A 1NMZA 1BFDA 2XNDG 1KZ1A 1ZVQA 4YUXA 4KLAA 1B00A 4QNNA 1GG2A 3IEKA 2OSBA 5KNDH 4NMLA 2FPRA 1SBTA 4I81A 4JOQA 1WCYA 4PX5A 2ZK7A 1XRJA 2H7YA 1YB6A 4HWPA 3HU3A 5EJ2A 2FWMX 1JXMA 2GZ3A 4HWTA 4P53A 2G4LA 2J08A 3PYMA 4C7UA 1JA9A 3E7WA 2Q3FA 5E1AC 5BNIA 5REQB 4ECEA 5I5GA 3D8RA 4YI5A 1YS1X 1TA8A 4IV0A 1NTKH 1QB8A 3GZTB 5DTRA 5CA0F 1UJWB 5BW8A 2RHDA 1W9MA 2I91A 2J0VA 4UVHA 2FPOA 5DP2A 3B1YA 1MAHA 4YK7A 3CCLV 1V48A 2PFKA 3ESXA 2G9NA 4D9HA 5CW1A 3B1VA 1NBHA 3W7BA 1UBRS 1C5KA 2GDJA 2M1XA 2IOYA 3H9EO 3HAXD 1ZVMA 3SVTA 1GRQA 2BMVA 3AEIA 2VNJA 3OCCA 5EP2A 4Y2GA 3V7YA 1FNMA 1WP7A 1EQUA 1S2GA 4PO8A 3HUTA 3E9MA 3OWOA 4CRWB 1AE1A 4AY2A 1ZD8A 4ZHSA 5DTQA 1PLJA 3RBAA 4ZANA 1VQ9V 4YMGA 1GPNA 4F3NA 1CD5A 3V3KA 1KP3A 2Z5FA 5AW3A 3JQ9C 4IHJB 4V2IA 3I0MA 1JI3A 2RHRA 4EVRA 3VHXB 4ENPA 4CL3A 3OPMA 2ZBGA 1P9WA 2Q8PA 5DI3B 4IDGA 3UM7A 1NGSA 3EYWA 4AZVA 3QYPA 1NH2D 4NU6A 1QH9A 4ZBMA 5KUMA 2D00A 4LISA 1VE1A 4UHDA 3ETJA 3TIIA 1A9ZA 3T5PA 1JKJA 4WVLA 5E2AA 2WV9A 2I7CA 2XRMA 5KNDA 3UAOA 1BZKA 4ZAVA 1EFVB 5LPNA 1RAIA 1V39A 2XLBA 3WHKA 3DZ8A 4O4HA 1SD2A 4L08A 1WBBA 3RVPA 5AW4A 2JBAB 3TECE 5GV7A 5JNUA 1ZOLA 3VR5D 5BORA 2W37A 4RYLA 3NOXA 3HKEB 4FILA 3IOYA 4JPRA 1RAFA 1EE2A 2X2PA 1KYQA 1J6UA 3W1WA 3STHA 1Y8CA 1GT6A 3QX8A 4KE7A 2JIMA 4AUEA 1F6BA 3NHMA 3ADKA 1XDBA 3EG5A 1AJPA 1E7RA 1PW5A 4S1NA 2H59A 4GOND 4M2LA 1TGOA 3PNYA 1N7IA 3G9TA 1PVOA 4YIKA 2CBXA 1ZUQA 5DT9A 1YT5A 4DG8A 3C16C 4V1CA 4P83A 2UVQA 1K5PA 3WK6A 2BC9A 3IKLA 3WO1A 4G4YA 1Y7PA 1YH3A 5LBIA 2FPGA 4NVRA 5AI8A 4C0JA 1Y4ZA 1JH8A 3JWJA 1MMMA 2IM9A 4RTMA 4TS9A 3B7WA 1S3FA 2H6LA 3STLC 1ZUNA 2ODBA 3HYRA 1AI4A 5JU6A 3AY0A 1E1CA 8GPBA 4WFGA 4HHEA 2OEPA 3ZI4A 3FYHA 3R7LA 4MKXA 4CM4B 3H1BA 2FJPA 1EFDN 1KYTA 2NVOA 1RKBA 4JLAA 4R1OA 1A32A 4HVLA 2FMTA 4BNFA 1UBEA 3KQMA 1FZQA 4KO8A 2V3VA 4EEZA 1HLPA 1WU8A 4OOEA 2B8TA 1N5LA 3Q7EA 4DR5O 1PXWA 3FB1A 1AGRA 1EHYA 4FYIA 4XRRA 3EAGA 4PDVA 3H1LH 1O54A 9LDBA 4ONEA 5E95A 1RSZA 5CN0A 4I5EA 1G8PA 1V3QE 2GBIA 1XZAA 5JSQA 3IBGA 3I5MA 5FI0B 5ALFA 4IDDA 1XUOA 121PA 5KTPA 4CH3A 4I4TA 3D6JA 1N36B 5JWOA 4OA8A 4ZIRB 3N2GB 4WMLA 4CQLB 1V2GA 2AI2A 1NQVA 2LWIA 5IMBA 4Q82A 1PV1A 1SPBS 5J63A 2B9ZA 1RAEA 1O94C 1YI2V 1K9VF 3OH8A 2O1XA 3PXUA 4EG3A 3GHZA 4HO1X 4JI6O 1CV2A 4BLOA 4M1KA 1K5SA 2CV0A 3QXCA 5JV5A 1DIRA 3DVRX 2WICA 1E60A 3AEQB 5LHIA 4Q9LA 2YQ5A 1YCFA 4DJTA 1S2DA 5C8DA 2FEWB 2WJ6A 3P0ZA 2GSWA 4Z7QB 4EFBA 3S2GA 3M4NA 4U7FA 1EJBA 5TEVA 4IF4A 1GM9A 2K87A 2HA2A 3HCEA 1V1MA 2VDJA 2QRVA 3K5LA 2FKNA 1Z5OA 4YAFA 3BOSA 1FXUA 2ASVA 5KHOC 1KERA 3C9TA 2H8GA 1XZPA 1IV2A 1KYIA 2UXDO 1RM5A 3LTEA 1Q7YW 2ZM6O 1J8QA 4S2UA 4I9NA 1XTZA 2E74B 4ZRMA 3KLOA 4I0XA 3C6ZA 1PAUA 3KZIZ 1VMKA 3PSAA 2GARA 5DE3A 3DCYA 4MVJG 2IA5A 2XUPA 4H6WA 3VZCA 3U7FB 5EA2A 2BGNA 3HU5A 4BR6A 4IQFA 5KYXB 3H5WA 2EP8A 4LF7B 1H66A 4ZT6A 5BNTA 3KJFA 3B6IA 4REQB 4TROA 4HNHA 3CNNA 3CCEF 1QSGA 1U5CA 1JN0A 2CSXA 4RVFA 3ZTWA 3NUZA 2SHKA 3G0OA 1JD1A 3RT7A 5BO5A 4CKEA 5LQCA 4DV2O 1DTEA 5FPYA 3PC8A 4CMGA 5A9TA 4Y2QA 2PZ8A 4JT9A 2AN1A 2ZT7A 1U8EA 1D9ZA 1SCKA 3ZEIA 3KZNA 1T0HB 5CM9C 3WRVA 3NDJA 3MWGA 4A0HA 3HCFA 1N4CA 1J0DA 3ZVKA 1X13A 1HT3A 3EY4A 4NMXB 3WNZA 1ZKDA 1JX6A 1UJ4A 3R9WA 3CC2V 2GCOB 1QLEC 5HDQA 4KODA 1S77D 3I2FA 2PL3A 3FJOA 1FRFS 2I6UA 1HM5A 1ECLA 3EVEA 4RIGA 4Y2HA 4B3XA 5HUJA 3TD2A 1G9SA 2K2WA 2HW8A 4LJ8A 5EXSA 3GGDA 1K7YA 3VNQA 1P62B 4OREX 2EIHA 3S0HA 4XWAA 1I7LA 1NHGA 4B6PA 3TOCA 3VH1A 2GKGA 1Z7BA 2EKLA 2IS6A 4GZ5A 3G71F 2EZPA 4ZQCB 4IL6Z 4NCJA 4TLAA 3GA0A 2V3WA 4I1VA 4XARA 2IZ5A 1PKXA 2C83A 4US0R 2RQ6A 2UZ0A 2JGFA 2HIGA 2OCYC 4M89A 2JD2A 1N9GA 5JYBA 3MJSA 5L51A 4Y2JA 3ODGA 4F60A 1WNFA 4QAQA 1S72V 1W19A 1N8TA 2ZRFA 1PFUA 1J20A 1KRXA 1UM8A 3PXDA 2GLUA 3CCBA 4CYMA 4KXYA 4DE5A 4ZOLA 1U1DA 3QZUA 4IDFA 4XIIA 1P8JA 1BMTA 2O3RA 3CR3C 3KL2A 4XOIA 4QTZA 1SKUA 1Q6YA 1L5KA 5I48A 4FLUA 1BH6A 1D2NA 1W49A 3H18A 4X97A 3I42A 4QDXA 1YJWF 3TLKA 4WOCA 4QRHA 4BCDA 4QE7A 2PJZA 3IQZA 2A9VA 1N0NA 2AX3A 4X8AA 3Q5EA 3HL0A 3SI7A 3PU6A 4IDOA 3GWZA 2M6SA 3X1DA 5EERA 3T15A 2UYKA 1XQVA 4PY2A 3N2IA 1YDMA 4E1AA 2IEGA 3DL4A 2FHSA 5KX5A 5BN3B 2ZT5A 5KOHB 2DHEA 3A6EA 2PMDA 1IRXA 1X9HA 5GONF 5ICGA 4RVUA 4QE3A 4PCUA 4OGGA 2Z1MA 3UYLA 4GKBA 3ZDQA 2EJWA 3CZQA 5IM5A 3U3ZA 3IELA 3IT2A 4KFMA 1SHTX 3BYZA 1SUDA 4X1KB 1NN3A 3EC2A 5JT1A 4YCDA 2ZQZA 4FMTA 3ESBA 4W5RA 3PX3A 4J9YB 3RFXA 3WIEA 2DBYA 3JQ8B 4J75A 1I6KA 1ZD9A 2R6DA 2IEBA 3OG9A 1KH2A 3EOZA 3EIQA 3R6DA 2R87A 1BMFG 5DNWA 3OUUA 2WTEA 3BSFA 5DBFA 1YRAA 2MW2B 2GEFA 2QTVB 2GTSA 2NAFA 4BT7A 4O4JA 2O20A 1TM3E 3H5RA 3H11B 1BXZA 3N76A 5BV7A 1R8YA 1Y6ZA 4IP0A 3KE1A 3OMXA 2TMDA 1S8AA 2X8LA 4D3FA 4R0MA 1S9DA 4TTVA 4WBSA 2AQ8A 4XM0A 4RNCA 2X7XA 3OMNB 1QUFA 3KAPA 4EW3A 3TZ6A 2VDLB 