3JALB

Cryo-em structure of gmpcpp-microtubule co-polymerized with eb3
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 150
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jalB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jalB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jalB01
1RLUA 5LOVA 4TV8A 4KWEA 2R6R1 3JALB 4X1KA 5M7EA 4O2AB 3RYIB 4LNUB 1W5EA 5IJ9B 1TUBB 5KMGB 3R4VA 5JCOA 4EI9A 5MN4A 2RHOA 4O4LB 1SA0B 5JQGB 5LP6B 4ZOLA 4IHJA 3HKCA 5FNVB 3WGJA 5CA0A 1RQ7A 4U39A 2XKAA 5JVDB 4I4TB 4DRXA 5ITZA 4TV8B 3WGKA 2Q1XA 4E6EA 3ZBPA 3ZIDA 5BMVA 2VAWA 3HKBB 3JASA 5IJ0A 4EI7A 5C8YA 4WBNA 2Q1YA 4ZI7B 3N2GA 5J2UB 3UT5A 5KX5A 1FSZA 3JATA 5EYPA 5JH7A 4YJ2A 3HKEB 3VOBA 4IHJB 4O2BB 4I55A 4F6RB 3JAWB 4FFBA 3E22B 4EB6B 3JAKA 5EZYA 4O4HA 4O4IA 4O4JA 4HNAB 5LYJA 1W59A 5CA1B 5BMVB 3CB2A 3RYCB 5C8YB 3WGNA 3N2KA 2BTQA 4WBNB 4DXDA 5LA6A 2VXYA 5CB4B 1W581 2RHLA 5EYPB 4TV9A 5LOVB 4X1YA 4M8IA 3VOAA 1Z5VA 4I55B 4X20A 2RHHA 1W5BA 4X1KB 5LP6C 3ZBQA 4FFBB 4I50A 3JAKB 5EZYB 4O4HB 3RB8A 3RYFA 2GVIA 3RYHA 4TUYA 5IYZA 1FFXA 5LXTA 2VAPA 4YJ3A 4B45A 4ZOLB 5LA6B 4ZHQA 3HKCB 5MN5A 5CA0B 3WGLA 4DRXB 5ITZB 3JALA 3VO9A 4XCQA 3JARA 3RYIA 3JASB 4X20B 5IJ0B 5GONA 5IJ9A 1TUBA 1OFUA 3N2GB 3UT5B 5KX5B 1JFFA 1SA0A 3RYFB 5JQGA 3JATB 3RYHB 5JH7B 3M89A 4YJ2B 4TUYB 5IYZB 3VO8A 1FFXB 5LXTB 3WGMA 4ZHQB 5MN6A 1Z5WA 3HKDA 4X1IA 2RHJA 5JVDA 4I4TA 1W5FA 4O4IB 4O4JB 4IIJA 5LYJB 3HKBA 1TVKA 3JARB 4U3JA 5GONB 3N2KB 2BTQB 4ZI7A 5J2UA 1W5AA 4B46A 5J2TA 1JFFB 3HKEA 2XKBA 4TV9B 5EIBD 5JCOC 1RQ2A 4O2BA 4F6RA 3JAWA 4X1YB 4O2AA 3E22A 4EB6A 4LNUA 3HKDB 4X1IB 4EI8A 2BTOA 5EIBC 4HNAA 5KMGA 4I50B 3VPAA 3V3TA 5CA1A 4IIJB 4O4LA 3RYCA 3C8LA 1TVKB 2VAMA 5LP6A 4U3JB 4YJ3B 2R751 5CB4A 5FNVA 3M8KA 5J2TB
chains in the Genus database with same CATH superfamily
1T9CA 1GARA 1O96A 1PGOA 2SNIE 1O95D 4MRRA 4E32A 2HPVA 4IMRA 3ODGA 3NTUA 5JC1A 1I1HA 5KSPA 3IAS1 1CJKC 1XAGA 1RM0A 3OHSX 3PFKA 3PUZA 3P3PA 1N1DA 5BY1A 2E85A 4EB6B 1KO1A 1H2GA 2FAXA 1RMQA 2BHTA 1RM1C 4LZJA 2XBUA 4BO5A 4F04A 3HEBA 3P94A 1PTJC 1YQDA 1VQ1A 1S2IA 3OWHA 4CQNA 3MXTA 2EV9A 4N82A 1A9RA 4LHSA 2YFHA 3K14A 5TJHA 2WG0A 5I3CA 2JD0A 5A7GA 1N1GA 4YJ2B 3CM0A 3FD6A 4EGSA 1V96A 1IXKA 3I3OA 3FWZA 4KR3A 1OKKD 1J0AA 3JVIA 4CM3A 3H9QA 3HVIA 2AGAA 4YCNA 5DECA 2QJWA 4KNVA 2ZXEA 4O2AA 3ZZ0A 2JHFA 3E8HA 2XT6A 1XTKA 3PA6A 2IZ1A 5FHQA 5KOJA 1J49A 1FSFA 4UHDA 4YXWG 3QPCA 1ZD3A 5L8VA 2WBLC 4OJNA 1W6UA 1EVQA 3WRXC 3ANMA 5EJ5A 4NBUA 1Z15A 1EK0A 3N6VA 4UTVA 4WK4B 2DC1A 2QY9A 4MJ3A 4IZ6A 4HJXA 1YBHA 3X2SA 4WF9V 4CIWA 1NI4A 3H9CA 4PXSA 1EDEA 2IOQA 3G13A 4S1NA 4A6EA 5G0UA 3IDSA 3ZTWA 5HXAA 2BM0A 1TQDA 3H1PA 4NI5A 4KSYA 5TNXA 3L75H 2EFGA 2XITA 5F64A 1R15A 5DM6V 4PWZA 5JANA 5DGHA 4ZCPA 4YCCA 3HNRA 4WNAA 1ZKMA 2E3CA 4FLVA 5B7PA 3GAMA 2EKLA 1UT6A 3I6QA 4ZN6A 4WCVA 1GZ6A 4CN9A 4KODA 4LGYA 3RS2A 2GFQA 1NZDA 2CJPA 2QMUA 2JIDA 1Z0SA 5IJ9B 1P5JA 5ECWA 2D1YA 1YBFA 3CH6A 2ETNA 3F3SA 3JR3A 3S8YA 2E3JA 2HDWA 4Y2PA 4ZCQA 1VHDA 4WPGA 4XTCS 1CCWA 3I04M 2PE5A 5CU7A 1V54B 1Q86W 5KHJA 3TJRA 4KL8S 3NKFA 3KCXA 2AHOA 3K94A 3N2LA 1N0UA 4ZI3A 1TZMA 1M2OB 5T41A 4E12A 2DR0A 1PN3A 2RGNC 2HX1A 4CLRA 1DTOA 3H05A 1Y66A 1MQAA 2QLJA 4FGUA 4OKIA 1OH5A 3M6WA 3IQHX 3A7DA 5ARBA 1MX3A 4DV3B 3S7TA 1R6BX 2F23A 4AKEA 4YQFA 4PZPA 2H4JA 2P8SA 2J59A 3V4VB 3NKLA 2BUAA 4GHWA 3GJ6A 4B7CA 3WIEA 3FYUC 2P9JA 1L4NA 5FJIA 1AK9A 1QB8A 5D86A 5KAMA 3G2HA 4RIGA 3BXZA 2QS9A 4H1TA 4JTCB 2CMFA 3DZIA 1DQRA 5B2ZA 3TFOA 3ENKA 3RVJA 2Z04A 4FQ7A 1V3TA 3CN7A 4J49A 4US0R 2AWOA 1TGYA 5KU7A 1QR9A 1PSWA 5K8CA 4WFJA 1XZMA 5DOZA 4G3XA 4FYJA 3DCIA 3JD0A 1EB8A 1PV2A 3BE5A 3A0RA 1H8EA 5A1JA 3KFLA 3D59A 2NTYC 1YRBA 3TS1A 3HGQA 1X7PA 2V9CA 3HH8A 4OPAA 1I7NA 2W83A 5EZSA 3WWOA 1CY8A 3F9CA 3L8GA 3F7YC 1VMAA 4M88A 4X65B 1H1LA 2OXEA 3FSGD 2A79B 1JG2A 1VJDA 3ESBA 3K9HA 5A3JA 3FIJA 1TA8A 4DLPA 5C32A 1V8BA 2QTVB 4BCBA 2Q0OC 3LDDA 4CKCA 1IBMO 3EODA 3OLZA 5IAAA 3AJDA 4FWBA 3IDOA 4Z54A 4X3LA 2RG1A 3T35A 1ZJJA 5CVEA 4TL6A 5EERA 3QELB 1TEXA 4DG5A 4PINA 2FZWA 1A2BA 3R65A 2NZYA 1QM5A 3LHSA 4KYUA 4RMHA 2OCAA 3LL7A 4C0HA 3TOSA 1V1RB 1NF3A 5FP0A 2YV3A 5C8YB 5U9CA 5FYQA 2VA9A 4YJKA 3ABRB 3C70A 4Q21A 1F8YA 3NNNA 1ZVVA 5LVAA 4R2IA 4HAYA 2BLLA 3A4YA 1X1TA 5FPQA 1NN1A 3V7FA 1Y4ZA 2DTXA 3DL2A 1VA5A 2OKCA 3UFXA 1NL3A 4L4YA 2QPLA 4MQ4A 4B3GA 5EMMA 5LXTB 2ZT9B 3LBYA 4KWIA 3O3NB 2DULA 3AF6A 3PP8A 2ZWAA 4B7XA 1VQ5V 3RTAA 4DCSA 3C6XA 5D3KA 3AO0B 4RZIA 1UPXA 2QUHA 2HYIC 3OTFA 2HHLA 5AT1A 4YDQA 1GTL1 4Q4AB 1QIEA 4M21A 3Q7SA 4YUAA 4Q66C 1J0BA 1Q22A 1SUCA 1SKMA 5JSFA 3GEIA 1AP5A 2AFHE 3IHKA 3C74A 4BO0A 4HFNA 4KUHA 4KW7A 3T7IA 3OW2F 2X0JA 5B36A 5IK2A 1C2YA 4OLAA 3NO4A 4J29A 1MFZA 1ZSYA 2XUGA 5CAEA 3QO5A 1EZJA 4WXMA 4UKDA 5CNJA 2DEUA 4E4RA 5FA5A 2GX6A 2NTEA 4OXNA 1D7OA 1PL6A 2N9UA 3FGNA 1H42A 1JDPA 4LJLA 3BJZA 4M9ZA 1CQWA 4IEEA 3WLNA 2IF2A 3GZTB 5KZMB 1WOYA 4ZK7A 3KD2A 9LDTA 4NBWA 3HA2A 4GE0A 1AVTA 3F5DA 2Z5VA 1YZLA 1XO1A 1PE0A 2KB0A 2RONA 2Q3MA 4HBZA 2DFDA 5IYDO 1R5NA 3FUUA 5T4EA 1NT4A 3RO7A 2W2OA 1MA1A 2HC9A 4UBKA 2KI5A 