3JALB

Cryo-em structure of gmpcpp-microtubule co-polymerized with eb3
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 150
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jalB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jalB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jalB01
5J2UA 5FNVB 3RB8A 5M7EA 4DRXB 5EZYB 3R4VA 2VAMA 3RYHB 3JATB 2BTQA 3ZIDA 3WGLA 5JH7B 1FSZA 5EIBC 5JH7A 1W5FA 4LNUA 4X1YA 5EIBD 5CA1A 5IJ9B 3WGNA 5EYPA 5MN6A 5MN4A 4EI8A 4X1KA 1SA0A 5LA6A 1TVKB 4O2BB 4TUYB 3RYCA 4U3JB 1W59A 5BMVA 2RHOA 4X20B 3RYIA 4TV9A 4O4LB 4E6EA 2XKBA 4ZHQB 2VAWA 4YJ2A 3JARB 3JAWA 2VXYA 3JARA 5CB4B 4IIJB 5FNVA 5CA0B 4WBNA 4EI9A 5LYJB 3RYFB 3JATA 3E22A 5EYPB 2RHLA 3JALB 1TUBA 5BMVB 3WGJA 1TUBB 4O4IA 4YJ3A 4EB6B 4O4IB 4EB6A 1W5AA 3WGKA 1JFFA 5KMGA 4YJ2B 3CB2A 4HNAA 3JASA 5JVDB 4I50A 5CA0A 2Q1YA 4DRXA 4B45A 5LYJA 2BTOA 4O4HB 5J2TA 4ZI7A 3HKDB 4FFBB 3JAWB 5ITZB 5JCOC 5LXTA 1W5EA 3V3TA 4XCQA 3E22B 4TV8B 4TV8A 4O2AB 3JAKA 5LOVA 1W5BA 4I55B 3UT5B 4X1YB 5IYZB 4LNUB 4U39A 3N2KA 4ZOLA 5JQGB 5KMGB 2R6R1 1SA0B 5LA6B 3HKEB 5JVDA 3HKEA 4YJ3B 4O4LA 4TV9B 3VO9A 4X20A 4O4HA 5J2TB 2RHHA 1OFUA 4B46A 4X1IB 3N2GA 5GONA 3M89A 3RYHA 5IJ0B 4X1KB 3WGMA 4HNAB 4IIJA 4I4TA 4WBNB 2Q1XA 5ITZA 5LXTB 2XKAA 3N2KB 1RLUA 4DXDA 1FFXB 5CB4A 3VOAA 4O4JA 1TVKA 1Z5WA 4O2BA 4TUYA 5C8YA 3RYCB 4I55A 3UT5A 5C8YB 3JAKB 5IYZA 2R751 5LP6A 4F6RA 5MN5A 5LP6B 3RYIB 3ZBQA 5KX5A 4ZHQA 2RHJA 3HKCB 4KWEA 4IHJB 3HKCA 3N2GB 4EI7A 3JASB 5JCOA 1RQ7A 2GVIA 3ZBPA 4I50B 4I4TB 3M8KA 4M8IA 3HKDA 4FFBA 4X1IA 5GONB 1JFFB 5IJ0A 3JALA 2VAPA 4O2AA 5LOVB 5LP6C 3VOBA 5EZYA 3RYFA 4IHJA 4O4JB 5JQGA 1RQ2A 1FFXA 4ZOLB 1W581 2BTQB 3VO8A 4F6RB 1Z5VA 3VPAA 5KX5B 3HKBA 5CA1B 3HKBB 4ZI7B 5IJ9A 3C8LA 4U3JA 5J2UB
chains in the Genus database with same CATH superfamily
3LUDA 2HA6A 4BV2A 2JFNA 4G8JA 3UM9A 4DR1O 1RMQA 2HU7A 2MT9A 1OZAA 3FPLA 4NONA 1T0AA 5FV7A 1OREA 3E18A 3NJ4A 4DQVA 3IEMA 4QNMA 721PA 3B8MA 1KC3A 2H07A 4WXMA 4C8GA 1AZSC 3LWDA 1JAYA 1RRPA 2AR9A 2JH9A 2V3WA 2L19A 1U7UA 2XDAA 2WU8A 2GD6A 4PRYA 3OP1A 2IBTA 4A4DA 1PNKA 4RQFA 3TSWA 3DD1A 2WU1A 2DHQA 1N2XA 5CN0A 4HRXA 1C8KA 4NH0A 1WVIA 4B3FX 3I6BA 4CN8A 4ABMA 3LXXA 5DN6G 3ILHA 4L28A 3DLHA 2B21A 4WASA 4M9SA 1IEXA 2UYGA 4ZQHA 5LM3A 1R50A 4QUKA 4RZUA 4ROTA 3OA0A 4YJ2A 3W7UA 1D2DA 2JC3A 4FOTA 4IH9A 4IDOA 3V1YA 5A5DA 5C2JB 1WIWA 3HNPA 1JWLA 4IRMA 4G25A 3PXUA 1GOTA 1VMDA 1XQYA 2GRJA 4Q1FA 1QS0B 2LDBA 1PSWA 4ARZB 1E1KA 3O4GA 5EUCA 4FKMA 2OYRA 5JAMA 4CMAA 2JIDA 3LYUA 1H9BA 2QAIA 1W73A 2FPWA 3ZR4B 4B32A 1RDFA 1ZICA 3F5QA 4IH1A 4UU0A 3N76A 3CG6A 4HXYA 1T9ZA 4RELA 2GBGA 3S1AB 4EO7A 1N6KA 1RAAA 3VSBA 2WMDA 4RY0A 3IC5A 2Y1GA 3V8RA 1BA3A 1EVZA 4HAOA 3CNQS 2RB4A 2CFSA 4LC1A 1Z6ZA 4V02A 1KE1A 2FMUA 3QBTA 1P9NA 1UFRA 4CMBA 5EJ9A 4PW0A 1KRXA 5KHHA 4UCFA 3WTCA 2QRVA 3BK7A 4MS1A 5IZ4A 2ZUBA 3S1LA 1TEXA 2WA3A 1GTRA 3LPAA 3ELBA 4RK5A 5AOCA 4FLMA 2ZYHA 4NKRA 4LNUB 2JJYA 2Y3IA 1VIMA 3HCDA 2WDPA 4QXMA 2UUPA 3QPDA 2C59A 1P2BA 2CXQA 1P39A 2XVYA 4Y7CA 3NALA 1OASA 1CZLA 1O6GA 3D31A 3U3ZA 4DYVA 3LWVC 2Z5FA 3IEPA 3FROA 2I65A 4MRPA 1CUIA 2V74B 1FFAA 4GXNA 1FX0A 4KWTA 4BLOA 5KIAA 1XWWA 3MFQA 1CERA 1QH1B 2FPUA 4DR7B 3RE3A 1COMA 1THGA 1R6XA 1ZOSA 2OV8A 3H1AA 3GDOA 3CEJA 3UPDA 2ONCA 4D44A 1YF2A 5T8KC 1R0LA 1YS4A 4WNCA 3F5TA 2W11A 5FPRA 3D2AA 5BSHA 2QW1A 1XEXA 1MN6A 2WC1A 2MJLA 5MGNA 2UUAB 3MWJA 2P30A 4N1AA 2ZYWX 2V98A 1TAUA 4RC9A 3LWPC 1K7DA 2HXYA 2YHIA 2WLIA 4H7JA 1KECA 1XCBA 2I29A 3C3CA 3W3AH 1NUTA 3R6TA 1DP4A 1XA0A 1K98A 4C6SA 3HXMA 5HS4A 4I5GA 3ER9A 3GNQA 5EN4A 4YDQA 2G77B 3GMSA 4OL9A 4XPIB 4YJDA 5AKEA 4H13B 4OOFA 5JAQA 1OT5A 1JJFA 5BR8O 4Y2GA 4DIEA 4HDNA 5FPSA 3RVBA 5DEIA 2GBIA 3BXGA 4IO1A 4EL0A 3GVMA 3E23A 1VC2A 4OK6A 4YY3B 3PIRA 1Y6FA 1H2GA 3L9XA 2YCBA 3BGDA 3CIFA 3ROEA 2VXOA 2GA8A 3EZGA 4EKWA 1X9GA 4N12A 4D2IA 1TYCA 5FLXA 2IXFA 3P4EA 1M2HA 3VPFA 2D13A 1T9BA 3HV0A 2DSNA 4XRRA 4D9IA 3RFRA 1M6VB 4C05A 1WSDA 2BTEA 1TZBA 3KHNA 2V3CC 2GHYA 2O57A 1FOEB 4MGEA 2VT3A 3ONWA 4LXXA 4ZVVA 4AWAA 4D9MA 4JL8A 2CXTA 4DG5A 3E61A 3ZX5A 2XKKA 4G9GA 3ZTTA 2A9RA 3FPSA 4HXFB 1BMFG 1Q22A 4FONA 5JSFA 3HCBA 1R1BA 3ZJYA 2GFIA 3G1WA 4ZVKA 2L6LA 1G42A 2C3OA 3NWBA 3GMDA 4KXMA 3I6IA 2Q9BA 4K40A 1RBMA 2ISQA 5A3JA 1N5IA 4GGMX 3EEYA 3VAYA 2XYVA 1OWNA 2OCLA 4UU1A 2BFBB 5ICGA 1NYQA 1G4YB 3PLAC 2IL1A 4GL2A 1XL1A 1UK7A 4XX1A 1ODKA 3IP8A 1H38A 5EI5A 1Q50A 3KB2A 1EB9A 4BXOB 3QWHA 4FWTA 2O05A 4OXQA 4ZDKA 4MRSA 2Q5OA 3RYIA 4E12A 1XROA 4B3JA 5J9PC 1BG6A 1ELOA 3OIYA 2EV9A 4RMNA 1FYEA 4INAA 4LRSB 2G1JA 4Q4JB 5E2AA 2AG5A 2XUPA 3AI2A 2HGSA 4ETIA 3JQBA 1G19A 1PV2A 1YHYA 1KDYA 3ZCSA 2V7WA 2XDYA 4A26A 3FFBA 2O8NA 1KZGB 4UTPA 3CC7F 5IJWA 2JFQA 