4PTYA 3T80A 2IYSA 3HR4A 2OY0A 1YTUA 3K35A 5AVVA 1OBHA 3F0GA 4AY3A 2QQEA 3HCDA 4DLSA 5F23A 1H5QA 3ZIDA 5HOEA 3E89A 3E1YA 3G9ZA 4D6XA 5D51S 2HPHA 3PUXA 2DECA 2KG7A 4M8SA 2CN1A 3I34X 5H2FZ 3UK6A 3RGBA 3OJCA 1QP8A 3RJ5A 4LHWA 3DG9A 4KWIA 2QV7A 3LIPA 2HYIC 2ABWA 4Y6LA 4JC0A 3PI7A 1FDIA 1DAPA 3PTLA 4NRDA 4MQFB 3A2KA 1CF9A 4LUCA 2IU3A 2O8VA 3IVAA 4WHMA 3HJBA 2X23A 4FFPA 2HWXA 2VVTA 2O2SA 3PRHA 2ZSHA 2FF5A 2ZTHA 2ON6A 3MCZA 5HQJA 1KPHA 5A1JA 4JR2A 1DX9A 4GI2A 5BWMA 1DTOA 2X42A 3KUCA 1R5OA 3ZIAG 1JHPA 1ORHA 1E5VA 1H0HA 4D56A 4NWIA 4TL8A 3HPLC 4BFXA 4RENA 1ACJA 3H6HA 3K06A 5L3QA 4DIUA 1MH9A 3CJTA 4RVCA 1PP9H 4EVIA 1AJNA 3PTAA 4ND4A 1L7RA 2AK2A 3VVMA 4ZHQF 4BLWA 3V8MA 3TI9A 2Q9LA 1U0EA 4MARA 4I1IA 2EX4A 3DDHA 3F74A 4M1ZA 5IPFA 2JRLA 1CWUA 4FOOA 4KK4A 4PANA 3L7NA 3U1BA 4UC0A 3ZE9A 3Q3VA 3RWMB 3L6DA 1A9SA 4WKBA 4M8KA 2ZBQA 3H1IH 1FC0A 3KJQA 1M56C 1NVDA 3T1QA 4CM9D 3OM8A 5EESA 3ICVA 1P0MA 4H18A 3Q2OA 4ZXPA 3R3YA 4GOOD 1SZJG 2OGSA 2X0RA 1SBIA 4TRNA 4LXHA 5THXA 2FSFA 3ZHYA 3PFCA 2W2TA 5A4IS 3TD3A 2XAJA 2D74A 2A94A 3WIOA 2DFVA 5JSYA 1KARA 1KJNA 2OPBA 2FN3A 4DR3O 3AZQA 4K8OA 3A3NA 2J9FB 4BNUA 1MXHA 1MJ5A 1B3QA 4GW3A 3I58A 4TKLA 1QHSA 5FPPA 3N6RA 3MAQA 1MB4A 4K28A 5LUBA 3JQBA 4CU2A 2WIFA 5LQAA 1DAOA 5TVGA 2PI4A 3QJYA 4OXQA 4NBKA 1H47A 3MUEA 4QARA 4HEJA 1KKUA 1IPFA 1TYDE 2RAVA 2EV9A 2J3JA 4RS4A 1UAYA 1BU8A 3MW8A 2V7XA 1STOA 1Y3BE 1QNLA 2X9LA 4FI3F 2W8BA 4FE4A 2NX2A 1V8OA 3TM4A 4MP8A 3RS8A 5CNJA 2QTZA 1A8IA 4PHHA 5KCMA 5KYYA 1X6VA 3FMOB 4WFHA 1WZIA 3P3PA 2YXPX 3JVEA 2D06A 3BRWA 3T0IA 1GZ3A 2QSYA 4BVAA 4FD3A 4LTNA 2X1VA 4UCRA 5LP6A 3NU1A 1QMGA 1OJHA 1IY9A 3QLUC 5LBUA 1VL8A 3VTAA 1FXHA 4M9QA 1ZUIA 3TUIC 2JB9A 1W0CA 3R7NA 3RAEC 4EEKA 4G37A 4YO7A 4WCFB 1TRHA 4RE5A 1JMYA 4B3GA 4S1OA 3VBEA 5AOCA 4MIYA 3VO1A 3KOWA 5DLYA 3ZBUA 1X8JA 3SEQA 4B48A 2QU7A 5FYDA 3L4JA 1EP9A 3D4PA 3R20A 3PDJA 3T38A 4MB6A 2W42A 5EPOA 3JVVA 4NVPA 3U48A 2F64A 4MS3A 1LSOA 3QKWA 2D1RA 1U7UA 5DM60 3JZFA 3DEAA 5AVWA 3FLEA 4U0JA 2C54A 3CXCU 4WFFA 4D0LB 4GP6A 3RAJA 2FSSA 3E84A 3WIVA 3W7VA 3KAKA 4IXTA 3AXTA 1T4GA 5HE9A 2ZDHA 4MS4A 5AJWA 4WZAA 4IFBA 1AS3A 3CMEV 1TUEA 4C03A 1JLKA 1MA3A 3FYUA 3H87A 3P2EA 4JNCA 4X1YA 3WI7A 3WLTA 4MJLA 3SVZA 4HTFA 3I9OA 4RA9A 4ZQGA 3UJDA 4E70A 4CMIB 5M34A 3CKMA 2RGYA 5HFAA 4CLOA 2FRXA 4R2IA 4J41A 1C9KA 3ZV5A 3TR5A 4CMCA 1AF4A 2PVCA 4RYDA 1XZFA 1DB3A 2WSYB 4ZHVA 4NR1A 5ERXA 3E9CA 4M49A 1QH8A 1JIVA 4AQDA 5D2CA 1PZFA 4L16A 1R4MB 3HA2A 4C21A 4QPZA 1Z2DA 3NDPA 4KLZA 4EJ2A 4YT5A 2FMLA 4J0GA 3URMA 4BNWA 4GE3A 5BSEA 3CONA 4J0HA 1I3MA 5LCXA 2XRFA 4LZWA 1MDFA 5H5JA 1L5QA 3H5AA 4ON9A 4IJ6A 4O1MA 4DNQA 5I7UA 3DEKA 1RJ9B 3DL0A 3LCMA 1QS0B 4I1YA 4EHHA 5FXMA 2C3OA 4BU1A 5IJ0A 2BW0A 5IDXA 1GZDA 3WJ7A 1TQ2A 3PNOA 4KJXA 1BS2A 4RSGA 4RCZA 3DS8A 1AXGA 1QIEA 3JRNA 3NUGA 1K2WA 4JBNA 4MYUA 4F21A 2IU6A 5CT8A 4J2HA 2ZP1A 4KW7A 3WJAA 1DAEA 2NZXA 4KVFA 4Q6GA 2IUEA 5AM1A 3P96A 4J7JA 2IJGX 3Q3CA 1NT4A 1HT0A 1QFSA 4KYVA 4A5OA 1IZ7A 4EMTA 3W5VA 4Z1MG 5H02A 1MLDA 3SF8B 4F9FA 1TADA 1V43A 3PFGA 1ZS9A 3KQUA 1ENZA 5B1DA 4CM8B 5IAGA 3GOQA 3GLIB 3K8QA 1FSZA 3A6ZA 4YMSA 2PBFA 4R40B 4ZVNA 3WQBA 3ABTA 1W73A 4O8CA 2UZ1A 4C0AC 3A9RA 3KUXA 3H04A 1UK8A 1MFPA 1TXGA 1SMKA 1LK0A 4QGBA 5FUQA 3NHFA 3FUWA 3NKFA 3MAGA 1USGA 1QO0A 2GI4A 3EZ9A 1CR4A 3REOA 1JMVA 5KS2A 3VZDA 4LV8B 4KAJA 1VSVA 3PQ6A 5KJEA 1MX3A 1DEXA 1V0JA 4COOA 3F1KA 2PX6A 1UBOS 4O63O 1TZKA 2XWSA 1JSRA 5EE3A 2ES4A 4TMXA 1U40A 2PLFA 2WD7B 3C4QA 4RY9A 4ER0A 2VDKB 3HYLA 4ZO8A 3ANMA 3DAOA 3Q8KA 2CVZA 2FP4A 4EPVA 4NSNA 4L8LA 2ESRA 3G02A 2IH2A 3LFTA 5DNEA 5IAAA 3NTLA 2ZWVA 1M67A 4MW9A 3WB2A 1CNMA 4K6GA 4TLLB 4MP6A 2B7CA 4KN8A 2J6BA 3LP6A 3AF6A 1M1KW 1RYBA 2J6CA 4E5KA 2AI1A 2EF1A 3K5NA 3E82A 4JUFA 1FXWA 3IOBA 3TCNA 1GKLA 1QK3A 5FJIA 6NULA 2ZE5A 3EFFK 3QTTA 4LECA 2FPSA 4J0IA 4LBEC 1ULHA 3I83A 4KFCA 2PGNA 1APBA 2H8EA 4QA9A 5FBWB 1VBKA 3FNBA 3RYFA 4AQYB 2C04A 3GGPA 3FGPA 5I9TA 4AWXA 2QRNA 4KI7A 2ANBA 3DAHA 5AJYA 2JGRA 2BJVA 2YC4C 1YJNV 1OCCB 4MRMB 5K8IA 2GCEA 1OAOC 4J76A 3FF4A 5CYPA 5JC8A 1KTVA 1OXBB 4MOWA 2VQFB 3PQ3A 2VJQA 2V7QA 3ZOKA 5EJ8A 1OJ7A 4G0NA 3ZK9A 3ZE2B 2QJTA 2NLJC 4P4UA 3QM1A 4DV0B 2QV0A 2B1IA 1V55C 1IXMA 5LA6B 3ZMUA 4DV6B 1ITZA 2PY6A 1Z4PX 1RPOA 1P2VA 1RFGE 3FI9A 3KDPA 4Z7NB 2SICE 3GLVA 3GUCA 3HN2A 3SR0A 5LZ5A 3G2LA 1RXCA 4ZCLA 4JKYA 3REQB 3GPDG 4BECA 4GC9A 3RJZA 4LYHA 3SSMA 3T1OA 4CLHA 4DYDA 5IDWA 5IAEA 4DNXA 3DCNA 3ZZ0A 3L0ZA 3OM1A 5F33A 5DWDA 1KZ4A 3PNQA 2OBLA 4I5GA 3BBPA 4Q02A 1RYZA 5G0TA 1MZPA 5H9CA 1JIXA 5FO0A 3OIYA 1L4BA 5GANK 4AZTA 3IMEA 1MJGA 3G8BA 2PT9A 4WZAE 3MSCA 5IKEA 1D0SA 2OTMA 5DT2A 2IITA 4NOLA 3STXA 3CC8A 4JBIA 4DANA 3ESRA 5HXZA 5K0EA 5KHLB 4UMFA 3T06B 1H2KA 3R5SA 3R5TA 4L7VA 