3JALB

Cryo-em structure of gmpcpp-microtubule co-polymerized with eb3
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 150
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jalB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jalB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jalB01
4LNUB 5JQGA 4I50B 3E22A 5JH7A 1Z5WA 1Z5VA 4WBNA 3VPAA 3HKCA 4X20B 4DRXB 5BMVA 4YJ3B 3JASA 4O2BB 4TV8A 1SA0B 5LYJB 2XKAA 4EI9A 3HKDB 1W5FA 5FNVA 3JAKA 5LYJA 2RHHA 5CA0A 4EI7A 3RB8A 4TUYB 1W5BA 4ZI7B 2Q1XA 2VAMA 4X1KA 3JALA 4O2AA 5IJ9A 3RYIA 3HKBB 4X1IA 4X1YA 3RYFB 5J2UA 4IIJA 3N2GB 1OFUA 2RHJA 2XKBA 5IJ0A 5JCOA 5LP6B 1W5EA 2VXYA 3VO8A 1TVKB 4B46A 3ZBPA 3VOAA 3JATA 4HNAA 3HKEA 2BTQA 3JARB 1TVKA 5LOVA 4YJ2A 5J2TA 1W59A 1W581 3CB2A 4O4JA 3UT5A 4LNUA 3JARA 4I50A 4O4HB 2GVIA 3WGNA 5JCOC 4EB6B 4X20A 4DRXA 4YJ3A 4O2BA 1SA0A 5KX5B 2RHLA 5MN4A 3JAWB 4I4TB 3HKDA 2R6R1 5LP6C 3N2KB 5CA1B 5KMGB 5IYZB 3WGJA 4TUYA 5LXTB 5M7EA 4ZI7A 4I4TA 1RLUA 5CB4B 5EYPB 4FFBB 5LA6B 1TUBB 5GONB 3HKBA 2VAWA 4TV9B 3RYFA 4B45A 5EZYB 3N2GA 4ZHQB 4M8IA 3RYHB 5LP6A 3M89A 1W5AA 3WGKA 4O4LB 1FFXB 4E6EA 4F6RB 5JVDB 3V3TA 4I55B 4DXDA 4KWEA 3ZBQA 4U3JB 1JFFB 3M8KA 5ITZB 4XCQA 4IHJB 3VOBA 4O4IB 4O4HA 1RQ2A 3ZIDA 5C8YB 4EB6A 4ZOLB 3RYCB 2BTOA 5ITZA 5KX5A 5JH7B 3E22B 3JAWA 4WBNB 3HKCB 5BMVB 3N2KA 4TV8B 5C8YA 5CA1A 5KMGA 5IYZA 5LXTA 3WGMA 2RHOA 5FNVB 3JAKB 5CB4A 3VO9A 5CA0B 5EYPA 4FFBA 5LA6A 1TUBA 5GONA 4X1KB 3JALB 2R751 5MN5A 2VAPA 4TV9A 4O2AB 3C8LA 5EZYA 4ZHQA 5IJ9B 3RYIB 4U39A 4EI8A 3RYHA 4X1IB 4X1YB 5J2UB 5EIBD 2Q1YA 4IIJB 5EIBC 4O4LA 5IJ0B 1FFXA 4F6RA 1RQ7A 5JVDA 4I55A 5MN6A 3JATB 4HNAB 3HKEB 4U3JA 3UT5B 1JFFA 2BTQB 5JQGB 4YJ2B 5LOVB 5J2TB 4IHJA 4O4IA 1FSZA 4O4JB 3JASB 3WGLA 3R4VA 4ZOLA 3RYCA
chains in the Genus database with same CATH superfamily
3C3SA 1HSOA 1X77A 4M89A 1LK7A 2ZSUA 2N48A 3KLOA 5FWXB 1WB8A 4MRVA 2D1FA 1Y9EA 3EDYA 1BMFD 4OX9B 5AD1A 4LOIA 4DIEA 1CZRA 1W5EA 5C8DA 4CEIA 721PA 3B53X 3OE4A 1FZTA 3D6AA 2R0QC 1M1KW 2B82A 3JARA 3RUDA 4DGQA 2V7WA 2YMPA 3QLTA 3B8EA 2R2GA 3L0PA 2QLTA 1ADBA 2I8LA 4MKIA 4D6TH 4B31A 3EWIA 3R76A 2XUOA 4G0PA 4HGOA 3M8KA 5L9AA 1WABA 5EC8A 5K3OA 5IXYA 4EFLA 3E61A 4DBVO 2J9FB 1KI4A 4J07A 2P5OA 2HP3A 2OILA 2UZ3A 4WN9B 4X95A 3Q88A 3HJUA 3MB5A 1PZFA 2IDMA 4F4FA 3KR9A 4NAUA 3O84A 5CDSA 1T6BY 1SCNE 4PHGA 3TBHA 3W9UA 3G7UA 5CA0A 3UJ7A 4EVIA 3DL4A 2BZSA 2PRSA 4P54A 1P2UA 1J8MF 4WI1A 4FTWA 1M34B 2NU8A 4JTDB 4RGQA 1T9CA 3QUAA 4W8OA 1M54A 2YNMD 3G2HA 3GLTA 5JPIA 2YXBA 3E15A 1Z0ZA 2JGFA 1P49A 2NUBA 5G2OA 5G4KB 1J42A 3B85A 4RUFA 2JAQA 5E7IA 2C2KA 3KVNA 4TSFG 3NC1C 2IHKA 3W2TA 2BO1A 3FYSA 1SZCA 4GX5A 1JKIA 2ZRHA 5DCLA 1QBKC 5K9ZA 2Y1WA 1H2SB 2Z8XA 5FKJA 1NQXA 4LCUC 2YMMA 4QGBA 4ZHQA 1XZQA 3AWIA 1L8XA 1V16B 1ZL8A 3OTWA 1RJWA 4ZJUA 1NOIA 2GERA 3CTMA 1Q7EA 1Y3CE 1W6UA 4IJWA 4I1SA 2R2AA 5DOZA 1WVIA 3OZBA 1ZSPA 4NHEA 4EKDA 2IPMA 5HHTA 1NVPD 4GMGA 1OFIA 1IBRA 3AFOA 4BIZA 4DABA 1G19A 4QYSA 2IV3A 2VKQA 5EXDA 3LO5A 1QHXA 3L7CA 3WZMA 4JLBA 1G7CA 3VR5D 4UMVA 3WRVA 3FTCA 4C20A 3RTEA 4FLWA 4EYOA 1ZK4A 3DLCA 3UO3A 2VYVA 1WXIA 4CLXA 3PZRA 4JC5A 5F7XA 5A2QN 4A5SA 3HSKA 4WDRA 3S2IA 2PMWB 2QR5A 3MELA 4D4MA 5KQPA 2MYPA 2EJTA 3EPHA 3EGOA 1OCZC 3SJCA 5KO2A 5SY4A 3HTXA 3CCLV 3RNOA 2ODTX 1RWXA 4ZRDA 3RHZA 3QVGB 2R6JA 1AUVA 3ANTA 1SXJA 3OD4A 2QUBA 3E2EA 1RS0A 3CC8A 1FUUA 2PE5A 1QO7A 3CEHA 3VR0A 1BDJA 4KMRA 1W85B 4M86A 4AM8A 1WF3A 1QH8B 3ETDA 5T4HA 2JGDB 2QD4A 2OCLA 1M33A 2ZBRA 4NZOA 1R0BA 5E6RB 5AHWA 5E4YA 1HTWA 1GILA 3RUFA 2ETVA 3RV3A 4W5NA 3U4QB 5LUBA 4K88A 4R0VA 3R7NA 2FI1A 3NFYA 2EJRA 5IF9A 1SD1A 1RAIA 2NO5A 2VF4X 4OM7A 3A9SA 2HEGA 4CLRB 5L3BA 1JIVA 2BN4A 1SUBA 2ECFA 5DASA 3DH0A 4CLEA 1NSFA 3OT7A 1N34B 2JVIA 3GB7C 1A5ZA 3NHLA 3MN1A 5D00A 4OXRA 4TQUS 3LVBA 1UFKA 3SM9A 3CLHA 3KXKA 2HHHO 4JCOA 1IQPA 3I0MA 1BXGB 3KJJA 1OT3A 4AJNA 4CKWB 3ZPXA 1RFLA 1M0WA 4O08A 4PZAA 1GDTA 2JLYA 4X71A 1ZM7A 1GSOA 2AIFA 1XEFA 3RUHA 1MX5A 1QTQA 5LMZA 1FYEA 3MWEB 1NUPA 4IS2A 5CAEA 1B16A 1YCHA 2ZBQA 3CCQV 4OA5A 3FR8A 5CGZA 5CLLA 2WDPA 3F8WA 3FGOA 2IF2A 5DXJA 4OM8A 1T9GR 4NATA 5TQ0B 5BORA 3P0FA 3UHAA 3E8FA 3NJRA 1NJ8A 3HBNA 2YWCA 5IYZA 1NHGA 3C7KA 3WXMA 4CFSA 1XXLA 3K4PA 2BE9A 3QZUA 1JLLB 1RFGE 3ML0A 3U4MA 1QIIA 5HYVA 2OZEA 5J4YA 5JBQA 2AF3C 2WIBA 4NPAA 4WV3A 2AN9A 4KE9A 4QDUA 1APBA 2F9FA 2ATVA 3IAXA 4P6VF 3NEYA 1NT4A 4PPYA 4NCXA 1QF6A 4G6ZA 3GNSA 5HIJA 1XNQO 1WXXA 1Y76A 1P39A 2HA7A 2JAHA 4AKSA 3C7AA 3PXDA 4EEZA 4BMDA 1C14A 2Q46A 3JPWA 4O4JA 5KAFZ 1Z62A 3RH0A 2O5CA 4EF5A 3RUCA 3WYCA 2PX2A 1JILA 3V9PA 1NP6A 4B6OA 4YO8A 3MTDA 3BH7A 1P0IA 4MW6A 2FUG6 1DVRA 1RT9A 4OJYA 1L6IA 4R1TA 5AI4A 1PN3A 1UFYA 2PG3A 5T8KA 2BTUA 1PF5A 2FFAA 3V7WA 4N5NA 4N7MA 4UW9A 3FCCA 4K2AA 1XD9A 4DV3B 2QVXX 1J00A 2Z3WA 2EDCA 2WYUA 2DQSA 3HB5X 2BTQB 3HDYA 2VHTA 1UWKA 3EB9A 1RQXA 2OCCB 5HJ5A 2VTDA 3HPLC 2PUBA 1AI6A 4FFWA 5AI8A 4BBAA 2NN4A 4M0LA 5CRIA 1H4QA 1Q1ZA 1HYQA 2WQZA 1SHJA 3WAJA 2RSLA 4JBHA 4FFKA 2EARA 4YX9A 5KREA 2W6NA 3P3NA 1PCXA 3IDZA 4GF5A 1NAIA 2QVZX 2GYWA 1RW4A 4JXKA 3CF6R 1KBZA 2COKA 