2WBLC 2YN2A 4GI2A 2J3KA 2UXNA 2C5SA 3PICA 3QU4A 1V26A 2PH5A 3EYWA 3O1JC 3OJLA 3F3KA 2PGJA 2CNWA 1EIZA 5FPTA 1J95A 4HGOA 1AI7A 1PL4A 5LN1A 3EXAA 1N0VC 1CZKA 2OTJF 3PQ2A 1U8YA 3IPCA 4NJMB 4FBLA 4MR9A 3C8HA 4Q3EA 5J2TA 1LLDA 4PD4F 2ID7A 4BVRA 4AURA 3ZIAG 4AZ3B 4Z9BA 4NFLA 3QEBZ 1K34A 2GSMB 5KJFA 5B2EA 5ALLA 3CC8A 2VTKA 3LC2O 2BI8A 3T35A 3ZQUA 5B4UA 3HA5A 1IC6A 3EUWA 1JPXA 1KMQA 3OX3A 1XR3A 4RPKA 1KNJA 1ZVMA 2H2DA 3SEQA 3VNBA 3KETA 1J21A 3JWIA 4AUEA 5COBA 4IINA 4Y1FA 3RE1A 3GRVA 1CQXA 4GVLA 1XTBA 5A9SB 2PZMA 3DHEA 2YQZA 4FEGA 5JSHA 3KTAA 2O5RA 4XUGB 5HGJA 1UBCA 1N2JA 4WECA 3IT2A 2NO5A 5AUNB 1CF9A 3PC4A 4LX8A 4ZCQA 2IU4A 1MABB 2BHNA 3DB2A 1FQOA 1T36B 1Y7PA 1X80A 3I42A 3IUBA 4EHAA 2XQIA 4NI5A 4QOSA 4B71A 2I7DA 2HDOA 1KEZA 4DO2A 1GQYA 3QMWA 4LJSA 3LWOC 3AOGA 1AQYA 5AVOA 3AY7A 4YT8A 2H2HA 1KI2A 2QPAA 3SXUB 1RADA 2ZJ4A 3FSGA 1N8KA 1RYHA 2IKQA 4JLDA 2X1LA 1CS0A 2CLSA 2VF4X 1L5NA 3T3HA 1C5KA 2C2WA 2WSYB 4H1TA 4EITA 5KEIA 2H18A 4JIGA 4JYPA 3GV0A 1CF2O 2C42A 1PN3A 4HHEA 2HHHO 4PLZA 1PF7E 1P2SA 3G71F 4IOKA 1PZEA 5BO5A 3T7TA 1G6UA 3BN3A 4OYYA 2VKTA 1VMKA 2I03A 1XTTA 2FFRA 3KVRA 4UFPA 5JALA 1U0FA 3TXSA 2YVQA 2P5YA 2NU9A 2V7UA 1XJWA 1PVDA 3HP7A 2P62A 2ABWA 3DEFA 1W47A 1LW7A 3HHPA 3QH4A 4P08A 3VUEA 5A5VA 5FWYB 3UMSA 4G1UC 1JXMA 4OOEA 2Y05A 2GPYA 1VP7A 4GR9A 4Q3DA 4BRSA 2O8EA 2GR9A 3R4VA 3CUUA 4JYBA 2GESA 4C7XA 4N0DA 3W7BA 4HUJA 1GV1A 3G6WA 4NK4A 1KBOA 2NXWA 3A6PC 4OLFA 4RUFA 3TZBA 2C4TA 3ABUA 4UPDA 2CUGA 2G36A 1Z4OA 3LE8A 4C4OA 3DHYA 4MOWA 3IB3A 3Q40A 5IAEA 3EVKA 1JHPA 4YRRA 4MW2A 1AKVA 3H19A 2I6TA 2CYCA 4NCBA 1USWA 2PN1A 4N3GA 1VCNA 2NWQA 5JSYA 2QI9C 1DMSA 1OIWA 4K3AA 1BA2A 2JJMA 1FB5A 1JDBB 4FYWA 1S2IA 4BMSA 4GC9A 1WF6A 4NMXB 2EJWA 4WZAA 1LU9A 4PM4A 1YC2A 3VQWA 3CUTA 4BKPA 3GT3A 2OCKA 1EK6A 1NXSA 3EXHA 4QIHA 4KLNA 1TQ4A 2JB9A 2PZJA 4LJAA 4QOHA 3SMQA 4F1JA 4B4DA 3W8DA 1A9ZA 1LBIA 2JIOA 1NW9B 4KZKA 3KEMA 4MS4B 1SCAA 1T9GR 1ILWA 2JGRA 2QLMA 1TU4A 2MIIA 1UFIA 2BGIA 1ISIA 3E2MA 4CBCA 1N34O 5FEMA 3CVYA 2PT7A 4GBMA 3AF1A 2YXLA 3THOA 3VSAA 3KXKA 2IIPA 3LMKA 5BSUA 1FFGA 3NV9A 1U11A 1UP7A 1WDMA 1XDZA 3OU6A 4RYDA 4IOMA 4NR0A 3KKQA 1GYRA 1B6TA 2AYZA 4DLBA 5INTA 1EZVH 4FLFA 5LQAA 4HTAA 5TQ0A 3QELA 2P0AA 2Q4TA 1E58A 2W58A 4LV8B 3ZWYA 2RCYA 3OFJA 5L3EA 2W2KA 1NDHA 1QH0A 1XHLA 1D1SA 3IQFA 4O59O 4JGSA 1H4TA 4OV6B 1VPWA 1BQ3A 2OMEA 2ZR9A 3H9BA 1XZIA 3K70C 3T7KA 1PF5A 4QTTB 1CEZA 2HSZA 2ZB4A 3FNFA 2WLNA 1MOQA 1RCUA 1ID8A 3I4LA 1UUFA 4HBGA 1X1QA 3B2EE 3A14A 4DV2B 1OX4A 4XM0A 3UAGA 1BE8A 4WEQA 3LZCA 4Y6LA 1UMDA 1ZMTA 1RYYA 3LQYA 4L72A 1V9CA 1KUQA 5K0CA 4B7EA 4HNTA 3WK6A 4C87A 2DB3A 3A37A 3NUQA 3E84A 4PGGA 2VSOA 5LXTF 2XZLA 1CV2A 1LLUA 1N57A 1O8CA 1W4ZA 1M2GA 4C8IA 2VJDA 3OQPA 4S1VA 4O4JA 1BGYH 4OXRA 2OSVA 4CCYA 4UVBA 4TLMB 4L87A 3C3XA 1X7WA 5D1HA 4NAUA 3TI7A 1BGXT 5FLXN 3BA1A 2D1SA 3IR6A 2QI9F 1S2MA 1FS4A 2ZRPA 4N3CA 1HURA 2Y68A 1GGJA 2C3YA 4GMHA 1RYEA 3OFNG 3UYLA 3ZZUA 5JCOA 2QVYX 2V8OA 2WVHA 1BYIA 4MQLA 5F4ZA 1KYTA 3MJ4A 3R9WA 2ZJ6A 3EDCA 4NYMQ 1ETHA 1L7DA 3OUTA 3FAVB 4ITVA 3QENA 4P3PA 3V4SA 4E5KA 1CXZA 4DW1A 1U5BB 1Z56C 2FK8A 2DWEC 1UEIA 4ML3A 2N75A 4OXXA 3UZUA 4H17A 4ALIA 4C04A 2J3JA 1Z0IA 2EBFX 3EIXA 3HXKA 1C8LA 1Z0DA 3ANXA 4WINA 3UFXB 3BY6A 1XEFA 3ZVKA 3D1JA 4P4LA 1CY2A 4WFEA 3DW1X 4IVNA 1CQIA 1K73H 2Q3DA 1MA0A 2EU8A 2PXCA 4FGJA 4RCYA 4TT3D 2ZULA 1QU2A 3N1UA 4U6NA 5F5NA 4IIEA 1D7OA 4W4KA 1GITA 1Z4NA 2B4RO 2C0QA 3BCUA 1RXWA 5KLVH 1FP4B 1V48A 2PANA 5BSGA 1RRFA 1KJJA 1RJFA 2AX4A 1GTOA 2ISSD 4ZZ3A 1SZPA 3A05A 4KR3A 2BCCH 4B4OA 3R3YA 1M93A 3QO8A 1KC8H 5AXBA 5EKUA 5IJAA 3TAXA 5BORA 1C9MA 5H2FZ 5BN4B 1NXTA 4DA9A 3PQEA 3K70B 1GKLA 1LPSA 1SC3A 2HQSA 5CDYA 4UCVA 2GXUA 3A1DA 2KYRA 4AKTA 3PC2A 3G9QA 3OMXA 1HORA 3ER6A 4Z2YA 1SO8A 2JHCA 3VR1A 1YE5A 4I9FA 2AC7A 5HYVA 3DAGA 4TUYB 4J10A 2D2EA 5IT5A 5JJLA 2I2FA 5DT9A 2OTCA 2XXAB 4MGYR 1PD0A 4RQAA 4XSGA 5KTMA 5HF8A 1AVTA 1GPAA 4UE2A 3E1YA 2HYDA 2LCQA 2M32A 5HUJA 2JFVA 5B58C 3PHBE 1REQA 2ZJBA 1QU3A 3DPIA 3JYQA 2WKPA 1DWOA 3CLUC 4EEKA 2QE7A 4M60A 4MPJA 1G8YA 4M0DA 4MVXA 3D4BA 4RLFA 1T0UA 2B8EA 3T4EA 2DPHA 4C4RA 1ZMBA 3BERA 4YT2A 1PS8A 2RSLA 3ZWBA 1FA9A 2QX4A 4PX3A 5LBUA 4CLRB 3DWFA 3U4IA 1QLWA 2WZBA 5BQ3A 1FC0A 2BHRA 1ZOPA 4MQ5A 1K92A 2Q50A 4XYEA 3L7MA 1P0CA 4AJHA 3WGKA 4CQMD 5C81A 3EAFA 4RVNA 5TIIA 4PANA 2D2IA 4Q15A 1SESA 4YHHO 1I6LA 3CUYA 4QBGB 3UMMA 4OY3A 1W25A 2WHXA 1PQYA 3K31A 4MPRA 1DF4A 2PZGA 4L4UA 1GM7A 3JU3A 1L4HA 4KVGA 5A4MS 1SU7A 3KAKA 4NATA 4BBZA 4ES6A 1ZL0A 2F3PA 4RVOA 5I9BA 4W5NA 1YZQA 4UARA 3I6ZA 3M3PA 1UKEA 5HKAA 1FRVA 1XSEA 3RS5A 1E9RA 2XMGA 3VO2A 4EFKA 5IFKA 1OH8A 1KZ6A 1WU8A 2FP4B 5DM60 4OLBA 2DEUA 3A6ZA 2CV1A 4GS5A 4GRAA 2VNSA 4DR6O 