1QSGA 4XFDA 4NU6A 1QHTA 1HG1A 2ZVZA 3NBQA 1Y7TA 3KT6A 4JAUA 5KSWB 4C5CA 1TFRA 5JCZA 2CB9A 4AY3A 1A77A 4A15A 1DXQA 3SPCA 3UJ3X 3GGJA 3APQA 1K5DA 4YRIA 2H31A 4X85A 3M4NA 2E4WA 4EPWA 1BVUA 1RSOA 3RFXA 1L7AA 2AUTA 4PG5A 4YFVA 1RWVA 1QV9A 4KK3A 1NSYA 1ORQC 4QG3A 4FR0A 4DR4B 1D6SA 1GLGA 2AG1A 1NJIH 3CPJB 2YR0A 3PC8A 1XCLA 3JY6A 3VZPA 5DYNA 4D9HA 5FX2A 5LJLA 2O05A 2C9MA 2O5VA 4OGFA 4U0KA 2X13A 2PMEA 1C9NA 4RLSA 4EW1A 2H9YA 2PKXA 3K0CC 4EFNA 1FLAA 3WNQA 3H84A 3TG8A 3EEBA 4L8FA 3ZY6A 4E6EA 3KR9A 1C7RA 4UZFA 3F0TA 3QU5A 4X45A 3T7KA 1S1CA 3LUDA 3O0TA 1X7ZB 2HS0A 2WT4A 4HYTA 1F5NA 3Q9NA 5G1OA 2YL2A 4DCMA 2ZYTX 3P9ZA 1L7MA 4DDKA 1X3SA 1UBGA 2PR2A 3MBOA 4EMTA 3D2CA 4YP7A 2OLJA 5REQA 1OCZB 1M67A 4YJ2F 4IXWA 5EE9A 2H54A 4FNAA 4RK6A 3CXCU 3ITNA 4N47A 3PUVA 4ZDKA 3KSRA 5JCJD 3IMFA 3IT1A 2RJOA 1G21B 1U0FA 1ZVJA 2VRNA 3GRFA 2QGZA 5KQPA 4X3MA 1ZWLA 4JJAA 4TLMB 4UTZA 2G77B 2FR1A 3PUJA 1GKIA 3E3OA 3VKGA 1Y5IA 2R9AA 1JAIA 4YRQA 1WPRA 4IS2A 2DHQA 4D8TA 5K99A 4G28B 2G5GX 3KS9A 3DMYA 4CI0B 4LC9A 2CLIB 2Q4BA 3FOBA 3A3OA 5TPWB 3UICA 1KNQA 3K03A 2EW8A 4CDMA 4BGUA 4OP1A 4ZO7A 2QRVA 1A7AA 1NRXA 1T10A 2P6NA 4U3FH 4X91A 2JBAA 1H65A 1N2CE 3TL6A 1YS7A 1NV9A 5BOSA 5DYTA 1S2GA 2JS7A 4MWDA 4FDUA 4M8IA 2RH5A 3TG2A 3CS3A 3QO8A 1SWWA 2R7NA 1NAIA 4E1BA 4ZU6X 3STLC 3DE5X 1KP9A 1MOPA 4DB4A 1HGXA 2OUIA 1FDSA 4PX2A 5HFAA 3UXMA 2O3QA 1WDWB 2POQX 4NYJR 1H0SA 3HB9A 3RV4A 3DV2A 2B1RA 3LZDA 5IDQA 1KGSA 3W7XA 3D3IA 5JJJB 5EE0A 4EI8A 5KOYA 2R6AA 4NULA 2ZI4A 3W5IA 1L5LA 1FTYA 3E23A 4BIOA 2GZ3A 3ZRWB 3EFFK 3NQ41 1SESA 5C8XA 3FVVA 5ERYA 1GSIA 1E3MA 3JASA 2W6NA 3IXQA 5IUKC 3ANTA 3GVMA 3EB9A 2HOQA 3JCUZ 2PIDA 3COVA 4HEHA 1VRWA 3X1JA 1M56B 3B53X 1UDWA 3DDSA 3PNSA 1G9TA 4HUTA 4AF8A 3DLHA 4WFAV 1VCMA 1EDDA 1GP2A 5L4LA 2A0UA 5G2OA 4U2BA 1VE3A 4PDRA 2ADFA 5BWMA 3LY5A 2WJVA 1T3GA 3MCWA 3RN4A 2XCTB 3L43A 4Q9AA 3Q1LA 1LZLA 1SNYA 4OHKA 1PDVA 4AJJA 2HU5A 2GF9A 4RS4A 3VPCA 1E7KA 2NXWA 2FUG6 3E53A 1UKYA 5K09A 1RZUA 1JKXA 2NTNA 3GJRA 4RULA 3MT7A 5LYYA 4DYVA 3DM5A 2H8KA 4QPCA 1ZUD1 2I1VB 3ONVA 5A4KA 5JJBA 2WABA 1ZPDA 4BQFA 2BKXA 3BXEA 4FYPA 3X44A 5EKXA 2HIHA 2DFPA 4AL4A 5CNKA 2D74A 2HA7A 4KIFA 3RVZA 3SD7A 5JS7A 2LDBA 2A30A 2WT9A 1HR0O 3MRTA 5EJAA 1CG6A 4O2LA 3FJYA 2Z6UA 3O9OA 3ZE0B 1L1EA 3PF8A 1NR5A 5CDGA 4YROA 1TMKA 1UBFA 4WL0A 1EX9A 3TW0A 3R77A 3RJ9A 1MT3A 2H16A 2VLBA 2DLDA 1RVV1 4F9FA 5IABA 4G36A 3A0HZ 4BFLA 2HK9A 4KE8A 3G6WA 5EHIA 3DGEC 2GN1A 1KI7A 3J7AC 2ZAMA 1HG0A 4CXMA 5SYAA 1W7AA 4AF6A 3FOZA 4AZ0A 4F7WA 2KG7A 4BV2A 3PTAA 2PGDA 1NVPB 1UMKA 4Z9XA 3T0IA 3TQIA 5AR1A 1NZFA 1CUJA 2HSZA 3VJKA 1BCCH 2DN9A 1N78A 3VYUC 3H2GA 4PFJA 3TX6A 4QATA 3K09C 3P19A 3HMQA 3IAS6 3VR2A 2FFQA 1IM8A 3IUQA 3IPYA 1BQ0A 1CUFA 4U5XA 1ZRNA 2AMFA 3FOCA 4PG8A 1MH1A 2XY4A 1Z6ZA 4DLUA 3AR6A 3K2XA 4ISBA 2IUSA 2X22A 1JHRA 5FPKA 4CKYA 3LL4A 1W19A 3I9MA 2IYFA 1X7WA 3KE9A 3G8DA 3KL2A 1O77A 4LH7A 4A16A 3Q3CA 3GVIA 5FA8A 5TDHA 4PCUA 3CGGA 1VBMA 1JBEA 2BEUA 4JP3A 4ZT4A 2WFLB 2C3YA 1C14A 3FDJA 3JWGA 3QYAA 2PA0A 1OXMA 2LPMA 3AOGA 4Q9DA 2VQ3A 2ZCUA 1UM9A 5BUZA 1YRLA 4OHUA 4B47A 4GXQA 3SEFA 1DKPA 2P9TA 2H52A 4QFBA 2YIDA 1IBLO 2ZR3A 1E8NA 4JC8A 1T8TA 3D5TA 1P31A 3C3AA 2IE0A 2ZIEA 3TPFA 4E1VA 3K72B 3K04A 4P33A 4G9BA 3RANA 4RSMA 3VH3A 1XCMA 3CONA 4NE9A 3SN6A 3M4JA 3EPHA 5DNEA 2A9KA 2AXTZ 4GZMA 4LJKA 4CDRA 4OHRA 4RPKA 4JC5A 2Y0IA 2FWAA 3UV7A 5ED0A 3LQ4A 3K6SA 1RTKA 5CEEA 3BMQA 4IDEA 3DDZX 4BX9A 4U63A 5KHHA 5KMGA 4PSVA 2RHCA 4Y6SA 5FNVA 1QO0A 3IR7A 2KSDA 3FNEA 3SFVA 1XTZA 1EESA 2F3TA 2OP0A 3RYIB 3DWFA 1AZSC 1KQ3A 2ODQA 1LS1A 2E87A 4D4KA 5GM2A 3ILYA 1H2YA 1IXRC 3IS3A 1R5BA 1AKVA 1TYDE 4EI7A 3KKYA 3ACBA 1ISGA 1JOYA 2W2NA 4ENPA 2D0PB 1E64A 1DQYA 4IZIA 4MI9A 1WE2A 2GO7A 2DJIA 5JYEA 1BQZA 1LGYA 1CP2A 3G4SV 4G37A 4FQ8A 4FFVA 2M1ZA 1PIWA 4G89A 4FNGA 4LY6A 2QVGA 4NWOB 3B2EA 4KXRA 1CZKA 3F6MA 2R48A 1Y5NA 1H4SA 4M22A 2FPLA 1JJ2U 3MSCA 3L7YA 3JTEA 1U2GC 2TRSB 2DZDA 5E1DA 5I45A 4RSGA 1T15A 3ZP4A 2PU5A 4LRTB 1AKTA 4K1LA 2KJQA 1N8KA 1J1ZA 4L50A 3SSNA 2XWSA 4ER6A 3MAJA 2VJMA 3R8FA 1JCHA 1XNQO 4CQLB 2QMOA 3EEIA 1E2QA 1Y9DA 2FWBA 3PJGA 4JGIA 5D6NA 2I8AA 3KYBA 5I48A 1SRRA 1AY0A 1R50A 2JAPA 4F1WA 2BGNA 1JP7A 4MYUA 2HHJA 2I62A 3TZLA 5LKAA 3DE0X 1X87A 1PG2A 3PEYA 4Y7DA 1Z2EA 5A4MS 3EAGA 4EA6A 3O65A 4RMJA 5HQTA 4ERNA 4TQ9A 2WQZA 1B3QA 1MU0A 1DARA 2H4FA 5FBQB 4LS3A 4LNAA 2O5EA 3DP9A 4OOFA 1LLQA 2IYWA 2OLKA 5E0OA 3SJBA 3STVA 1QJ4A 3QWBA 4D26A 2A9JA 2Q5ZA 2EJVA 3CXCF 2QWQB 3TM5A 4IIXA 3IOYA 4FLZA 4BW9A 3ZS8A 4ENRA 2G4VA 1PQUA 3JZDA 3FB6C 3TQQA 1DLBA 4C7UA 2FN9A 1Y7PA 1Y3CE 3FDIA 1X0VA 1IDSA 2NUBA 2ID4A 4RSRA 3G2NA 2KS6A 1VLMA 4FSXA 2YVAA 1FDVA 4A2PA 2ONZA 3TLMA 3CCRF 3Q8WA 4JGGA 1CJSA 2R6JA 2P91A 4L4UA 1DQPA 2FN8A 1M2VB 1QQ7A 4Q3OA 1M2HA 4YVFA 2UZ0A 3DBIA 3CD6F 3OUTA 1XTIA 2B9ZA 4M86A 1QYCA 3HE3A 5C93A 4ZHVA 1I1QB 4M46A 2IYXA 3FKSG 1YNOA 3WAGA 3QPBA 1SUIA 5CHYA 4ZAZA 2ORIA 5ICEA 2WG1A 1P9OA 3QU2A 3OCYA 5F3WB 2XDQB 1FNKA 1CR0A 1YJCA 4IWXA 1XU4A 3OWOA 5DM60 2BEVA 3IEKA 4BVEA 5F52A 3O91A 5CDYA 1FVXA 5AW2A 5JWHA 1KK0A 3T1QA 3ZI7A 