5KC9A 3BRSA 4MR8B 5K51A 4WFBV 4FEEA 1V47A 1ZSVA 3O8BA 4UTPA 4RM2A 1VG8A 5EMLA 1Q6UA 2HWUA 4HB0A 3LQRA 4LF6B 1B8NA 1U0FA 5KO2A 1DG1G 2Y0PA 1IXKA 1K66A 2CNNA 4JI1B 1WZEA 3PCXA 1R50A 5CW2A 3FG9A 3F3SA 2UYJA 1NC3A 4X8LA 4HEHA 2O7VA 4G9BA 4RPCA 5ILGA 4M88A 1EJ6A 3JD3A 1D2HA 5JJJB 1Q0RA 4JJKA 4PSUA 1GZ7A 1AI6A 1PEAA 2A8YA 3OE7G 1J0XO 3PLNA 1Z5NA 3C1TA 1C1HA 1D6NA 2WM3A 3QUCA 3W2TA 3BWYA 2P2YA 4AZSA 1EWQA 4G4IA 3SD7A 1TMOA 2X40A 1CB0A 2V4MA 4ARAA 3CO5A 1JE0A 2W2KB 4NBTA 4J11A 2VHQA 5K09A 2VQEO 3BUSA 5IH7A 1TAEA 3O8QB 4JI0O 3VYSB 2BH2A 2VQSA 2GEKA 1ZI6A 4ENUA 4PBTA 5ESRA 3LL4A 4MHSA 1VHTA 4MSWC 3IUMA 2VQ6A 1GG9A 2G1PA 5I7HA 1RZRA 4GXQA 3CVVA 1Q82H 1J22A 1Q86W 4ETMA 1N77A 4JLKA 4F6RB 3KBBA 4HAMA 1Z6ZA 1SZQA 2P9TA 4I5IA 5DLEA 2Z8YA 3BA9A 4KFSA 5DCVA 2JJ2G 1T5DX 3KUUA 1KEPA 1H94A 6LDHA 4RMJA 2VQDA 1GDHA 1ND6A 4OHMA 1AHPA 1CUGA 1KJZA 1EAYA 2HJGA 1A2OA 1JA0A 3OETA 4LF8B 2NOAA 2Z57A 4AG3A 2OXCA 2GM9A 1XLUA 5LGTA 4RESA 3DAFA 5TSDA 1TZCA 3VHRA 1C41A 2LPMA 4GPEA 1FS4A 4GOXA 2E5LO 2WTXA 3S2ZA 3AHJA 4XX0A 2P22C 8ATCA 4L6CA 3VKUA 4O2AB 4BE7B 2DCMA 4AZ0B 4FFMA 4PVDA 3DSQA 2RCNA 4QJBA 3AJRA 3ROZA 3DH0A 1XEFA 4P4GA 2CNLA 5G02A 3F6EX 1JA8A 5GZ3A 1DKLA 5BQOA 3WRYC 3PHLA 4A2PA 5FKJA 3GLHA 3JQ9A 3HWSA 4BQFA 4C78A 3VAZA 3UMSA 2APJA 1FLVA 1AUVA 2PFGA 3FMVA 5TQ0B 2B9VA 4NXMO 1XQ8A 1DMSA 3AERB 2MMCA 1ECGA 1AJEA 2O5RA 2RIRA 5CIWA 3E1KA 5KREA 1DT3A 2YYYA 3T3EA 1JV2B 2R8RA 1L5HB 2KX7A 4NJMB 3AVUA 4K9NA 1YVUA 1AH2A 4UOEA 1A9XA 2R7NA 4HY3A 3TEFA 5JCZA 2ZUVA 4TRRA 4YJ2F 4XPIA 1ODFA 4C0BA 4G0WA 1M5TA 3HEBA 2CMFA 4NHOA 1YEWA 3TSZA 4BU0A 1W1UA 5H9VA 3GRCA 4L8GA 3PPWA 1SVIA 4OLFA 4P22A 3L9WA 5C1BA 4BAUA 2B2NA 4NNPA 3VYUB 1M1NB 1D2AA 1NYRA 2VOEA 3LNNA 3DO6A 4L8WB 2ZIEA 2WT9A 4R1LA 1C50A 2DTDA 3MXOA 1EJ0A 3OFVA 3QYJA 4D3YA 4R6ZA 4ZI5A 1I4EB 3HDVA 2IOHA 2IIVA 3BE6A 1WZCA 2X3YA 3DT6A 3HE3A 3CUEF 1I1OA 4P4LA 3FFTA 5FFFA 2VJNA 3C3EA 4YACA 1QH1A 4YXWG 2BGUA 3IAYA 1R3DA 1U3VA 3X1XA 3KYJB 4WN3A 4EG1A 1K0UA 3U3XA 1TUBA 3WDKA 1QGYA 2CL5A 5H6RA 1MOSA 4D82A 3L4KA 2YC0A 1LPOA 4L5BA 1EN6A 3CFYA 5SYNA 2G0NA 4EDHA 4O2AF 2UUCB 1JKIA 3R75A 3UT0A 4B80A 5IZCC 1R9JA 1N6OA 5EHQA 4MROA 2X0DA 3SBXA 4TMWA 1LXCA 1RWOA 4XOUA 2B9EA 3E61A 3DM9B 4WCDA 3VQWA 3DMYA 2NMVA 1F0KA 4YHHB 3QITA 3T9AA 4JT8A 2XZLA 3BB3A 2ZXWB 2Z1TA 1M0EA 3U6BA 1NI3A 3BXHA 4QYSA 1R6DA 4HLNA 3WWDA 1YI0A 4L87A 3D2CA 2ISQA 2XXAA 4B2YA 2BOVA 4I1SA 5UKDA 3FXAA 1M2HA 3D02A 1ORWA 4ZFNA 1GH6A 4QLAA 3K96A 3O75A 4GSKA 2QE7G 3CCUF 4PRYA 2ST1A 3I8XA 3GAFA 4F9GA 4WCVA 4OHBA 5K01A 4HN9A 4MTLA 1M34A 3U9SA 3JY6A 1VI2A 3R7FA 2YWDA 2WIKA 1T5IA 4ND2A 2X4DA 2OIGA 4TVKA 3E0XA 1Q1QA 1AKWA 5IG2A 1X7HA 1O94A 4MUEA 1EG2A 1A5ZA 3QI2A 4XWOA 1GZHB 2P69A 2JAQA 2ACEA 2OCAA 3IP7A 3PICA 3KETA 4QNMA 5JDIC 4UE6A 1DC5A 5BN5B 1RZ3A 4CCAA 3CPJB 1E0AA 2K9PA 5CFNA 2PH5A 4RIFA 2VTKA 3QKTA 5ECWA 1T9CA 3VZPA 3DSRA 5DYWA 3UWKA 3DR5A 3C5HA 4TMVA 1GPWB 4J2OA 2WSMA 3V1YA 1V71A 3DHEA 4ENQA 3A9VA 2XOEA 3Q7TA 4KXNA 1WD7A 1KD1W 3AR7A 4JSYA 8ADHA 2ZI5A 4C07A 3PA8A 3OIGA 2EJBA 1BXGA 4HR7A 1JEJA 3INNA 1TCVA 3BE4A 5LBTA 3H4TA 1X7YB 1P6XA 5AUNB 4UDYX 2VQ3A 1HNXO 4KNVA 2XOXA 3T95A 3GCGA 1X14A 4HAUA 3MC1A 3GUUA 3ICEA 1XA3A 1DKQA 1CU1A 5B3AA 2OFOA 3B7PA 3DZFA 5CCDA 3AVYA 4TKUA 4XGIA 4HBZA 2P6YA 2FUEA 3Q3GE 3QOXA 2R85A 4ALMA 3PR2B 2FUG1 3HR8A 2ACWA 1MQAA 1RWQA 2NYRA 1RI1A 3MLBA 1YUBA 2W8ZA 4PZCA 4AJHA 2RJOA 1VDZA 2O23A 2EKBA 5U9CA 1CW2B 3U60B 4V0MA 3RS7A 3PYLA 1G60A 1HE1C 1VQNV 1AT1A 2WWVD 3ZQUA 1E2IA 3AG6A 2M9MA 1EGQA 3L92A 2J46A 2DYSB 2GD1O 5DW0A 1EK1A 1RM0A 1SOMA 1OH7A 3S2UA 2QVZX 4C81A 1LKZA 5H82A 4Y0AA 2NO5A 1Z2GA 3VQTA 4CQMD 2GX6A 2BL4A 3SIPA 1GNRA 2HA6A 3BHPA 1Z22A 3TLGB 4HDRA 3DP7A 4CKBB 4TYWA 4DA6A 1TK3A 3GP5A 5JXWA 5JYCA 4IIVA 3U17A 1FFXA 4GYKA 5ECGC 1TF2A 3MCAA 2YW9A 1WDMA 2O1WA 3GLHE 1CJUC 2IXEA 3OEHD 2HA0A 2B5WA 1PNKA 1FSPA 3B48A 3G8DA 4Z2WA 2ZAYA 5H80A 2ZJ6A 2A79B 4GPD1 3B1JA 2WSSA 1IEQA 1GRJA 2DEUA 1O1YA 4RTRA 1S8NA 3R7SA 2EZ8A 1WUIS 5HFLA 5CXSA 3EHDA 1MHTA 2E2WA 3PTZA 5JS7A 3RE3A 5CFRA 2DJ5A 1SHZA 2O3UA 1PV0A 1QHHA 3B3QA 3LCUA 4U2FA 2LRHA 1E6MA 2EZOA 4LY0A 3HSYA 1NTOA 4J03A 3UGQA 3WLKX 2HK6A 1HYGA 4Y30A 3AILA 3OEWA 3WHLA 3RSZA 3T9BA 5G1NA 5CA0B 3AEUB 4EHBA 3OIUA 5HWSA 1R0BA 4IVQA 2XDYA 3BIWA 4Q4AA 3F8TA 1XRRA 2EYUA 2EBFX 4BNGA 2AW9A 2VGNA 1Q12A 2Q0OC 3PRKE 2QD5A 3D0QA 2HJWA 1NXPA 3T4ZA 3MK31 3MWYW 5B1OA 4P34A 2Z30A 3P26A 4D8WA 3D4BA 3EGDB 3PQ8A 1QWSA 2UZIR 3K31A 2I66A 2EU8A 3WP0A 4PG6A 2OHJA 2OILA 2OZLA 5LYYA 4YBZA 5CBPB 4LMBA 1T9ZA 1SUCA 5KAMA 4H60A 3NHZA 3IEMA 3NYIA 2OK7A 3B4SA 1J5EB 3MYRA 2R72A 5DO9A 2ZXFA 3CZ9A 2A5GA 1ZWLA 4DA4A 3IQHX 2OZVA 3IHWA 2VDPB 3NHRA 2PZGA 3NT2A 3UPUA 2ZRCA 1T1RA 4PO3X 4C29A 1VIAA 2LFRA 