1AHPA 1WP7A 2IYUA 4EL5A 3OPYA 3LYHA 3VTKA 2ZIMA 1SB9A 2CCJA 1XRPA 3N2NA 4H6XA 2M6SA 4BHTA 5K20A 3A0RA 4WN9A 2Z8XA 1Y6JA 1YRWA 3HSSA 1DWQA 1YS7A 3HN7A 2AW9A 4LJ5A 3LD9A 1E69A 3CZ9A 4PRZA 5A6SA 4XD7A 5KYWB 1Z8HA 3IAUA 1NDQA 1QKJA 3N2KB 2E2WA 3OZWA 3BKXA 3E8GA 4Q5IA 1OFUX 3L92A 4KFUA 1UBTS 5EUMA 5DMXA 1T3TA 2C9CA 4R1QA 5E8RA 3LP6A 4WA7A 4K8XA 3VZDA 3V8BA 5JCJD 1ZUQA 2GQ0A 1J0DA 5GOTA 4CTMA 2E48A 1NG1A 1X3LA 2NUAA 2OK7A 4RSGA 2Q27A 3TW8A 1MOSA 5CCEA 1W2GA 4DNOA 3TI9A 2BKAA 1A9YA 1NVXQ 3K1YA 3KWFA 1CJKC 3NIWA 5CA0F 4MP3A 2ZYAA 4P3YA 2VRZA 1U9JA 4JTDB 3NYWA 4WK6A 2PKXA 3HYSA 3FB1A 1UWVA 4DSUA 4K8ZA 4J16A 4E2YA 1EK0A 3VJRA 1DRVA 3LNCA 4D8WA 4DC1A 3MNFA 5THKA 2R86A 1ZH6A 4HYEA 3SIUA 3L6CA 4BFUA 4EHNA 5ESWA 1LVHA 3VU3A 2NZ8A 4PA3A 1N6PA 1K9MW 3SIXA 1BX3A 4UM7A 3I2KA 4ZPJA 3LT0A 3ESYA 4FZVA 2B3DA 2NU7A 1LH0A 1B41A 1TUIA 4DCJA 2DOKA 3RSSA 2P5OA 1T9HA 3LRTA 5CURA 1JDTA 5H82A 2FFBA 2GILA 3W34A 1OXVA 2QN1A 3AOEC 2XMRA 1FQJA 4IVQA 3NXSA 5D5PA 3S70A 2WTEA 1MUUA 1OPRA 1Q74A 3ZGVA 1Z15A 4PDRA 1GVNB 2BH2A 2XX3A 4IGFA 1WB4A 2QUZA 2ARHA 1ZL8A 3Q6MA 4BAZA 2ZWMA 1U3GA 1X94A 1AROP 2C3MA 3K94A 5G3ZA 3SBEA 4B33A 3LPDA 3E8SA 1N6OA 2BOVA 4P0QB 4Y0VA 3RUEA 4E5PA 3OESA 3QTLA 1OYYA 1UBSB 4J8PA 4UAGA 1JHMA 5D3MA 3EXFB 1ADYA 2R8ZA 3TRIA 5JR3A 5DHUA 2HQOA 2D7DA 3ZV5A 3WGVA 5FLEX 1HT1E 2G5GX 4MIYA 3DBRB 4RZ3A 3RYTC 4Z4QA 1PDOA 3QZUA 4LUCA 2LP4Y 1PKEA 4PYQA 1C2TA 5IAKA 2D3TA 5EWLB 3K0AB 2YI9A 2EQAA 2JJ2D 2XSZA 3CEAA 1GL7A 3K35A 2VBIA 3H5NA 4FS8A 3MGKA 4NBWA 1I10A 4IX1A 4RJKA 2BFOA 3OM3B 3DDHA 2H4JA 4R1PA 3ZV7A 3ZX6A 2F93B 1T5TA 1I1OA 2VHUA 3C6BA 1VQPF 3AYZB 1H8HD 1T6YA 4J43A 3VYRB 4F1WA 4ZI7F 4KDFA 3GFGA 1BN7A 1T4DA 2XEXA 3GGJA 2GDJA 2JS7A 2WUFA 4YMSA 5LC1A 3MBMA 4YC7A 2QG4A 3UWMA 3RJ9A 4B6EA 4QJ3A 5JPIA 3TG2A 4JKIA 4XASA 2ZSUA 4CH3A 3N3AC 4DCOA 4O4HB 3EBPA 2AOTB 3VQTA 3LQRA 4LRQA 2PSJA 3UO2A 2LP7A 4JYYA 3USZA 2P40A 1E99A 3SDZA 5IYZB 3EEFA 4EFBA 4YO7A 3RVMA 3TTVA 3VHXA 2WUEA 4EG0A 2WSSA 2NT4A 1II8A 3WLTA 4BC1A 1VQ5F 1CR0A 3RAGA 3EPRA 3OUZA 3K2QA 2AHYA 2NACA 4EEQA 3RHFA 5JD4A 5CB8A 4D9JA 1DEXA 3MUEA 3ECAA 1XPUA 3LLVA 2ZRLA 2A59A 2CVOA 3D36A 3IS3A 4LFBO 4B3MB 1CZNA 3VR5A 4D8TA 3MTGA 5DGCA 2XD9A 4H7FA 4HNGA 2Q5EA 3ITEA 4UUNA 2VBCA 1CYEA 3L7CA 3OMWA 1J23A 1RWKA 3GEIA 1ZJ6A 3L7JA 3NTUA 4PC7A 3M7MX 1R9GA 5BSKA 3AEQA 4C4WC 2E74B 1VIDA 4YT4A 5I51A 5TPZD 2XUQA 2Y1KA 4QPNA 5I4IA 3D7KA 3NM5A 4OJTA 2UYKA 3IC9A 4U7FA 4WXHA 3DEKA 4WTOA 3ZUGA 4D25A 3NVKI 4BKOA 2GN0A 2FE1A 1KYQA 3I8XA 3I72A 1TT7A 4CLEA 3TQQA 2WYWA 4AG3A 1VIBA 2Y0PA 1JIVA 4MV1A 5TQ0B 1UMDB 3UFBA 5JDIA 4OHPA 2OA0A 3TQSA 3R5XA 4MDYA 4DR2B 3AR2A 4MR8A 3WLMA 2AC4A 2BD0A 3VOBA 5CJJA 1E9EA 1J2RA 1U90A 2FUG6 2JFHA 2LCFA 2X4IA 4TL6A 4ARUA 1LI7A 1UBHS 2QTLA 1IZ7A 1ZI9A 4JK3A 2WIDA 3DLBA 3LCRA 4I46A 1E3LA 3LTNC 3VO8A 4DNXA 3DXXA 1Q44A 4LF8B 3V1MA 3RARA 2HRQA 2IXGA 1XYGA 3IQHX 4DSZA 2QV7A 2ZI7A 3AKCA 3Q3HA 4LMBA 3FOCA 2PSDA 4MPTA 3DMNA 1U9IA 1QORA 3QEKA 4QUAA 5BW5A 1V9SA 4IICA 3L4BA 3RUIA 4K9MA 5HGXA 3D8CA 1QPGA 1THTA 2QSAA 1Z6YA 3I55V 2JHGA 3I73A 5JSUA 1E5DA 5TMPA 1ZKMA 1ESDA 2VCYA 3GZ4A 4M0LA 3UG6A 3TMYA 1XDGA 3QSGA 4G81A 1I5RA 1U94A 2ID9A 4NZYA 2XCUA 4HADA 2ZEJA 1MSWD 4IEIA 1AQ6A 4A6DA 3NH6A 1VMGA 5K1PA 1JEQA 2QUKA 3SJBA 2RGXA 4NF2A 4AP5A 1G3MA 2XUDA 5BNFA 2FKAA 5F23A 4KBGA 3KKZA 1G6HA 1QKKA 3U3MA 3IURA 3EQ8A 2H2AA 3NPMA 3QUTA 3QF7A 1NKSA 3ENWA 3P19A 3DPSA 3PXGA 3TTUA 1JAXA 1E3TA 5TS2A 5IRCD 1RRCA 4PBSA 1OHHA 3OZEA 3QX7A 5JEEA 5K0FA 4YJHA 3P3PA 3OKCA 4YGXB 3R0JA 2XCTB 4G5FA 3P9CA 3VR5D 2ATEA 4MUAA 2ZT5A 5CFMA 3TSYA 2WLJA 3MDOA 2FHPA 3Q4HB 3C6KA 1WMSA 4GPTA 4MVJH 1C9KA 3HUFA 2LW1A 1B8UA 1N2CA 4MMZB 2L18A 3DVAA 2VDWA 3E9ZA 1JR3E 1X2BA 4KLZA 5CYOA 4BO0A 3QVXA 4UM5A 3RASA 4XYLA 3I61A 1EX7A 1N5LA 2FEOA 2VDPB 4JOBA 2IDKA 2MCFA 1LTQA 1XZEA 2RGWA 1GZVA 2PRJA 3P0ZA 2XYQA 1U65A 4F84A 4X7BA 2PJDA 4A6PA 4H1UA 4QQKA 4XLTA 4LDZA 3QVUA 1OHHG 4O2AB 2Z3YA 1ML4A 1WXEA 3HB1A 5HKBA 5I7SA 4U7PB 2XTJA 2EKPA 1WW8A 1RHQA 1TECE 3FNEA 4BFCA 3E27A 8AT1A 1RI1A 2L0XA 2SICE 1H85A 1Z39A 3OJCA 1SZQA 4IG9A 2PYLA 1L5SA 4UV9A 2OY0A 3A6DA 4ZHYB 3P97A 1M6NA 2C92A 5EJ2A 2Q41A 2CV2A 4MVJF 4O2AF 5E7MA 5CG2A 2X0NA 4LOAA 1XN1A 4DL9A 3E15A 1Y6RA 2CNBA 3D6MA 3SNKA 4GT1A 1H2NA 4HS9A 3CLRD 1HF3A 5IZCA 2J6IA 2BISA 3DXZA 1I6KA 2REBA 3GLTA 4J0DA 1RXVA 1OCOC 4W4LA 1T1JA 2NTEA 2P4SA 2RHRA 3EFOA 2ZXWB 4M1KA 3OZSA 4E5SA 4Q20A 3L6OO 4OTZA 1XMOB 3SHFA 4JOCA 2IBZH 1SZDA 4CLRA 1SWVA 1INLA 2O3QA 1RQNA 2WQZA 1YZKA 3O2JA 5TJ9A 1BVUA 1ZNYA 2HA0A 5B6JA 2FWAA 4JXKA 1Z4KA 3JRNA 1SELA 1UBEA 1D8TA 3K05A 3OCJA 4MEJA 3TLCA 1GPYA 4ESOA 1YB4A 2IZOA 3G0GA 5DTJA 5I7UA 2XD4A 2QROA 4TYPA 3ZNQA 3L8HA 4PFQA 2JBAA 4CQLB 