3PQ5A 5AUQA 1KZ9A 3MCAB 2F1OA 3B7GA 2CW5A 4QPZA 2DSTA 3DJYA 4PLWA 3HUUA 2EBWA 3SZGA 1RAIA 4IXTA 2VP0A 1UAAA 2Z1FA 2GAOA 3E1YA 1DBQA 3OLVA 4LMPA 3R23A 1SUWA 2G06A 1GZ5A 2XB8A 3SIPA 4JJGA 3SVLA 1OZFA 3LT5A 2ZJ7A 3E7WA 2H6LA 3ZK9A 5ITVA 4NICA 1L7DA 4O8CA 1WZEA 2OIEA 1N5RA 1CS4C 2YOHA 4O3MA 2CEKA 4YT4A 1JLSA 5J3JA 1IX9A 2C9DA 1J8YF 4ZWNA 4QDOA 5HF6A 5DHSA 3DW1X 4JQCA 3EXAA 5KJEA 4N65A 2HRCA 1UPUA 2OHIA 1JQKA 1J22A 3EZXA 3OOEA 5JD4A 1YMVA 4O5OA 1JZTA 4QQNA 2E5LO 1XI1A 2O1SA 2XA2A 2GKOA 3WPXA 3K05A 3HCEA 3F9IA 1WP4A 2BFWA 4CV3A 3SQOA 4D0RA 1U1GA 5CLIA 1VJGA 1J0CA 3K70B 5B7QA 4YIPA 4B5CA 3KV3O 1FVHA 5EC2C 4W9NA 3INTA 2QPOA 1YR6A 4DVGA 4YN3A 1L4MA 5T6BA 3P0RA 5KTNA 1Q90D 1PEDA 3DSQA 2QLMA 4F92B 4Q12A 4MVXA 2BF4A 5TLSA 4RDXA 4CIDA 1UF9A 4HAZA 1WUTA 4YLYA 2YDEA 5KNDD 1V6CA 1PX2A 2AXEA 5EXXA 5IANA 4KMRA 2OQRA 1E2IA 3D4OA 4LDZA 2NYAA 1YI2F 4ZODA 5BN4B 2GN2A 1A04A 3KQKA 2J09A 4TUYA 2WPDA 1AVMA 3VTFA 4RVNA 3JQAA 1BDIA 3FPIA 1TAUA 1ZU4A 3I8OA 2ASEA 1TUBA 2BFDA 4MUXA 4X6YA 4M8LA 3SSAA 1P3DA 1I32A 4TWBA 3EISA 2YZ7A 4G1BA 1FU7A 2ZB8A 3PLNA 1N0JA 4DT1B 3AIOA 3DV9A 2NV0A 2F95B 3GRPA 2OVBA 4WESB 4CBVA 4BLVA 4HZUB 2F3UA 3VNVA 3TSYA 2GEVA 2L18A 3A0UA 3CW9A 4AJIA 1QR2A 4IIYA 4I4NA 6ADHA 1Y74A 1X7XB 3WOVA 2C2BA 4PF1A 3N28A 5EUMA 1R5OA 2WIFA 4CU5A 1I6LA 2Q07A 1UIRA 5DM4A 3BPZA 2FWMX 1U7WA 1NA5A 2W2QA 5AM3A 1R0CA 4UE3S 3OI7A 4DMCA 2VK4A 5ELMA 1NTMH 1ZSVA 3VR5H 3RF6A 4Z9AA 1Y0BA 4EHHA 3Q2OA 2HA4A 2NSDA 1W36D 4WLFA 2BFOA 4AJ2A 5L3QB 3CF4G 3VO8A 2JCGA 4NJEB 1Z5WA 1DEKA 1U9YA 2XQKA 2JAHA 1IJKA 4M0UA 1LQTA 4EQZA 4LBZA 1WBJB 5EIBD 5FD8A 1T5IA 2WP0A 3R7SA 1Z8DA 3GFOA 1I2ZA 2R5NA 1WP8A 1U2DA 5H8WA 4RDHA 3N39C 4GWKA 4J9ZB 2HXGA 5DP2A 3OGCC 2YMLA 3H9VA 3AG4C 1S5PA 2HNBA 1U9IC 2C57A 4QQ8A 3TKYA 1ZN7A 2H17A 4X66O 4B4KA 3DMGA 1L3BA 3ZHOA 3I9KA 4I1SA 3R6WA 3CCSF 2JIQA 1X15A 5AK6A 1ESDA 1DRKA 5JRDS 5JSUA 1YR8A 4RPLA 1ISHA 2TMDA 2IX9A 2X0KA 1JFRA 1CDEA 3BTVA 3GGPA 5G4LA 2FFRA 1QOZA 5AD1A 5EJEA 3TLBA 5KYUB 3USCS 3K0AB 1XBLA 4DA6A 4JI0B 3MDSA 1Q0QA 5E7JA 1C1XA 4H7JA 3PJEA 2B34A 3CZQA 1AC5A 3VI3B 3F6CA 1SHKA 4V39A 2LJ2A 2W58A 4QYIA 3COZA 1GNVA 4PIPA 2Y1EA 5A3QA 2HP0A 3AR7A 1M93A 2R1TB 3FSRA 3RC2A 2CTPA 2ZDHA 4XDJA 2ZQZA 2ZYRA 2GM9A 1R74A 3GLIB 4NCJA 1F9AA 1Q82H 1GZUA 4ABMA 2ZWVA 3VZDA 4NMWA 1QU7A 4BVTA 3M0EA 1TM2A 3MLEA 1QLJA 3WLJA 2I7XA 4NBTA 2IDZA 1IXZA 3AY6A 1QCYA 2AZTA 2ZBDA 4N3NA 2PANA 4BB6A 2XD4A 2R9RB 4YUVA 1WQ1R 2HQRA 1TD9A 4LIPD 2X41A 2VAVA 3EPJA 1RBQA 1JJ2F 2ATIA 4RELA 1ULBA 4L9RA 2OFFA 2OAQ1 3ONEA 3ZCVA 2TYSB 5B3JA 4A1OA 3D3JA 4Q02A 3WKEA 1YB7A 4D25A 2RGGA 3QTYA 2CF6A 4KNYA 2IYYA 3DDWA 1E2MA 2A5JA 10MHA 3CP1A 3PNLA 1V1MA 2CGEA 1UIMA 3I9NA 4ES6A 3FTNA 2PNFA 3PQ8A 3ZW7A 3BGSA 2KLHA 2WTAA 1NP7A 2HJDA 3A32A 3N8NA 4GZ5A 3WTBA 2JFBA 4DNOA 4NAVA 1FMFA 3OPNA 2IEBA 1Z16A 1HT3A 4MS2A 3U0VA 4TV9A 1H2RS 1E0DA 4YCSA 2FUEA 4D46A 4X90A 3A2MA 2NNLD 4PPQA 3QBVA 1ZN9A 3D8CA 2B1QA 5BWBA 5FBWB 4NAHA 1YOVB 2H0QA 3MTIA 2X6QA 2WLIA 1RYFA 1VQOV 1XHLA 4KXQA 4MINA 2A9OA 1MV5A 2YBEA 1T3TA 1OLOA 2WTNA 4CM8A 3AGQA 4FOTA 1FDWA 5EZ6B 4M9XA 3OA2A 3IAM1 1S7GA 3RBXA 5IM5A 5DM70 1R8JA 2AVNA 1WB8A 3KR2A 3ZWYA 4QUDA 3WG7B 1XCJA 2NO7A 1I13A 4FWIB 1H48A 4MR9A 1CP9A 3HSKA 4BAYA 4OOEA 2J48A 4RTJA 5CPFA 5T3UA 2DBVO 1WXQA 3FOEC 3KELA 4MCJA 1TQHA 4QUEA 2ZFUA 2ONYA 3IPLA 4LKOA 3ZD6A 2R6CA 1A4IA 3WGHA 2FKAA 4LXTA 3PIRA 2O2SA 2LCIA 3SIXA 2RQ6A 4KXXA 1MNAA 1U11A 1MP0A 1TTHA 5GONA 3LP8A 4FDVA 3FMVA 3KDSE 2WA4A 4AQYO 4KIWA 1NXQA 1U65A 3LF2A 3G0DA 5C37A 1M90W 1U28C 5IUJC 5CXSA 3SFZA 5CD1A 2J9FB 3FZQA 16PKA 1H47A 2O2XA 4UNRA 3SYPA 3Q5DA 3AXTA 3UHFA 3E35A 2AIRA 1QHNA 4NFLA 1Y9EA 5LBUA 2RHOA 4DKJA 1CF9A 1RWQA 2CBZA 1XBTA 1XROA 3PEFA 1TKRA 1IXBA 4RE5A 3DLAA 1CQPA 2OTMA 2H8CA 1OX5A 2BJVA 4Z8YA 4BTLA 5LZ2A 1J8DA 4OEHA 4DCJA 4XPIA 3F4KA 4LJYA 2R1VB 3QUAA 4JYCA 1DUVG 1ZK1A 1T1IA 2IYZA 1V55B 3B3AA 4C7MA 5AJHA 2ADQB 2I1LA 2HR1A 2IODA 2FE1A 3WK9A 1G3RA 2A4MA 1BTOA 1MG0A 3E58A 1N3BA 2JF0A 4PN3A 5AW0A 2O3JA 4GM4A 2JLWA 1X38A 3FPKA 3SQWA 2ZIAA 3M81A 4YPVA 4OHWA 4NBNA 1T9HA 3MYRA 2PUDA 2NW6A 3VTKA 3ZGZA 2D5CA 4WNYA 2JBWA 2Y77A 2ZSDA 1EAMA 1LK0A 2YYAA 4H6PA 1KKDA 4UUNA 2QRZA 5CPBA 3LWBA 3M7IA 2ZKIA 1YE8A 2WU1A 4M53A 4JDUA 1JILA 3C24A 1JQBA 1H8ED 4OAPA 2UUCO 1R4NB 3ZWQA 4JIGA 3QLEA 1EG2A 2PT9A 1KARA 2Y1DA 1L5NA 2ZK7A 1P1IA 1X7YA 4JWKA 2G5TA 2C8LA 4Z3OA 1U3PA 3T95A 4K8ZA 1XCOA 3FFWA 2J4CA 5T57A 4ZGGA 2HJVA 1V7QA 1R7RA 2R9IA 4Y2RA 3CC2F 4A92A 5JQGA 3SGLA 1CYDA 2MSNA 1YZYA 1T2NA 3MINA 1NMQA 1VF6C 1WVMA 5FWXB 2QAGA 1HSOA 2J5BA 4DV1B 2AF3C 4J0DA 3HQ4O 5FLXA 1VHJA 2F1HA 2XVAA 2FSVC 4EJSA 4Q9LA 1AD2A 1Q1NA 2OHWA 4XR9A 2XB2A 3IUYA 1V11B 1R66A 4ZOLA 1QIKA 1ZL8A 3G0HA 1JEOA 2ZUTA 3EIHA 1HOTA 2DPHA 4AF7A 4C3OB 3IELA 2ZB4A 3VOBA 4JJ4A 1Q12A 1TPYA 3EH2A 5H1YA 5ALYA 4S3MA 4FBMA 1V8PA 2Y99A 4EEKA 4X8HA 3FOFC 2IBSA 4F06A 5F7ZA 1DXOA 4WFFA 1V7CA 3DZHA 4Y2VA 1TU3A 4CGYA 1R37A 4IDBA 3KZXA 1IMJA 2XXJA 4B3HA 4E2WA 5KX5B 4LGVA 1IHDA 3EFHA 4R3NA 2QSZA 2DYSC 3IE0A 3ZRVA 5IAGA 3V4PB 3G71V 5AI5A 1ZS9A 2RJNA 2ZUWA 5B30A 