3GLTA 4RX1A 4RCVA 3RC1A 2B8EA 4RHXA 1UT5A 1W2BF 1R74A 3DNMA 3ZLVA 3U6KA 5FUMA 4JI7B 2PDAA 2NZYA 1W0KA 1Q57A 2WYIA 4XASA 3RKRA 3HGTA 2PTMA 4J49A 2ADPA 4MCJA 2V9ZA 4N5MA 4LRWA 1GL3A 1PFQA 1EJ2A 4WX2B 3KD3A 2VP2A 3LZCA 2R65A 1M34E 2AT1A 1DAHA 4AROA 2OL4A 2XBLA 2VHTA 4GP7A 3IDFA 5C5CA 2P6NA 4H3KB 1GLNA 3HCBA 2AG5A 1CCWA 2V1DA 2ETXA 2QBYB 3JVDA 1PE0A 5LD2C 2POCA 3K9FC 4G2TA 3CIOA 1BJTA 4BQOA 5ITZB 3MGGA 5DGDA 3EB9A 4Q16A 1F17A 1Y3AA 4KO1S 2WG1A 1CY4A 2PXAA 4RFSA 4F8YA 4UBNA 1XIVA 3V00A 3GB9A 1Y74B 5CDYA 5C9ZA 1SKYE 2EYQA 3EGXB 4DWJA 2GTHA 1OWNA 3MTEA 3BBLA 2JCSA 1P3JA 4B35A 4IV5A 1B0AA 1YJAA 2C00A 1GQQA 3AX6A 1DZIA 2V7BA 2BR4A 3TJZA 3LC1O 1O97D 2AZMA 2QROA 1E4EB 2BWJA 1OJLA 4IH1A 2GTPA 5E9AA 1SQ5A 2BIFA 5ENZA 4E09A 4XWKA 1EZ1A 4GMXA 3TH5A 3IE2A 1NBWB 3J7AR 2JLVA 4E5NA 1Z88A 1NKTA 1Y67A 2HS4A 4ZVVA 3KHTA 4YJ3A 3TOSA 3P0IA 2OV2A 3SOPA 4HX9A 1KZ6A 1AKEA 2B83A 3DEZA 1VKRA 2QX6A 5B4VA 1TCCA 3KR9A 5JNTA 1F3OA 4U2BA 2NUAB 5BMVA 4DM4A 1Z17A 2Z1EA 4J7CA 4FNOA 5I9SA 3G5AA 3CLUC 4LC9A 3CUTA 4EJSC 4NJEA 2XX3A 3QY9A 2B2CA 4UV9A 4EPXA 1BFUA 3SK0A 1KUQA 4JLBA 5AVUA 1P61B 1JLSA 3LK6A 3UQYS 2CJYA 4BFVA 3N0TA 4V0ME 5BUSA 1JIUA 1ZNYA 2FSVC 4OV6B 5TF4A 3HR0A 1A50B 5A3JA 1THZA 2QTCA 2HA7A 2OHWA 4BIOA 1L4UA 621PA 4RO0A 2CFSA 2C9ZA 1DUIA 5DCYA 3A6DA 2EG5A 3NHWA 3L6BA 5ED4A 2VWJA 5JSZB 4Q3AA 2F9LA 2WDZA 1DC3A 3UNXA 2VHCA 1RLTA 1U8CB 1HXHA 3A1EA 3THRA 4JMPA 1U8ZA 1K4YA 5EAIA 2QYOA 2POQX 3IEXA 2HHJA 3HJRA 3ONVA 4GYWA 3NHBA 2JGAA 3MWJA 4XGKA 1XI1A 4HNGA 3CYOA 1EFAA 1FBTA 3CKKA 5HJ7A 5IUNC 3SYAA 1NVWQ 4C06A 4QTYA 3OFNG 3GW8A 1MVLA 3BQNB 2HAEA 3CZRA 1TAQA 1NSFA 3O2JA 3IGFA 1R4AA 3MA0A 5CP8A 1FX0B 3AZOA 2X0LA 1LNZA 3F5WC 4QRIA 1AZTA 2YN2A 3TSAA 3NK6A 1I1NA 5J2UF 3KJGA 4GGOA 3LC2O 4ZV7A 2YHAA 2I6FA 2AG8A 4R6WA 4XM2A 4AJ1A 4KQ9A 3AUFA 4EKDA 2HA3A 2GFQA 3NEPX 1HZZC 1AA6A 3IERA 3K20A 4FTWA 3L8CA 3X1KA 1ETUA 4HB4A 4Z9AA 5EC1C 5KTYA 2C2BA 1OLSA 5D3ZA 2ZDIC 5KTKA 3OLWA 1WLEA 1O95D 4BPBA 4FGLA 3RC9A 3DYVA 1SRYA 1Z8DA 2YCLA 2Z56A 4DR7B 1Q50A 3K53A 1JAIA 3B85A 4LBVA 1HY3A 1JXQA 4KGDA 1DV1A 4H2DA 1L3BA 2P4SA 3U4CA 4P9OA 1NTRA 2JD1A 4XQ9A 3MNFA 1FJGO 1XKLA 3BXFA 3DFMA 4P54A 3ZLBA 4PRZA 2YVQA 1EK6A 4PELA 4LX8A 1JYFA 4P4SA 3HBMA 5DK6A 3L0BA 2QAGB 2CFIA 4LJ5A 3N53A 4FDLA 2X2EA 1JLMA 3MJTA 2C57A 2BKAA 4NARA 2DM6A 2Y4TA 3RHZA 2QKSA 4G5QA 4IPTA 3KKYA 1O57A 2XIJA 2CCJA 4AJ2A 1BD3A 3FTPA 4MVZA 4EGAA 1BCCH 2DYRC 3N28A 1U9CA 4G26A 1QHEA 3QUAA 4PYRA 4TYYA 3IQIX 4UFNA 3VNSA 1X1DA 2TYSB 1DV2A 4MWCA 3RVRA 1M2GA 3FFMA 3T3MB 4YH1A 4JLMA 5FWNA 5A6SA 3B82A 1RHKA 3D3IA 5A3SA 3SE0A 3DOOA 4OJKA 3Q8LA 4X62O 2X4LA 1J8VA 1MC4A 2B82A 1WCV1 4FDMA 4J0FA 1A4IA 5IN5A 3ZLUA 4HEQA 4ZYZA 1NT2A 3P10A 1Z2CA 3MQWA 1I6MA 2PX3A 4X8MA 2PT5A 4ZZ0A 5B7PA 3W8NA 1NTZH 3N2YA 1VYTA 5FD8A 3L4BC 4A2CA 2RGCA 1ZGJA 1U31A 5FT9A 5ED0A 5C7IO 4K9PA 3P9PA 1H2WA 1HRDA 1SZDA 1QIGA 5JAIA 3VQYA 2FK7A 4ZT5A 2O05A 4MZDA 2XRZA 3ETDA 2YMPA 5GONB 4I1PA 5IXYA 5TARA 1IHPA 4TVBA 1P72A 5CFZA 1NVMB 3TBHA 3B70A 2YMLA 1U8UA 3I2KA 4KLRA 3UFXA 4DVJA 4LCJA 4MYCA 2GM4A 3EFOA 3DTVD 3RUAA 1TTQB 4IDBA 2ODAA 1UKVY 4G2NA 4RH0A 3L0IB 2R66A 4H16A 4Z1VA 4XCVA 3ELDA 3K0BA 5HF8A 1F2TA 3DO8A 3IVCA 2PVSA 3CPEA 4UEQA 1ZI8A 5FLXM 4KR7A 5GY7A 2BZSA 1HDXA 4AD8A 2XHZA 4ES6A 2CD9A 2EKDA 2ZR0A 2F1IA 4JYZA 2A30A 3UB4A 1Y9AA 2HR1A 1G41A 3BGVA 1FTWA 1QJCA 3WDSA 1JE1A 4IIGA 1WU7A 1KR5A 2OCXA 3F9RA 4O4IF 4ZV9A 4NV3A 4D0NA 2E5WA 3WMGA 1I7NA 5TMEA 2X8WA 4E31A 5IJXA 2BSQA 1F8FA 5HQTA 1G9XA 3KQHA 3UK0A 2VJKA 4QX6A 2FSHA 2P7TC 2CJFA 3CLSC 2RARA 5DECA 4LVUA 1UDBA 3EXFB 3O1HB 3VA7A 2QI9C 3KEGA 2DB3A 3CX3A 1A9OA 1TJ5A 1B1AA 2W11A 2OZBA 5B5SA 1AI5A 3EVDA 4DC1A 3RANA 4X9QA 1X7PA 3FCSB 1IUPA 4FPPA 4UAJA 2E6UX 5B7GA 3RH0A 1XO1A 3E86A 1XVVA 2L69A 4LF9O 1N32O 5EMKA 3QEKA 3JAKA 1Q2UA 4EARA 1UBGA 3SYNA 4KC0A 3WICA 3O1LA 3BABA 1U9YA 3K1AA 2LO1A 3LOPA 4OG2A 3ZQJA 3PC4A 2Z3ZA 2NV0A 4LFCO 5M29A 4LFBB 2GJSA 1V11A 3BFJA 1L4HA 1Y98A 4MT8A 4AJEA 2EWMA 1DF4A 4PSCA 5EQDA 3WHIA 5FP0A 4GOLD 4MYTA 3UQ8A 4ZU1X 3HJNA 1AMUA 1JHXA 4TTSA 2VJOA 1CJTC 4BMNA 2LUOA 2EJUA 1U28C 3DF9A 4XSVA 4CEIB 1E4OA 4QZVA 2QLTA 4RSRA 2WD9A 1P9NA 2Q0HA 2G07A 5KNBH 1QVGF 1FQOA 4M83A 1BKDR 3TMAA 4QUIA 2ZSDA 3AW8A 2FWNA 3HI6A 5BOSA 5A4MS 4FFVA 2EDCA 1K92A 4JSTA 4Q9HA 4HRAA 4ZHQB 1NZDA 5DJ5A 4JELA 1IXZA 3PX7A 1XMSA 4PV7A 4NMWA 4U02A 1XVAA 4G5OA 1J39A 4A36A 4FZJA 5EWMB 3ABSB 2P5SA 2FRVA 1ZSNA 4PZEA 1E2QA 1AV7A 4ALKA 1IH8A 3KKEA 3P52A 4LJ7A 2WTMA 1G8HA 4OSEA 2EKQA 4R8LA 1QYCA 4N3BA 1FDVA 2WIAA 4RAQA 3UKMA 2F67A 1C9EA 3ZPXA 1CZOA 3TRDA 4QLOA 4E15A 1SCUA 3I53A 2FC3A 4FLVA 5KWSA 4YR9A 4B3SO 4C6RA 3RS4A 2WUWE 1T0PA 2OO3A 4FUTA 4MV1A 5EZSA 3U81A 2NO9A 5DV9A 1MNQA 3NGMA 3KZXA 5LOVA 