4MUGA 3WYBA 1A77A 2I33A 3JQ8B 3F7VC 1E77A 1VP3A 5EPUA 4E08A 2AFVA 4JP8A 3OEHA 3MUEA 3K8ZA 3MTGA 3LUGA 1MOZA 3DXRA 4O0MA 3PHBE 1JHDA 4DR5B 1PNVA 4FR2A 1ZY2A 1QQ5A 4JBLA 4BX8A 4RESA 1Y6FA 3B1ZA 1Y74A 1RRFA 1V55B 1X7XB 2W2VA 5C52B 3PJSK 4EW1A 1SBIA 2C07A 2IHZA 5DZSA 1IZZA 4IJQA 1UWLA 4KUMA 3UNXA 5HF9A 4J0FA 2PBLA 4XX1A 3B1KA 2WF8A 2I7DA 1XTVA 2BD0A 1N8RH 4TYNA 3WWPA 1C3EA 4JJZA 2NXCA 1UR5A 2HCFA 2QHXA 2MYUA 5HQ3B 4LJRA 1UK7A 3IR5A 1L8AA 3WMRA 1OXBB 1EFKA 3PFGA 3EF3A 4RFSB 2HX0A 2BLLA 4L7QA 2CKDA 2A59A 3PGXA 2CHSA 2Y0CA 2XAAA 4BZQA 3VC1A 3T0FA 3DMHA 4BNMA 4N3AA 2RCVA 3S0YA 3N74A 2GJSA 3AR9A 2QOEA 2REOA 1OLSB 3HLYA 4X62B 2HS3A 2J41A 1UZNA 4Y2SA 2AG0A 4HYTA 2P9CA 2VFAA 4KMSA 1W2GA 1ZL0A 5ETJA 5JQGA 2CL6X 3JASA 3BM5A 5J23A 4MVRA 3Q8LA 1PJLA 4GZ5A 1GKUB 2B99A 3MK31 4Q9HA 3W9BA 2R8YA 2BCGY 5HRCA 4K8OA 4JUBA 1N4AA 1C0IA 3H4MA 4F1JA 3PGLA 1V9PA 4OF4A 2X77A 4KXYA 2C2AA 2FMIA 4FLFA 3ABMB 1G20A 1F48A 3IKLA 1JEDA 1KU0A 1KQ3A 3IERA 3N2GA 4ZREA 2FUNB 3LRTA 2YDXA 3RIEA 4R16A 1I3NA 2HIAA 5THXA 3AI3A 4RVDA 1LXCA 3GLSA 2FMKA 3MOGA 3BT7A 2VJMB 5TT1A 3L3BA 5HUJA 4I1YA 1ABBA 1W5SA 5F33A 4C6HA 2FSPA 1V5IA 1ZINA 1U3TA 3HY3A 3CPQA 3L9DA 2OQ2A 2M32A 1L8OA 1NBMA 3AEQA 1WSAA 3OQIA 2JC3A 5HZGA 4EGCB 5AVOA 3DT8A 5DNVA 1DDOA 4JZ2A 1N2IA 5KYWA 4U2FA 3K53A 3MXTA 4JP3A 1VKJA 3U6KA 1FNMA 2VSOA 3VPGA 5D6NA 1T0KB 1UAGA 1Z88A 1AROP 5CBGA 1S3FA 5MN4A 2GN2A 3L4SO 5DYWA 2CUNA 3P0IA 4NBKA 1VCIA 3NT2A 4LCEA 4ON9A 5H3CA 1EWVA 2WE8A 1DV1A 5GTDA 4LHWA 4ETIA 2OXIA 3FKSG 3BJRA 3JQFA 2QR4A 4FGJA 4J8PA 3H9BA 4R2MA 3GLHE 4BGDA 3RIMA 4DXDA 4QGPA 4OHBA 2F7SA 4MW1A 2IHUA 5DTEA 2V7EA 1Y3FE 3N75A 3HKCB 3SVZA 4ONEA 3ORYA 4YROA 4FZJA 3HBLA 1GQYA 1X2EA 5JCJA 1ZRSA 1XDUA 1A5AB 2NV2B 3NBAA 2D2VA 5HTKA 3QO8A 1P33A 2QA4V 2B7BA 2VUIB 3FZQA 3R4VA 3E5RA 2YZGA 2QJ1A 4ENRA 4GZ6A 4R9SA 4Z9YA 3X3HA 2VZ9A 4DGSA 2Q41A 1Q3HA 1DQNA 4E88A 5C93A 4AUEA 2FZWA 1W4LA 3UMFA 4AQDA 5AFSA 3IMCA 1KU9A 3GA5A 1N6LA 3K92A 3C24A 2ZZMA 3WSTA 2Q8VA 1JVSA 1H85A 4BL5A 3QYJA 5LU8A 2I3GA 1GX1A 2PIAA 4BQRA 5JSZA 2R8OA 4GZLA 4JODA 1POWA 2WSSA 3B9BA 1NRXA 3EGVA 4DCTA 5JYEA 4S1TA 1YACA 5HGXA 1OXUA 4KP4A 3OCVA 4RA6A 1NQOA 4BT4A 1RZ3A 4C4OA 2F3TA 1L5OA 1FU8A 4DEXA 2POCA 4YJGA 4F7WA 3JALB 2V55B 2QKSA 4FM1A 2CSLA 5DYNA 3ZH2A 3BFPA 3P26A 3SPJA 1OXXK 1EFTA 4IIHA 2EIKC 4B8WA 4D3SA 2VEOA 5CPFA 5EHZA 1X7PA 4DG9A 3E9EA 1JQ3A 1NW4A 2FSHA 2FFJA 4RDIA 3DZKA 4IHQA 4KQ2A 2DBVO 3AFMA 4MUFA 4DA0A 3GJYA 3EZFA 3LF2A 2W58A 5ALVA 3NK7A 3M4ZA 5L3EA 1IEXA 1PQYA 1XFDA 1R6AA 1C0EA 5KU1A 3MJCA 2JJ1D 4BGUA 4UV9A 4DIFA 5TJHA 1RTKA 2R96A 3DFMA 1X1QA 3KDAA 2P78A 4I5GA 4J3NA 4LQCA 1Z5UA 3OMWA 1VBMA 4WKOA 3AI1A 1G63A 1TCCA 2YZ7A 2OV4A 4R0NA 3ES9A 2FW0A 2ZAYA 3WLSA 2DGDA 3WGMA 1LI4A 2P2GA 3B1WA 2D7JA 4MWCA 4O4LA 4BVLA 5K03A 1JJBA 1JKMA 1NN1A 2JVJA 4DR4O 2G04A 3CCJV 2XSZD 5HFAA 4JC8A 1JXAA 3OT1A 1Y37A 3JD0A 5CXQA 4JKIA 4HLNA 1JIIA 2VSNA 1RYFA 2H1LA 3OA2A 2EG9A 1G3RA 3VX3A 3B12A 1T6NA 3K1AB 4G4WA 1IDN1 5L95A 3DEFA 3QOYA 2BOBC 4YASA 1HYEA 1JZSA 1VPVA 4JLJA 1G64A 4MUNA 2A5FA 4RGBA 4C6TA 1MZFA 1PSZA 4MO9A 4G24A 1Z7EA 3GZ4A 2QTCA 2ZRLA 5HFNA 3ELUA 1M8GA 4TQFA 3K96A 4ZU6X 4FW8A 4NU8X 2Q1SA 3RSQA 4P98A 4RELA 1FC0A 5U9CA 3JQ7A 4ICIA 4RHXA 2HVJC 3VBCA 3G68A 4KVFA 2HLDG 4XARA 4CMKA 2JFWA 5HP8A 1W25A 1ESCA 1XRJA 4MOWA 4AICA 4NICA 1U2GA 1LRJA 2WT4A 5EZYA 1PV4A 3PEWA 2PJRA 1E1CB 4HNHA 2ZJ1A 3LQFA 1Z2NX 4N5HX 1GUDA 2B5OA 2XI4A 1RXCA 2OHOA 1NV8A 3RC7A 1AGYA 2XVYA 1OH5A 4O2AA 3ZRVA 4GSYA 1VQLV 4RPGA 2OHWA 2O8BA 5LBTA 1M2WA 2V7XA 5EC1C 4BZWA 4P9OA 2GFQA 3ZD9A 1OYOA 3RT1A 1DUIA 1GNRA 4ALKA 3T99A 1FPOA 4YK7A 3JVIA 5ENDA 4PX9A 2REBA 4JVNA 4S1WA 3CW2A 1EGAA 5JXWA 1KY5A 2Z8ZA 1FQWA 5I7RA 2Z1DA 5EGSA 2JGIA 5GWXA 3STLC 2OP0A 5JXIA 1NYQA 5AKKA 6PFKA 4TZ0A 3IBGA 4ARSA 2PANA 4HBNA 3V8MA 4UZSA 3HNRA 4M7OA 1IM8A 5CG2A 1VHJA 3TRKA 4LZLA 2YCLA 1QUEA 5D3QA 3K0AA 3NOQA 1TLTA 3PPIA 3C8UA 5LQNA 3SYPA 3D59A 1Q17A 4Q3NA 2WSSG 4XM0A 3ILYA 3IOYA 2XD4A 1OD6A 4ZVUA 5EXTA 1AKRA 4EZBA 2WHPB 1VF6C 1YCIA 4AKEA 3DMFA 1AM4D 2LCQA 3BPSA 2I29A 4FHZA 1S77D 3KYJB 1BHSA 2AEMA 3EVKA 1MF7A 2ATKC 4P3OA 4X3PA 5ENVA 1GGEA 1CJKC 2R5WA 4PF1A 4HD8A 5BUZA 1KYIA 1B8NA 1HV8A 1RMQA 1KFKB 3CC4F 3AJRA 1AC5A 4N8EA 5FWXA 1ODIA 3KPJA 4P4NA 3QEJA 1I2BA 3QUBA 1TTPB 1S2NA 1P62B 1TZ2A 4ABYA 4RTLA 4EITA 1ILWA 2GN8A 5GW7A 5I9SA 1L0BA 3UCFA 1G2PA 2XYGA 1ISPA 2Y48A 3REOA 4BXOA 4IQGA 1KYZA 2QWXA 4M76B 1GVNB 1VSUA 3L0CA 1S96A 1WOYA 4HUTA 3S3TA 4RW0A 2FJUA 5KQSA 1JI0A 1H05A 3GZNB 3U5ZB 3EZLA 3N76A 3TO5A 3IQGX 3BILA 2GCOB 3LY5A 4ZYYA 1G5HA 2Z1FA 2J9FA 1MB9A 3MDOA 1HE3A 4BRWA 1TT5B 1OMOA 2E75B 2E6KA 4B7KA 4CMHA 2ID9A 1E0JA 3L8FA 3ANXA 3GGCA 2Y76A 4WN9A 2FR1A 3LQ1A 1IUOA 2WIJA 1CZOA 1ENOA 2DYRB 2XQVA 1GPUA 1CY6A 3P27A 4DNXA 4YTEA 2HT6A 1PZEA 3MRVA 1OZ0A 4F4LA 1V2GA 1PUXA 2V4MA 5AVSA 1GR1A 4JS0A 4KXWA 2ZSEA 2HCTA 1HM5A 4BMCA 3VH3A 2H2FA 4RLHA 2FEWB 3C4JA 4I6GA 2PCLA 3VNRA 3SEQA 5DLPA 4LJYA 4XDHA 4EJMA 1X6VA 1IWBB 3H9QA 5BPFA 2YIDA 4D43A 4Y2RA 5G4KA 3LUTB 3QFCA 1QDUA 3CN7A 4J0GA 4HMQA 1Z36A 4LWSB 1NWCA 