3E20B 1RP7A 5H5JA 1PNRA 1JY8A 3RYCA 1M0WA 4KGDA 4GL2A 2A9QA 1JFLA 5IK2D 5H9VA 3OZWA 4LK2A 3KQHA 4OB6A 1M34B 3KDPA 2B4AA 1G0OA 1ZM7A 1W0CA 3E3LA 2Q41A 2V9ZA 2JDID 4O4LF 3E9RA 3A1FA 3TZBA 1HPLA 1I4TD 2REQB 2CNWA 2V9YA 2DFTA 1VE1A 4M60A 4MYCA 2WF7A 4QU0A 3PWTA 1RJDA 2IPAB 1DMSA 4ER3A 2W0MA 1E1YA 2VWHA 4IVRA 3OZTA 1DLJA 1RQPA 2O23A 3EXHC 3Q3EA 2IK8A 3C6ZA 3JCZA 2OAP1 2PZAA 2OENG 4XGRA 4UHKA 4W5OA 1MSDA 4OUKX 3OIUA 4NKGB 1L5RA 3AEKA 1HDIA 4BNJA 1H2XA 3PN1A 1XCPA 2C58A 1A96A 1FVFA 1BWSA 1LRKA 2VPWA 2C9OA 2VQEO 3OCUA 1TYAE 1Y67A 4RM3A 3R3JA 4I50B 4MRNA 4PLGA 5FRDA 1IY8A 1FW6A 4MP8A 5CRIA 3NGLA 4NL4H 4QLBA 4UV8A 4OV6B 1GN4A 3O31A 1KFKB 4ZYZA 1DT3A 2WEKA 3ET5A 1H3EA 1MXHA 1RNLA 3E2MA 2JJYA 4TKZA 3AK3A 3GUVA 3NWEA 5LBQA 4MICA 4FC6A 4ROSA 1H0HA 2CK3G 4P4LA 1J07A 1PR3A 2WF6A 1LVHA 3MPOA 1SURA 1CR6A 3IIIA 2HDNB 1C7FA 4N3CA 1A97A 2W0SA 3ZGYA 3WISA 3FHTA 3G0OA 4X3PA 4U8GA 2O50A 5AM4A 1RC0A 2A9RA 4ZYXA 3L7CA 5EP4A 1EI9A 4K6KA 3K4PA 1BW9B 3MWEA 5ITZB 1IK4A 1QPGA 2BJHA 4H0NA 3ZD9A 4DEXA 1W40A 5B6IA 1X80B 2QY6A 4PX3A 1W36C 1EFLA 4L8YA 2CVZA 3S2IA 4AU1A 5F2EA 1ZGAA 2BOCC 1N92A 3L0DA 1W4BA 4FZVA 5EIBC 2HSWA 3C2QA 2HU8A 3PHHA 4XX1A 1XD2B 1V0JA 1OX6A 4TKVB 2BFEA 2WV7A 3R0JA 1JEAA 3ZK8A 4PRKA 2M6KA 3V1LA 4RQBA 1ZP6A 3R0VA 1FX1A 5C3MA 4HXYA 4JI4O 5DNYB 1FQOA 2BKLA 4ZO9A 3FUTA 4JX8A 2FN4A 4GS5A 1R3DA 5BSFA 1CQXA 2QROA 5PNTA 2Z01A 2ZSUA 5G0VA 5ILOA 3AHCA 3KXDA 2P4HX 1RABA 3VUFA 4KQCA 2PH1A 2D54A 1GQYA 4QWMA 2M6LA 3GLFA 2DBYA 1MHTA 1IYZA 3CWBH 3I1YA 3UHPA 3TD6A 3V5NA 1JXQA 1ZN8A 2HRBA 1EX7A 1NP3A 5K05A 1VYHA 4YCLA 4YLGA 1W8DA 1NI3A 1CZHA 4IH9A 4MYTA 3QMWA 3O2QB 1GZ4A 1ZG3A 4QHYA 1REQB 5SZJA 2OTCA 4WKPA 1JTEA 1EE9A 1GDTA 5JJEB 1T3LA 4EARA 1UT8A 4NENA 4QYTA 1SZQA 4P30A 4BW5A 3P9RA 5DGIA 3AGKA 4WBNA 1W88A 2E18A 3RIXA 3L01A 3ROPA 3NATA 2ZIGA 3CCVF 1QHFA 5JT1A 5HF5A 1K7DA 2GZMA 4J0QA 3GUCA 1HEIA 3R5TA 3NHLA 1FZQA 5IWAO 3FFMA 2O5RA 4BMXA 3HYRA 2R11A 1ZNXA 3FX2A 4X8LA 2IIQA 1Q3TA 4Z2YA 1JJIA 4JI3B 3GA0A 5LD2C 3DW3X 4BT3A 4LISA 4K6OA 5BR4A 1AHIA 3NK6A 5LWQA 3ZH2A 4CCWA 1U8YA 3QJYA 3DD5A 4MGYR 2IEGA 2AVDA 1ENVA 2FG6C 4Q1DA 3QUBA 1Q86H 2NUPA 1A4XA 2BISA 4D9BA 5BN3B 4CL0A 4C89A 3RUCA 4S05A 2ZYUX 3MM4A 4B3CA 4IGEA 5AHKA 2I76A 3GJZA 2M7WA 3VNAA 1V39A 1H85A 4DYLA 3L1VA 5FLXM 4O2BB 4GICA 2LDXA 3UAOA 1VB3A 2V3WA 3KB1A 3IKVA 2GJAA 3UKMA 1XXHA 4YO7A 2BLNA 5FTKA 1GGKA 2EIMC 1LBIA 3HFGA 3FDZB 1G2PA 2GD0A 2JGDB 2YH2A 2H2HA 3CX3A 4JT2A 4C29A 1UZAA 2WMDA 3DV0A 4QDJA 1KC3A 5CN0A 1GA1A 5CIYA 1AE1A 3DLTA 2EC5A 3GMTA 2XNHA 4P3KA 4N6GA 4UDYX 4PBRA 1ADYA 5C52B 1DAIA 4TM8A 3KQUA 4LHZA 3DXRA 2JFGA 1THZA 4GX2A 2G28A 3P9NA 1QDLB 4I1OA 2X5JO 1SHZA 1OU0A 2XHEA 4L08A 3NHUA 3WZLA 2X9QA 1IQPA 5HJ5A 1LLDA 3FLMA 4Q1EA 4AS2A 1G5PA 3JV7A 4F84A 3QX9A 1BG6A 4ROTA 3TQHA 2IHBA 5FOTA 3CPQA 1D2CA 1QFJA 4M38A 2IBTA 2JH8A 1T2AA 4Q20A 1E4VA 2NP7A 3Q4HA 2XTAA 1Q7CA 3AHFA 4I19A 4RKEA 1JPJA 4Q82A 4KBGA 3OCJA 1N57A 2FPGA 4U7JA 3WGVA 4MNTA 4MUYA 1Z6QA 3OG9A 3UT5B 2O7SA 5JZOA 5F5LA 5IG2A 2MSKA 2HAEA 4I1RA 3S99A 1Q7BA 3DBLB 4R1OA 2GH1A 4IUBS 1UBJS 1SDSA 1Y81A 4KQFA 4AKIA 1NBMG 2GJ8A 2PD6A 1ZWZA 2JZOA 5AVOA 1UQTA 2RDMA 3RK4A 2YCLA 3R5SA 3N0RA 2BMEA 5ALDA 4RZHA 3RROA 3VR2D 3UMVA 3WLQA 1B3BA 821PA 1VCHA 1R8YA 7AT1A 5HXUA 4BZPA 1K8AW 1M6EX 1QIJA 4W6QA 4XLZA 2XV1A 2A1TR 4KR9A 3PUHA 3F0EA 1WO8A 4P36A 4R0MA 3C3BA 4D8VA 3ZVMA 4BEJA 4BRUA 5LM3A 2QKCA 3BK1A 2PV0A 2GNPA 1XFDA 2P9QA 2VJNA 1UWVA 2L2QA 5KX5F 4QULA 4WZAA 5CA0B 3C4JA 1U3UA 3VAZA 1JLLB 3HBNA 3ROMA 2KB1A 2G04A 3GJYA 2IWRA 1GCAA 5BV0A 2IYOA 1IUKA 1U3CA 2XIQA 1D5WA 1XRMA 1YITV 1GL9B 2GM3A 3FUXA 2Q21A 3GY0A 2C2YA 3HAXD 3L0PA 4IDPA 4UUOA 3ETNA 3HRKA 4XWWA 5JS2A 2DJVA 1A8QA 3ROFA 2RIPA 5A3RA 1AROP 3DEKA 1QQ6A 5KB3A 1BNCA 3Q6IA 3FMPB 4QIHA 3RUEA 1OBFO 4CV1A 4MQLA 3IAM6 4EHDA 4HEA1 1JAHA 4KR7A 3OURA 5E4FA 3UYKA 3U3ZA 3BTUA 4QD3A 2CXXA 1TAHA 3NORA 3C6KA 1GR0A 5CEFA 1GN6A 2ZNIA 4IGIA 2FG7C 2DWQA 5EWRA 2QA4V 4RKYA 3QOXA 1JMVA 4DBVO 1WXDA 5JDIA 4J4BA 4K46A 2XT0A 2DT5A 4JI7O 1NVXQ 2ZXWB 1L5QA 1VQ9F 5MN5A 4CEJA 5HFLA 1GTVA 3ZHQA 1ZVQA 3QEKA 2FR8A 2VSXA 2JNBA 3NTOA 1QO0D 4D3SA 1M1YA 3R3VA 4BNIA 4O59O 3ESQA 3HRHA 4I50F 1G3IA 1QRDA 4MR8B 4WUTA 4UBIA 1QVGU 4PIVA 2BTOA 1BC5A 3QW2A 1Q7RA 4KP4A 3K4QA 5BYBA 2R96A 5CR9A 1CEXA 3PJRA 3B2EE 3ZW8A 1AI5A 3SICE 3R3WA 5T4BA 3QUCA 4WBSA 4XSHA 4BFYA 2NSLA 2O2GA 3KO8A 4KRFA 1KKCA 4JVSB 4JITA 3D7MA 1OFTA 2RSLA 4DK0A 3A9VA 3LC7O 2PSSA 4P54A 3TR0A 4HDCA 1DV2A 1EDOA 4G8BA 1JBKA 4YMIA 5DN6G 2G1PA 4OHFA 2Q0AA 1V2HE 3EEOA 1MENA 3JQ9C 3A1TA 2E1RA 4WZ6A 2B6NA 5F51A 3MD9A 3ZDCA 3C3WA 3OH8A 4KGZA 1J8VA 3QXJA 1ZK4A 3LSSA 1JDTA 1F23A 1RI4A 4N5HX 2QL9A 4GXNA 5JBQA 1MCZA 4RK5A 4GX5A 2X6TA 4AIRA 5CX1B 4U7DA 3WWEA 2FTKA 2TMKA 2P2SA 3F7NA 1JFSA 4WASA 2FQWA 4IJUA 5CA1A 3H86A 2ZDQA 2V0CA 3WLTA 2PH3A 4X1KA 4RPGA 4OX9O 1IJEA 2XWPA 2ZULA 3KCNA 4QIWF 1KU9A 3IYLW 2XCLA 4WKCA 4MQEB 5HFNA 1OCRC 3LE8A 4YCMA 4O4JA 4CH4A 5B3SB 2ZIWB 1VSQA 3UHOA 2BYTA 2QX4A 2YXZA 1WL8A 3ABLB 4ATNA 4XQEA 2XGJA 5EQTA 1SCDA 2ICAA 1JV2B 2DF8A 1H94A 1OJLA 