4DA8A 1FUEA 1QQAA 3KWMA 3EW9A 3SKVA 2QUJA 4E2XA 2QF7A 3FE2A 2XUGA 3BZUA 3V4PB 4B33A 3THYA 2RJ3A 4J1SA 1BXKA 3O03A 1TEHA 2O0KA 1YK0A 1A2KC 2J1LA 3LT2A 3SZUA 2PUDA 2O6HA 3M8AA 4LOAA 4B40A 4UBJA 3MWFA 1E69A 1GL7A 4LVCA 4I36A 1TT5A 5LB2A 4N6GA 1OHHD 2PRKA 1Z5VA 4LCBA 3FTEA 1P1CA 1WB7A 1G0OA 2W48A 2VAVA 5F76A 2OCKA 3CCMV 3DBOB 3HG7A 3CPQA 3DMPA 3WK9A 2GHQA 1I0LA 3E2MA 3ZY6A 5KNBA 4F86A 2BGIA 5LQRA 4DNOA 1A9QA 1GQSA 3S7TA 1WSWA 3EW7A 4LF4B 3E53A 1JDVA 3L8DA 1YXBA 1T5SA 1F12A 2O0MA 1IEVA 4NCAA 1K9MH 1Y1SA 3TPZA 2I4OA 1XEQA 4DARA 4BIZA 3L7LA 5IKXA 1WPQA 1AG9A 3CIFA 1VHQA 4LV5B 1LDEA 1RQXA 3PDWA 4FFBB 1TFUA 3DWGA 4E1BA 1O5OA 4MQEB 1GGVA 2ZNJA 3CSUA 4KREA 2CHQA 5AVRA 1KORA 1Z2EA 1EFRA 3PXAA 4A1OA 2AG0A 2KE5A 3DMNA 2X77A 4ABTA 1PJ2A 1XPOA 2FN8A 2DWPA 3EISA 1JGTA 5TIIA 3QVWA 1UBTS 4Y9TA 4U0KA 2Q28A 3PA6A 2B8JA 4CM5A 3CU5A 5TJHA 4BCCA 1EVIA 5IVDA 1NZFA 2BDTA 3ZUGA 2HDNB 2PKQO 3V1LA 2ZJ4A 3FDJA 3CD6F 1C9NA 2WJZB 3DDUA 4HLUC 3NMUC 4GLLA 2AJLI 5JCJD 3LTNC 2OZPA 3DB1A 5C2JB 1C9MA 3V4SA 1R8JA 2H7XA 4ZVSA 2BFEA 2P2SA 4OGKA 5EIOA 4EOGA 2HF2A 2C7QA 1WHTA 1LDGA 4DPMA 5A3VA 4RORA 4E7PA 1JDTA 3PGKA 4Q19A 2IQ5A 1SIBE 3T4UA 3KCXA 5BN1A 4G0MA 3I5YA 2EZ9A 2RI1A 2CGEA 3DVSX 4N5HX 2QWXA 4XB2A 3VC3A 3ZQKA 2VRCA 2BFMA 1RJEA 2O2ZA 5AKKA 4DR6B 1CVLA 2P7IA 3VX4A 1A2BA 2ZJYA 3GRUA 1DXOA 2F93B 3BPSA 4C04A 1KU6A 1XAHA 2JFQA 3N2KB 1IBCA 1CEYA 1G7SA 2BP7A 1VCIA 3NIDB 1N3YA 1U3DA 4YA6A 3R5JA 4Q3OA 3WLSA 2WKPA 3S70A 4D7TA 3H1PA 1FMTA 3OFJA 4IKEA 3ZWNA 2OXIA 2Z9CA 3X1MA 1X1CA 1BDJA 5FL7D 4X93A 1XZMA 2HNKA 5FWXB 2PA3A 2OECA 4RAIA 3BH7A 2PWZA 3KOYA 3WRYA 4S12A 1EXNA 5I6DA 1I3OA 3A0HZ 2CVQA 1ZJ6A 3KWLA 1SC9A 5EKXA 5IF3A 2HLNA 3ECCA 3MG9A 4YRAA 2QZZA 2JAHA 3K6JA 4GD3Q 4B5KA 3LT4A 2DP4E 3FKSD 1D1SA 5K3CA 1SXPA 3NATA 2CDCA 4MQMA 4QDKA 2NZVG 3HMQA 1TO2E 4IFIA 2X5OA 4KVZA 4JTCB 2E18A 1FQJA 4QFDA 1DBRA 4EA8A 3M4YA 1K8AW 1IZYA 4HWGA 2Y0EA 2QTSA 3TCKA 1Y80A 2ODWA 4FYVA 1LCIA 2OK8A 1K7CA 4DMCA 4ZP1A 4M21A 3RE1A 5AJXA 1SOWA 2HLDA 1AUQA 2REXB 5T6MA 3BVOA 1A1SA 3I39X 1GNPA 4YRMA 1TJPB 4F1WA 1KMQA 5ERYA 2J9XB 1P17A 2YWCA 3E48A 4EO7A 3IMFA 3LUFA 1D2MA 3WL4A 3N6XA 3R7BA 2WM9B 2GK7A 4UBLA 1E61A 3K4HA 3ULKA 3I61A 2HQOA 4KQGA 1TT7A 2X5NA 1RIFA 721PA 3R8XA 1Y7IA 2DUWA 1YRWA 5I9NA 1PJCA 1Z47A 1NVAA 3ASVA 4DYLA 1ZH6A 1CUJA 3ILYA 2OB1A 3D9QX 5LXTF 2WTAA 3NM6B 3PD1A 1Y1QA 2YN4A 3RJTA 4L8VA 4J1TC 2Z01A 3L1VA 3QNMA 1BWPA 3B77A 1S5LZ 2C4TA 2H2WA 3P2OA 2GLZA 1OQAA 4K5QA 5DBOA 4Z54A 3IA2A 1CUHA 2OT3B 4P9PA 1Y8RB 3UK2A 1C7FA 3CRAA 4ZOEA 2A14A 5CDFA 4X7MA 3FGOA 1BJRE 3VR1A 2FU5C 1IJFA 1M6VA 1P0PA 3F0DA 2V6GA 4LZZA 3HU1A 1OAPA 3W7SA 1ZAUA 1NI8A 3TTWA 2WSBA 5DHSA 3Q1LA 2O2HA 5B2ZA 2BOBC 2ID7A 3IUNA 2HFEC 2VDOB 3NT5A 4L95C 3ASOB 4Z2AA 3MELA 3NCHA 4Q15A 3T7TA 2BYTA 2UXBO 3K0AB 3NGLA 3KV1A 2GEUA 2QRGA 1JH9A 4B46A 5CK5A 2IU4A 3B7GA 1DP4A 4MVYA 4NOJA 5JZ9A 5JDIA 1P74A 1JR9A 3RUHA 3HCPA 1O9GA 2GPSA 1R10A 2A92A 5IJAA 1CLEA 1LI4A 2O54A 4AI6A 3PT9A 3ITEA 4C4ZA 3UV3A 5EIFA 5KNCD 1I7FA 1THGA 2YZKA 3O1JC 1L4YA 5TQJA 4R2HA 4ZVRA 2G0AA 2ZAGA 4TV8A 2V8OA 2PZJA 2NV6A 2I3GA 4OI0A 4LZJA 1TRKA 4P3XA 1PQYA 3FMIA 5H81A 1XRQA 2QTTA 3NASA 3P9ZA 1C3JA 5I7WA 5J23A 1CEQA 1U7ZA 3WL3A 2BLLA 2I5PO 3OOYA 3RIYA 5EYPA 1KU9A 1N8RW 2N1BA 3MGKA 3K73O 1G4YB 3WGLA 3EDMA 2Z83A 3BTUA 3TOZA 4LTDA 4ERXA 1VE7A 2W6JA 3FMPB 4IZOA 2W5UA 1YAHA 1T5EA 3CW8X 3IAS1 5FV4A 1D04A 2F1HA 4KSYA 3TX2A 5DNYB 4RWZA 1EM6A 1Q0SA 2VK4A 3LIIA 3B5EA 2HF7A 3G85A 4OU5A 1ADJA 1RPZA 4LXXA 3S2YA 1H2LA 4MV5A 1W4RA 4IX1A 1Z39A 3PYXA 4YRQA 1OLOA 2OVFA 1T0JB 1JJ7A 1QVZA 2PMWB 2H17A 4FYKA 2WMNB 3VQXA 4Q00A 3M1YA 4EZBA 4BKMA 4DC0A 4QBFA 5L3BA 1Q3TA 1II9A 2Q7HA 2AF4C 2O1EA 1F4MA 4GM1A 3E5NA 2BY4A 1WTAA 1T2UA 5T6BA 4P0QB 5CFPA 3L7MA 3G0CA 5CTAA 2H4HA 2Y3IA 3HJGA 5G2OA 2HH9A 4OBBA 1WS6A 1VHAA 1ISMA 4TWBA 4MRVA 4KPEC 2P65A 5JJ5A 2H94A 3IODA 2DPMA 4X00A 4ZK2A 2V7WA 1AXEA 4KQFA 3UENA 1NNUA 3NBKA 4Q9JA 2QJWA 3T34A 5AXAA 1KYWA 2H3HA 1OFTA 2ZKIA 4KP7A 1JR6A 1E1RG 1M0TA 4NFYA 1SNYA 1QC5B 3S03A 5I45A 1GMGA 3GLQA 3JZMA 1ADBA 4PHGA 2IP2A 4EX7A 4J0EA 4FGWA 4K6OA 5AI0A 4L8YA 4MQUA 4UJ3A 1RFYA 5G0SA 2BFDB 3WSWA 1KK1A 4RLQA 2ZATA 2IP1A 1Z82A 3WAGA 5HQ3A 4L5CA 3IUBA 1YZNA 5CEFA 5JISA 4ZXFA 2RG1A 1GL9B 4JBHA 2YHBA 3V33A 2NT4A 2XOKD 4A6EA 2YSUB 4C4AA 3FCUB 3OOEA 4IDAA 2GFHA 1L7VC 4GRDA 4PAGA 3VDMA 1C9DB 2WLIA 3UHFA 2Q5OA 2HK9A 3ZD7A 4L5YA 4PZAA 1NC1A 5TMDA 4PR0A 4E4YA 1IJEA 3WLQA 3NVIB 3FDZA 1RZVA 2CVLA 3DE6X 1XNRB 1V96A 4NE9A 3CPSA 3D4OA 2FLKA 2O50A 4DQDA 2XKBA 4ZQFA 1XU4A 1CXZA 3EWNA 5K8LA 3GLGB 2UU9B 3IB3A 4EB6A 1X80A 1NLZA 1EM8A 1QZXA 2EJVA 5FLKA 2OTCA 5IDYA 2B7BA 2IYQA 1MC1A 1D5AA 1QTNA 1QZUA 2I71A 2YIBA 1Z5WA 3KR0A 3U9TA 3RO7A 3FHCB 4JOCA 