4BNYA 1HT2E 3AG1C 2NSYA 4LZAA 4MDFA 5EO3A 2F00A 3KJGA 3LOPA 1R66A 3ER8A 5D1NA 1V16A 1D2HA 2GRJA 1XRRA 3TGPA 2X13A 2GX6A 1JJVA 3HM9A 3DMGA 2MR5A 3VMMA 4YLYA 3CW8X 1VQMV 2Z9CA 3IP5A 3AVVA 3ZNQA 4DDHA 3GXOA 2NSLA 3O82A 1XTJA 3CXHF 1II0A 1IOVA 1E9VA 3BY6A 1F0NA 1N8RW 4UMEA 5ICMA 1IH8A 3HWUA 4U7FA 4PU0A 3ZGXA 3CZMA 2GHTA 4ZDWA 3TOCA 3C6KA 3LOUA 5EC2C 1U94A 4IFTA 3HABA 3DUWA 3AHDA 2REQB 5K01A 3IEIA 1ODSA 4ZOLF 2A7WA 2A1TR 4MI3A 4A0QA 1PFGA 1Y48E 4FEAA 1RWMA 2R7KA 2WLMA 4G1BA 2FJPA 4KCGA 3NVDA 1RD4A 3GUCA 4MHOA 1US8B 2GDZA 2H1FA 2FWIA 1HDZA 2D8MA 1CEQA 3EXFB 1T34A 2GNAA 3KD2A 2Z8YM 1U1DA 2PD3A 1OGJA 3BRWA 4HRVA 2D00A 2PT7A 4RMGA 2APJA 5JLAA 1MA1A 2W22A 3HA7A 3I5UA 4MVJH 2CDRA 4B84A 1UZUA 1J49A 2FRVA 3VJRA 1PZGA 2AI2A 5KHIA 4H31A 5CFQA 1M3SA 1M6HA 1IV3A 1XMJA 3Q7TA 1Y4MA 2FKAA 2EL7A 4OLJA 1SBQA 1VRWA 5K7SA 4FQ5A 2PHZA 5ES4B 3MTBA 3EJ6A 4R1MA 1GDDA 2G0NA 5JY1A 4DQDA 1UEXC 2AE1A 3CCMV 3LIPA 2BPOA 3PVSA 3LFUA 3MINB 3E18A 4Z2AA 4URYR 1W85A 3BSWA 1QH8A 2JGDA 5FLXM 3HNOA 1D09A 5JU6A 1PNTA 3PE4A 1P7WA 1XRLA 4A1FA 2JCBA 1CY1A 5E6RA 1W7AA 4Y1EA 1RLIA 4BDSA 2L17A 2CVPA 4EM6A 4LYEA 3SBOA 2OCKA 3U4QA 1M9NA 1VZ2A 3KAKA 1D2EA 1R15A 3IKVA 4BMSA 4WIAA 4FEEA 4DA6A 3B3GA 4PHCA 1W1UA 4RJIA 2WFLA 3H7IA 3A9TA 4MRSA 4GNKA 1TZMA 2IJGX 5LOVB 4CLRA 4ESVA 4JJ8A 3WLLA 4A4DA 1QIFA 2BISA 4HAZA 2LIPA 4CQMD 3EPKA 1T6YA 4PPNA 4AJPA 3C5VA 2B8WA 3RWOA 1O96B 2QAGC 5EWMB 2QNRA 4G1EB 2WHXA 2CVHA 3OTHA 3NKFA 1C3XA 3E53A 1ZUIA 4QGAA 4V24A 2JLVA 3RCBA 1FP6A 3DBHB 2JIBA 1PNRA 1CUUA 5AHKA 4JHLA 4ZCIA 1FX0B 1HQYE 3RKRA 1Z34A 1HT1E 5KJFA 4BFVA 4A0FA 2C0QA 3TVYA 1YDFA 3UMMA 3AFHA 5JJLA 4BNNA 2H2GA 3E20B 5FPQA 1YTFD 4CMJA 3T7TA 3TTTA 1SUEA 3MWEA 1RJGA 2BBTA 4JX8A 3D3IA 2IVFA 3F2IA 4YFYA 4MINA 3DMTA 1ZRNA 2YIAA 5TQ0A 1UBTS 5H82A 1NA5A 1NQ3A 2JDID 3N0RA 1PV1A 1K8QA 5WRFA 4Z1MA 2WTEA 2YZKA 5FOSA 1KO4A 2EGGA 4DV7O 2BGNA 4UHFA 1W2HA 2D1RA 1AMUA 1SM4A 4I8XA 3PCRB 4NHOA 1Q0SA 3FIUA 1YIDA 2H8CA 3T7AA 2VHYA 4TTJA 1FNJA 2R5FA 5H4GA 1VXOA 4XRRA 1WG8A 2CWWA 1Z6QA 3BRQA 3GFGA 4CM9D 2CJWB 5AJZA 3OAAA 2HDOA 2F59A 5FEUA 1NTKH 4H33A 1NP7A 3WIDA 4ZEOA 2VQEO 4QRHA 2EFDB 4CF5A 3QU5A 1QR2A 1GCIA 4D8TA 2ENUA 4TV8B 1OFHA 2G4LA 1JG2A 1JE1A 1AI7A 2O0MA 4H7EA 3EY4A 4CYMA 2RK3A 5DEDA 2JW5A 1N1MA 1E6LA 1ZJWA 4G0NA 1XTQA 3FPHA 4KFMA 2LKCA 3TEFA 3KTDA 4WZBA 3JTMA 3CG0A 1NM5A 3V4ZA 4FCTA 1P5JA 3CH5A 3T9CA 1FFDA 1SCKA 1Y89A 2EULA 3ZY4A 5B7PA 5DPMA 1LBSA 4KIWA 5KHLB 4P4LA 1V1RB 2BTQA 3GHYA 1RSOB 4EKNB 3AEUB 3VGJA 2EIMC 4Q66C 5NULA 1I80A 4AS3A 1SB9A 2NU7B 4ZU3A 1Z7WA 3PDCA 4NARA 1M1NB 2AD5A 5SYNA 4DC0A 2W2LD 3GPBA 1ZQ1A 3DD5A 2ZBDA 1Q7CA 4IZHA 1AS0A 4AL4A 3BBPA 1ULSA 2JI6A 2NTJA 4OHFA 1THTA 3JQ8A 4HC4A 2H8KA 3ZGZA 1C4WA 4E5VA 3R6DA 1NLUA 1NNEA 3MBKA 5JD3A 1P84F 4L4UA 2PL1A 4OY3A 4WLNA 3V1LA 2PYZA 1YQEA 3IIEA 3TM5A 1GU1A 3L7JA 1FTWA 4X63A 4B6JA 1TGOA 4U7WA 3PNYA 3E4CA 1SRQA 5H80A 4NAHA 3DZ8A 2J7PD 1N9GB 2WP8J 5AKYA 5FO1A 1OAOA 4MA0A 1JZQA 3KDSE 5CITA 1Z83A 6CHYA 1F17A 2AMJA 4J75A 1ICIA 4M54A 3ZLTA 3BA6A 4YY3O 4FLXA 1QHNA 1Y1PA 2YW9A 2WWYA 2NM0A 2YHUA 4LYFA 2V8BA 5JYBA 3LT2A 3GHZA 3UG7A 1R0YA 5EBWC 3DVSX 5COBA 4AIIA 3OOSA 3PS9A 3ABZA 4RFSA 4C7MA 1IVYA 2JZOA 4X1IB 4RPCA 3WJRA 3D2LA 1V1MA 4E5PA 3T1HB 1ZNZA 2PGDA 1PRYA 3ZZ0A 1QOQB 4ZV4A 3RLIA 4Q20A 3RVYA 2Y1EA 1ZP6A 4R9RA 4RV9A 3CUSA 1CYDA 2A3RA 4RAOA 1OLSA 3N0WA 4UEJA 4R2WA 2ZI6A 1BX1A 3A6DA 3ROQA 4I7ZB 4FUQA 5F77A 3HBFA 4E30A 4L08A 3HXOA 3DDNA 1M0TA 2PRZA 3OJWA 3KVOA 3EVNA 2NT3A 3NCTA 1GZ4A 1Q1NA 5KPDA 3QPCA 1MZVA 3V4DA 3H9EO 4C2TA 5DHAA 1KQGA 1X94A 3L6DA 1O6FA 1VSTA 4YNBA 8OHMA 1W93A 3H1AA 1X86B 2NP6A 2KQUA 4DV4B 2WPNA 1KIMA 3DSQA 1OBHA 2WM3A 2NNLD 5JATA 4U4AA 2I6RA 1NMQA 3KOXA 4LXTA 2P9HA 4UHEA 4N54A 2H85A 4D4HA 1EJ0A 5BNFA 4WFGA 4GKAA 4DKXA 1W8IA 3AUFA 2VJMA 4YJDA 1DRJA 2G5PA 3K79A 3DDWA 3F0FA 2K9PA 4J0EA 5B1BC 2ZI3A 4FSHA 4K8ZA 3H0EA 1HDCA 4ZVKA 1U40A 3M6FA 2QA4F 1SO8A 2CHUA 1OGIA 4NTYA 2EBHX 4MROA 1E59A 1GN2A 4DM4A 1A7AA 4TLBA 4UUOA 3CISA 3L8EA 4WK2B 1Y82A 2HO5A 1R0RE 1NSTA 2BEKA 1WN7A 1VJRA 1VMIA 1L4HA 3UHFA 1TFRA 1UZAA 4UJ5A 5H3HA 1B93A 4ASUD 3KAQA 3RU9A 4JI7O 5T3UA 3FWHA 2BMVA 5FNVF 2R62A 3AHCA 2XITA 1KWGA 2XZOA 2ZREA 4IIJF 3P19A 1SCIA 3WLIA 4B6SA 1HE5A 4IXMA 3NXSA 3A70A 5T4EA 3SWWA 1EZJA 4KGVA 4DWWA 1FJGB 1U7PA 3HKCA 5J4VA 3BTSA 4URVR 4F3CA 4HAOA 4QNRA 1TQ4A 5DU2A 4KQFA 4DV6O 5AW0A 4QOSA 4CDNA 4NP6A 1DXYA 3FHJA 5D51S 3S29A 4QGFA 1OLOA 4BX3A 5LMCA 3Q0IA 5ALFA 1E0AA 1G41A 1RMTA 1TB4A 4KL1A 2GN6A 1MC1A 3SGIA 1UEIA 4WZ6A 3DT6A 1H47A 3R44A 2OXCA 2Z8YA 1QWSA 4L3VA 5IJZA 3ASOB 2O54A 4TT8A 1GA1A 2MK3A 2EZPA 2A4KA 4XWTA 2O8EB 3RVPA 1UAYA 3GLUA 3KYDB 1I4LD 5JWHA 1P1RA 2GBFA 2QN3A 3S02A 4RTMA 1D4OA 2OC4A 3AY0A 2HBRA 1BYUA 4LF9B 1F2UB 4FQ7A 2ZT7A 3ROEA 1R0LA 3MGCA 1X7DA 3VYTB 3F4BA 2QL9A 1I7PA 3B2NA 4B6GA 1B15A 5HOEA 1GR0A 2GD2A 5CTJA 1U3DA 3ZHZA 3FNBA 2RGUA 5FLXA 3JALA 4BVAA 4HZ3A 5K8VA 2V45A 4FJ0A 4JT9A 1BX0A 2E89A 2XKBA 2QP3A 3K6RA 3M4JA 3N5KA 4M49A 3L8GA 1O54A 3PUWA 3G13A 2G1KA 4W1PA 4L5YA 3D0QA 1PJZA 4AQ7A 3U44B 1G291 5SICE 2OFFA 