2OTJF 2XTMA 5LQNA 2PKCA 3ETLA 2R85A 2QKSA 1VF7A 4YI3A 2Z6QA 9GPBA 3WFVA 3KYDB 3O8RA 2ERYA 3DEAA 2FZLA 3FOWA 2PVPA 1O95C 4L78A 3OKPA 2IQIA 4OUDB 1DC6A 4GOMD 3FIUA 3NIDB 3QPUA 1YS2X 5E3IA 2ZRCA 4QL3A 2ZAGA 3HU1A 3RGBA 1ZXXA 3MJHA 3Q98A 3WNDA 2I54A 3B6ZA 3CCLV 5LMNB 1AT1A 3EZLA 2Y69C 4JI2O 1DJMA 2HEGA 4GP7A 1DBRA 1ODFA 4JHXA 3WADA 5LMUO 1OREA 4FK5C 2P79A 2PIAA 4JLPA 3UBTA 1M2OA 4J41A 4QODA 1XDSA 1ULAA 4AG6A 3O9ZA 2PS9A 2HJRA 4TX1A 2AK3A 2WF5A 2W70A 3PQEA 4R2HA 2ID8A 3SY8A 3PC8C 3CNQS 2C7BA 2FX5A 3A3PA 3IAFA 1VRCA 4JAVC 2ZRGA 4M7OA 4W4TA 2X1LA 1COWG 2PQ6A 2EIJB 3ZLJA 4LC1A 2WDPA 2I9PA 4LY3A 4DSAA 3KSZO 5FNZA 4YJFA 3NBFA 1XQYA 4P2BA 4HAWA 4U9IS 1OCEA 3ZR4B 2QENA 5L53A 2QXTA 1EBUA 4POOA 2QM3A 3PUIA 1FY2A 2GUWA 3WLHA 2X2PA 2I4RA 3VC3A 4Q7JB 2GT1A 1ZW6A 4FLWA 3HCWA 2Z1TA 4XVUA 4C5BA 4GMDA 1EWKA 5EO3A 4O2BF 2XW6A 2Z0AA 3EMVA 3RKRA 5CT8A 5T8KA 1ANKA 3BJMA 2J1LA 4QXPA 2C61A 1EZ4A 3TRJA 3OEEA 4OREX 4BNVA 3ZLTA 5IU6A 3GFGA 4YY3B 4I9HA 2J4FA 1M5UA 2EJCA 2ZANA 2XB9A 3LUAA 3V7WA 2JD2A 1UPFA 1PKXA 2YWCA 2NSYA 4DIKA 3AVVA 3BGVA 3IKLA 1PNQA 1MQ8B 1RLGA 3AUSA 1ITZA 4KXVA 4M1MA 4RPJA 1Q3KA 5JYBA 1CC1S 4RKWA 3PHGA 4FFRA 5JZBA 4JTDB 3ILHA 3GBSA 4N5MA 3IBYA 1H6CA 1SMKA 1ACLA 3OUUA 1WUJS 1ROPA 3HR0A 2G5PA 5C8YA 2AV6A 5L6MB 4HOYA 1VL5A 1KHTA 2WPDD 3WGYA 3JQAD 3KEGA 3HN2A 5BVHA 1H2MA 3G3EA 1D5AA 4G5RA 3VMFA 3O8QB 1GGFA 1AQIA 1A9YA 2GLTA 3CBQA 4XQ0A 5LXTA 3AKYA 3ZHXA 2OPBA 3U44B 3R9IA 3B9BA 2BR4A 2BBSA 4BDSA 3QHAA 2BR3A 2GSWA 1WB5A 5KSZA 1RTTA 1WA5A 1WB6A 1LJLA 1ECPA 3B6KA 3SXPA 1VQ6V 3G2KA 3HWUA 4BMPB 1MOSA 2OZVA 1A2OA 3U4HA 3TD3A 2IH5A 3VYSB 3OHPA 1TA0A 2OGUA 2QBYA 4B3IA 4K6FA 3MF4A 3B12A 2DW4A 2OEPA 4A0FA 1BGXT 3CH4B 5FOXA 2VSQA 3AG1B 3ANXA 3HWRA 2PYIA 1F7VA 4EHKA 4D42A 1PZHA 3UWMA 4ZYUA 3U11A 2C03A 3I4CA 3VMMA 3TB4A 3VVBA 1BQEA 3VZBA 1M2WA 1XL1A 3EIWA 4ICGA 5J5CA 2CVHA 1E1KA 5CA0F 5KNLA 4YRTA 3HXQA 2R6ZA 4E4YA 3RIMA 4BASA 3ABMC 2CVOA 3MPUA 2JZCA 2YV5A 2C31A 2D5AA 3S68A 4Z1MG 4XYGA 3NM5A 3MJSA 4G8CA 4BTEA 4A2WA 3VI4B 3EPPA 2AXNA 2QM0A 1KJJA 3R3SA 2WM2A 4MB6A 4WINA 2GS9A 4DV0O 2ZJ2A 1QRRA 2NXEA 4JEUA 5TE9A 2IVFA 2XCQA 3QYFA 4J11A 4FHEA 1KBZA 3TTVA 1K8XB 2HA2A 2JIPA 3CLRD 3UF0A 1WTCA 3UFBA 1G4AE 3OBIA 1T36A 3TW6A 1NM5C 1EXVA 4FB4A 1K5HA 4URVR 2CLMB 1DQNA 1X0XA 1YC5A 1MA0A 4CF6A 3QVVA 3RJZA 1E2DA 3LYLA 2H94A 3DOCA 4D7TA 4RE6A 4ZFNA 4UUBA 4UCOA 4U8HA 4DMKA 4TL7A 1WXWA 3BGOS 3EY4A 4XDGA 2GYWA 1LX6A 2PL1A 2OOSA 5DGCA 4MEJA 3UJCA 3LTEA 3F67A 1NT2B 1WOMA 5EFOA 4YP0A 5TGZA 5FLXN 3GP8A 5LR6A 3GJ5A 4F2WA 2BGGA 2ANBA 2CHUA 1ZIYA 1PDOA 3EDRA 4WZBE 4WH0A 1WSBA 5C4MA 1NWCA 3ZI4A 4D4GA 1LDMA 4F5EA 3W7UA 2E2WA 1QVGF 3HU5A 4GZ6A 2XYPA 3AY0A 2HYDA 1W9HA 3AT1A 1ONPA 5FBVB 4PGFA 3AHEA 3WGJA 4OFZA 4LZPA 2GV9A 5IJ0A 4MDHA 3ZHYA 3MDOA 3GCZA 2GRAA 5JRZA 2ODWA 2XTNA 3D3NA 4UXHA 1AZWA 4UAVA 1U0NA 1U8EA 2HSGA 2O48X 3LCRA 3HUDA 3JQFA 3VOAA 1E59A 5L3BA 2PPVA 1G21A 2JNWA 4BQSA 2FN7A 3E7DA 1KFBB 2QYSA 3FPFA 1SXJB 4KDEA 1E99A 2XMQA 3T1HO 2PBFA 1HURA 4D9CA 1P29A 4DCCA 1SN7A 1LFDB 2ZJFA 4B3XA 3OKFA 2QTOA 5CHEA 3U4AA 4FI3C 1ZL0A 3Q72A 2VH2A 4X89A 1VQKF 7GPBA 3LBIA 1YGYA 3VPAA 5BSWA 2UV8A 3LNMB 1P17A 1AMNA 5TPWA 1ECFA 1P1FA 2HF7A 3LUHA 1B1AA 1ZITA 2ZS7A 4E2YA 3G1WA 1LUAA 3SNHA 1MV8A 4WOKA 1PV1A 4BXOA 3UO3A 1BDHA 2BFAA 4BCDA 1ADFA 1IHPA 3PVCA 4LF7B 1IQUA 2QQEA 3ABZA 4Z4GA 3ERCA 4BNDB 1T4GA 4Y2XA 2R8BA 3ABKC 2J6HA 4LJSA 3LXXA 4IF6A 4ZU3A 4DHEA 3MOIA 2EILC 1DOHA 5HDQA 2YXYA 3LPCA 2PXAA 2DH5A 4PI2A 3OAAA 5F73A 4TL9A 3RV3A 5CYGA 1MQ9A 3NOXA 5A7FA 3HEMA 4OB8A 1XR3A 1XILA 1G6Q1 1WN7A 3E7PA 4DCGA 2PY5A 3D64A 3UMYA 3H3JA 1KJNA 4FKBA 1Z4LA 5DWDA 2DPYA 3ZCRA 1TMYA 2FYUH 4CMAA 1AQUA 3BEDA 3WSVA 2PRYA 1ZX1A 4BTVA 2Y05A 4JR2A 3PTZA 2HM7A 3RS7A 1K7SN 2QMQA 1CS0B 1TRKA 4NOMA 2ZQMA 4Q3KA 1RPZA 1XFAA 2VHVA 1QDEA 3JQ7B 1R1DA 3MCQA 1KJ8A 4OGQB 2OO5A 3JAWB 1KEZA 4UEOA 4A4DA 3WR5A 4UCFA 4IKEA 1C50A 2DHCA 1NJ1A 4KXYA 5K0EA 1ZW1A 3LNNA 2VUIB 2ZJ8A 2J07A 2Q7EA 3CR8A 4G86A 4PRLA 1NBEA 3NG1A 4Y6OA 1HM5A 4J1TA 1G8SA 2PRJA 1QC5A 3CF0A 3A6DA 1P0MA 1LSSA 3ZO8A 3WFJA 3ASVA 3IEUA 4ZVSA 4YHHO 4X62B 5FUBA 2P22C 3N4ZA 3SC2B 3LH5A 1P0IA 4TTAA 1AJPA 1A1SA 4CIAA 3RKUA 1DQZA 1UFOA 1VP7A 4D4MA 1YQXA 1L5YA 1HYGA 4IF4A 3N8HA 5J4HA 5SZHB 2W00A 2R44A 4RSHA 2CSLA 3B48A 4YJ3B 2JRLA 1RKUA 3EC2A 4IO1A 3EA4A 2QI9F 4QOEA 5A71A 5D8DA 4HWPA 2V7QA 1OTXA 3IOCA 1QGZA 1KFCB 3N86A 5FWYA 5DBEX 4OHCA 1TAGA 4L22A 4YAOA 1GILA 1B1CA 1UUFA 2NO9A 3V8RA 4IIHA 2YOGA 2J3QA 4HEA6 3KTAB 4GX0A 2EDCA 1U3WA 4IIDA 4LZZA 5C80A 3SHFA 2OTLV 1V8OA 3FNRA 4EPXA 1B0AA 2A78A 1XZHA 3WIOA 1ZMOA 1U2PA 5AVRA 4TQAA 3WY9A 3VVLA 1H8HG 1W4ZA 1UANA 1V48A 3ORQA 3OJEA 4QXRA 5AOVA 3KIZA 2BCCH 1OLUB 4AZWA 3CCFA 5CCEA 3FJOA 3RFCA 1X59A 4WK6A 1MZFA 2ZVDA 2J6IA 4YFYA 3SHOA 1U4OA 4KKVA 3LYBA 5EAZA 1JQJC 4HYYA 4I7ZB 3GDHA 2PY6A 1M6YA 1W25A 5TEWA 1B8PA 1XZGA 2DUWA 2YXDA 2CMGA 4R05A 4ITUA 1VSTA 3RAJA 3UQ8A 4KQIA 4KRGA 4QQFA 3H1AA 5H4HA 2CDCA 4I66A 2BFFB 3HCCA 5MFZA 4FM9A 2M2IA 5CLJA 2PGOA 2VDWB 2XSZA 1G8PA 3PCRB 3WO0A 2C9YA 1CBUA 2G0AA 3UM9A 1Y82A 1GT6A 