3GBPA 1W5TA 3OZCA 1GO0A 4ZYXA 2R47A 4A23A 1IHDA 1I32A 4AZ3A 5I7FA 4GP9A 3TLCA 4KXRA 2FGKA 1HFWA 1HSOA 3C74A 5EE9A 3OKFA 4C82A 5GTDA 2FI1A 4YPVA 4X6UA 1MRSA 4E4TA 1BDBA 1V9CA 4YJ2B 5CDFE 5AM3A 1JVMA 1IZ9A 1KFEB 2HS0A 4QJIA 2JZCA 4R69A 5IT9M 4JC4A 2F1KA 5KHGA 2Y6UA 3ONWA 3R5FA 2GTIA 2PGIA 1GG8A 5ILQA 1OASA 4M9CA 4EB3A 4PCVA 3IL2A 5DSTA 1R0ZA 4IT5A 3QK7A 2B78A 4QXAA 1J49A 4WPGA 2FQ1A 3OGCC 3FPKA 5CAEB 1XMXA 5AHWA 3URKA 1K4KA 4ZICA 2NVWA 1DTSA 2A9FA 1Z9BA 4NICA 2B1GA 4TXMA 4ZVUA 4MV6A 2EATA 5JD4A 2UYGA 5JSUA 5IYDO 2MIIA 1Y42X 3DKRA 3RASA 2CNOA 3RM3A 4AP9A 2QM0A 1L0BA 3JYOA 4WTOA 3ZWBA 5ENDA 5LUAA 4OMFG 3FPFA 4INPA 3TJMA 2QG4A 3IHTA 3S06A 3W5AA 1T2NA 3C3JA 3A2LA 3R4VA 2KGWA 1YS9A 4FR2A 4A6XA 1WB5A 1SN7A 3OP1A 2YXLA 1USIA 3AG3B 5DM2A 5DSZA 4FVTA 1KECA 4TXLA 3CG6A 1IVNA 2OT5A 1FXKB 1NJ6A 1SVLA 2G83A 2FY8A 5ALWA 1BS1A 3MINB 3S1AB 1LDYA 3TR0A 3HV2A 1YFLA 3HB3B 3ZD6A 5B5EZ 5T3UA 1BC5A 3AVOA 1MN6A 4XJTA 5BQXA 4E21A 2OTJV 1P7YA 1VQPF 1CG6A 3MGBA 4CVNA 1GTMA 3M6FA 5D3MB 4EJSA 4EENA 4OYRA 4XD7A 5C51B 2C99A 2BEWA 1Q90D 1DKNA 1CUFA 1N57A 3ASNB 1Z0KA 4PJ0Z 3LECA 2ADOA 1Q15A 3LQFA 4I14A 4LOLA 3DHVA 2PH7A 3HL4A 2QRPA 1DL5A 2A0WA 3MWLA 4IIEA 4B6QA 5LU9A 5B3LA 4ARVA 2AMTA 4MICA 5BSHA 3OZFA 1E98A 3ZGLA 3TQOA 1BQZA 1LF5A 3KU4A 2A0KA 2PMKA 4J9ZB 2E9SA 4LDAA 3CCQF 1T3GA 4DV5B 3WA7A 2JFHA 2B8NA 5U1PA 1XHXA 3L43A 3ZGZA 4OPHA 3GNTA 5DFAA 4RTJA 2NTYC 4MKFA 2ACVA 3BD9A 2EINB 2GXSA 2CGNA 3SIRA 4N6OA 1DG9A 3V8BA 4R8KA 4DFDA 4DY4A 4DLRA 1N9KA 2BJHA 1TMKA 2LIPA 4F8EA 2HA5A 3OM3B 1UOOA 4N03A 4JIMA 5AQ1A 1WMBA 3PF9A 3TBFA 2FHPA 4RD1A 4LFAB 1V1RB 2J5BA 3EASA 4FLXA 2ZUFA 1VSBA 2QJ1A 4RTOA 1G3UA 2EW1A 4KBYA 5DASA 3BK2A 4FK8A 4G63A 2QP4A 2FOIA 1FP7A 2H8KA 2FW0A 4U7TB 2UXCO 4J16C 4X6XA 1TECE 3O91A 2QTRA 5IDJA 2VP9A 1IOLA 5JMWA 4HDMB 2WINI 5HP7A 3K0KA 4RH1A 1BEZA 1HZZA 1D9XA 3BXZA 3ZDXB 3ABKC 1IPHA 2P9EA 3BE8A 2FFBA 2PQMA 3VC7A 2ZDIA 1DE0A 4KQIA 2LTAA 1SD5A 2GTAA 1BXRB 4ZAGA 4X7BA 4HGYA 1Q11A 2AFHB 2R6GA 3OTIA 3STYA 3QO8A 1G291 5EIEA 1G20B 4QXRA 2TS1A 3CPWU 3QHAA 1B0UA 1DKOA 4INJA 3AF0A 1EH5A 4U3JA 1TL7C 4A8JB 5JAPA 2WF7A 3ORQA 2ZLBA 4EIWA 2UYNA 1OD6A 3DXYA 5J4YA 3VO8A 2XBMA 3PFIA 4JL8A 2HXGA 3S1LA 2DYYA 2IXDA 4F3RA 1R2QA 4BO1A 3EXHB 4CUZA 4L0QA 4L0DA 5E8RA 3QOWA 1DX4A 2CLDX 2ZBVA 4G67A 4LY6A 3VH2A 1RACA 3I5DA 1K75A 4P30A 5KQRA 2ZETA 4GZ6A 2H3OA 3E35A 3VNAA 1QHFA 1SG9A 4IJQA 1N0IA 2YJ3A 1ZKMA 4JI2B 1QOPB 4O2BF 1OY1A 1A77A 2IBSA 3EGWA 3AHHA 2J45A 1NVPB 4HPJB 4AT1A 3FNEA 1U9JA 3ZV4A 4P31A 1AO0A 1Z37A 1FTYA 1PCXA 2EAUA 2JRCA 3LY8A 5B58T 1Q0TA 4KIFA 2LGQA 1C7JA 2PKCA 3VZBA 1ZJZA 2VWKA 4JP1A 1VJTA 1PFVA 5EVCA 2O52A 2OYRA 1GTL1 2F23A 5EZYF 3MFQA 4WLNA 4AW9A 1OX5A 3ROGA 1OI3A 1WMFA 4C0LA 3RK1A 3PKIA 1NBIA 1NW8A 1ZVVA 2YWBA 3U10A 2IP4A 3T4XA 3IOCA 2XZOA 1JVSA 1Y6FA 2R4UA 2IKQA 4O5OA 3I3OA 5CFOA 4FLWA 4ADSG 3LWRC 2E4ZA 1XTIA 3KKZA 1I3KA 2FMFA 3LWVC 3K9BA 3U9LA 3L4BA 1Y7HA 2BFCB 1VF7A 4WOJA 5L3RA 2V6IA 2PIAA 4P82A 4F96A 1ZWZA 5JDCC 4Q93A 3QFTA 1U3LA 3GROA 3DOEA 2FR0A 4YXFA 1BCSB 1DLJA 2B92A 2GNOA 1LFDB 3QX9A 2KQUA 4WNCA 2YOHA 4JBYA 4BNDB 2NQ8A 4Q9DA 5F1KA 1EX1A 4KXQA 4MH0R 2P5TB 3L3BA 4DMGA 2G6BA 2EVWX 1U0GA 2PGLA 3H86A 4AMGA 2DE0X 1LI7A 4MKGA 1ZUNB 3WRXC 4LOHA 2PBZA 3GVCA 3A31A 3KOUA 5ALKA 3DP9A 1E1CB 2H9YA 3KQVA 2N3ZA 1Q81W 4R0VA 3F90A 5CB6A 4ER5A 2RIPA 4NTZA 3D59A 5B58C 3TDKA 4QLBA 1B93A 3U80A 3WGQA 4HOYA 3Q7PA 5F5LA 3W6UA 1P91A 2H9AA 3Q4HB 2AHZA 3FZGA 1X7XB 2HBZA 3AIMA 4BVLA 4RVGA 3GJ7A 5B1IA 1VQOV 1RE0A 3R7AA 4WJKB 1E2LA 1BHQ1 3I12A 1M1YA 4BVEA 2HUPA 1XCLA 3IT3A 4I9WA 1YR9A 3INRA 3WQHA 4UHBA 4BO6A 2I3DA 5FUVA 4PDRA 5CX4A 3F5DA 2VR1A 2HY7A 5AVKA 3BWXA 1Y3FE 5G4VC 3CRMA 2J0UA 4JU8A 4H7DA 4F2WA 2J6HA 2I8CA 4YQFA 4G27B 3IAM6 3EORA 4O4HF 4DIKA 1A8PA 3KCNA 2WFMA 3C5EA 2B4QA 1T24A 1EQ2A 4BO0A 4F11A 1A2QA 2I1VB 4YP0A 2FOLA 5DHQA 4P3NA 1HKUA 3RTDA 4G4GA 4MINA 3ABLC 5B55A 1F7YA 4ISBA 2AFIA 2QA4V 1NF8A 5I5EA 1ZO8A 3TIFA 3ANNA 2GM3A 3W2EA 1Q14A 3EIXA 1M2OB 4NKRA 4J7UA 5CJPA 4MTFA 1OMOA 3PIRA 1DBVO 2HBRA 3QMVA 4NJOA 4IJUA 1ZXLA 5BUZA 2YJTD 3A26A 3GVXA 3CUYA 1U28A 1D0VA 3U62A 4UCOA 1VJ5A 2C1EA 2V1XA 2ZI6A 2Q8NA 1KI4A 2AFVA 4AP6A 4KNYA 3LP8A 1KH1A 1Z5PA 4DMUB 2AJTA 4FQ7A 4JV5B 3RW9A 2VZ9A 4PYKA 3LSUA 2OO7A 4AUKA 1WO8A 2GCNA 2QUZA 5BW5A 3ES9A 4LBZA 3BDIA 5BUQA 4NNJA 4N0MA 3ASYA 1PO7A 3P4XA 1JTFA 4JLDA 4Z3KA 4CKEB 3J80N 5DF1A 4WXPA 3NKLA 3DF7A 5HSGA 5JPCA 4L1KA 1DFGA 1IULA 2HJFC 4GI5A 1P2GA 2C9MA 2R6CA 4ZPJA 4AP5A 4EG5A 2GZMA 2VXCA 4Q3BA 1MNAA 5L4SA 1NQOA 3OZIA 5JVDA 3THSA 5B4TA 4I4TF 1FBNA 1U1GA 3TAXA 3OFKA 3SJCC 3S0YA 3IUQA 1C7RA 4BLQA 1PSDA 4RV4A 2KS6A 2Z6VA 4Q4DA 4NZNA 3TI7A 1T36A 4WT7A 1HDJA 4K86A 2QUBA 4WKGA 2IUUA 1NJ1A 4QEKA 4XQ0A 