3U39A 1PNQA 1VSBA 4PY2A 3GLIE 4PSAA 3IXMA 1ZGAA 2ZYRA 1TYAE 4G65A 4ALLA 2J46A 2IZZA 3SLKA 3OZEA 1Y33E 3T1TA 1ORTA 5CD9A 4JI5O 2PZMA 1JNYA 2G9IA 1F0PA 1H2KA 3OLXA 1O0SA 4Q1EA 2RN9A 4JBYA 1DINA 4LHEA 4C76A 2ODEA 2BGIA 4Y9UA 4BKPA 1OBVA 2GVNA 4WW0A 5GV8A 1LEHA 4CIDA 1SG0A 5A0TA 3LJKA 3TIGA 3ENKA 3WA7A 3C8HA 4BEBA 1QOZA 1RP3B 4I4TF 3ZI7A 1NZJA 2DUJA 3MJEA 5GOZA 3ABQB 1FXHA 5FDFA 1N3IA 1P1CA 1RHMA 4LMPA 3KP1A 4QA9A 2X8JA 4C21A 3KPUA 2JA1A 3IHWA 4QXPA 1L5YA 1JB9A 3I8SA 1AA9A 2GUWA 4TLEA 4KSBA 4IILA 4K9SA 4OYYA 5AP9A 5I9MA 1KQNA 5DHQA 1IBSA 4LJ9A 1XX6A 1B3QA 5J1TB 5EBLC 2O3QA 2RH4A 2JFPA 2ARHA 4NL4H 3MQ4A 5AW6A 1OWOA 4M9RA 4K40A 2W98A 2ZJ0A 4TPKA 2G08A 1NVPB 2D0OB 3A4VA 3PQ8A 2ZB4A 2XZDA 1YUBA 1SB8A 4G1MB 5AHRA 2XUJA 1ORDA 3J7AC 2IZ0A 3QE4A 1E1CA 5KSPA 2GPWA 1J0XO 4PLPA 2A1UB 3M1IA 1I0HA 2WG2A 3JY6A 4M7RA 1K5GA 2LCIA 1CP2A 2AMTA 4BLSA 1FNDA 3T4XA 1KNJA 4TV9B 3CNOA 1Z56C 1XA0A 4LDAA 3T7CA 4N0PA 4BNGA 3X1KA 1F7UA 5HKKD 1GGHA 1BW9B 1Q0RA 1IOLA 1GLGA 3ZBUA 3WG9A 3AI7A 4PIVA 3L6OO 2D1QA 3HG7A 5EJIA 4R3NA 2HSWA 4EKIA 4CTJA 2XNJA 2GAIA 3TZQA 3RAFC 2VLIA 3LMEA 4GXTA 4OU5A 2ZPTX 5FPOA 2C2GA 1EAMA 3PNVA 2G40A 3HCWA 1G8JA 2XTJA 3A8TA 2MDTA 2XTNA 4EECA 1ULAA 1VKOA 3VX4A 4QNHB 4HZUB 4MTGA 3N7UA 1TKCA 4BJ6A 2ADPA 4RS4A 4EX7A 3H2HA 3D0RA 3HA3A 5T41A 2WHPA 4LBWA 3HB1A 4PXYA 5B7GA 3LPMA 1DQPA 1TU4A 1Y1KE 4NY1A 3NHBA 2LTAA 4LCKA 4HZGA 4JVSB 4B4KA 5ECWA 5E7JA 1WV1A 3USCS 4K6KA 1ZMBA 2AFHB 4D4GA 3LSTA 3TQSA 4X9XA 1TK3A 2Q99A 4BB0A 1OIWA 1P2BA 2UVDA 3K73O 3OTIA 4PSKA 1U90A 5G0UA 3O31A 5TS2A 4WNAB 4BNJA 1QHTA 3PC6A 4OREX 4D9EA 4K35A 1XJ5A 1L4NA 2XWBF 2XNCA 2WWGA 4IH9A 4BPRA 2F1OA 3O21A 4AJIA 5F2OA 1OV9A 1ST2A 1VXRA 3PK0A 4MYHA 1NVUQ 3ASNB 1P4RA 3EMBA 1GEEA 4FYMA 3O38A 3E83A 4AK9A 3ZHTA 1ST3A 3G7SA 1KSGA 5HY4A 2GCOA 2PIDA 3RF6A 3AYZB 2V7VA 3AKYA 3TNYA 1FS6A 5CYPA 3ND6A 4QELA 4WY8A 4BEVA 1TT5A 3WO1A 2QU7A 3IKTA 4OV6B 1KORA 2ZQZA 2AQIA 1JAHA 1LNSA 2D4HA 4G5QA 2QMOA 4B75A 3SQNA 3IT0A 2V5AA 1NU1H 1SD5A 1LK0A 2VP6A 4D3YA 1NDUA 2VAXA 4OOFA 4TWIA 1U7DA 1XTSA 1FSSA 1X7WB 1VMKA 3OPYB 4W9NA 1BH2A 5P21A 4PE5B 4ZQEA 3AR7A 3NDRA 1YQXA 4D7AA 3L0OA 2R7LA 2YY7A 1Y6GA 4M8KA 1NRWA 2GVZC 2ZDIC 3NVIB 2YJ6A 2L0XA 1QSGA 3JYOA 5A04A 4GD3Q 1RCFA 2X8WA 4CKBB 1IEVA 1ZD9A 5JY6A 1SBTA 4OHZA 5DWDA 3PUIA 1PD3A 4LWSA 3PEEA 4KQ6A 5JMPA 4E12A 3D4PA 4M0UA 2CY0A 2RD2A 4W4LA 2GNPA 4KQGA 5FH9A 1UKEA 1JDBB 1EB9A 1TUGA 4UUQA 1YK1A 4KK4A 2DM6A 4DYHA 2HI0A 1GUZA 3ZDZB 2B9VA 2C9MA 1Q12A 3OG9A 3STWA 4PG8A 4IHAA 4G81A 1QGZA 1X1AA 3AH8A 4ED9A 3B3AA 3V8NA 4IIXA 3NXKA 3CCSV 5JYDA 3QXGA 1T5EA 2W7TA 2QXYA 1ZJZA 4HDNB 5JJKA 4HGYA 2OXTA 2REQA 1GKKA 1B6RA 4UXNA 2XKAA 1CUEA 3IOCA 2KS6A 4HNSA 2GN0A 4WINA 5IBPA 3WAGA 4EBBA 4XR4A 3DYVA 3GD7A 1US8A 4IH1A 4AY4A 3OCWA 4JYPA 3EXFA 2A79B 2IW3A 4JLAA 1UQUA 4C0BA 1E6MA 2GJ4A 1VC2A 3R20A 2AWNA 3N0XA 4L0MA 5CFZA 4AB1A 4UAVA 4QGHA 4JLMA 4RWZA 3EMVA 3GT7A 4JUDX 2K7FA 4M36A 4PAQA 4CMCA 3EVGA 4CV3A 3QVUA 4COOA 4CT4B 3PHLA 1EUCA 3AERA 3H8VA 1HY3A 3CCEV 2VN8A 1SMKA 2FG6C 4J0DA 4G63A 2IKSA 2ZRNA 4GKVA 4BMOB 1K7XB 3ZV6A 4NBTA 3MINA 4ECEA 2H1WA 3AEXA 1M2NA 5C81A 3DV0B 1TAGA 4UM5A 1QQAA 1U31A 1A8UA 2QMEA 3U3RA 1U7TA 5CD1A 3DXXA 4GGMX 2SHKA 1TYBE 3GCZA 4QOEA 4AF7A 4BFUA 5CLGA 1AI4A 5JCXA 1E2MA 4O2RA 5K3FB 2I7TA 3EH1A 1Y9DA 4F4DA 1RM1C 7ABPA 4LV5B 3FMPB 5LOVA 4P7GA 1SY7A 4KXUA 5E9WA 3KB2A 3ESYA 4NOMA 3OZIA 1M6YA 1O96A 3Q1KA 1A9ZA 1IQRA 2H2HA 3V6MA 2VP5A 4QFDA 2FPGB 3KETA 1QNMA 2H3OA 2LWIA 10MHA 1M6EX 1DCMA 2ZJAA 4B4UA 1YC5A 3LHFA 1XOUA 3DBHA 4AJ2A 4RPHA 5ALYA 2BH9A 3FKSA 4B0OA 2HV9A 4EO9A 2QD2A 4W1SA 4XCVA 2RAFA 3L46A 2OB1A 3M2PA 4JOSA 2D2IA 1KVRA 1FBTA 2NOAA 4JAUA 3H1EA 2JHPA 3BB1A 2F66C 3JRNA 1OLXA 1PR3A 3Q0TA 2A9RA 3DMRA 3JSLA 2VSQA 1VDZA 2XDYA 2R25B 2Q0OC 4BNLA 2H6LA 4IZ6A 4HNRA 2CTQA 3D36A 3KB8A 3ZJUA 4LF7B 4PCAA 3NCHA 1UKCA 4TZKA 1C3LA 4H77A 2I4MA 3DGEC 3TIXB 3DFFA 3IYLW 1YFZA 1U7XA 2OL4A 1BZYA 4CMEC 2JLUA 4LXHA 4KN8A 5B55A 3QENA 1LUVA 4L15A 1G5PA 3OZCA 3IV6A 1COMA 1H5QA 5EFOA 1RKXA 3DMYA 1E1RD 3L73H 5H70A 3C3MA 2B1RA 3NT4A 4HAIA 3I9V1 2XMBA 5BMVB 1OWLA 1U8ZA 1VQ6V 2E4ZA 3CH7A 1TFUA 3S3WA 1M72A 2CJWA 1N8NA 3SE7A 3TVDA 3EVEA 1MU0A 3BCSA 3T5CA 4K26A 2Q3BA 4F2PA 4H7JA 3TQRA 4JUFA 1UT6A 3CH6A 2B3TA 2AZMA 2UYGA 4TV8A 1BCRB 1I7QB 3OPMA 4W9MC 2Z43A 2RHHA 4MV4A 1SUDA 3B6ZA 2Z2YA 2C57A 3SR3A 4FS3A 2G8NA 4QPZA 4RSRA 1OCOC 3ZE7A 5U1PA 13PKA 2E4XA 3HDQA 2OV1A 2PY6A 3O8OB 2V1UA 2YY5A 2WUWE 2DPLA 1PQ4A 3F78A 3WG7B 2W6ZA 1XG5A 3UUFA 4D74A 4BO3A 1VQPV 1Z6XA 2DQ4A 3GFSA 2OYRA 5BRJA 1N25A 5I5GA 1T9GS 4XQCA 2QTWB 1RSOA 1H4SA 1E66A 4JVMA 1QQ7A 3L70H 4WEOA 3G49A 1W47A 1T0IA 2NU7A 3OICA 1FFBA 1H8EA 1M1NA 2DBQA 2VZLA 1OI7A 2BZ1A 4PC7A 2RHRA 3NMUF 5CG1A 2QQGA 4WFFA 3L7QA 1EFRD 3CZPA 2NZWA 1EE1A 2FTKE 3VR3A 1OCCC 3CZAA 2QX9A 3HDGA 3FVQA 4LF8B 2IEGA 5IZCA 5KC9A 2R6ZA 4FJ1A 3C4VA 2FDCA 4Y9DA 4EHHA 3KQMA 1ZEMA 2X0KA 5TMEA 5LP6B 1UPBA 1XEAA 5C51B 3LYLA 2AMFA 5EJ6A 2XMDA 1TECE 2YV3A 4YGYA 3ZP7A 3OWXA 4J1SA 4O4HB 2P2NA 4FMCB 2QTFA 1N2OA 3B78A 5KHAA 3FGPA 4YAKA 3L7BA 