4FGKA 4XYBA 4BHTA 3W90A 3P27A 5E1OA 1QAOA 3E3NA 1QTNA 2PBZA 1S5LZ 3TZCA 3HEAA 1BH2A 1DEOA 1Y5LA 2FDXA 2L17A 1JA9A 4RF5A 2WUFA 1EXDA 2D62A 4FXPA 4BIIA 3EASA 4FN4A 5KTTA 3UXYA 2YC0A 3OC0A 3P26A 2O8EB 1YBMA 4EJ6A 3M5WA 3SX2A 1RC8A 5C53B 4YR9A 3ITDA 9LDBA 3U3DA 3DPUA 1KI1A 4R16A 3KM0A 4O4LB 3A6HA 1SQPH 4EKEA 3W4KA 2IXEA 1E5VA 1QTQA 3PGLA 3PE3A 4C8IA 4GPBA 3HB1A 3N0WA 1RXCA 4IQFA 4CG2A 3JWEA 1CZOA 1Y7IA 1QHHB 2H1HA 3H7AA 3SHQA 3LYAA 3CB2A 4QE7A 2X6RA 3NT4A 4KRXA 1B26A 1EP1B 4RY2A 3MTGA 4YHBA 2V4UA 3O38A 2D1QA 2Q0QA 4E88A 4P3XA 3QNEA 2Q7OE 5THKA 1FYJA 1N2XA 1QBZA 3R0QA 2IIBA 4W9NC 4N1AA 1CRPA 4P34A 2AG5A 2ZUSA 1ZNYA 1P77A 4Q01A 1CVLA 3N5CA 4JK3A 3UKJA 1EBFA 4K9SA 2C95A 3L1HA 5FBZA 4PCAA 4NV0A 1T0JB 3H2HA 2AF4C 3WI7A 4XYEA 4XIIA 3URMA 3L4SO 3SR4A 4F3KA 3ASYA 4LBVA 3V97A 3ROTA 1P62B 4MVJF 2J30A 2RGRA 5EHQA 4HWOA 1O58A 3T52A 3T7TA 2R84A 4CMIB 1FMLA 3HBMA 1U96A 1YRHA 1EAYA 3ZGNA 4IJMA 4EF5A 1EUZA 2JCYA 4AKHA 2OG1A 5CW1A 2FW9A 1HMPA 4JI6O 3L82B 4UFPA 2ZTVA 3D36C 4F12A 2QJTA 2FP3A 1NZJA 1I4OA 1PL0A 4JLNA 4QOGA 5B1OA 1QS0B 1LLFA 1WNTA 3M49A 5IXJA 3OJ0A 4JMPA 4CUJA 2WC1A 3P96A 2XNDA 4MV4A 1MEOA 2WZDA 2QVLA 5D3MA 3HSYA 2ACEA 5CH5A 3K20A 4R31A 1CJVC 1KERA 2PSDA 3SZMA 4LVOA 1QRUA 3H0KA 1P7GA 3V46A 3K9FC 4QU5A 2GZ1A 1MORA 4IOJA 2EWMA 1AO3A 2X8LA 2XUJA 2B1JA 4D98A 3KZ1E 2O54A 4PVDA 5IW8A 4ZEVA 2A7WA 1T2CA 1QOPB 1KVUA 3VQYA 3PTLA 4E4TA 1DBWA 3E18A 4ZZ2A 2WINI 2Y68A 3IR6A 3AVTA 1XU7A 5CGQB 4I1IA 1YCIA 3VPSA 3KAPA 4IDNA 4DREA 3PX7A 4S1VA 4D3ZA 4DY4A 2G9QA 4C87A 2PSFA 1MO5A 3HLYA 3AUYA 3M8AA 4DRXB 2RK3A 1C4XA 4LXQA 2ZRDA 3ZTTA 4PPGA 3GDFA 2OXIA 5IX8A 3QENA 4HYEA 2X0FA 1AGRA 1MB9A 3AFOA 1FMCA 3LLVA 4MUBA 5CVCA 3R7NA 2I2WA 2FSFA 5DXFA 3IIEA 2YHUA 1FAFA 2YJGA 1MGPA 4G4IA 1NLMA 2PKRA 2IZ6A 3D0RA 5AKEA 3GGDA 1L5VA 1ULZA 1XNRO 3SHWA 2OSVA 3CLRC 5DNVA 1YR1A 3GLFE 3UG6A 2QN9A 3IEIA 1T2UA 1HQDA 4RTKA 2B35A 1IZZA 3HO6A 1Z6XA 4GLXA 2BR5A 3K15A 5F9MA 1FS0G 1SVNA 1Y1PA 2XDQA 3M5CA 3EWSA 4W4KA 4C2BA 4HQFA 1A9SA 1GRCA 4Z99A 4GLOA 1NXVA 1GGMA 3Q7PA 2FGYA 3R7WB 3VNRA 3AEXA 1SY7A 1H5QA 4OFXA 3KQOA 3MCAA 1I7PA 4HBNA 4DCTA 3WYDA 3MBIA 3NT5A 4R1LA 1ZWKA 1S8FA 5IASA 1I7QB 3VVMA 1SIBE 5FUQA 3DD1A 2I3AA 3TF5A 4GI3A 5EGSA 1YJ8A 1C8LA 4ZYTA 3W7AA 3FPLA 4AO6A 5C1OA 2EBFX 4LFBO 3T9DA 4HWKA 4M54A 1EVIA 1E3EA 1JG7A 4BAZA 1S2OA 2VBGA 1CUYA 3V6MA 2J3LA 4HAMA 4IDFA 5SYNA 4D45A 3TLYA 3OQVA 4L7VA 1ORVA 5HOEA 5CX4A 2XXAA 1TDJA 1Z56C 3Q3IA 1QLNA 3K3WA 4OXYA 3W2FA 1DQSA 2IHVA 1XEWY 1Z0UA 5GV7A 4JJ7A 1M90H 5EKSA 4XAQA 1N9GB 2J87A 3C6BA 4K6CA 5DIFA 1C2TA 4GKVA 4F5WA 2Z5GA 4A6DA 1KPIA 2IU3A 4A8TA 4DMHA 5HKOA 2C3OA 3T94A 4LSMA 1AQ6A 1O6FA 1NIJA 2JIOA 1SUFA 1T5DX 4OXXA 1I4LD 5D2CA 1VQ4F 3TETA 4Z86A 4F4IA 3Q3GE 4RO2A 3QUTA 3EPLA 2VF7A 5B4UA 1RWOA 4YJ3F 5IZCA 2C00A 4IIGA 4YRBA 5IKOA 3WMGA 1KVRA 2AIFA 4MW6A 4B3SO 3KVNA 3B1KA 1DMRA 4G4XA 4N23A 3F0GA 3IO3A 2LGQA 3TEFA 3JALB 5H80A 1FYFA 3KHKA 3GZNA 5KVQA 3B5EA 3QVKA 3DVLA 3UA4A 1P4AA 4RAQA 5KHAA 2ZBRA 2VHJA 1XBIA 2YYSA 5D5HA 1X1BA 1BMFA 3ZY2A 3CJQA 3HRIA 5ALZA 1SC4A 2C7PA 3U62A 2VUHB 3BXOA 1B8NA 3B5IA 5KCZA 2PUSA 4ZTUB 2DKNA 2X9GA 3HCNA 3WJQA 4ZPXA 4UHCA 2HHCA 3L8EA 3SSMA 2XBLA 3LUPA 4YGXB 2YIAA 4QX6A 4DUZB 3W3AA 1ZD2P 1T9GR 3C0KA 3L93A 5F4ZA 1UDBA 3DAGA 5GGYA 2C2ZA 3DVQX 1A5ZA 4O25A 1JHQA 2YY7A 2EHJA 5JAPA 4DT1A 4U2GA 1WHTB 2DTDA 4B7ZA 4WESA 2G71A 3MSXA 4KXFB 1E3DA 4HZUA 4US1R 2XNSA 3LHIA 1M10A 4X7RA 1X7XA 3ZLVA 3W7BA 3WLEA 5JS6A 4QHTA 3FMIA 4WLOA 2WTEA 5EG5A 5LFAA 2X76A 1F17A 3QX7A 1JYSA 1JH9A 1Y37A 3ICPA 2WB4A 1JHUA 2R1UA 3QWIA 3OIDA 1BOFA 2ACVA 1R00A 1PS0A 5IKPA 3AY7A 1VKNA 4IRXA 4BIZA 3BPSA 3B7WA 4NWIA 3M3DA 5EC1C 2NLOA 3L4JA 1SXHA 3MHHC 2JEZA 3I09A 4F3TA 2BFCB 3FF4A 1E8MA 3I5MA 4TVBA 2QL5A 1T6BY 4XR4A 4NR0A 3CUKA 3LQ1A 4R1SA 4R2LA 4H15A 1L5ZA 1OWMA 3K32A 2FMUA 1RQNA 3WWPA 3C97A 3NAMA 2CVQA 1XVUA 1UFIA 2ZKOA 1PQWA 1WZUA 3QVXA 4GVXA 3ABOB 1PEKE 4TKUB 3M6AA 2IY8A 3BYQA 1DAFA 4Q47A 1KAHA 5F3RA 4KR0A 5F5NA 1FU4A 1LW7A 2W4IA 2W6IG 2I7VA 1G5IA 2QDXA 4R2XA 5EPEA 3W1WA 4NZPA 3HXTA 2VBFA 3EHBB 3PYXA 1TCCA 2B83A 1WB9A 1AB3A 3IURA 1E9AA 4IG9A 3SIWA 3D2LA 2ODMA 1V6AA 4TVKA 2KBFA 3K0AA 3NFYA 4UULA 3USES 5BV8A 5EWJA 3LT1A 3WZMA 2Y66A 2QRPA 2QD1A 3B13B 2QRJA 3ZE1B 1R3JC 1KD1W 3OHMA 2G0NA 5SICE 1QH9A 4H33A 1O6ZA 1VH8A 1P7WA 3DBRA 5JSZB 1UJBA 3ADDA 3DXZA 4Q3LA 4CG3A 3I7TA 1EUYA 5E9AA 3RS5A 4C4SA 3MYYA 4LYGA 3S2GA 4X44A 2CVFA 3CEMA 1BVHA 1CW2B 5EIXA 2BKEA 3TRIA 1L5SA 1OJHA 3LGAA 4B74A 4Y67A 1X7OA 4W9RA 4BCCA 1S7CA 3BIFA 4WADA 4WFIA 2EKDA 5EQDA 3RTEA 1JFTA 2P78A 3GEBA 3D7RA 3D01A 2EERA 3BQ9A 1JHOA 1HX7A 2EWWA 3DYBA 4AJKA 5GZ3A 1NSTA 4GMFA 4K9MA 4R8RA 5E9QA 3FYTA 4P31A 4HNHA 3H1IH 3D8TA 1K33A 1MVLA 2QAGC 2ZIZA 4G01B 3QP9A 3ZRXA 5KNDH 4YNBA 1PJAA 1X1EA 4XOUA 4AZSA 1CZNA 2OVFA 3WPWA 3NALA 2B8JA 1CJMA 1UK8A 1Z2NX 1L6RA 3UH0A 4P4SA 3PRYA 3KJXA 1Q91A 3FVTA 4PA3A 3QJGA 4OCZA 2BGKA 4UQPA 1BCSB 1FU8A 1JIJA 4YO8A 2JIMA 2VHUA 4JXJA 2PGJA 5ECGC 3KQNA 1ZNWA 1K1EA 3MCUA 2JJ8A 3EXFB 1ZUWA 4QDUA 4FFOA 4MYSA 3NYIA 4UOQA 1RLJA 3UUGA 3INRA 2PLAA 