5LGNA 4JLWA 2FYTA 4BVTA 1C9YA 3MCUA 1E6EA 2VGMA 1FDRA 1T25A 4EL5A 4EITA 3A6KA 1IOWA 1C7EA 2CXOA 5DN6A 4L9WA 1KNQA 3PUKA 5H16A 3VSDA 1FYVA 3IRUA 1RQLA 3L74H 1TJNA 2Z6QA 3HXQA 3VR5H 2VCEA 2FWPA 5J2UB 1XMIA 1T1EA 4XDZA 5IBPA 5K0ZA 5G4KA 2QK4A 4Q9KA 1QLNA 5IKPA 3ZWXA 1VE6A 5IX8A 3SJBC 3M4JA 4YMHA 2I7XA 1XRPA 1K8QA 1U43A 2CFTA 2EJTA 3T1HB 4HGOA 2PUCA 2B61A 4NZPA 4IIUA 5IARA 4CIYA 4R16A 4M8IA 2ECPA 4N23A 2OBNA 1PQPA 5TRTA 3FYIB 3MQFA 1SK9A 5DM6V 1PD3A 3QA3E 4XIGS 3GYBA 2PHNA 3BK7A 2GJ9A 2FX2A 4FNMA 2EULA 4RPHA 5JD3A 5CDUA 4HDOB 4R9NA 4MAFA 5JAUA 2AL7A 4CTNA 3FKJA 2HPZA 4B7EA 3V4DA 1W6UA 4NH0A 1FLAA 4J4BA 5EKTA 3G5UA 4EQ6B 4DCPA 2JGDA 4LNUB 1A8UA 1DIAA 2W0FC 5KTNA 2O3TA 3T7DA 4XGNA 1PJTA 3OESA 3WLLA 3ZC3A 1RHRA 6REQA 4NCBA 3T99A 3PRYA 3VU1A 3S5JA 4OFXA 3WNQA 4BWFB 1V6CA 4JJFA 4J6FA 1QK5A 4LE0A 1YFKA 1JDJA 2HG5C 4WXEA 3GARA 2I6DA 1GTSA 5J1TB 3H9GA 5MDHA 5JWRA 1KKMA 2LNDA 2CXRA 1EUQA 1E3DA 2GZSA 2F55A 3PIDA 2DHQA 2JIZA 2YHSA 3H2JA 3GUVA 3EVBA 4FYPA 5BV8A 1E7MA 3B1KA 4HLUA 1OH8A 5EBMC 3M6UA 3IJEB 2YWFA 5C1IA 2JLAA 1OZHA 3ZDEA 5HNKA 3VMFA 1RJWA 2PYDA 4AJPA 4HUQA 5MF6A 1E79A 3IIIA 2QJRA 4EKIA 4LDNA 5DMHA 3CEAA 4G8JA 4WZBA 2K5UA 1SOAA 1U7OA 4H17A 4Z49A 4LYDA 3RT3C 2ROQA 4L8FA 1Y5RA 2QVGA 1SWVA 2WHPB 1KQ3A 3OD4A 3SNKA 1B04A 3C97A 4RVOA 3V9PA 5KYTA 5DGXA 4XDHA 5AQEA 4PNPA 3TDMA 3UC9A 4RA6A 3SXUB 4WNAA 3G6EV 1GWNA 1PL8A 3FCYA 4F1KA 4UE3S 3S44A 1G5FA 3WWPA 3MAAC 4KGVA 2CF6A 3TF5A 1PT8A 1NWHA 3MS2A 1YRYE 1XCMA 1X8KA 4N9WA 4ZOLF 3AHCA 3LNMB 1NNSA 2R1ZA 3ILXA 5E3IA 1OPXA 4Q4CA 1HQYE 4G3XA 3QLUA 2BEVA 1TM2A 1IATA 2ENUA 2AFIE 4Z9FA 1BG6A 1LSJA 4HAYA 3RU3A 4KZPA 3LUGA 4DPLA 2P41A 3K9LA 3DW1X 3JWIA 4E2WA 3ABOB 1BE8A 3KLPX 1VKHA 1PL7A 3H0KA 3U40A 1IY1A 1YJ5A 2QLFA 4QYIB 3VUFA 5A0TA 1FKAO 2CTWA 2FZGA 4X92A 1UXHA 2IT1A 2OGUA 2V4DA 3ND6A 4KPUA 4EWLA 3N5KA 3M6WA 2PN1A 2GLTA 3GX1A 1WRBA 2YZ2A 3RSGA 1YQEA 3I32A 1JBKA 2PRZA 5KX5F 4WGFA 5HCNA 4IQ4A 2A1TS 3KUKA 5DGTA 1PQWA 1IG3A 2PO7A 3IC7A 3CH5A 2EFYA 3ZHZA 1TIPA 4MRSA 3V4LA 1RWKA 4K9DA 3ROXA 5LMUB 5DBGA 1FRVA 4O4IB 4KUMA 3FAVB 1PFWA 3JASA 4ARSA 2VPTA 1RCFA 4TYQA 4NIMA 4OLBA 4FM9A 2OWDA 4OAOA 3NPAA 4BNIA 3LXRA 3THWA 4Y2UA 4DYHA 5A9RA 4KR0A 1TYEB 4V39A 4IGEA 3OCVA 2ODQA 3KFLA 3PXEA 2RHOA 4DEVA 1H6CA 4IO1A 1PEYA 5EP4A 3WMXA 1SQVH 4DMLA 4ZCIA 1YQXA 4Y6RA 5ABPA 4O4JF 2FQXA 1KPIA 4PFSA 3VNUA 2O8DB 5G4LA 3K2QA 3QX7A 2YXEA 3P0HA 1P81A 4HZ3A 3LCJA 2C1XA 4PCAA 5A5FA 2CH7A 5L4LA 2CCKA 2VWHA 1G7RA 4X89A 3OP4A 4YY3B 1M6WA 3W5DA 3U44B 1TNDA 1YL6A 4CJXA 3KQOA 1IK4A 3C7CB 2P75A 3ROKA 4AC9A 3KQLA 4Z4CA 2ALJA 1FDSA 2W0SA 4QUHA 2C7GA 1T0UA 4CKYA 2RCVA 1NW3A 4G97A 2O5VA 2V6MA 1KO1A 2G1JA 4RKFA 2DU8A 4J1TA 5BQFA 4H31A 4R51A 1Q1GA 1QK4A 1XNJA 4WA7A 3ACDA 1VQ8V 4ZYTA 4MR9A 3LX8A 3TKAA 2VBIA 3DDCA 3ZRWB 1M3SA 1M2VB 3BGDA 4YBRA 4YAIA 4TKVA 4RLFA 1W7AA 4RD4A 4RF5A 3IAXA 5CA1A 3BD6A 1K8ZB 1KAGA 1U1EA 4K1XA 2FF7A 3AESA 4B3BA 3NOQA 3QPBA 1W8IA 1U3PA 3A6GA 4KIWA 2C61A 4OJYA 3VTFA 1U5BA 1BN7A 2Y48A 5KYYB 4NG4A 2A5YB 3K57A 1UBLS 1E1LA 2YOGA 5C5DA 4JI5B 1WB6A 1DLIA 2OMEA 1KIMA 2CJXA 1YRHA 2O8CA 1Q6ZA 1MRZA 1C7ZA 4D9EA 4QHYA 4I19A 2HHCA 1RQ2A 4WKOA 3KJHA 4URUR 3I52A 4BFWA 3W8RA 1GT91 4RD2A 3TQIA 2I7DA 3L40A 1A5BB 3JCUZ 2QWOB 2PKQP 2PS3A 2XDAA 3ZOPA 1V2HE 3B1XA 2IODA 1PNMA 3O4HA 4DW0A 1E3WA 2CMGA 4P7KA 3MS7A 1NM5C 2H4FA 1XPJA 4KFTA 4BGEA 3OQ1A 2QMZA 4KWHA 3OMLA 3O94A 1XNHA 1XELA 1C8VB 2CB0A 4DDKA 2AOTB 5AJTA 3AP3A 1E1MA 4K9OA 1A76A 2XWQA 1X3SA 2W6ZA 3B60A 4QBIA 4MS3B 2A86A 3D8SA 1DOHA 2IVZA 2VYVD 1MUUA 2GT1A 1EUYA 3L70H 1DIGA 1U7XA 1N3LA 4ND3A 3RYCA 1T9HA 4E4EA 5FBLB 4BRZA 5ESWA 1LQ2A 2ZYUX 5E1OA 3RK4A 4ZAYA 1ULZA 3WMRA 4K46A 2WTNA 4AICA 4WZBE 2A1UA 3FCXA 5L3DA 5IU6A 1OV6A 2IU0A 1TTHA 4JTAB 1Z4MA 2CB9A 3RBVA 1QLJA 1PFGA 1Z6AA 4YP1A 2BHSA 2XVZA 1EK5A 4MXDA 3SZOA 2C7RA 2BGJA 1E58A 2Y0CA 1Q5PA 1Y8QA 5H0IA 5CU7A 1Z73A 1F8YA 3UAZA 1BFKA 1XRSB 1OAOA 1VI5A 2OCCC 4R1SA 2ZVJA 2G67A 5FDFA 4RM3A 2Q9BA 1N2GA 2UUAO 2O59A 2PM8A 2ZCEA 3O9MA 2CLHB 2E87A 3EJ6A 3B09A 2X7JA 3GRYA 2GD2A 4MZXA 3JAMN 4XBFA 2TRSB 3IHKA 2OWOA 5JMTA 5JMPA 1YNSA 4TT3D 5LP6F 1I3NA 4DSZA 1M7HA 3Q0IA 1OREA 2DG2A 3C1AA 4GO1A 4ARCA 1DDOA 2NU8B 2DOSA 2Q5HA 3C5CA 4OJTA 1Y5NA 4YRNA 1CUEA 4F1JA 3B6ZA 1FDOA 1JQKA 1Y1PA 2H0QA 1CY2A 1K88A 3SQNA 1GCIA 1YZVA 2VDRB 1Y81A 1F8UA 4INZA 4FM2A 1ULBA 4REMA 2YJ5A 2P2CA 2QAJA 3OSZA 2RGUA 1ZMTA 1BE6A 1YR7A 4NYMQ 1R0KA 2H92A 3TQCA 2JFOA 3CMAF 1XZEA 4DJAA 4RJIA 1XVTA 1VBFA 3GEGA 4HN4B 4A10A 1G6UA 2PJRA 4ZGBA 3OVMA 4W9NC 5EZQA 5HR5A 3AEXA 1EXDA 1H9CA 1XTVA 3M9XA 4RPIA 1QF7A 1N7JA 5FOUA 1VPWA 1W29A 3BDAA 3RUPA 1PWYE 1YB1A 1KSJA 5K45A 1U2SA 3LKVA 1KDOA 4RL4A 5IF9A 1T3TA 1QFJA 3L77A 3DZJA 1LJUA 5EIXA 4AWAA 