4YXWA 1H1DA 3SC2A 4PVCA 5EB0A 2DR3A 4OKIA 1QAOA 1P60A 1JIXA 1RAFA 3U39A 3ZCRA 1JIUA 4B4UA 1AXEA 1T5BA 2Y1DA 4FVMA 3K9GA 1VJ0A 4HRAA 1FBTA 1TMGE 1H8ED 2BCJQ 5H5NA 1PFWA 1K7CA 2H16A 2KLHA 2RD2A 5CAEA 5KA5A 1HPLA 2N9UA 1IB0A 1UCFA 3NAGA 3JVEA 5BR7A 1NYLA 2V6BA 3TUZC 7MHTA 4BVSA 2R3SA 1VL5A 4L85A 1L8DA 1VYTA 3KJEA 4R1MA 3UV6A 4WGGA 3ZRWB 2VP2A 5F78A 1LCIA 2OORC 2IPXA 3I5AA 4FZRA 3C45A 2P2CA 3UYKA 1OCEA 2QM0A 4EYKA 2E0IA 2BFDA 2NNLD 1X0XA 4TT3A 4V24A 4EZIA 1W36D 5HK9A 1DK1A 4EAQA 2OLKA 3BFJA 2WAMA 2QUIA 3Q72A 4WBSA 5ALXA 4BNIA 2D0DA 1EWKA 1H1LA 1MAWA 4R2KA 1USGA 1PFQA 3TW8B 1K89A 1CRQA 2RCNA 4RHEA 1QVFF 3EZ9A 4IXNA 4DR7O 2P2SA 3ZOPA 2WNIA 3C8UA 3ONFA 4CEJB 2IEIA 1USIA 1Y76B 2PT9A 3E3OA 2ZATA 3L6EA 3CP1A 3A25A 2XT9A 4QPDA 2PT6A 4RGBA 5DULA 3FTEA 3LBYA 2ENWA 2XMDA 2O7SA 3EVCA 3KJGA 1K8RA 2BE9A 1ONBA 2KJQA 2ZIVB 4X93A 1IXZA 3AVPA 3ZQJA 3G88A 2BVNA 4UZEA 2VFAA 5TGTA 5FWXB 5LMUO 3E0QA 2IS6A 2VSYA 4GG1A 4LISA 3BK1A 4FDMA 4GKKO 4WDQA 2IY8A 2R8RA 1B8VA 2F62A 3BTVA 2Q0HA 5LZ4A 2GVNA 2PRKA 4PC6A 1JQDA 4G86A 4KACA 3U4HA 3BPSA 3ZC3A 1LDEA 4JEUA 3PHHA 3FMPB 1XT6A 1H69A 3E9RA 3ZBUA 4IS3A 2ZBQA 4Q7MB 3S2UA 5CDUA 5HFLA 3GJ0A 3LKBA 3SX2A 4O02B 4KQJA 2UZHA 1J1ZA 1RWMA 1P80A 1VP3A 3HJBA 1JPVA 2QMHA 3FKSG 4E22A 5CBGA 1NH2B 4LWSB 3AB8A 4IZOA 1N0UA 3OLVA 2ERYA 5L7TA 5C1PA 3OC0A 4HFJA 1TAHA 3KSMA 1NHGA 4TS9A 2I4OA 1VQPV 1YNSA 2A5JA 5HQ3B 3RFCA 4CF6A 4MQEA 1IIRA 3H7IA 4MI6A 4IUBS 5I5GA 4OHBA 3T9FA 4UTNA 5EIXA 4OVKA 3V8EA 3IAAA 1OAPA 3HGTA 1H8EA 1PP4A 3VNVA 2WWVD 4QUHA 4DOMA 4BFVA 3WYAA 1NF9A 2DFDA 2FZKA 3OLYA 1QK4A 4HWRA 2OBFA 2P4HX 1VA4A 1ZWIC 1JG7A 1W88B 1BOFA 4FE4A 3YASA 3IBFA 4C3VA 2CXRA 3BICA 1XL6A 3AF2A 5LR6A 2C8KA 1F7VA 3R0IA 3TL3A 2ODBA 9MHTA 1QPZA 4B74A 4HBNA 2DYKA 2HK6A 1FSGA 3U7FB 1SXJD 3ELCA 3HBLA 2GK3A 4I3FA 4TWAA 3SQOA 1FTYA 1SB8A 1ZOLA 2QV0A 3MD9A 3F6PA 2AE2A 5JPCA 5AESA 1T3HA 4Z8XA 3SAJA 2PKWA 2BGRA 2IQ5A 1YTUA 4D0SA 1W0KG 2EF0A 1COWG 3FFXA 3ZXUB 4KDRA 2W6ID 3NG1A 4BAGA 4GX2A 4GEGA 5J4LA 4F0JA 1KB9F 1DCTA 2VR1A 4P98A 3STLC 4V3CA 3DOUA 4EG5A 2FPPB 1II8B 1VJRA 4LECA 5AKZA 2FUG1 1WHSA 2CYBA 5DYTA 5JJKA 3ZMSA 3A4LA 3ICQB 1SUIA 2VSFA 3A10A 2AW3A 3ZWMA 4YREA 4DN6A 5CM9C 2VSNA 5KX5B 4NPCA 3AVUA 1THZA 1BXRA 1ZUIA 2FZVA 1PZHA 2OPBA 2ZI6A 2Q68A 4CMHA 3QU9A 1FP7A 3WWCA 4A0FA 4EGCB 4D92A 3PEEA 1Y5LA 2BAGA 1KFJB 3OGCC 3A3OA 4WZAE 2BR5A 3DC5A 3GXBA 4I5FA 4E2ZA 4PZ9A 1YSCA 1CVLA 3D3NA 1V55B 2ZM6O 3OAAD 4KWHA 2HCRA 2QTAA 4KPUA 3RM3A 3S29A 1CY6A 3H11B 2RJZA 5IF9A 2CL6X 2NVBA 4DV5O 2FPGB 5J4YA 3FTNA 4DNQA 4IDQA 2BM8A 2J0QA 2OWOA 3TTXA 3FBAA 3ORQA 4LIPD 5ED0A 4HLUA 1DBIA 1KEPA 1Q14A 2X9QA 4MRNA 3JR3A 1R6TA 3GFQA 3DTVD 1E3SA 4X3MA 4YWJA 4CU2A 3COVA 4JUAA 5GINC 3HWX1 5DNYB 4GPEA 5CA0B 1F6WA 1JQAA 1WEHA 4N76A 2HAEA 1KQ3A 2ZW9A 3P4UA 4C88A 1T29A 3B78A 4FR2A 2JANA 3IP1A 2P5SA 2ZIOA 2F3SA 5AW3A 2G0AA 1PZFA 4QQFA 2B8TA 2RHLA 4KMSA 2VDUE 3ENKA 4QXPA 3MAQA 3ELDA 3C5CA 4I3HA 1V5EA 3VJLA 1MNQA 3VQYA 4FJCC 4O4IA 1Y8CA 1PQPA 2HS3A 3BMQA 4DIKA 4GMDA 2RMKA 1TC2A 3EIQA 3TTWA 5C8VA 2GCPA 4MJ3A 2A4KA 2QT9A 4PIPA 1SKBA 3FTCA 3I4FA 3FR7A 3TN7A 2P67A 4WLVA 2XNJA 1EFCA 2HQSC 2XE4A 1AUPA 1OAOC 1ZCJA 2ZS8A 3B2NA 2HKOA 1XCOA 2WWHA 3DT9A 1PWYE 3DVQX 3LKDA 3FXAA 1BQEA 2NOAA 4WLOA 1YDWA 4TV8A 4IMPA 3GG2A 5E7IA 3WWPA 3T1TA 2XA9A 2HSEA 1JQ0A 1B1CA 2XUOA 4JJ7A 4E4EA 1GPH1 1UH5A 1H1TA 1X86B 2QQEA 2E4UA 3OEEG 3K1AB 4E03A 4F46A 5JO0A 2O9JA 3CN7A 3HCRA 4JAAA 2IHYA 2G8NA 1NBEA 3AYXB 3HKEA 2FMIA 3HVUA 4X65B 3ORHA 4JSTA 4AY4A 5KB3A 3SYNA 2WHPB 4TYQA 5JS1A 5L53A 1ZP6A 3VDXA 5FOQA 1N6LA 1CY0A 1NXVA 3PSHA 4G8CA 4RCVA 3ZGXA 4H27A 3BYQA 4WLUA 4GZRB 1D2NA 1G18A 1ZIOA 2HI0A 4HP8A 1YJWV 1EFKA 3BXFA 4NU0A 4RLSA 5JU6A 2QRNA 1SBQA 3GWGA 2YJ5A 3W7AA 1P5HA 1Z73A 4NL4H 4M7RA 1I80A 4OFZA 2F8LA 3RRNA 1ADFA 1YRYE 1NNUA 2BKEA 3LDUA 4XQ9A 2O06A 3QIVA 3ZBQA 5LLTA 4H6PA 1E18A 5K0NA 1VARA 2XMZA 1U3DA 2WJVA 1P9OA 4PWTA 3GJ7A 5C32A 1L4KA 4FCVA 3QHQA 4O63O 1Y37A 1E32A 4AW9A 2GJ4A 3JPYA 4HYQA 3GLUA 4RMHA 3OY2A 4ALJA 3SM3A 4JB8A 4IJKA 2B78A 1U04A 3LUBA 4FGSA 4G5HA 4PU0A 1S2NA 5ALYA 5EFOA 5CDTA 1DO2A 2AXEA 2X8WA 3D2CA 4WXEA 6NULA 3WWDA 1WMFA 5ICSA 2BFWA 2EEZA 1R4MA 2IPNA 2VL7A 2DFLA 4TSKA 3ORSA 3K9NA 2UXCB 4J1SA 2H4FA 1EFVB 4I2NA 3PE4A 3BFPA 2PYZA 1IL0A 1EUDA 2QL7A 4CQMB 1SAYA 2VQFB 1YTFD 1V11A 1G1XB 1QVZA 3NMUF 2VPTA 2Q6TA 4KX5A 4MWEA 5BMOA 3P52A 2MINA 5KKNB 4OSPA 1E3WB 1QAMA 2VF5X 2AOUA 3H2YA 1MDBA 1OGIA 5ESRA 3G9ZA 1KJZA 3LXUX 1R5BA 4BGUA 1P18A 4AJNA 4G0WA 4KJZA 1ES9A 3ONDA 3A9VA 2HLDG 4Q9IA 4F3CA 4AZVA 2PUJA 5DSTA 4DQLA 3A06A 3MAAC 4MINA 5J43A 5A9GA 2NZ2A 3EVGA 4UKDA 5AI6A 3VGPA 3JWPA 5JWRA 4PI2A 1DX9A 1Q17A 1Z0AA 2GN4A 2NZUG 4QDTA 1ZK2A 1USUA 3QVJA 