1MPTA 1E1KA 2GZHA 1G21E 3DWIA 4C4TA 2I6QA 5F1OA 1FFAA 2YQ5A 4HI0E 2M6KA 3T4ZA 4Y6OA 4ACAA 3GFFA 4RIFA 4EF6A 3VQTA 1PFUA 5LBQA 3WL8A 2YUIA 4F86A 1EQ2A 1KFBB 1KYQA 4JL5A 3FW1A 2W6MA 1R0KA 3T61A 2RBKA 1ZD3A 1AK9A 3TSAA 1DEAA 1IB0A 3RVOA 5FCDA 5AUNB 3R7SA 2IPOA 2HLDA 1N77A 4KE6A 1E60A 2EJVA 4ENTA 1DXOA 4R6XA 1X1SA 3GWZA 3P2EA 3X1YA 5AOVA 2BR3A 3CLKA 2XTAA 4JB8A 3AVWA 2AX4A 1Q6YA 3IDQA 1QQ6A 4X1IA 2IHTA 2AH5A 5KU7A 4GI2A 3ICXA 5HKAA 5I47A 3AHFA 1R6KA 2W6JA 2G83A 2I2WA 3UBMA 3TZHA 3BQMB 4J2TA 2WZQA 1H8HG 4Z2WA 3I2HA 4YXWG 1NURA 2M7WA 4P7BA 1SKMA 1VPTA 4AKGA 1SCJA 3AUYA 1CEEA 3ADPA 4XPZA 3F4KA 1QYDA 5H9WA 5JAUA 3HCBA 5F2NA 4JKYA 4HO1X 4GICA 5EK0A 5C32A 4R5MA 4K6GA 2XCTB 3I76A 5DSXA 3SZOA 2FCAA 2AJ8A 5DGCA 3WPWA 4L9AA 4NMWA 1NTMH 1WEKA 1WSDA 1RBYA 4LF4O 1LKZA 1KI7A 1PNMA 4E5KA 5DBFA 2X9LA 3JWHA 2Y4TA 1L4BA 3EVBA 3NFRA 1J2JA 4BIIA 4DV0O 2D3OW 2OR3A 1ZU4A 2OT5A 2CHTA 1N0WA 4ND4A 4CL8A 3MM4A 5AXBA 4BUJA 3CVYA 3U61B 1JN0A 1SA0B 3MMPA 1SKQA 2ANCA 5IT9N 4OHRA 3RB8A 6YASA 3W78A 5A5VA 3RRZA 4OK6A 5DYIA 1JS1X 5DXAA 1WAMA 1NKSA 4I4NA 2Q4RA 4IMPA 2GAJA 2XQJA 2Q6KA 4WAUA 5DHPA 5I9IA 5EXEA 1W40A 1V7QA 2Q3DA 3HR0A 4H0CA 4UXJA 4GGPA 4JI4B 4CF4A 4MVJP 3D7MA 2W6ID 5EQTA 4M1ZA 5I7UA 4NV0A 4M1OA 1O7JA 2BM8A 1S7GA 2JAUA 4RH3A 5T4BA 1RWOA 1YA8A 1XZLA 4DCPA 3RVMA 2V5VA 2NVOA 4K0RA 3N2ZB 3ZUGA 1Q2XA 2Z6QA 1LPAB 2ZVYA 3QHDA 1RHRA 5ES3A 3HVJA 4AY6A 3LAWA 1N9ZA 4G85A 2Q5CA 3RTCA 3RUPA 1QVZA 5HIIA 1O0CA 5JW6A 3GFQA 1J8YF 3TD6A 2J5KA 3P9ZA 3PSAA 2BRUA 3HL0A 4KQJA 5FBHA 1Q7RA 2VQSA 2G9NA 2AZ4A 1FNNA 1G8KA 1U7UA 5AJYA 3L06A 4PELA 2N0SA 1H8EG 5K3DA 1PW7A 4MVJA 2DYYA 5M7EA 2WM9B 3P0JA 4HXYA 1X9GA 1O8CA 3P20A 5M29A 2Q0XA 2EIJC 1ZG3A 3RV4A 3QX7A 4XEHA 1HLGA 3RYCB 4KXQA 4R83A 2BSXA 1V3VA 3I2GA 2LW1A 1OB2A 3U80A 5DSTA 1TM3E 3V8QA 2Y1CA 2ATXA 4WOKA 3N6XA 2X1MA 4DS3A 2RJ3A 4G25A 3TUIC 3BXHA 2O8EA 1PL4A 4OL9A 2VT6A 1GTMA 3F3YA 1A7UA 3FPKA 3UB3A 1YS9A 2H63A 2PQ6A 3WL5A 3O26A 3SR4A 3QO7A 1VQ8V 2Q5IA 3ZMVA 3VYSB 1F2UA 4IYHA 4YMIA 3ZTWA 4KXNA 5A5DA 1SKYE 4P4SB 4B71A 1XQ6A 2J5XA 2OSVA 3KOOA 5B30A 1K7YA 1DC8A 4P2BA 2UUCB 1NOKA 1XKTA 4G37A 4HP8A 1JHAA 1SUCA 4J0QA 4DUYO 4ZAXA 3TSYA 1KYXA 1PSWA 3X2SA 2VQDA 3WNZA 3NAGA 2QPOA 4EPWA 3U7JA 3WK9A 1CUGA 2H9IA 3G2MA 3TW6A 2H8GA 1DGQA 3L1IA 2J85A 1WUIS 3U44A 3W5IA 5M3BA 1DT9A 4H7DA 3Q9NA 2W6JG 2WA1A 2HREA 1CRZA 1XBLA 4Q01A 1YU9A 2D1SA 2E55A 1U0LA 1UADA 3FFQA 3S70A 2DJVA 1JHPA 3U37A 1U8TA 1E8NA 5F1YA 1XBTA 1JHQA 3K2QA 5LYJB 5ALSA 4DG8A 4K9NA 3KAPA 4DCGA 4BLTA 3OO1A 2VJLA 1UFIA 4OBBA 3H5WA 1MCZA 3BQ9A 5F9FA 1GLVA 2A8YA 2JHGA 2RBGA 1XDZA 2EX3A 2GK7A 2HPVA 3ZWXA 1OFVA 1WLYA 1Y63A 4JU9A 4ZANA 3WBBA 3SJUA 2X9GA 4BC1A 2R48A 2R8XA 1COWG 4L95C 3JR7A 3R5JA 5JAZA 3CWZA 1VBNA 3QOWA 3HMQA 2PSFA 2DWEC 3H11B 1ZVVA 1CZUA 2PU7A 5EE9A 3S2ZA 2BSAA 2A0FA 1ECPA 1FJHA 1IXBA 2JFGA 2XDWA 3BREA 5CA0F 2ZAMA 2F9MA 1GV0A 3KYIB 1C81A 3IJEB 1X2BA 3LUBA 2ZI9A 2KSDA 4CKXA 3HDHA 1QZ3A 4Y3UA 4GC5A 3U0BA 1T5OA 1N2CE 4NH0A 3HAXD 1LDGA 1XEWY 3CNBA 3KJIA 4KWHA 3CPWU 3P2YA 4HDQB 1AGNA 3ZWMA 1Q90D 3PHCA 4BQPA 4EQ6B 2YI8A 5FUBA 1ZW1A 4UNSA 3V8EA 1Z6PA 1YE8A 3C41J 3TKYA 1N6RA 1Z0KA 3RK0A 5TEWA 3ET4A 4X92A 3QUCA 2FP4B 2FU5C 2W9XA 3O3NB 3CPWF 1GQSA 1KS9A 1GXSB 4ZHQF 2OHXA 3MYRA 1MZPA 1KYYA 3AG6A 4YCAA 2ZM6O 2AI3A 2A1UA 1WMFA 4W5JA 2OPBA 2GUZB 4I1RA 5DHUA 4QLOA 1M56B 4DXWA 2ZSAA 1LSSA 4MJXA 2R1ZA 4PGAA 3ZHBA 3F3SA 4X6UA 4TV9A 1FXWA 2FEOA 3JYHA 4FU0A 5F73A 3SM3A 4AI8A 2WW8A 4MVJG 2B92A 4X3OA 1EX6A 4G5HA 1Z26A 1BW9A 2H29A 4OHXA 1L7BA 5FLYA 2L35A 2PRJA 3NWJA 2G76A 1NH2B 1G2IA 4Q02A 2JKYA 1E61A 2CK3D 1N8KA 4HEJA 3NU1A 1M34A 2QX7A 5DLYA 2MTBA 3F74A 5AMXA 5CB6A 5C35A 1CQXA 1HKHA 3VC7A 1LPNA 4DE5A 3PC3A 4YIKA 4KWTA 4MS3B 4NESA 4KMOA 4B3MO 1W29A 1P91A 1ZNYA 3IP3A 4HZUA 4K9OA 1I3OA 2OQRA 1IY2A 5FI5A 4OLFA 1GO1A 2IZ1A 3H6HA 3TD9A 1XNHA 1Y9AA 1BMFG 4CQMB 2VPXA 4RZQA 5CFPA 1D2GA 3CCLF 4XGNA 1RRVA 5F1PA 1FNKA 3TIIA 1Q83A 3OZUA 2Y92A 4L5BA 1N32B 1UJ4A 2YDEA 3ND5A 1RI5A 2AFHA 4ZGWA 1JEOA 1JHUA 1KMMA 3MS4A 1JLHA 2GPSA 2IWHA 1SZQA 2AEJA 2OWEA 1R3DA 2Q62A 1XL0A 4UREA 3TXAA 5ALQA 4B6FA 3T7SA 2HYDA 1LV8A 3VSDA 5FBVB 1OBCA 5SY9A 5IVKA 2P1ZA 4WNAA 2UZ4A 4F9TA 4L4SA 4Y6PA 1GN4A 1EJ2A 2XF8A 3L0ZA 2FEAA 4KQ9A 1A88A 2Q5EA 4S1PA 4MTCA 3B70A 3C9RA 2WA2A 3WMXA 4BT6A 3GJXC 2DFTA 4PYMA 2AGVA 3K8OE 2XMGA 2XUQA 1FZQA 1KMHB 1SG9A 2FSIA 1Z8DA 3WV4A 3ETQA 5FBLB 5K3EA 2QNIA 1USUA 1N36B 2GVDC 3OQOA 2CN1A 5HBRA 4YCCA 3VTIC 4BECA 3M49A 3ZEDA 3BJZA 4A73A 3BGOS 1PVVA 3AY7A 3I72A 1KC3A 3AJEA 1J2TA 4GPIB 4HJRA 5JO9A 1UK8A 1UOQA 4BO2A 7YASA 2WSYB 3B9PA 3JWIA 3WA6A 1KQPA 4KC0A 1F4LA 3U4CA 3QVGA 2GETA 4BN4A 4NBVA 2DLCX 5AM5A 2HIGA 3QTTA 2E87A 2ZZNA 2WNIA 1X4TA 2EW1A 3NBMA 4MVWA 5AVQA 5TF4A 4GRAA 4IIVA 4D9FA 1RZRD 3PGJA 3OPYA 3DSRA 4JROA 3UAVA 3SYRA 4NBWA 3R66A 2DUNA 4U0KA 3A04A 1JAZA 3Q4GA 3VH2A 2QSJA 4BP8A 4QEZA 3GN2A 4B85A 3EQ8A 2BUCA 1BN7A 3ZDYB 1ZJJA 5IYZF 5HCUA 5ABPA 3EDMA 5EUBA 4D9MA 4CKBA 4BYGA 3CCQF 1SU6A 4MSWC 2YMQA 4JP5A 4ZOAA 1HDYA 1K4KA 1E64A 1LTHR 3OVMA 4CGZA 2Z95A 4Y1RB 4JT2A 1INLA 