5B64A 3DHWC 8ABPA 1JEQA 1YIDA 1X59A 3C3MA 4ZI2A 3D0KA 3WNBA 4PPGA 1O97C 5EC8A 4JCCA 2YEVA 3UMGA 1GQOA 4AJ9A 2ZDQA 3A4MA 3F97A 2NSJA 2ZKOA 1IWBB 3WYNA 2X7HA 3QRWA 1Z0JA 2VC2B 4ER7A 2ZWMA 3ND7A 3D3JA 4CNBA 2BM8A 1NBEA 3J80A 4NZYA 4CEJA 4K35A 2GK6A 4BB9A 1FTNA 5J2TB 3BEDA 5DYTA 3RABA 2FPKA 3QVUA 3KYCB 2V54A 3ICPA 1SU7A 3KHSA 4YRCA 1ISGA 1RPJA 4IYHA 1K7XB 1LPBB 5BSVA 4L27A 4EFLA 5HRCA 2A9KA 4GUAA 2PRYA 3R44A 1JJ2U 1YHQF 2RHWA 1NBAA 1IN4A 3MWEA 3D0OA 4Z51A 2JEXA 1TF5A 9GPBA 4G09A 2DW4A 3E7PA 4Y2PA 1V5FA 3T5GA 4C7OA 4OI1A 4A26A 4J4TA 1T4DA 2GN9A 1XP5A 4HEA1 2G1KA 2JK1A 4XH9B 4J7KA 3ZHUA 1TVCA 2P1RA 3C3XA 4JYAO 1OI4A 4TSFG 3RYFB 3LSSA 3GGOA 1R8QA 1NVVQ 1PTJC 4FXPA 4J10A 5CURA 2VUTA 4K0KO 2RCYA 4M0CA 5BPFA 2P7HA 2JK5C 4B5CA 1YDHA 4C2TA 1V6SA 1VLMA 1PTKA 4F12A 4ZQEA 3F7VC 1JDUA 2P40A 2PLWA 3IJPA 1PKEA 3RIHA 4ASUG 4O08A 4BJHB 4NBUA 1NBMD 4CC5A 1KMIY 4NK5A 1KJWA 2BVNA 1Y1KE 5KAPA 3RRYA 2Z1FA 2JGIA 2XVAA 3TIXB 1UR5A 5LXTB 3BZWA 1OB2A 2R0QC 3DW3X 3EIOA 3AM4A 3EX7C 2QN9A 5COQA 2H2AA 2Q5FA 4V3CA 1GGHA 2HP0B 1WA8A 2P4QA 2OHVA 4TWKA 3OJLA 5J2TF 4LHEA 4GZMA 2Y4UA 3DKKA 1DRUA 1JL3A 1WP8A 1GCGA 5K0CA 3AU9A 2D5AA 3KKMA 2AYYA 4AFNA 1TAGA 2E89A 5JBQA 4DCTA 4HMOA 4E51A 3LGAA 5FPHA 3AG7A 1TQDA 1JHRA 1E0SA 2JVJA 2MSKA 3NH9A 3S8YA 5ALDA 3MWDB 3NVAA 1GUDA 3T6KA 3NDIA 1JU3A 3DL7A 1F06A 1FXWF 3K32A 3B89A 3GZNB 3BIOA 3L7KA 4LRSB 2DLDA 1DTWB 4BB5A 2VJLA 1W36D 3UG7A 1M57C 2QM4A 2BONA 3WK5A 1E63A 2BKEA 3G4SF 4PZZA 3A0UA 1XMVA 1LW6E 3NHJA 1CQZA 3R3VA 5IVHA 4YJFB 4R3WA 3VPFA 1M6YA 2WW8A 1N8SA 3NR2A 5CHYA 3M9WA 4OP3A 1DEOA 3QH4A 1D4OA 2HSEA 3LHIA 1JI0A 3V2UA 3ND8A 2FLVA 1U0OC 4KXVA 1LJ8A 3QE3A 3CXUA 2H5IA 4ZGWA 1ZJJA 2I76A 4G1CA 1E5XA 4EBBA 1DC7A 2XECA 5J5VA 3RHFA 2FQWA 2O7NA 3ZCUA 4DXWA 3ZLTA 5IZCA 4QOGA 2XA1A 2X6RA 2F1OA 5ALNA 1DAMA 2DHRA 3GRAA 2R44A 3IKMB 3G7NA 4Q34A 2I4TA 5DBIA 5SYAA 1KSHA 2OFFA 1KY4A 1VMDA 2Y2UA 2NQTA 3KSUA 4J16A 3KPVA 2IZ1A 3JQAB 4C3OB 4PZYA 1KYVA 4R1NA 1WMSA 4IJWA 4B3RO 4XWTA 2OFXA 3OA2A 4NUTA 2OIEA 1G21A 3CCRV 4OXYA 2CK3G 2HTEA 3GT4A 2Y0DA 2IS2A 2CWWA 2ZR2A 2KHZA 3DKPA 5K3OA 4J7XA 2ZINA 4G4SO 1GGEA 1VCHA 5JRDS 5A4DA 1E1QA 2Y8EA 1W88B 4J91A 5LZ4A 2P9GA 3VSAA 2NLOA 5WRFA 3GEPA 4HXYA 3RVDA 2Q7XA 3FDFA 3UUEA 5B3SB 4NBLA 1ZNXA 3WKCA 4WOBA 2CD7A 5FPTA 5KMGB 1V26A 1QO7A 1JBEA 2W4MA 1W2WB 4ZRNA 3KELA 1OTYA 4R1QA 3TGUH 2NNWB 3MRXA 2WA3A 3RUFA 3DJYA 1WE2A 2RK4A 2PL5A 1IVYA 4C6TB 2A5FA 2EFCB 1G0NA 2PHZA 1KKLA 1UDWA 1O58A 3PG5A 2XXJA 2MSEB 1Y48E 4DCUA 1N2HA 2WMYA 3DVAB 1NDHA 4ER3A 4CMKA 2JEUA 3W5HA 4UTOA 4BXOB 3L8ZA 2Y27A 1RDFA 1IVSA 3RFUA 5BN4B 1CUSA 1U0TA 3V1NA 1EWYA 3P27A 3ZDBA 2P90A 1Y3CE 1MORA 3GLHB 2AOUB 2IDJA 1R6XA 1G5IA 3CE9A 2J3EA 3DZKA 4PQYA 3PQDA 4J43A 1CEXA 1YGPA 1GFWA 3CCFA 3UCSC 2AZ0A 1EGMB 3F3YA 1ZYUA 2CVFA 2JRIA 1CK2A 1Z4QA 1KO8A 3O73A 2BGLA 1GIAA 2B25A 5TMBA 2FMKA 3VV3A 3H1HH 2G8NA 3OMWA 1BHAA 2FKXA 2Q1UA 4CS2A 4RZXA 4DNFA 1YDXA 3PFHA 3QVLA 3ZNNA 1VMEA 5HF9A 2RGDA 2JNBA 2XUIA 2LD4A 1SCJA 3EDCA 5EWJB 4EHJA 1XAJA 3EEBA 1UKEA 4XRGA 4P08A 2DCUA 4WUVA 1LTKA 2HJHA 4WVFA 5JDCA 2XVMA 1AKRA 3F7NA 4HBNA 2IPOA 5IC5A 1GN2A 2EF0A 3R2JA 4BVKA 1GZ0A 3RSHA 1KI3A 2AXTZ 1W5EA 4NAVA 3PLAC 4D0GA 3PSHA 4NCNA 3NUQA 4C0KA 4FYYA 4KYUA 3QIVA 2B69A 4B2LA 3WXMB 1H93A 4LEIA 1CBUA 2PSEA 4BQRA 2Q6OA 3WRXA 2WJ4A 5AOAA 2WG0A 1JQ5A 2O8EB 1S2LA 4FLFA 3FH0A 3RGWS 2JLQA 4YMLA 1YITF 3SWWA 1TC2A 1NYQA 4M6WB 3AJ9A 4F2DA 2GVZC 1GAXA 1GAQA 1C3EA 2IHTA 4FYMA 2RAFA 2EKPA 2WFLB 1BRMA 4JI6B 2UZ4A 3GT7A 1FVHA 1I7DA 4QVKA 2A5DA 2XUQA 3A1WA 1E6CA 3G9UA 3MDSA 4PHFA 1I4DD 3CT4A 5KHIA 2ZIGA 2RMKB 3B36A 3EGOA 1PS8A 3HXKA 1YBMA 1H8HG 1SVUA 5ICSA 4DOMA 2D7JA 1G18A 4ID3A 1X1QA 1SFRA 5A2GA 2XXAB 2YJGA 4QT4A 3BIJA 4KE8A 2QYSA 1S89A 4K9KA 4IGGA 4JUAA 3V4ZA 2OBXA 1F4LA 2B4KA 1ORVA 4W6QA 2YDEA 4GI1A 4QGAA 1QGDA 3NAMA 2UYCA 3U1TA 4IVNA 3JU3A 2GZLA 1SCDA 5GGXA 3HO8A 5F7JA 1COWG 5CUQA 1TA4A 2IQQA 2XGGA 3VR0A 2AZXA 3K9HA 4HMPA 1Q3HA 2XVYA 1SO8A 1T4CA 2C5FA 2NUTB 1OLUA 2A5JA 3TSYA 4X1OA 2XVXA 1SKYB 3QFCA 2MTBA 4CEHA 2JDIA 3JQ7B 3CH7A 2YHIB 2I2FA 5JBIA 4JP5A 4DV2B 4JXJA 3X2EA 1N5DA 5FWAA 2C98A 3QBVA 1ZD2P 1SURA 3F7OA 4MV0A 4HLDA 4BX8A 3L0CA 2R62A 4S05A 5TPZA 1F6DA 2A1TR 2BTQA 3L7YA 3I56V 5EMJA 3IMGA 5E3HA 2IYAA 5EHIA 5LDGA 5AT1A 3KEOA 4DR4O 1N4AA 1W0JG 3Q2IA 4P3KA 1T91A 3JAMA 3WX0A 3R3SA 3K9AA 2PXXA 1YAJA 1VHDA 1ZX1A 2XNHA 2ZT6A 1G21E 3WE7A 1SUSA 2RK3A 5C35A 5L3EA 3Q85A 3E8HA 2X1MA 3STWA 2EFJA 3BEOA 5DTEA 5AOVA 5K9ZA 3E7XA 3ZHTA 1QVVA 1NUHA 3HTNA 4G86A 3IURA 4LZNA 2IYZA 3TKLA 1F2UB 3OTFA 1WVMA 4TTJA 3L7OA 2ZTUA 4BW5A 4E13A 2Q5CA 4PTLA 4J0KA 5DX1A 3GWGA 2IV7A 1NLUA 3BEHA 1G8GA 2H5EA 5HBGA 2HFJA 3J81k 3LMKA 3L1KA 4CUKA 4FYXA 1ZMOA 3UHPA 2BCEA 4V38A 4