3IEUA 3TLXA 4JXJA 1L2TA 4A9AA 3ORRA 7GPBA 1SOMA 4PHTA 1DJPA 2D1TA 1YZTA 5BWNA 2NNUA 3PN1A 2B5WA 4WK0B 4PO1A 1YFLA 3L0YA 4E07A 3IJPA 3T1CA 1FDSA 2ZSDA 4I1YA 5JZBA 1U0OC 5F98A 3TPCA 5IVPA 3NDIA 1LVUA 4HN2A 2Z2JA 1ZEMA 4ND1A 2PXHA 3ZHOA 4BLTA 5JT1A 1PUIA 1PTJA 4Y1EA 2JJQA 2FU5C 4RTJA 1P4GA 1O95C 2C3UA 2H8KA 3QVKA 4MAAA 5D84A 2HO5A 3DMYA 3SF0A 3MCWA 5CT4A 1DHRA 2GTPA 4IUCS 2G09A 2HPZA 3ZMZA 4DK0A 2FPRA 1VLLA 3DPUA 3KHUA 5EIHA 3ZHUA 5K0ZA 4BCDA 3GRFA 4PICA 4EP1A 2J5KA 1LB1B 3OICA 3QKSA 4U4AA 4B47A 3I39X 3K5WA 4RA6B 3OPXA 5LD2C 2XF2A 4XDKA 3RNLA 2ZG6A 3D0KA 3NBXX 4M7WA 3CCRV 5FRDA 3T5PA 2ZT8A 5B4TA 2SBTA 2DSTA 1VQLV 3BRSA 5BV1A 1EGAA 4ZMBA 3NMUC 2BFDB 1I9GA 2B4KA 2JIRA 3B20A 2Q0AA 1CFJA 3KS9A 4G8DA 1Y9AA 4J0QA 3PF9A 5IFLA 5I9IA 3BIXA 2ZUEA 4AI6A 5LOVA 2CDYA 2QKAA 4I9QA 2I4NA 1GPUA 1E6EA 1JF8A 2YV3A 4HFNA 1W0JD 4D99A 1EBOA 3CSUA 3D4LA 3OD1A 3JSNA 1SQVH 2DE0X 2GM5A 1NN3A 1G8GA 2WJ3A 4IJQA 4IV5A 4M9UA 3VR2A 3ZZMA 1V8PA 2E49A 1EP9A 1PTJC 1RLIA 4B46A 1DKNA 1OYOA 1JA0A 1OOEA 3BILA 3RIGA 2WTNA 4UAUA 5CH3A 2PM8A 3K5PA 3RK0A 4ENWA 4YXWG 1MC8A 2I2BA 2B1JA 1F2UB 1JR4A 1OLSB 2R8OA 2VDMB 2W2PA 1Y74A 3SIVA 4RANA 4XXHA 5CIWA 2X4DA 3UMBA 2HD4A 3FVVA 3TIIA 4CR8A 1MABA 3CMEV 3TCXB 2IU3A 3J7AU 1I3KA 4UTXA 3OT5A 4BJ1A 3I0NA 1IRXA 1BHAA 2X8AA 2FPOA 4NS1A 4EA9A 3CSXA 4DLUA 4LJ8A 3H5LA 1A2BA 1UF9A 1JSZA 1S7CA 3SXUA 1XLUA 2JLXA 4AP6A 1E2UA 1M6HA 3AILA 2HJWA 3KFLA 4PLCA 1XVAA 2YIBA 4N6NA 2AIZP 2ZXFA 4KE6A 3S3XA 4K46A 3SPXA 1DINA 4G23A 6CHYA 1OX5A 3I3OA 1IV4A 4IGAA 1ZONA 3I28A 3KJIA 4F92B 4A15A 4RGQA 3DM9B 3K6SB 1XWIA 3HCOA 4GIBA 3ZZNA 4C7UA 1A9PA 2CB9A 1PZXA 4PLFA 1V9LA 4NC9A 2OV2A 3EQZA 2B94A 4FLEA 1OZHA 3A4TA 2ZIAA 4X60A 1UFYA 3ZNOA 4ZAVA 3FNQA 3FI0A 4JHXA 4MGKR 2X0RA 2F1HA 2WKQA 1WB5A 3DYBA 2A7XA 2GNPA 3S1SA 1TA9A 2QM7A 3TCKA 4HATA 4N01A 2X3YA 3GY0A 4OXKA 4TMFA 3RRFA 2ZSEA 1VF5B 2XUHA 3N7AA 1WNSA 1QX4A 1UT6A 2OT5A 2Z1TA 4JDUA 4O6VA 1W2BF 4TXMA 5HZMA 1U2ZA 3G0OA 2QZZA 3CHYA 4CBVA 4RFLA 4XVCA 2R6CA 3I37X 4ND6A 4U3FH 3EULA 3MGBA 4RF2A 5F3WB 2VQEB 4UCWA 2HTFA 2PMKA 1P2VA 4EO4A 1E9VA 5HMMA 5JH7A 1YDEA 3DTYA 5DBEX 1Y8QA 3FGPA 4RVHA 2XGGA 1GPWB 4GOMD 2Z83A 5IC4A 4RTMA 5JDIC 4DWVA 8GPBA 1FU8A 4S1TA 3SIRA 4F4LA 4YAUA 1ZRSA 3OW2F 2C2OA 3RS7A 3EPJA 4D3FA 4LN1A 4OGFA 3HNRA 1D1QA 3KDPA 2LIVA 4RZHA 4RGVA 2BO1A 1SNYA 2FPPA 3E7XA 1AD2A 3U7QB 4YRDA 3L6RA 3HCFA 5LCXA 5TNXA 4B44A 2G4LA 3K0CC 4TM7A 4P7BA 5ECWA 4NDAA 1TKBA 1PR6A 2O7QA 2WM8A 5G4LA 5K3FB 4BX2A 3L73H 5LMCA 3AF6A 2WYHA 4BL5A 5AUOB 1NVGA 1JZTA 3BRQA 1JA1A 4MR7B 1CSEE 4C03A 2FKXA 2I2DA 1X8JA 4C3OB 1OCCC 2CGNA 1YZGA 2MSWA 3A2NA 2KSDA 3N70A 4GX1A 3RSHA 2OFXA 1JDBC 4JC0A 4RS4A 3U7JA 2JA1A 3TGLA 4B45A 1L5YA 1KD1H 2NSDA 5AVJA 4DAOA 4E5MA 2VXCA 3O6VA 4ARCA 1EN6A 1Z0JA 1SHTX 2IK8A 3GB9A 3MC1A 4NZPA 2Q4PA 5CYPA 2W42A 1A32A 4G5RA 1UWLA 2ZTHA 5F12A 4DQXA 2CJWA 3I04M 3RNOA 4F7DA 2DFNA 4HD8A 1SKYB 1TCAA 2NU8A 4A92A 5I8PA 5DGXA 2PLWA 4ZANA 3LW7A 4GUAA 4EELA 4MRMB 4RHXA 3F67A 3BD8A 1ZK0A 4PCUA 4TTQA 4MTCA 4OM7A 1A97A 1VHDA 1IM5A 4Y2YA 3RC2A 4LJ7A 5JATA 3OTOB 2C0PA 1NY6A 1O54A 3RYHA 1FXWA 2DHRA 2IF2A 4JHLA 4LBYA 1AKEA 4Z1MD 5AW6A 1XLTC 1D7AA 3NHSA 4W6ZA 2GAJA 1JQKA 3BM5A 3TK1A 1GQRA 3P9QA 1JLHA 3K0CA 2GCOA 4KQ1A 2W2LA 3IB6A 3KCYA 1ISRA 3MT8A 4RSRA 5IMBA 3W6PA 7REQA 2OHWA 5BRJA 1LPPA 2JK5C 1Q1NA 5IDXA 5A4JA 4CKEA 4QUIA 4PYLA 2LKDA 4PFJA 5DBGA 3JYCA 4X89A 1Z88A 4MTOA 3B9RA 1SWWA 2E87A 3W2TA 3WNBA 1EAYA 2I3ZA 3KSUA 1P44A 2ECQA 3HGQA 5KPDA 3N7UA 3UATA 3THYB 2BIFA 3LC1O 1GN9A 1UC5B 1VECA 3D8UA 2VZLA 3FNHA 5F2EA 4AMUA 4HB2A 1YVWA 1T5EA 3QE2A 4OFBA 3QI2A 3HBJA 4J0EA 2J07A 2KW5A 4HAVA 4ND8A 2JGAA 2QXTA 2BMJA 3IHKA 3MHSC 3AM5A 2FFAA 4FPXA 4U0JA 4YLGA 5MHTA 4X66O 4TKUA 3MERA 3S8EA 2XWBF 4R2JA 2WKRA 3U3RA 1CETA 2ZCJA 4AKEA 2GXQA 3U9TA 2P3SA 2CXOA 4Z1OA 3D0QA 4U9UA 5EC1C 4Q4AB 2VUTA 4A8JC 1BE1A 2J09A 3AKZA 4RD3A 4D3YA 5CU7A 1R73A 1F12A 2XNCA 4ENQA 1VGRA 1BHQ1 4YFYA 1Z7BA 4CYMA 3E5MA 5LYJF 4PSDA 2YJTD 1GL3A 4OL0A 2WLSA 3GUUA 3IDOA 3DL4A 4QX6A 2MTBA 1MB3A 2EFJA 2IW1A 2UV8A 3HVIA 2G1PA 2PGLA 3NOQA 1XMIA 4JEIA 4L22A 4LXQA 3SX0A 3O7MA 4J1NA 1YAHA 2PIAA 5FTMA 4QOIA 2CV0A 4QE7A 3E9CA 3KJXA 3TB6A 5LMNB 1N4CA 2VT2A 1P9RA 1HRKA 2XGSA 3GZJA 5FJ4C 4PDLA 4QPPA 3CR3C 4F4CA 4C7OA 4B3MO 3R2JA 2QN3A 4IWXA 1TYDE 2I2XB 3EOZA 3PQ5A 3CCEV 3OAAA 5KSOA 1F23A 4I81A 4I9NA 4J6FA 2XUFA 1TJNA 5EWJA 5CP8A 3II6X 4BFSA 4C2TA 3L40A 2ZNJA 2YYEA 3E53A 4TPKA 5AW9A 4XZ3A 2J9FA 4LXIA 1SBZA 1U7XA 1ZI8A 1UJ5A 2WUGA 5ALKA 4ZO9A 5CFQA 2EGUA 2GBPA 1VHWA 2HU8A 3E22A 1RBYA 5EKDA 5FAXA 5LQRA 1CVIA 4IW3B 3LY7A 4MCHA 4J9ZB 4BVAA 1F9EA 5DXJA 1TUBB 3D5QA 3HR4A 1GPMA 2DPMA 4GZ5A 1YL7A 3CPWF 2JHFA 4J0CA 4FMCB 4ZT3A 