1U7HA 3LC0A 2VDQB 1N0IA 5CR9A 1PAUA 1X70A 4O4JF 1IQUA 1U02A 3TX2A 4UB8Z 1G2QA 5L4SA 4E1VA 3JVVA 2L18A 4ZI7B 4C0AC 1WUKS 1BXGA 2WF7A 1V35A 4CKWA 4HDNA 4PCLA 2EKDA 2VUHB 1S5HC 2FF5A 2NP7A 1UXOA 1S02A 4D81A 1R0ZA 2OHIA 3EZ7A 1WUJS 4GI1A 4ZQIA 1K5DA 1I5RA 2AXNA 3AG4B 5TR9A 4PANA 3B52X 2C7QA 3EXG2 3C87A 3VR6D 1RCUA 5A5EA 2Q3HA 4JJEA 4GL4A 1TADA 3VOBA 1OU4A 3AXSA 4ALMA 3PIIA 2FWPA 1GPWB 2ZIXB 2HA2A 2UYQA 4XPIB 4FONA 4NYMR 1QIGA 2J07A 3QU4A 4PZ0A 3L7KA 1JLLA 4GR5A 3STXA 4MWSA 4LXQA 4EHKA 3VI4B 2QPAA 5MN6A 1A1SA 3QVXA 1QD9A 4BY9D 4N7BA 4CIBA 2C5SA 3ZE2B 3JYNA 2VXBA 4KTTE 2MYTA 4N3CA 1ECFA 3KCYA 1NUQA 1X39A 4EGQA 1D3AA 3DV0A 1F4MA 2B4AA 3TN7A 4L8LA 1I1HA 4F5YA 3DB1A 2MU1A 1PZNA 4PO9A 4I19A 3LF1A 2P9FA 4JHXA 4XDKA 2Y1XA 2JLBA 4E7PA 1C1YA 5K3FA 2AN4A 1QKJA 3Q3EA 4XGRA 5DYYA 3GCWA 1H93A 1UCFA 1QZZA 3A58B 2W2QA 2QN1A 2A1TS 1WPXA 2HF9A 4ZVTA 2MOKA 1JP7A 5EBMC 4XLLA 2P6PA 1K9MH 4B3TB 2XBLA 4NVPA 3GLFE 1J5PA 3O7MA 3QVKA 2GZRA 4P3PA 3VR5H 4JT8A 1WXWA 2OC9A 2J48A 2LZ0A 5EQDA 5BSFA 2WJGA 1VA4A 1VQ6F 2ITCC 3AHEA 3LUKA 2IVZA 1BHJA 1QORA 2VBIA 4C7KA 4CH5A 3N0TA 1IPHA 1BDMA 3KSMA 5TJ9A 5CK5A 1I01A 1TO1E 1RZUA 4IVRA 4N76A 4XOUA 1KK3A 1B43A 1C0LA 3GWOA 4ESEA 1DX6A 3H1KH 2Q6AA 3WGZA 1AKNA 1ONPA 4B3XA 3K16A 1W19A 4XIGS 2F9ZC 4XD7A 3LYHA 3G4SV 4H3SA 3GFOA 3H13A 1UP4A 3O2JA 3FBAA 5FA8A 4E09A 3A1SA 4JITA 5LQAA 5C5IA 4IJMA 3HS3A 4EY3A 2GH1A 2DYSB 4PS1A 1ENZA 5JQGF 4MW2A 4E13A 1K8AH 1VQPF 3AIOA 1Z7GA 1CXZB 3GNLA 1ZJYA 1B0UA 1F2TB 3O1LA 1XQYA 1GVHA 4YV1A 4LXGA 4TS1A 3TTXA 3IEUA 3OONA 3SC6A 2IY7A 2N3ZA 5BMVA 1VKRA 1X7XA 4JDPA 1JY8A 1KAMA 4DR3O 2C4NA 1XAJA 4GSLA 3FLBA 4GR9A 4LECA 1SXGA 5IH3A 3DVLA 1BJTA 3NHAA 5K4HA 4IVNA 1KWKA 1E2GA 1BCRA 5TY0A 1RXYA 5HQ3A 1QYXA 1N5MA 1F4VA 4V0KA 3B1VA 3G0OA 3KXLA 3TQCA 4YAIA 4JI8B 2ZYHA 2ZUUA 5LIPA 3ZMZA 2X0FA 3AF1A 2EXXA 3USZA 2VC2B 3ER9A 3HCAA 4KYIB 4Q05A 1MO5A 1N3LA 2GAFA 1N6NA 3LWQC 5JD6A 1F23A 1Q0LA 3FSRA 4XDJA 2X8BA 2J3QA 2QKYA 4A5UB 3CCCA 1CETA 5E6UB 2HQ1A 1MB2A 3ZU3A 4YRDA 3RI3A 1WPGA 2WYVA 2Z04A 2FPKA 4GBJA 2TMDA 4I50B 3WO0A 5AXAA 4KN6A 1VKNA 2X5JO 1DJMA 3MB8A 4CG2A 3PXXA 5BWBA 3WNBA 1YRBA 1NR7A 4BAGA 4MMYB 5IK2D 3R75A 5M2QA 4XDZA 4DREA 3JX9A 1FX1A 1PEDA 2IHNA 1HNXO 1QGDA 5LP6A 4CTNA 4LI0A 2QORA 4DV1O 3JCUZ 1KSJA 1GGKA 4G41A 8AT1A 2WILA 4CI0B 2CUTA 3CNLA 4O4HA 3HVUA 4AG6A 1AP6A 1EFLA 1P1IA 4Y6QA 5FPHA 4C3ZA 5TXGA 4DDWA 2BHTA 2OTCA 2C82A 5EJFA 4IDQA 2X4DA 1H94A 1PWXA 4F45A 4Q3CA 3E2PA 1A32A 3DTTA 3ZOZA 4FGLA 2HK6A 1Z4NA 4W4TA 3EG5A 1NR1A 5TGTA 3NEJA 5DFAA 4JYAB 3ZCCA 2VTKA 5AK4A 3L1UA 5HP4A 1PR1A 1U1CA 2CNWD 2LIVA 1MH9A 2AMYA 3ONDA 3EXHB 3S0JA 3P3PA 5ADWA 4QDJA 1GFIA 1QDLB 3J81N 2PS1A 4UAUA 2ZWMA 2JVKA 4CIYA 2CEAA 2ZR9A 4XXHA 4UQPA 3TF5A 4GP9A 4OK3A 4ZHYB 1HZZC 1M1XB 1TK9A 4TS9A 1QH0A 3WDMA 1CC1S 3CCBA 4CUZA 3C6QA 4Y2JA 4MKGA 1ZMTA 3UK7A 2BGGA 2PZBA 4M9CA 4WCFB 1J4AA 3UKOA 2QUKA 3EC7A 5B1AC 2LDBA 3DC2A 4H2DA 3NTRA 3UENA 2J3DA 4YCDA 5K0SA 2C00A 3KQSA 1LF5A 3R2JA 2W4IA 3ENQA 4O5OA 2QD3A 3GMIA 1EDOA 1AF4A 2PWAA 7ADHA 1L9XA 1E7YA 3QEKA 1CY0A 1V47A 1CZHA 2LBPA 3BE5A 4RXMA 3JSXA 1SNYA 3BG5A 4OYRA 4FYHA 1QGYA 3KB1A 1C7EA 1HNZO 2WWRA 2ZUVA 2H5EA 4DO2A 4QU5A 3BDVA 1SVKA 1MG5A 2P0AA 3UG6A 3WS7A 1VLVA 1SA0A 3CZCA 2IZ6A 5DM2A 1M7HA 1G5IA 1UXGA 2ERYA 1CIVA 4OX9Y 5E8RA 2PUFA 3L4KA 4O4LF 1J8VA 3PYMA 2BHNA 1Z6GA 3EVDA 4MPTA 5CVDA 3Q7QA 3O03A 3NPAA 3PITA 3NM6B 5KQMA 4QUKA 4AY5A 2HAEA 2QU8A 2YFQA 3QVJA 3CKKA 4HAXA 3RS4A 3UWPA 4OXKA 1PFVA 3IPLA 3FGZA 1U43A 5T64A 9LDBA 1V43A 3CCJF 1ZCZA 2GSMB 2OWOA 1RPOA 3VH4A 2BGWA 5GJCA 5DT9A 4ZGGA 2H06A 2O8DB 1OKKD 5FLKA 4BWAA 3WGGA 2GHQA 2P4QA 1JSZA 1U7WA 1YK0A 3CU5A 2RI1A 2YBEA 3HFRA 1TKRA 4DSAA 5EP4A 3E82A 3ROTA 1VQ8F 1KK0A 5P8WA 1N7GA 2ZCUA 1UWCA 3C3EA 3CEAA 1HO3A 5EZYF 3SDLA 5AKHA 5EVCA 5DX8A 4JI0B 4IQFA 2EZUA 4MHSA 1EN5A 4QAQA 1JYFA 2QZJA 5A9GA 2P4SA 3DDHA 3NVMB 4IRMA 1LBIA 3FMFA 1GRJA 3G0HA 4H7FA 1Q5PA 4IJUA 4O2AF 4X6XA 5I8ZA 3TXXA 3ZDBA 1F2VA 3EA0A 1G0NA 3MHTA 4ZO8A 1C30B 2Q4PA 3RYCA 2JF0A 1XDGA 2F62A 3S06A 3T9FA 2DETA 3QI7A 3EA4A 4B7AA 2F6RA 5EMNA 2NPIA 3N7TA 4KZPA 1HFWA 5I6DA 2DTEA 4NG4A 5AT1A 1VQLF 5IY5B 1WUHS 3WNDA 4R1QA 4FZ3A 3EORA 3UXEA 1H38A 2HLHA 1AB5A 5DV9A 3K1AA 5IKXA 3HDTA 3D8RA 4PIMA 2W6IG 1YDWA 5CH5A 4FXOA 5G4UC 3LU1A 3MILA 3QPAA 4U7HA 1XEQA 4RTSA 3KO8A 4DXHA 4P4SA 1IDOA 2VH2A 4G01B 1DTOA 3CONA 4LUCA 2V0CA 2W2MA 1S2GA 4W5WA 3JZIA 4DVGA 1DFIA 2D0DA 5E9JA 3JZAA 3R8XA 2C9BA 1PT8A 3EBOA 1KEUA 1YJ9V 1VL0A 5AVJA 3OGIB 1YJQA 1DELA 1KKUA 5K05A 4YRBA 4TMYA 5T6MA 2JJ1G 1HC7A 2O2IA 3IKMB 2IIQA 1W5FA 3CB4A 3QXXA 1KP2A 3PYXA 3LP8A 1PYOA 4MTXA 3KZ1E 4OGKA 2ZXWB 1CB0A 3ENVA 1CUIA 4EW3A 2AOUB 2VG8A 1F14A 2JLSA 3ZCSA 4J0CA 3FOCA 2I2FA 3L8DA 4F46A 2YJ4A 2IU6A 3R3UA 2ODNA 4NLLA 2GARA 5LZ2A 1UIRA 4WUVA 1MOQA 1B4DA 3EEQA 4BLQA 4LJKA 4XYBA 4U7TB 2YWBA 3OZGA 1ZPDA 4M21A 5CDFE 4ZK6A 2DRIA 4MGEA 2Q6OA 3A3OA 3K94A 3GAAA 2H3EA 3NHUA 3TGUH 2EGUA 1SAYA 4B3JA 4NG5A 2ZUEA 4CC6A 2IU3A 3AM1A 4EUSA 4BR6A 1C5KA 4MLPA 3AETB 3UB2A 2G88A 4LJ7A 1HZJA 3IDFA 5FP0A 1PHRA 1ZIYA 3TWOA 3IAHA 