2NYRA 2Q1WA 3DCNA 3K9SA 2FTKE 1E5QA 1R9GA 3RA5A 4NCAA 5EXSA 3LGXA 2B5VA 1FIUA 1WMSA 1E9VA 1ESNA 2PS0A 2IH3C 5FT9A 3MWFA 1DT9A 5HY1A 1XRLA 1DKUA 3KHSA 3MXOA 1T5SA 2IY7A 1IOLA 1K3FA 4TTJA 3GLHB 3I28A 2P4SA 3VISA 1P45A 4KI7A 4LJAA 5BVGA 4WHMA 1V4NA 1YDHA 4U00A 1XPJA 2HWWA 1CUWA 1ZJ4A 4TXLA 3IP9A 3AEQB 3DMFA 4GSYA 5GPBA 4C2TA 4EG6A 2OZPA 4FKZA 3MUFA 5BT8A 4CS3A 3IDAA 1IBMB 4Y9RA 3ZY5A 4CM9A 4ZDJA 2OXFA 1T5TA 3KTFA 4K6GA 5KYGA 4G41A 2FZ4A 2CUTA 4NAUA 4E5YA 2HRQA 1V2GA 4IIBA 1FFBA 2IYUA 2X2EA 3CVWA 4Q7QA 4FW8A 3V1MA 2G88A 1CRZA 1P2DA 4K9DA 1JR9A 3NP7A 1PAUA 4KAAA 2CBXA 4RAOA 1JN0A 1A9XA 1USUA 3EMKA 1YVEI 2DQYA 3A4IA 1RQRA 2MK3A 2QE7G 1SK9A 1Z33A 4KN8A 1ZNZA 1U63A 1RRCA 2F8MA 3ZXYA 4AP6A 4KV7A 4Q03A 1GPLA 3VPBA 3EOBI 2L69A 5JALA 1CUVA 4KN6A 2HZBA 4R8VA 4JYBA 2J9FA 4UCTA 4F2PA 2FRVA 2YHBA 3T5TA 3NI2A 1IC6A 1HEUA 2HA3A 1DK1A 4EIWA 3C9RA 3NR2A 1MX1A 2CNNA 5A7HA 1G2QA 3WWZA 2Q2VA 1RYZA 3DKIA 1KC8W 1JT2A 3BE6A 3S28A 5HYVA 1SXGA 2ZAOA 3QVWA 3CISA 5ENZA 5H2FZ 1I3CA 3AG3B 1YHQF 3ELYA 1F38A 3C8UA 1QE0A 4ESEA 5BNIA 3G2OA 4CTKA 1DEHA 3VX4A 2DFKB 3A1WA 5K8TA 3ZIDA 4BEBA 1LJUA 1PFGA 2CT8A 2R1VA 4E1AA 1OIWA 2LKCA 3DM9B 3GEGA 2VWKA 5JXHA 3T7AA 2W6MA 5KDLA 3G2LA 5AJWA 3UMJA 2OFXA 4FW9A 2JCXA 3GG2A 1T0KB 2ZLBA 3REQA 4MRMA 1RA4A 1V47A 3NVIB 1TO6A 1Q3HA 1UMCA 1JVNA 5CLGA 4S35A 1G5TA 4PAMA 2ADOA 1LS6A 1ZO8A 1T4MA 1WQ4A 1VQNF 4HGPA 2BI7A 2X4DA 4LX8A 2RE8A 2EXXA 3AP2A 3OR6C 5JXWA 5TMBA 4DLBA 5IM4F 2Y3IA 4UPVA 3EQ8A 4JCCA 2ISSD 3GV0A 4G9GA 4UCVA 3E84A 3K9WA 2BFPA 3I64A 4BO3A 3V48A 5D84A 3OEED 4MUIA 4EI9A 2VHYA 2XVXA 1NG1A 4QTYA 2EFHB 4YP1A 5JNSA 2QW8A 4UPEA 5BSTA 4L73A 3F2VA 2CAZC 1P1JA 4EZEA 4MGKR 4RYDA 3PFHA 1MJ5A 1P73A 3S02A 2VYCA 4EVIA 1PLJA 1UBHS 4TLAA 1NZ6A 4CJXA 2C5AA 3K58A 1T5EA 1YZKA 1WDTA 3PL1A 1GFSA 4M1TA 4X41A 4DUYO 4OBBA 4J1NA 4B4WA 2VL7A 2WFAA 1KNJA 3D8HA 5IFKA 5GIPE 1JFFB 1F7UA 1L7EA 5KQSA 4LF5B 4G81A 5LQCA 2GKGA 1V3UA 2WE7A 2XAFA 1LQUA 1DE0A 5HRUA 3N87A 2X40A 1FFHA 2YX1A 1FFGA 1T24A 5BWCA 3DTUB 1ZH0A 3CJHA 1U7ZA 1RM4A 5BWNA 1PYDA 3NIBA 1JDNA 2J31A 2O6LA 1OPXA 3ZEAA 1OLSA 1Q7EA 5KTPA 3CLTD 2XOXA 3T4XA 4N8EA 5F1KA 3QHDA 2HB6A 5DYWA 5C9ZA 3LZCA 3ZJUA 1ZGGA 3F98A 1EP3B 1T2FA 3U49A 1ETHA 1R0LA 2ZVYA 2YXPX 5K8VA 3EVNA 2PJZA 1M83A 1KQGA 3GLTA 4Y7CA 1T13A 5JH7B 1E1RA 3PR3A 1YFZA 3GNLA 2O7QA 2G4CA 5JJ5A 1TW2A 2R60A 4KE7A 1OA0A 3P9YA 1OX4A 4G5GA 3IE2A 1R3KC 1K8AH 2CHEA 1EEHA 4J43A 4HNQA 4NE2A 1RKBA 3EY9A 3FR7A 2Z3ZA 1VA4A 1JEEA 1K4DC 2GAFA 2REQA 4V02A 2IU4A 2RJ3A 4NDZA 4RKRA 1YIOA 2W6JG 4TSRA 4BO1A 1MNQA 4N5LA 1QLWA 3MWGA 4KXWA 2IU6A 5AW3A 4ZZIA 3KJJA 5DGDA 3PD7A 4X0EA 2VJYA 5JAUA 3K06A 1ZEJA 1ML3A 3FD8A 3ERNA 2PGGA 1KR5A 1YRQA 1DWPA 3F1LA 3IBGA 4HTFA 3FJ1A 3MFYA 4AULA 2YHAA 4P22A 3VDQA 3FW1A 1CUCA 4Q3CA 5ANRB 1T1GA 1A4UA 5WRFA 1IMOA 2R6DA 3K5IA 3KKOA 4ZDWA 5TIIA 1IZ9A 4L16A 1XJ5A 1TKAA 2ZRHA 4HAVA 4UEQA 3KAJA 1VKJA 1S2NA 4QFDA 4B6SA 3OQIB 5KINB 3QHPA 4EB6A 1DBSA 4R8MA 1QU2A 1UPBA 1B0ZA 1LY1A 4P7BA 2QN3A 1L2TA 1IK6A 1EFPB 4PAWA 4JB0A 5ALUA 2GYUA 3ADOA 4QRHA 4QGAA 4R6XA 2GCNA 4JIMA 2QEXF 4GRIA 1W76A 5HM6A 3B5JA 4M9QA 4TS9A 1FYDA 1OFGA 5TT1A 3BAZA 2G1AA 3ENZA 2HMWA 2YWDA 1GTJ1 1RLIA 3UWKA 2P0EA 4LF9B 4YJ2A 2QR2A 3KC2A 4LJ9A 3G85A 4P86A 3LKDA 1EHYA 4KQWA 3IT2A 4D97A 3E5MA 1U3GA 1F2TB 3ISVA 3WMWA 3UB3A 2WQ7A 2VJQA 4RY9A 1BGWA 2VF2A 3S8MA 3ND8A 1QYIA 4G1EB 2IJJA 1ARZA 3H1BA 4R1PA 5DLDA 2D1TA 3V4OA 1FNSA 2Y0PA 2RBKA 4QVIA 3TCKA 3CR7A 1EFUA 4FFLA 4R6WA 4JYPA 5A02A 3T8YA 2XZTA 2ZRAA 4AM8A 1I1OA 1HDYA 3MJCA 3BMXA 1THTA 4LOIA 1MC4A 1COMA 5BNFA 1XD2A 4ASUA 5DLEA 1BQ3A 4KYIB 1K73W 4MLZA 4YRLA 2AMTA 2PBRA 3FB7C 1IIBA 1UDRA 5DYGA 1OCOC 3R20A 3L40A 2DPMA 3H8VA 1SUDA 1RHUA 1SBQA 4MAFA 4P9PA 3R9KA 5D5PA 4LMBA 2HG5C 1BS9A 1WSDA 3VKWA 2C0CA 2QRHA 3JSLA 3I1FA 2PUWA 3NC4A 4DTCA 1TUEB 4YPOA 4IIVA 2R2GA 5IBRA 3WAKA 1UJCA 4MP3A 1N5OX 1KEKA 3OQOA 2Z83A 4JP1A 4OQNA 1DEAA 5EIWA 5EP1A 3ZC3A 5EVJA 4Q9HA 5IJ9A 3H2IA 2AC4A 1F51A 1YA4A 4B3DA 4BKPA 1OHHG 3I01A 1FRQA 2R6HA 2BIFA 3WGZA 4Q00A 2R3SA 4OYLA 1REQA 3K16A 3CMEF 1W0JG 3IEVA 4HL6A 5GOTA 1PJ8A 1KK3A 4CMCA 4EQ6B 4JU9A 3T54A 5CXQA 1HP8A 4MUNA 1IY2A 1EN4A 1VDMA 2ACKA 3QEMB 3UWPA 1YS6A 1IL0A 4LDJA 1JKJB 2PKQO 4MV0A 1WMFA 4HAXA 2XBMA 2OYRA 3B1XA 3OAAD 1DKRA 2OAGA 3REFA 3V7UA 1FUYB 4EPVA 3ZPXA 4L8LA 2CNBA 3HHEA 5EMHA 3L71H 3H6GA 4DEYA 2VCHA 3DKVA 2A0FA 1SUSA 2B7BA 2QRNA 3C1OA 1DKQA 3MWKA 2J8ZA 4M9CA 3EC1A 3VSAA 3E2EA 3V1TC 2FDCA 4NR1A 1T9AA 3BIXA 2V0NA 4AJ4A 1DRVA 4CQMB 1ONSA 4KVAA 4BVKA 3AIMA 4RCYA 4NCBA 5JTTA 4DJTA 4FOSA 1C3JA 2W42A 2ET6A 3OZVA 4AT1A 3OCZA 1IB0A 3VZRA 3E8GA 4FM2A 2BD0A 2DVMA 1HLGA 3HPQA 3E8FA 1IVSA 4DIUA 4PY2A 2LW7A 4BE4A 1K5GA 2JJ1G 2ZIVB 2NIPA 5H6QA 3NWPA 4I1UA 2H6EA 2P9EA 2QUIA 3U7JA 3TKAA 3NVAA 3IUMA 2FCRA 3VO1A 5B1BB 3K35A 1Z0KA 1A9OA 3NHYA 1AOXA 2EX0A 3FWPA 1P18A 2NVUB 3S1SA 4TMYA 1Q92A 3FDZA 2JGDA 3CWCA 5DNCA 2Q6LA 5LL6Y 3GLRA 3H83A 3ON1A 1XPOA 2QTVA 2VBCA 3DF7A 5CFQA 4TTQA 4JUCA 1RWKA 4Q1AA 4DDUA 3QELA 1Z4KA 2V7QD 1WCXA 4C4AA 1GHTA 5ABPA 5ICMA 2JCSA 3X2QB 2GK7A 1WBDA 