1YDGA 2A3RA 2GKSA 2WIBA 4LZJA 4OHUA 2VATA 1TJYA 1U0JA 4DPKA 3WKAA 4Z0TA 4PYJA 3DKKA 1ORRA 4Z3OA 4GE3A 2Q2QA 1THMA 3U37A 5IKEA 1M2KA 5KZMB 5IYDO 5J47A 1PW7A 2QD5A 4WHMA 4DLPA 1RWBA 4AKGA 2OHIA 5KQGA 4GI7A 1EXMA 5F2OA 3UV3A 3RU2A 4IIFA 5CBPA 3ROKA 3VXKA 1QRAA 2O59A 2GO1A 2IXBA 2YYAA 1KVQA 2CLEB 2XODA 1G5RA 2EJTA 3W4IA 2WJJA 2ZP1A 4EZEA 1HLPA 2X0IA 1YOVB 1UJCA 1XVIA 1GCIA 3NCHA 5JS6A 1WZEA 5FT9A 3BB3A 3KK0A 2N3ZA 1ODJA 1PFUA 1V5FA 1SERA 1GAWA 3DHWC 3MA0A 3EK2A 4NBKA 1QHSA 3AZPA 2NXCA 3GR6A 3RV4A 2IC5A 4G0NA 1B0AA 2O7NA 1I9CA 1S5LZ 4DV2O 2A14A 2Q4OA 2Z2IA 3MTAA 1SCUA 2XTZA 4P32A 4ENRA 4JXZA 3P5BA 4G85A 4HZUB 1VQLF 3GC6A 2BM1A 4WBNB 3A2MA 4MQFA 4ARAA 4LGMA 2BUAA 2R70A 1JU4A 2C78A 4CS3A 1YJ9F 1M1XB 2H9YA 3ESDA 2W0XA 3G5UA 1C30B 1FPOA 1VQ8F 1LDNA 1RPNA 1XMJA 3ADOA 3WB0A 4CIWA 4JF3A 3CPSA 2ONZA 2HY7A 1P1KA 4NENA 2NUAB 4G41A 2G1AA 2Q62A 4B3RB 1CY1A 1ZM3A 3O1LA 5K8LA 1QFZA 1G0NA 1J56A 2W2VA 2ET6A 4PG4A 3EYAA 4L51A 5AM3A 5KJCA 4QNRA 1YRAA 3C4VA 3UMYA 1HT3A 2CE4A 3MILA 1SD5A 3VGJA 1G38A 3HFSA 4CLDA 3QE9Y 2R00C 2QUBA 1FUIA 1GKUB 3KYCA 1UMBB 5A1TA 3SVTA 3V7QA 2I76A 3OLZA 1QOQB 3C90A 1BO6A 2RNBA 3ZK7A 2P1ZA 1D0IA 2H2WA 1PPJH 1ZEJA 2OHGA 1EQAA 4M0UA 4HNHA 5NULA 4C2AA 1ZL8B 4RLHA 4KQFA 4GKVA 1LPMA 1Q0ZA 4X8MA 2OCXA 2Q69A 2IW5A 3IUJA 3VMFA 4EWLA 3N0VA 1WE2A 5IY5B 3FKQA 5I7EA 3WQRA 3CR7A 3V4VB 3V8VA 4AKHA 1B43A 2D06A 3LIIA 4NNJA 1XI1A 2P9ZA 4I1IA 1I5YA 3A11A 3WYDA 1SD2A 4LHZA 5D3MB 5LHGA 5IKOA 1ZD8A 3SZMA 4CDGA 3RC9A 4TX1A 2WP0A 4QBTA 5ERGB 3T41A 3KJKA 1FXHA 2IPMA 2YYZA 4GP9A 1ECCA 4WOCA 5DYNA 2LGWA 4V1CB 3IP3A 4NHEA 1RWWA 4J3JA 4C6RA 4YV0A 2A9OA 4OHZA 1NJ8A 3AB7A 3OF5A 1FYVA 1CCWA 5EXDA 4C9BA 4F96A 2G70A 1Z8FA 1R0RE 5KJ6A 4U7OA 5EIBD 4XOIA 3WGIA 3LHSA 4UUQA 2PUAA 3VNQA 4BEWA 3SPGA 3UAWA 1XCMA 3IPXA 2BMFA 1YMUA 3AG4C 2C5BA 2YS7A 3R23A 1FPQA 1LJLA 1NI4B 2J30A 1LJUA 4TV9A 2AN1A 2VH2A 2BEJA 4FSDA 4BVLA 5DSZA 2CDBA 4CKYA 4GVXA 5KYYB 3BFKA 3QBJA 1U8XX 3KKNA 4FZ5A 4FIPC 1B0ZA 1MBZA 1JG2A 1SCDA 1QYIA 5BWLA 3A1FA 5I3CA 2ZDIA 4OQ4A 5HPYB 4D79A 1WCWA 1NQOA 3FD6A 4F3KA 3L8FA 3ACDA 2AF4C 1L4YA 1KQSF 4B4KA 1NFRA 2YEVB 3EAQA 3K3WA 4DEYA 1QIIA 3N8NA 5K4AA 1XQWA 1H2EA 2DPGA 2R7LA 2P4EA 3NWOA 4F2PA 5KX5F 4EI2A 2V5VA 1ORIA 2G0TA 4HDQB 4EJFA 5SICE 1ORHA 2IS2A 1PJRA 1DKPA 1XLVA 3EPPA 1Q6YA 2ZNIA 4H1VA 4L8FA 3UA3A 3T1NA 2PQ0A 4PINA 3HUEA 4U2EA 4OXNA 3HWSA 3H2GA 5GVRA 3AQ4A 3GA0A 3G02A 3ABLB 4YFVA 1I0ZA 1U02A 2ANBA 5EO3A 3K57A 3ESCA 5GV8A 2X3FA 7YASA 4FYKA 4IJ6A 2DXIA 2DQ0A 3ZWAA 2D2CB 2VHWA 2PQMA 1P1IA 4MW4A 2WB2A 3WP0A 5L3FA 5JD5A 3IIMA 4LY3A 4J41A 2A0XA 2W37A 3B6JA 4BVHA 3E9YA 2R62A 3WB1A 4C6TB 1F2TB 4G3XA 4M1TA 2QJWA 3K15A 3OECA 2J31A 4NOLA 1NVKA 2E82A 3JAMM 3TXYA 3WNVA 4KLAA 4DR3O 4CKBB 4DQKA 4KR6A 2FSHA 2F1MA 2ZAIA 1R1MA 3OFNA 1BRTA 4L5IA 4ECEA 2OQRA 5ENVA 4B2LA 3LHKA 4PZLA 1WXFA 4U9HS 3LVQE 1TIPA 4MWBA 3IR7A 1BEUB 1G20B 2DQ4A 4PZPA 2R85A 2FPKA 3ZGNA 5LB2A 3KTDA 2PWAA 4M9CA 1SXGA 4AQYB 5K03A 2NU8B 5K0JA 5IM4A 3UWOA 2C4NA 4B9AA 4S05A 1QR9A 3K0KA 3BHPA 2GLUA 2L69A 2ZT7A 1XTUA 1G291 1JB9A 2JLBA 1NT4A 3EEBA 2R4TA 3IPYA 4P83A 1GG8A 1Y9EA 2KQUA 4KQWA 1E7QA 4LSZA 3TG8A 5GJVC 4IJVA 4PAOA 3P4YA 2CXHA 3NO4A 4IIJF 1DPGA 2HNAA 4B62A 4UPVA 1YA6A 1I5EA 2VPXA 3R0QA 4MMYB 3NNDA 2QN7A 2H5IA 2PRYA 5SY4A 3V7WA 3FBWA 3KD2A 3RJTA 5T7BA 4M6WB 5GANK 4PNPA 3RYFA 4DR4O 1GZ5A 4HAXA 3U49A 3P27A 5DLEA 1QGOA 1OHHD 3OWXA 1YRBA 5DN6A 2W0SA 1RQRA 2KX7A 1SOVA 1MQ9A 2OZVA 2QZPA 4TQGA 4EG6A 3BB4A 3DCJA 4KGZA 2PGGA 1N2IA 2AQHA 2B30A 1TK2A 2A1TS 1J8FA 2P6PA 3K0HA 1Z4PX 1CQWA 4I0XA 1I7LA 2ZZMA 3PUKA 4X63A 3M99B 2F48A 5LB4A 3IMKA 1WUYA 2OHHA 3H1FA 4BQOA 1ZIYA 4Q00A 3LYLA 4NX2A 1NU1H 1HDIA 4TLAA 5AMXA 1YK1A 1PV4A 3RGBA 4LX0A 2A67A 3ICWA 1QAQA 3V7UA 1M8JA 3I09A 1WUTA 4B7XA 2CLLB 1RM0A 2V3VA 3OPNA 3WMWA 4KWIA 2DWQA 4AMBA 1TM5E 4N7JA 4GUNA 5CGQB 1PYDA 1WQ1R 3Q4HA 2CUKA 3I53A 3KLPX 2H1VA 4HVAA 5J9FA 1KQFA 4BOYA 2NPIA 4W1SA 2HLPA 2IF0A 1KHTA 4KFSA 2YSUB 5JISA 5DT2A 1NQAO 1E1RG 2NU6A 5DM6V 1GHTA 3LBFA 4LKOA 4M76B 4J3FA 1TJPB 4YCCA 2IJGX 2ZDHA 5L4NA 1HZJA 2KMLA 3Q5EA 3HB0A 3AFIA 4QVIA 3GT0A 1Q0TA 3T4DA 2I6QA 1XHZA 3AVOA 3JATA 1Y4MA 3I7TA 3OVMA 1E9CA 3PQ7A 5EYPB 1DRJA 2AG0A 3D7NA 4HL6A 1Q7BA 2NO4A 2VRCA 3PR2B 3HJGA 1PAUA 1YJ8A 1N0WA 3WICA 1F51A 1GPNA 3UAZA 4C0XA 5ICCA 2OR3A 2IEZA 3A32A 1ZUHA 1ZLZA 1WO8A 3GJRA 4OI2A 4RJ2A 3F6SA 5ENZA 3VC2A 1WMEA 1I7SB 3BMCB 2JFBA 2GHIA 1GDHA 3CT6A 1P1JA 5JNLA 1T9KA 3THWA 2D1YA 1DADA 2VN8A 1KAOA 4ZXPA 4EF6A 1GPBA 2YIVX 3T61A 2LFSA 4BP9A 2QM4A 3L7LA 4HJRA 1TRKA 1AGNA 4J9VA 5DV9A 5AQ1A 5KTPA 2HEPA 3IAM1 4C20A 3B12A 3N2YA 1XRSB 5EHQA 2P4UA 1YBMA 3FYUB 4QUBA 4WZBB 1Z37A 2UZ3A 2VSQA 3KWJA 1BH6A 1FSFA 3CO5A 3KNZA 