3T95A 2G77B 4S1NA 3FFAA 1I4DD 3ZOKA 1NF2A 1E99A 4R7GA 4EHBA 3OR7C 1MPXA 2FPIB 1GRRA 4C08A 2OO5C 1VE3A 2I9KA 3LV8A 3ITDA 3HBJA 4J43A 4RQBA 2P4VA 5L6MB 3NHSA 1Y34E 1TEHA 1NJSA 4ZDIA 3FRIA 1E3WB 3I5XA 1QG6A 1E9BA 4IGAA 5LMUO 1KDYA 1JD1A 3DDOA 2Z5UA 1DTEA 3WGVA 3WHLA 3COSA 621PA 2NZJA 4KYVA 4KAJA 4EAQA 4C22A 1ZGJA 2LVBA 3EVTA 2WKRA 1EZZA 4WOCA 5BUSA 1OY1A 4G2TA 5HK8A 3W8NA 3GJ4A 3B6IA 4FPPA 4AZWA 4X7RA 1DGSA 2NNUA 2XE4A 3AQ4A 3CC2V 2FXVA 5DECA 2IYVA 2VBCA 3ETNA 5AOCA 1RAFA 4MGHA 2ODBA 4KIUA 4FE4A 3DHVA 3OLQA 4DQUA 4RF2A 1PYGA 4R40B 4XLZA 1R0CA 2XYPA 2FP4A 2VPIA 2EHDA 1WBBA 5J9FA 2NGRA 1Z0IA 4D6YA 2O19A 3BOSA 1Z5NA 4H3HB 2DP4E 3FJOA 3EIEA 2GUZA 5K3CA 4ARUA 4LYYA 2EQAA 3W77A 1CHNA 3GZNA 5DKFA 3ZCPA 3VOSA 1K9MW 4GX0A 1XMIA 1RZVA 2BDEA 1S0UA 1P0CA 1PX2A 3KKQA 1ZKMA 4D26A 1BCCH 1VQMF 3N1UA 2X6BA 2BKVA 4XUDA 3L6UA 5AIBA 2IYPA 5IBRA 1W8DA 4UHKA 4F9EA 4DIBA 4ZCSA 2M9MA 2ZIFA 2GF9A 3SZGA 4AMBA 4CG3A 2DMXA 4YN3A 4HQ0A 2AW3A 5HQJA 5LQCA 5JJ5A 4MS3A 4Z4GA 1LTQA 4AYXA 3UEOA 4A8PA 2OHFA 1HLDA 1IZ8A 4KPUB 4Q9LA 4MQBA 4QPNA 5LZ9A 2X2FA 4L8VA 3FHOA 3SF0A 5KVSA 5LNK6 2ZPAA 3LCUA 1HFJA 4CQMA 5EZ5A 2WAAA 5JARA 3K0CC 4DLZA 1P4HA 2AEEA 4JAAA 4Q19A 1FFHA 1W30A 2GASA 1F4PA 3DULA 2PVSA 3H2SA 4GL2A 1M83A 3I23A 4NABA 5FJIA 4MVUA 4G09A 3UATA 3DE6X 1EVLA 5AI9A 3CCMF 3K70D 1TIKA 1VHLA 1U9CA 3OMAB 4MVJM 4CN8A 1TF5A 3GJQA 2ZE6A 1G8AA 3QJ5A 2EQ5A 5B3KA 3ZD8A 5DTQA 4D02A 4Z51A 4LJSA 3DE5X 2LPMA 1Q0PA 5KQGA 1SBYA 1KMHA 1EBFA 1ZK2A 1RBMA 1L7RA 2D59A 4Y67A 3EQ2A 2ZDGA 1C1DB 1Q57A 1KDTA 3ZTTA 1ZD2P 1EP2B 2GEVA 3RARA 4E21A 1BC5A 1KKMA 2YRFA 3UOGA 1DXQA 1I9GA 3M4NA 1VLMA 1FP7A 2X4GA 1KI9A 2VWJA 4BE4A 1QR8A 3ABLC 3WLEA 1THGA 2ZATA 4EARA 4Y2TA 3PI6A 4JVOA 2XT9A 1Y9JA 1QAHA 2UUAB 2CHEA 2WIAA 4ZKDA 1G3UA 3CH4B 5JSUA 3JWJA 3S1SA 2ZUWA 3HN2A 4KI7A 1V37A 1SVLA 4CM9A 4RS3A 1P73A 3C3TA 4PTLA 1KTIA 2PZFA 2QE6A 4H13B 3RT3C 4RMNA 1Z6YA 1P7BA 3MJTA 1XQXA 3F8SA 2GWHA 3WGQA 1K63A 4WH0A 3FTEA 3DBIA 1NN3A 1TTQB 3RRYA 1XRQA 4RK6A 4KGXA 2NUTB 2C2OA 4PN7A 3QEAZ 1CZNA 1V8ZA 4U9IS 2P27A 5EWMA 5REQB 4Y1RA 4Q39A 3DVAB 2AXTZ 2PSDA 1O97D 4PR3A 3EEFA 1Q19A 4G23A 3COVA 1A8IA 5D5QA 2B7LA 2CJPA 3OD1A 1F8YA 2PQ0A 2R6R1 1VF7A 3DAFA 4ZI7A 4C05A 1FX0A 2BBOA 1YKGA 2QM3A 1TI7A 2J1LA 3LBNA 1T5HX 2Q7XA 1H8HA 5KYXB 3J7AR 2YHIB 4YXWA 4R8LA 3FNGA 1H2MA 3H86A 1XI1A 1JH9A 1S8NA 2VJOA 1RQGA 4IO0A 3DV2A 4UE6A 1AQ6A 2I78A 1YO6A 2CJYA 1H5UA 4OXIA 1MO4A 4K6CA 1V41E 3HFJA 3NDIA 4ATNA 5KOJB 3ZCVA 1SXHA 1K3UB 4BTEA 4Y2GA 2ZIXA 4J9VA 3LL4A 2IJHA 3RKSA 4XPIA 2ZTVA 2QL7A 1F51E 2FFQA 3AK4A 4OH1A 1AD2A 4YT5A 1N1EA 4MVCA 3BWYA 3OP4A 2V4ZA 1U5AA 4JFAA 5EHXA 3TNLA 3EMDA 3CVVA 4JBGA 4ZOEA 2VWPA 4ENQA 2EAUA 1YQTA 3CCUV 1GNQA 3CWCA 5TMDA 5EHIA 4XD2A 3NHZA 1QGOA 3PXEA 2HBQA 3CT6A 3LC2O 3PI7A 2ZRBA 5AVRA 3NP7A 5I9BA 2HH9A 4YRGA 1IHPA 1K3TA 3BX1A 4MWDA 5IPFA 2NVWA 1N3YA 5BRNA 2Q9BA 5I8PA 3GR6A 5D85A 2D2XA 1PJBA 3OFJA 3QRWA 2Z5GA 3P4EA 1XCBA 2GILA 3ET5A 2HNAA 3LKDA 2XV1A 1W0CA 3CSSA 1T9BA 1XTUA 3LHKA 2R8EA 3P5BA 1BX3A 1ANKA 4XB1A 3G17A 4WKNA 4W6QA 4ER5A 3GLVA 2PYIA 1V1RA 4N7JA 4UM9D 3AEUA 3TLYA 4N18A 3IILA 1C8BA 1FTGA 1DUSA 3NAMA 3DD1A 1A9YA 4NCAA 1E1QD 1D5WA 4AX8A 4E4RA 2QUAA 1ONOA 1KS2A 2P4HX 1WULS 2RC6A 3AJ9A 1XTIA 2HHAA 5M34A 3X1JA 2JDIG 1U9IC 4DV2O 3C8MA 3SE0A 2AE2A 1XQWA 4YWHA 5COAA 2BEVB 1XCMA 1PWZA 4CV1A 3D54A 3OKAA 2F8MA 4NZPA 4HRYA 1ZZEA 4BMZA 1JJFA 2J3KA 4DCSA 3ED5A 3ECCA 4UE3S 3STZC 4PHFA 4BQIA 1FBNA 5KOHB 3CJQA 1T2EA 3MAJA 3GLKA 4REMA 3T1VA 1RKBA 4XSVA 1FNCA 1LW7A 4ZEXA 3X2QC 2BHSA 2INGX 1STOA 1C3OB 1CXZA 4QU9A 4QEKA 3WIEA 4LISA 2RH5A 1F2TA 1VGRA 2W8BC 4NCJA 3B6EA 5FPSA 3E23A 3H9CA 1IJEA 1MGOA 3CRVA 4F8JA 5C1BA 4O1MA 4DR2B 1N9GA 4UTNA 4A91A 1XOIA 4MUXA 1O94A 4L9WA 2BR4A 1VPDA 4TWBA 1K5SA 2IA5A 2IH1C 3E9CA 3I01M 2OP1A 2WZBA 3QJGA 3Q8WA 1KVQA 4KRGA 2HMAA 4DR6O 1T8TA 1W36D 3FVRA 1BSVA 3HH8A 2WLKA 3AHHA 5KCMA 2FDRA 2JCSA 4BE9A 1P18A 4LY3A 1KOLA 4E03A 1KI8A 4WVFA 1QLEC 4TRMA 5ALKA 1L8LA 1S01A 2G3YA 3DT9A 4KYTA 5SZKB 4WJKB 3E35A 4Q93A 3UMGA 3U1TA 1H1DA 5FF9A 1H2AS 3RYFB 1JI3A 3HUTA 1E2NA 1NDQA 3ONEA 4QFCA 5JAIA 4QJIA 1XDBA 4I50A 1ZRMA 2G07A 1UPAA 3NATA 5KBYA 1H42A 4HNGA 3L0DA 2FR0A 3IMKA 5AVXA 1A5TA 3WGYA 5LQJA 4DMCA 1DWOA 3GJTA 2DKOA 2AC2A 4UBKA 2H7YA 2GB4A 3T5DA 1JDUA 1YZKA 4RL4A 1COWA 4ZYZA 4KR7A 2XH8A 4YT2A 1H6BA 2E0IA 3GI1A 4HUJA 2BE3A 5M5BA 4DY4A 4FYVA 1AJNA 1JDZA 1O5IA 2GO1A 3FYUC 3COYA 1XZCA 3K9AA 4M1YA 1TXGA 4Y0AA 2QN8A 4DJTA 5F64A 3UAWA 3ZXUB 1FPQA 3MDSA 4RANA 1M2KA 4G84A 1G60A 2JD0A 1LBTA 3NB0A 1CRWG 3TIFA 3F98A 5FBKA 2YEVB 1OC2A 1N33B 3CX5F 2CCJA 3KXDA 3ZNPA 2NG1A 4YRLA 4LY0A 4LRSB 4KRFA 3IV9A 4FCCA 5AJVB 4YQZA 2FZCA 3S8EA 3BWBA 4KQ1A 1M66A 1DTWB 3PRKE 3ORSA 4ZXFA 3BF7A 2NPFA 3SIRA 5KX5B 2I7XA 4TKLA 3CYQA 3SIUA 2V7GA 4C0HA 1FLAA 3Q8MA 1FPMA 1GTVA 3D0KA 3EXHA 1MDBA 4H59A 4ZHSA 2RK4A 3A36A 5F98A 5DM60 5I8WA 1T9HA 4A27A 4NTZA 2ZAUA 3KWMA 3BC1A 5FFMA 1A9XB 2O5EA 1U98A 2DT5A 4LBEC 4ND8B 4UMDA 3KKNA 4IIBA 1OXSC 3MYYA 1UQTA 1E92A 4M9XA 1EX9A 4P7JA 1XZFA 4M55A 4U7NA 4UOZA 1EWRA 1E96A 