3R0XA 4X64O 1V1RA 4JL6A 1QIMA 1Z0AA 1PGJA 1VSUA 1Z08A 1G3MA 3S2FA 1VL8A 1UKZA 4ZMRA 5JCXA 1HSZA 2JGKA 3LKBA 2Y8EA 1EGVB 2FP4B 5CEJA 2VHWA 4ZZ3A 1MZVA 1YB4A 4ZV7A 4G1MB 4L8GA 3QX8A 5GVRA 5FTNA 1R4AA 5A5GA 1FFDA 5BQ3A 1GRNA 3NP9A 4CNBA 5ALSA 4DQVA 5IEBA 3PVZA 3DOHA 3BBLA 4ZOAA 4DABA 1Y76B 4BMNA 1D04A 2VJKA 4Q4AA 3ENVA 4RD0A 4G26A 2WIGA 3LRXA 4KO4S 3SEZA 1G2IA 1P6UA 3PS9A 3PR1A 4NTYA 3GHHA 1NVPD 1FW8A 4P1ZA 3GCXA 3TEMA 1OYVA 2PZBA 1XMOO 4AIIA 5JASA 3DVSX 4GX1A 1E9SA 3E27A 1JDJA 1XNQB 3AV3A 3LS2A 1FUKA 4GKKB 1TVKB 4ND2A 4PONA 2XSZD 1IBKO 2B5WA 4IDQA 3ZKAA 4AWXA 2PTGA 1RJEA 4I08A 4FNOA 3VYVA 2X8JB 1C1HA 1P9RA 2FV8A 1RXSA 5ADVA 3HL4A 5FR2A 3I23A 3V00A 1AKWA 2QJ1A 2PQ0A 4B79A 4F60A 1NVEA 5T4HA 1FYEA 2Q9CA 2HJSA 5CFLA 3UVEA 5C46F 1YKFA 1GM7A 1F6DA 2G3YA 4BNWA 1JLLA 4WOJA 3PWKA 1QVZA 4UOEA 3GVCA 5JH7F 2G8NA 3NVMB 5I47A 1SKYE 2SICE 3S3WA 1QXSA 2GHRA 1AUQA 2Z2IA 2Z95A 1R3LC 4OP2A 3F2IA 2VDMB 5HEKA 3B1JA 4AJOA 1JL3A 1LUWA 2Q6OA 1KZ7B 5ESRA 3FAVB 5HWEA 4YMSA 1N8NA 2MHCA 3WGQA 2UUAO 3GGCA 1CDZA 3STWA 1NDQA 5JV5A 4FHGA 4MEAA 5AW5A 1DBVO 2JAQA 3MA0A 2Y76A 3FB4A 2NPOA 4BB5A 4D99A 5KPDA 5JIBA 1M7BA 2WUDA 4J2HA 4NY1A 1HDGO 5FPPA 2CWDA 3DKKA 2O1XA 4QNMA 3IPRA 4BVHA 2HJGA 3VU3A 4TM7A 3SVTA 2C8VA 4MKHA 5ADWA 5I51A 3L5KA 1E9EA 3AY3A 3C90A 1RM3A 3H2YA 1HFJA 4HPJB 4B3RO 2Q2NA 3LBAA 2VWJA 1PM9A 3NRBA 4IGKA 4MR8A 4A2QA 4DSZA 5L3VA 4MV9A 1P39A 3N9IA 1FNJA 1LW6E 4DPLA 4EWLA 2YZGA 4NOJA 3I5AA 4PEVA 4C0JA 1X7ZA 3QEOA 1X7HA 4IUDS 2P9GA 4BT7A 2QR5A 4W7IA 1V9LA 2DYYA 5AW1A 4HLQB 1N9KA 5ARCA 3I01M 4ZYLA 3SE7A 1PR5A 2MSLA 2HT6A 1A9QA 3C1UA 5BQPA 5GIPC 1Z8FA 1L8LA 5DMHA 3MB8A 1E79G 5FL7A 3ZDDA 2A8YA 1XZCA 2VNKA 1QHXA 3A9CA 1CB0A 4L0QA 3PJSK 1D2GA 3BZUA 3I6MA 3A36A 2VHQA 3AJRA 2CSUA 2IOFK 4BMCA 3PEVA 3LDTA 1XDBA 4CZZA 1RAHA 4KIUA 4UU1A 1F12A 3Q8HA 1IURA 1B2RA 1MG5A 2XNDD 3AL2A 3OOJA 4KOEC 4FLTA 3HKCB 1A71A 3IH5A 5I5GA 3K1AB 4UATA 4Y2YA 1V3QE 2GPNA 2FETA 3H2JA 4GEGA 5DNUA 3TQCA 3ICCA 3GOQA 5P8WA 3AK1A 4UBJA 4BMSA 3Q7IA 1QCCA 4QXOA 3WZ2A 5LSAA 3WSWA 3BX1A 5FORA 3KUKA 1I7DA 3NJ8A 2I1WA 3WO1A 2YTZA 5GW7A 4NFHA 5HP4A 3LWNA 4K0KO 3IP6A 2A9FA 3GT7A 3H5OA 1XD9A 3QUWA 2COEA 2QPAA 2ZPAA 4UVDA 4ZT7A 1XQWA 2AFIB 4MQMA 4NH4A 4I4LA 3GPLA 3D1LA 2VN8A 3PL5A 4ZAVA 1G8KA 1T1RA 3ZRWA 3KYDA 4KX3A 3K1YA 4LF8O 1I30A 2P2GA 3MGCA 3FPBA 3F0FA 2YMQA 3K4HA 4FYWA 4OUDA 2WVHA 4EYQA 1QFYA 2ZT6A 3OMNB 5DTJA 2GD6A 2Y27A 4I1YA 4DR2O 1M0EA 5ALMA 5DLPA 2XMRA 4D82A 1B04A 5IP5A 4WFHA 5TVKA 2V6MA 4KIGA 3HUEA 4D3DA 3NJ4A 2CD7A 5FI1B 4K2AA 4MV8A 3PFWO 2EW2A 3DZCA 2G6BA 2QRKA 3TW4A 2UKDA 3TSOA 3WHPA 1RAFA 2M6RA 5BN5B 2IUTA 2ZRLA 2PGNA 2AE2A 3B1YA 4LFCO 3I6YA 4FJCC 2A7QA 1KOLA 2CCKA 4BVQA 2F62A 3PKZA 4H7DA 4ARCA 3D1JA 4ISCA 2R25B 5CBPB 1I2DA 3FAZA 1YTLA 4GRDA 3UKDA 1KJWA 3D8SA 2QTGA 5KDOA 4IWYA 4WA8A 4POAA 2DXIA 1NUHA 4HK4A 4IQ0A 4BBPA 3CKLA 1JQAA 3DAFA 1N75A 4QGFA 3BG5A 2JC3A 1SQQH 4YRZA 1VQ8F 3QOYA 4JA0A 1UBNA 1XKLA 4ZAFA 1S4QA 3ELWA 2P41A 1ISPA 3MG9A 2B99A 1NNSA 4PAGA 3IQZA 4BMZA 3KLPX 3NEAA 4HDRB 5IC4A 4L75A 4Q9IA 3SJBC 3KTDA 4X97A 1Y7HA 3B1VA 4P5DA 3OM9A 2C84A 4ID3A 4AILC 4PYQA 4C3ZA 1LVGA 5TQ2B 5EWLB 1EK2A 4X66B 4S0XA 1L5WA 3C3DA 1PS9A 3OECA 3ZS8C 4I1PA 4WV3A 2DUUA 3I6IA 4ND8B 4QXAA 4UBMA 1GQSA 2HQ1A 3LXMA 3LVRE 4OLBA 2OZBA 2PAAA 2XYVA 3SM3A 1Z82A 2PFKA 3TTYA 1ULUA 3KQWA 2VKQA 4PANA 3CLKA 3TECE 2BGMA 3ZZMA 4U2EA 5BRNA 2WWHA 4Z0TA 2ZVQX 5I4KA 1OFIA 4D43A 1EM6A 1QHGA 3H1LH 5C4GB 1TM7E 4DCNA 2YINC 5C7LO 2VI5A 3NUGA 2COUA 3TLGB 2Q5FA 1H2KA 4HFJA 3CX8A 1YBAA 4MQFB 2WT8A 2RHBA 4IICA 1XMJA 2E49A 4BVJA 1RZRA 3UUFA 4TXNA 3QVGB 4XB1A 5AHXA 5ALNA 2AYXA 3QBJA 1NW5A 1GG9A 3CNLA 1T1SA 4NF2A 3RJMA 2VIIA 2WF8A 3WB0A 1DTWB 5AHOA 4L4SA 2PD4A 1VL6A 1VE7A 1U5BB 3L5OA 1LRLA 3JU3A 4Q7LA 4BU0A 1ESCA 3W3AD 3RTBA 3IE1A 1LPSA 1YTUA 3KB6A 4QNRA 5EE3A 5TMDA 3F8WA 1FDUA 3A8TA 3TZQA 2B69A 2WFLA 4AUMA 4QOSA 4XCQA 1X2BA 3KQSA 1HLDA 2PSHA 3H0CA 1BWRA 1YC2A 1P7PA 4KAFA 2BMFA 4MXDA 3I56V 2F55A 3KXLA 4LBWA 2P2ZA 4PQFA 5TS3A 2G08A 2J5QA 2DCUA 1PV0A 1U8ZA 4QASA 1MB0A 1JEDA 1AB6A 1ZJWA 2WWXA 5ENDA 3AFGA 2ZYAA 1G0NA 1XCGB 1FS4A 3OZCA 2OO5C 3IUEA 3HGMA 4NMHA 4CL8A 5KYXB 5H59A 4LSZA 1GM9A 4ZXFA 4UHHA 3RUDA 3PFGA 3PU6A 5KAFZ 2FYTA 1OZ0A 1BYUA 1LBHA 3ZH9B 2JLQA 3VXKA 4HF7A 4MEBA 1S89A 5KWSA 2JVJA 1NI5A 3WBFA 4CMEA 1A7KA 2V7TA 2JLZA 4K6MA 2HHHB 2WIJA 2RC6A 1TZKA 1AGPA 4RANA 2MINB 5J4LA 2G38A 2FPUA 4HWTA 4XOIA 2ZSEA 2QTFA 3VRHA 1HH4A 2BDUA 3G5LA 5I7EA 3RYIA 4FZRA 1Z5NA 4D6TH 3D54A 3KRTA 3OPQA 2XJ4A 1EXMA 1T8WA 1RJ9B 3KEOA 2CNWD 4YT8A 4ALLA 3A10A 1K34A 3LECA 5LQAA 3KU1A 5DT9A 1U1IA 2Z1UA 1MFPA 1L4YA 3CCUV 5JCOA 4M0KA 2Q45A 1VYUA 4IDDA 4YAGA 5B1NA 2B5OA 4NABA 4XDYA 4AUKA 1QONA 1SZXA 5FTJA 1YDEA 2ZJYA 3GQBB 5E9WA 4HEJA 4YJDA 4AN1A 4LRYA 4PG4A 2I5PO 2HTFA 1RP1A 2N1BA 1NT2A 1JHAA 2XODA 3M6UA 4H3VA 4UASA 4IHAA 4IIFA 1ZJYA 4BFVA 3MRXA 4MPPA 4CQLA 2PU7A 1G42A 5K3EA 1EU1A 4EW3A 1Q20A 1G38A 2WAAA 2YFKA 5J5VA 4B8ZA 4MKGA 1U7XA 1NV8A 1WSWA 4AQYB 4RLFA 4MUAA 3LPAA 1E3IA 3RVBA 2ADPA 5AW4A 3F5SA 3QPAA 1ZRHA 4RF4A 5JFOA 3HBAA