5AUQA 1EINA 4ZV9A 4EARA 1IG0A 5KVQA 1J90A 1E1DA 2NYRA 2R7NA 2JAOA 3BGVA 2QGNA 3UH0A 3WZMA 4Q66C 3I9NA 4R2XA 3CNLA 1V7QA 2DCUA 5CYFA 4YAJA 1H2LA 2W5UA 3QPAA 5DN6D 3CEMA 1V45E 3DV2A 3O7WA 2C1EA 1N25A 4ENUA 2P06A 1IVYA 4LA4A 1VP9A 2PGOA 3V80A 1YR2A 2NYVA 5EXPA 2MWMA 1H65A 1SIOA 4S1PA 5CRIA 2XUGA 3GRAA 4X97A 2FCAA 1DT9A 4MWTA 1LFDB 4U6SA 4UDYX 1XI2A 4NYJR 5CH5A 1OBHA 1GUAA 1LA2A 1Q19A 1E79D 3R5HA 2NN3C 4NVRA 3TNLA 4YCLA 3GHYA 1OF1A 5J2TF 1JE1A 3ZY2A 4UHEA 4LJRA 4ER6A 2CCKA 4F04A 3ABSB 1IUOA 4MSUA 2VTDA 4P8RA 4BO6A 4PRLA 3HBNA 1X1DA 2F64A 3TMAA 3L8MA 1K8AH 2OFWA 4JLSA 4LF9O 1FP6A 4S3MA 5FTNA 1N2HA 3DGEC 4DMLA 3VZRA 5I7HA 1LV7A 2DYSC 1Y6QA 4GRDA 2GF2A 2J6CA 4I9WA 1QIJA 3PFCA 4Q4JA 4PAGA 2IYPA 4NTZA 2DGDA 4REOA 4A3SA 5HW0A 2VJAA 1G4HA 2EFYA 3FVWA 3DLPX 4C89A 5HE9A 2R1UA 3F5FA 3EHEA 4Z7NB 1MC5A 1YJ9V 4AZ3A 5K4GA 1RQ2A 1Y4DE 2ZK7A 1GNQA 1ZWZA 1M0WA 3CCVF 4H0LB 3AM3A 4UFZA 4YA6A 5BSVA 3FKSD 5JHHB 3E7FA 4Z4IA 1EZ4A 3RJMA 4PO8A 1W2WB 3PJEA 3BXPA 1UPCA 1RKQA 1U9ZA 5LUBA 1ZNXA 4HFRA 2BM9A 1NNEA 1W2BU 4CLHA 1UBGA 2ZVQX 1AUQA 1W42A 3N05A 4M8KA 1KZ4A 4R2WA 1UXOA 4EDFA 5HR5A 4RY8A 4RWZA 3EHBB 2J67A 5FUVA 4EENA 4FFMA 4HAZA 4W1QA 4DTIA 2PGXA 3H6HA 2ZDIC 4HWTA 3JZIA 4U5XA 2MK3A 2QKCA 3RC3A 3Q2IA 1K8AW 4RY9A 1K08A 3RTDA 1J5XA 3K5LA 1IHYA 2OCYC 4N6GA 4RD0A 5BWOA 2XPCA 2GTAA 3L0BA 1O9HA 4YB8A 2WHYA 2ZQ5A 4KHPB 4E1BA 4D3DA 3VAZA 2H92A 4BEVA 1C80A 4X3LA 1Y5IA 2D4AA 4C14A 4OU5A 3JQ7B 4BU0A 1N3BA 1YO6A 1CJMA 1FUKA 2WAYA 3KLBA 1B7GO 4NV1A 4DCCA 3IKVA 1ULBA 5MF6A 2W6IG 1XN4A 5EGSA 4RO0A 4HPJB 4Q21A 4IMJB 1QLJA 1WNTA 3BFXA 2VI5A 4LSGA 4YALA 2HLDA 3V7FA 4POAA 4R40A 1SXHA 1KGDA 4F8EA 1GCUA 2BUBA 4OPAA 1YBAA 3DMTA 4EB6A 3OQVA 3D59A 3AESA 1QIKA 5TSDA 1FX0B 2OB2A 4PPNA 2FEAA 2HKIA 3IKJA 2Q2OA 4E33A 4LE0A 4JWTA 4N18A 4H3SA 3VPDA 3WHKA 4BKUA 3PNQA 3IAS1 3JYPA 1CS0B 4IYJA 1X7ZA 3COJA 1NV9A 4UD2A 4HEJA 2EIKB 3KUKA 2JLSA 3IP7A 4IGGA 2ACVA 2WI8A 3NYIA 1JCHA 3MAJA 5EMKA 4BQSA 4EY6A 1O94D 4R0MA 5ETJA 5LQUA 3K06A 1I2MA 1YITV 1IBMO 2Z9DA 4U39A 1DXQA 3KP1A 3IEKA 3FCAA 2M6KA 1K97A 2C9BA 2ESRA 1AF4A 1QOPB 1YL5A 5LA6B 4LHXA 5DISB 1G20E 3UWSA 3VPXA 2XXBA 3UAVA 1R0SA 5EJGA 1ISPA 2YFHA 4NXMO 4WW0A 4CMIB 1PE0A 1YVEI 5JXGA 1EESA 1X39A 1AKWA 3JVUA 3FB4A 1SR8A 1SXJA 2DJ5A 2BMWA 2HIGA 3PKJA 3RKSA 4A1OA 3KZCA 5BV7A 3CLSC 4B83A 3ANYB 1H8HA 5ADVA 3I6YA 2OVFA 3HP1A 1MIHA 4URVR 4Q4CA 1PS9A 3FPCA 2IJIA 2HWYA 2ZQZA 4WZAB 2ICAA 2UYCA 1NI5A 4NCAA 1QDUA 4MVQA 3KOZA 4YCJA 3T5CA 1GG9A 4HZ3A 1K88A 2RGGA 2HMVA 2JS3A 1WTCA 2O2SA 4BIZA 3KZKA 4KQ9A 1WHSB 3AF3A 4HDSB 4WFKA 4GU5A 2CNOA 1ZIDA 4WH0A 1MNGA 3S7TA 9GPBA 1S3IA 1JDVA 4UASA 1NX6A 4ZK7A 1EH5A 4ZVRA 5I01A 5LKAA 3IT1A 1DAMA 1ZWLA 4C6TA 3F6RA 4GSYA 1W8DA 2PX4A 2BEKA 2XDQA 4IHAA 4FOLA 1E1QG 2X6BA 1P77A 1XHFA 2CBGA 4KL1A 2I99A 4J49A 2ECOA 1YJ5A 2BH9A 4G4XA 3QOWA 1NC1A 1T9DA 4LV5B 1YF3A 4K9OA 3T3MB 2GJSA 1XTQA 5GWXA 4QPKA 1NPDA 1AGPA 4HWSA 1ESCA 4UJ3A 3GLHA 2YWFA 4RKFA 5EEHA 2CH7B 4MW0A 2FW8A 2HF7A 2P79A 3TIXB 3D4IA 5C52B 4ZI7B 5HCUA 4C30A 1O4WA 2C0CA 1TLTA 3LOPA 1HNXO 2BMVA 2D2XA 3FOBA 2HVKC 5EE0A 1NONA 2V03A 121PA 3BIOA 2CHSA 1KI8A 1R15A 2REOA 4P81A 2FUKA 3C9UA 3O8LA 3PFNA 4EGQA 2EGGA 3CXHF 4B1FA 2JDIG 4CFYA 1YHQF 1CBUA 4HQFA 4MQMA 3V4ZA 1QGDA 4HWPA 4RKYA 3W5AA 3A9WA 3ULKA 3SBOA 1HI9A 4QNHB 3FVQA 3AK3A 4R05A 4MVMA 3MWLA 5HY1A 1I4WA 4EI8A 1VE7A 3B5EA 1UXIA 4LJ9A 5FUMA 3RSZA 4C0BA 3HU5A 4ZTZB 2R6HA 1C4WA 4MA0A 4TRNA 2XOKA 3DMRA 4RORA 1WN7A 2IAFA 2IHTA 2Z9CA 4NYJQ 2BEUB 1X1CA 2RI1A 4QLAA 4JI4O 4F4DA 1Z45A 1WCIA 3M1LA 1N77A 1A9QA 2UUOA 2J7PD 2ZIXB 3DBIA 4N7BA 1YZLA 5FWNA 2F3UA 5FR1A 1WX1A 2IXEA 3FCSB 3RYFB 3QE3A 4E5DA 4PPQA 2VA9A 2FP3A 5CLQA 1QDEA 5B1DA 3CUWA 2GLZA 4ENVA 1UBLS 3NEJA 3DDCA 2JFWA 4HBZA 1WM1A 4HTFB 4RPHA 1XQ1A 2DBVO 1DUSA 2Y9MB 2NO1A 5JNUA 3IE1A 1U0BB 2WU4A 4XVUA 2A0LA 4B8ZA 9ABPA 2HU2A 3NT5A 1XZJA 5A3VA 4EJ2A 1W41A 5B57C 4L0CA 4TWRA 1R8QA 1H47A 1Q0RA 2EWWA 2GLTA 2R6DA 3GEMA 3F2VA 3HI6A 1NXOA 2RGEA 2E5WA 3Q11A 2B69A 4NG5A 4Y6OA 4NEHB 3R5SA 1MHTA 2WV7A 4TV8B 4MITA 3Q9LA 1E4YA 4UZFA 1FS6A 3BCSA 3CO0S 3E9EA 3HU2A 3WQQA 4A5SA 3AR4A 3R09A 4KSBA 3INRA 5JQGB 3I9MA 5ALOA 4DMMA 2G0NA 4C43A 4E7OA 4QM7A 3HKEB 3CVUA 4OCZA 1MMFB 4LWZA 3ABMC 4JBNA 3X44A 3SDLA 1G8AA 1E4EA 3JQGA 1J0BA 1JEAA 1ESEA 1O7JA 2DC1A 3BMOA 3RLIA 2GEFA 4L95C 3T1QA 5KVCA 4TRJA 3F78A 4S1WA 1E2IA 3O91A 2E5LO 5B6IA 4RS3A 1LY1A 2JEXA 4G2KA 1L5WA 2V4UA 1XK7A 4HDKB 5DHTA 3L01A 4GQBA 1UT5A 1GX1A 1KZHA 4MLPA 5A4DA 3T5AA 4DWWA 1D2EA 4Q03A 3LA6A 4C2UA 1REQB 5HSGA 5LP6A 1WQ4A 4BLQA 2I1VB 5ALGA 1WXWA 1FLNA 2QX9A 1GUFA 2XHZA 4JLKA 4WZBA 3HU1A 1DQZA 4PQGA 5A7HA 4PPYA 3DNFA 3CKMA 2AHOA 4MW5A 1RABA 2FGYA 1M67A 1RWOA 1FE8A 