3GWKC 3DBVO 1S9HA 3R6GA 4PNPA 4WCFA 5ADVA 2PT5A 3PNSA 3I05A 3ZC3A 1NY6A 4JJAA 5L7TA 1N6IA 5DI3B 4B46A 2OHJA 5AVVA 4EY8A 4J90A 4KO4S 2Q5JA 2ZSJA 2XXJA 1O87A 4ME6A 4Y0NA 2OBYA 3HR4A 3IAM6 4YYEA 4JGSA 1G55A 2Z1TA 5FL7D 5EXPA 4IDGA 5FBZA 2B8TA 5BQOA 3ZBQA 4RC9A 1ADFA 1U5BB 2EIHA 2OKGA 5CBKA 3ZD6A 5PNTA 3Q87B 3U3KA 3K1YA 3KYDA 3ESRA 2EFEB 3PT9A 1JQDA 3C4QA 1UDRA 5IKMA 4ER3A 4R1OA 2QYTA 1FCJA 2WLJA 3G89A 5T4FA 3ZZNA 1JFSA 3HGTA 2BHLA 4FVTA 3K05A 2HXGA 4I7EA 3I64A 2P4EA 3W7AA 3TLXA 2IIVA 3L77A 3K2XA 5LQMA 1N1DA 3KCQA 3B1YA 3HVKA 5DX1A 2JIRA 1VI2A 1BMFA 2C5HA 3HCFA 4CI9A 2JHAA 4JMLA 4MHTA 2CCKA 3A6LA 3ON5A 2EATA 4F5EA 5FA6A 2NUAB 3R4CA 2BMEA 3NEPX 5B6JA 3EAQA 3G0GA 4E2FA 1IV1A 4D4IA 4C2UA 3VU3A 3FDIA 4Q3EA 1BD4A 4WDQA 1NXQA 1AN9A 4ASUG 1IC6A 3B40A 4JWTA 3CHYA 5F9MA 1NXXA 3EAGA 1NU8A 2O8DA 3VZBA 1O4VA 1YDXA 2RGCA 4PZEA 4QJ5A 2X0DA 2WAYA 4QWWA 2OM6A 4RK0A 1QTIA 4DEVA 5JZSA 5IMBA 4CDRA 4QTYA 3MBIA 2TSYB 3VO2A 3VDNB 3U4IA 3IP1A 3QWFA 2QVBA 2QE7D 2P6YA 4KX5A 3Q9UA 5IJ0B 1G8GA 1TJ3A 4Q3LA 1YCFA 3CUVA 5DGDA 3TMKA 1Z28A 4KFTA 4MUMA 4GOJA 4NC9A 4EJSB 2QT0A 3K2EA 4LWPA 1BS3A 3W7BA 4BC0A 1E7SA 3L18A 3NLLA 3A9UA 3OURA 2LUOA 2OGTA 3WXBA 3GFBA 3K30A 4A0SA 2YNMA 1C30A 3ZDXB 5BPHA 4U9UA 4C9BA 3D3JA 4LHSA 2JFFA 3OKFA 3HWX1 5KTKA 3HTNA 3P96A 3QF7A 4RBNA 3TJRA 4MI1A 3FMOB 2HA5A 2CBZA 2HGZA 4WXPA 2ECKA 3PPYA 4N8DA 2HRCA 3DEZA 1JAIA 2RGNC 1W5AA 5J1SB 3G7NA 3GUZA 1DLIA 1LC3A 5ERYA 4ZPJA 2GAAA 4LRWA 4F3RA 3M1YA 1B73A 3F90A 5JXHA 4MQ4A 1D0VA 2R8BA 4J1TA 4DA4A 5CX1B 3GF4A 2H59A 4N0DA 4J0IA 3VOTA 3LHSA 4OFZA 1Z6TA 4P2ZA 4NZYA 4N0EA 3C98A 2G9QA 3I0NA 5BSUA 3CX3A 2GV9A 1CUVA 2O8VA 1YS1X 2P79A 2Q3CA 2L26A 4H0NA 3QHPA 1VLJA 3L1HA 2B83A 3WB0A 2BFAA 4JU8A 1YSCA 4F93B 2VAVA 3GO4A 3FCYA 2BEUB 3A1DA 4ND1A 4ZA2A 3VR5A 2IBSA 2X42A 1XVTA 1E0DA 1FTQA 3H9JA 3A37A 4ZN6A 3I1YA 3A9RA 4GECA 2M6SA 4D6XA 1PJCA 1VMAA 4HDOB 3NTQA 1JHMA 2CYCA 2VGMA 4PZUA 2MINB 2CXQA 3VYUB 3ADCA 2AOUA 2HWUA 3L04A 1GG8A 1M57C 4E11A 1OW3B 1ZD8A 2H5IA 2GKGA 5LR6A 1OPXA 4MQLA 1W75A 3K6JA 2I0FA 3O8CA 4BKMA 4FMPA 1E2BA 1K2VN 4XIFA 3CC2F 1DQRA 4CS2A 4TVOA 4MH0R 2HJRA 5IAAA 1GO0A 5B1EA 2VCYA 2C03A 2CDNA 3JQQA 3CWQA 4L85A 4RVFA 2PCJA 4OLAA 2WWIA 3ASZA 4YUWA 2VLBA 3AETA 4JBNA 3IPCA 1KDRA 4NYJR 1K5HA 1N34O 4LWQA 1IXKA 3MBMA 2NV6A 1TIBA 2PZJA 2J33A 4HGZA 2FPIA 3WRXC 2WKWA 3E0QA 4ZTZB 1GKIA 4MEJA 2JFZA 3BUSA 1Q7GA 1SQ0A 2ORIA 1NF8A 3D1JA 1KDZA 1XXHB 4QUHA 1E3WA 2C42A 1KB9F 4BUCA 2FUKA 4Y7DA 4K9PA 3I7TA 5A06A 4Q16A 1BGXT 4DLAA 2XGSA 1JLSA 2GEFA 3I55V 3DTNA 4OQNA 5JZ9A 1MUUA 2GXQA 2Q29A 3RAEC 4E1AA 4FX5A 2ZQYA 4FHGA 1QHYA 4K1LA 1OYYA 5ISMA 4LRUA 1TLLA 1FY2A 3UY4A 3UH1A 5G1OA 5A9RA 3ZDRA 4LXXA 3ENZA 2FR8A 2HMWA 3I01A 2GYUA 1NF3A 2C0PA 4B48A 1F0YA 4WKPA 4KFCA 1Y5LA 1YTFB 1ORRA 4F4JA 1AXRA 2SCUB 4GMKA 3H97A 4IIDA 4PICA 4A82A 1KR5A 1F20A 2FXIA 3MC1A 2C8VA 4W63A 3SHOA 2RGRA 3UJBA 1LSJA 2JLAA 2JI4A 1E4YA 1FJ2A 1JTEA 1GKYA 2O4CA 4H08A 2XRFA 2QQFA 4EDFA 4QASA 1WQ3A 2ZBFA 3K5IA 4MLZA 2LBTA 1QCDA 2R1VB 3SQLA 4JLNA 4Y0VA 1SC4A 5F1KA 4GMXA 3GEPA 3OTGA 5K1XA 2FUEA 3CCSF 2REXB 3OOJA 3W04A 2NU9B 1Q86H 1X7WA 2QL6A 3BMCB 3IAAA 3EHEA 5SZJA 1B26A 3IELA 1B04A 4HFRA 3U40A 4FOTA 5IAOA 4ZVSA 1C9DB 3IRUA 4DV3O 3BCHA 1GAEO 3QTYA 2DW4A 2V74B 3EARA 2ZOVA 3DKPA 3LYAA 3QLVC 3UMRA 5KWVA 4G4JA 1XU9A 3RS8A 2HCRA 4IWYA 3T54A 3LECA 4KPUA 3F5DA 4EYEA 1TO2E 2AQ8A 5ALEA 4FLMA 5ARDA 1XK6A 1J09A 4A8JC 1N6HA 1E2KA 3DLIA 3D6UA 4EA9A 3IDAA 3A1FA 2W83A 3SYNA 2FPXA 4GP7A 4N8SA 1F60A 3IA7A 5B8FA 3LW8A 1ZAKA 2J6CA 4XVQA 1VMGA 3CCEF 2WLTA 1GT91 1H69A 3HYCA 3D7RA 2JEZA 2ZRCA 3RU3A 2R8RA 1A8HA 4C4AA 3KHNA 1U0NA 1OI2A 3PUVA 5LOVF 5JSYA 4FYIA 1I2DA 1PLJA 3F6CA 2M6LA 4DR5O 1GGVA 4UULA 1PM9A 1YZUA 3F4LA 3V2GA 1XLTA 1F1BA 1Z4QA 2P7TC 3WK8A 3NGXA 3WI7A 1N2ZA 4M98A 1AIPA 1Z15A 2H57A 1C1DA 1Z8HA 2XB9A 5AM3A 2LCAA 3G79A 3ZDQA 1EK1A 3RS0A 3AESB 1KJ8A 821PA 3FNQA 1FK8A 4WOJA 3U3ZA 2C84A 4QGGA 1SZPA 4BLPA 1SC5B 1H3FA 5AW9A 3JCZA 3UJCA 3MGKA 4WNYA 2XGGA 2FMXA 4EHJA 4PG6A 4ILEA 1DQSA 4BX9A 1J9GA 1YJBA 1XKLA 1Q50A 4Z4FA 2BFPA 4QPJA 4UVIA 2OZLB 4G56A 1J7HA 2Q3MA 3GBPA 2VAPA 3DOCA 5AG2A 4MCJA 3U4HA 3E1KA 4Q00A 4TKZA 2XYRA 3CLSD 3H5LA 3K0FB 1WXHA 2VS0A 3V33A 2X40A 2IYRA 3FTQA 3Q7EA 4PZLA 2JK1A 3I92A 4A5OA 1BSMA 3PC2A 3EF1A 4LSZA 2QUZA 4G36A 3K09C 4S2EA 1XMXA 5AKLA 4RD1A 2DQKA 2PV0A 2MMCA 3RVQA 1JAYA 1MJNA 4ITVA 3OQMA 1UANA 1OYWA 2JK5C 1RRMA 3E3AA 3ACCA 1Q6ZA 3NWEA 2O0HA 1ODCA 1R74A 3AFGA 2OV8A 4XM2A 1HE1C 1EZ1A 1Q6IA 5AVYA 3JQAD 4P38A 2BV3A 3C45A 5C9ZA 2FPGA 3DVAA 2FUG1 3OIYA 3T4EA 1PYDA 4BO9A 2JVDA 4FDTA 3O3OB 3VU8A 5ALGA 1XCLA 4TV8F 2H9AA 4DPLA 3ZIAD 1MC8A 2L82A 3JQRA 1WVGA 3CCUF 1PHPA 5EIBC 4V2UA 1DKRA 2R70A 2DSTA 2C7PA 5KWIA 2VJDA 5KYXA 2YHIA 2LE0A 1U8UA 1JIQA 1MVNA 3UK6A 3SEZA 2ZTLA 4QICA 3GTZA 4N5DA 1DMRA 2R9AA 5AH0A 5F35A 1L3BA 2F67A 1NXSA 3O5AA 3JV7A 1NVFA 1G20E 5KOJA 2WP0A 4RQFA 3G6EV 1IEWA 1U80A 2XADA 1TQ6A 4G0MA 5DO9A 2PD4A 2HNBA 3M5WA 5BSRA 4EGSA 2PR7A 3TCKA 4HLUA 4RQAA 3A2FA 4C8EA 4BVGA 3RO7A 3WGIA 1GNVA 4N65A 1OWMA 3IVMA 5C4IA 1X3LA