2AK2A 4DSTA 4ZREA 3OD4A 2VS1A 3DQQA 5A5EA 1SF9A 2QW0X 4G5SA 4NMWA 5I5EA 1EZJA 4EPTA 2CN1A 1SEVA 2Q7HA 3EORA 4UM9D 5KHIA 3KYBA 5EP3A 4CUJA 1T8SA 3RU3A 3O92A 3ZWNA 4IQ0A 4FOSA 4M0KA 4N3NA 4L4YA 3ROGA 2I6SA 2ZAGA 4CL0A 4JI2O 4LG1A 4ZOLB 3ICCA 3ZHYA 3HLYA 5HX7A 3RIYA 4BNDB 5JDCA 1IYZA 3IBCA 2B25A 3H99A 4ND5A 3LY5A 3R41A 3T7JA 1NW4A 4DJEC 1PL0A 1HEYA 2VP0A 5CVJA 1NH2D 3E3LA 3FCYA 4XGRA 5ARCA 3T9CA 1H23A 1MKYA 3FWZA 1ENZA 1KS9A 4Q9KA 5IC6A 4KRFA 2HJFC 4NCNA 4K9RA 4R31A 3ETQA 1AXGA 2ZUTA 4X45A 2C8VA 5JAHA 1FK8A 5B36A 3PX3A 1OI2A 2PWZA 4UUJC 4KP4A 4QOFA 4TMWA 4KNYA 1JAHA 1W2HA 1KIMA 2DWDC 1E2NA 2H17A 2AMTA 3HVRA 1R12A 2GA9A 2H00A 4FVTA 1H48A 4X54A 1EHCA 2YINC 2B7LA 3A8TA 3BORA 1RKXA 1PJ4A 2Z4SA 3CF0A 2WPDG 3LWQC 1VJCA 1FYXA 3Q87B 4NSNA 2ORIA 1X7PA 4GPIB 4PGFA 4RUKA 4ZT5A 1KEEA 1KR2A 1MC4A 1TK3A 3JQFA 4K9QA 4RA6A 4MVJI 1NQUA 2PU5A 4BGIA 1YZNA 2Y0EA 5FH9A 5HXZA 3CD6F 1V41E 3AHEA 4RTRA 3MOIA 2VNHA 3NIGB 1VZ2A 3T5GA 2XNDG 1J99A 4W8GA 1VI2A 2I6FA 2KWIA 3KL2A 1S96A 2OBYA 1NVTA 2XAQA 3MWDB 2WKWA 3RWBA 4B4WA 5JECA 4AZTA 4NHOA 1CRWG 2P9BA 4FFRA 4XJXA 5EPOA 5ITVA 3CR8A 2OCPA 2ZU6A 2EYUA 2P2GA 3FOZA 1VSVA 4QPJC 1U2TA 3UICA 3EIWA 3K1TA 3U16A 1G2QA 2ALEA 4COKA 1W5EA 4RQEA 2RONA 2VBGA 3K3PA 2WALA 1O6BA 1Z35A 2FOLA 2OWEA 2PMWB 3L9DA 1DEKA 4HDMA 1F2UA 2XNHA 2DPLA 2UZ1B 2FQWA 3ABIA 1OPXA 1HDJA 2PR7A 3WPWA 3CGGA 5FFNA 2XR1A 3CIOA 2WJ6A 4UEJA 4U7NA 3CVOA 3B1WA 2NQ2C 4WKOA 5CFOA 4RQOA 2AJLI 3EVTA 3PGMA 2ZUVA 5KVSA 3GP8A 1JTVA 2CSUA 3BJZA 3GFVA 4PBTA 1CRLA 4WE3A 3ZGYA 5JWOA 1JR6A 1F2DA 4YN3A 3WBBA 1HE2A 1ONSA 5BR1A 1IXRC 4ESEA 2DZDA 1UDCA 3ON1A 5KNCD 3O26A 3U3KA 4EG7A 3FYEB 3LDHA 1J9ZA 3DP9A 1IXSB 1Y34E 4WXPA 3BWEA 2CK3D 3GWKC 4YJGA 3T3PB 2VTBA 4JXXA 3D54A 1Z6QA 2VUIB 4CM4A 5LXTB 3CCUV 4B80A 3UJ3X 1BXKA 1JV2B 5DNVA 3OT1B 3QFFA 4V2UA 3UNXA 4ZVTA 4QYIA 1NZJA 5DM2A 4UW9A 2GDZA 4JOSA 1WMBA 1WUIS 3H2ZA 3HEBA 4RKQA 2BJVA 1XRRA 1EM1A 1U2DC 4YCBA 1FUEA 1TYAE 1FNJA 1HKHA 2ZVJA 3A9SA 2DYRB 3ILXA 4POOA 4C2BA 4X24A 3PR1A 3M8KA 1XU4A 4FFPA 4OSOA 1BW9A 4DLVA 3OM0A 3COYA 1DFIA 1P7YA 3WLQA 2LW7A 2R7MA 5T6BA 2FRDC 4IGIA 5E4YA 4J0GA 3QW2A 2DW4A 3I3FA 1P2DA 2ERXA 4MW3A 2PBFA 1POXA 1GA6A 2HREA 3KB1A 3M5PA 5DO9A 3J81A 3GEDA 4LFCO 4L6IA 1WEKA 3B4SA 4P3KA 2KG7B 5C5EA 2BEVB 3T1YB 4KQIA 4UTOA 3AW8A 4WCEV 4PRKA 2ZRBA 4YLEA 5DI9A 3WGYA 4U2FA 3O8OA 5L3SB 2I7XA 1AA6A 2OCBA 1HNXB 3QHPA 1WSWA 3HJUA 4TTJA 3VR5H 1JN0A 2X0EA 1N4DA 3TDKA 5IH7A 2IOQA 1UFVA 1ATIA 4MVJD 1BMQA 3B3AA 4CM8B 1A9XA 3T3OA 3B3FA 3UTCA 1CIJA 3CC4F 3QXHA 2HA2A 1NNSA 2HJDA 3H0CA 5FPYA 1ORQC 3LSUA 2QD3A 2ZBGA 2V7XA 2VNKA 4BNHA 1PR9A 3J7TA 3O82A 1D4ZA 3ICEA 1XVLA 2VCHA 2DAPA 4QUGA 1BCCH 1I5XA 5JH7B 2DOSA 1W5FA 3LOUA 1OH5A 4J4TA 1BKDR 4IWYA 1B3QA 4IF4A 4D9KA 3IBSA 1IZYA 3U7QA 2HRCA 2QE7D 3GN2A 3OEEA 2A94A 3OG9A 2EIXA 5J5AA 2PF4E 5SYMA 4C08A 4AJEA 5CD9A 3GLHB 3UM7A 2P2DA 4JS0A 4AULA 1NR1A 3L77A 3AEKA 3MHPA 4WIAA 3P9KA 2ZKOA 3K0EA 1E8DA 4H0NA 4IXTA 4MHTA 1FMJA 4UBJA 1GSIA 5A0TA 5TF4A 5DYWA 1NE2A 521PA 3MAGA 3WK9A 1ZPDA 3IULA 3NT4A 6AT1A 4PHHA 1PG5A 1OWPA 3T9BA 1WW3A 4PLGA 4BFTA 3E9QA 5AICA 5HOEA 1OROA 5JZSA 1BCSA 4AJ1A 1A69A 1GTG1 3JALB 3L7KA 1YZUA 3S2IA 5A2GA 2WIAA 3LX6A 3BMNA 1GTZA 2R4QA 3IYLW 4JUBA 1F4MA 4Z7QB 1J6UA 2CMDA 1SCIA 1L4NA 2VQ6A 1XQXA 1Y89A 2ZIWB 2QX6A 3DBVO 4PCLA 2CDNA 3VU0A 1SVOA 3BXHA 1NTRA 4QBHA 5C51B 1LNSA 3HN6A 4LF5O 1WBJB 1L5QA 2XH8A 4IDGA 4UOZA 1UR5A 1CU1A 2D5BA 5F51A 3DOIA 1MX1A 3F6CA 1B15A 1V3QE 1ZKDA 1P3JA 3H2HA 3IIEA 3STWA 3W2IA 1Y1QA 4QXAA 2RH8A 1GRQA 4DWOA 5KBYA 1T5HX 1YE8A 1LS1A 2GCOB 4X8HA 4G4WA 2XOXA 4ZAYA 3DTVA 1N32B 3CMAV 1Z0FA 3PTLA 4Q7JB 2R5WA 2R6GA 5J3JA 1GQ2A 3ADKA 2DETA 2GXSA 5TQ2A 1Q7TA 4XIYA 3DTTA 2HX1A 3SVLA 3QX9A 2O1XA 1LBQA 4OPHA 1Y9JA 1JI0A 3DDUA 1KY3A 1V16B 2W6QA 3L1IA 3DA8A 2XIJA 2ZIXA 1D2HA 3HACA 1QVFU 4HDAA 4LDPA 3WP1B 3U1BA 2XCSB 2C2MA 3AMVA 2ZYIA 1EZ1A 1C41A 4O1IA 2HT6A 4XJTA 4IKOA 4N82A 5F21A 1BFUA 2WFZA 3AM4A 1I14A 1CDEA 1MGOA 1RLUA 5DWQA 3ZE9A 5U4QA 2XHBA 3S2SA 1VKHA 4FC6A 2G9NA 1XZGA 3T5DA 3KPYA 4BQEA 4MKIA 5CCDA 4GAEA 5GP1A 4BN5A 3AZQA 2AKEA 3ZKWA 3FTFA 1PWHA 2DN9A 2CMFA 3GJSA 2FWRA 3EPKA 4J07A 1P6XA 1UJBA 2Z2XA 1MJGA 4BV3A 2VWQA 4YXFA 1Z5GA 4INJA 1K33A 2G7MC 4E21A 1YR9A 1EAMA 4PYIA 1CNMA 3TE7A 1Y74B 2WJIA 3DVAB 3I1JA 4LOHA 3ZU3A 2ZANA 4CH4A 1T4CA 1K9VF 3I9LA 5CW1A 3Q6IA 1WKCA 5DASA 2HSWA 3H4TA 1E1YA 3Q9NA 3QFSA 4O1HA 3T34A 1Q77A 1KARA 1AS2A 1NVPB 4MVJM 4WT7A 4F3TA 3L18A 3FJ1A 4QXOA 1HG0A 5JQGA 2XOKG 2H63A 3MT9A 3P94A 4FMBB 4WCFC 3RG8A 4JLWA 7MDHA 3IEXA 1ZOOA 4KHZA 4ZOQI 1BS9A 5G40A 3NBYC 4CQNA 1NBMA 3EC7A 2UUCB 5LHHA 3W79A 5G4VC 1GO1A 2Q3FA 2ERCA 5ULLA 5JJNB 2ZR8A 3SYLA 2J0VA 4H6WA 2AB0A 1JKJA 1JPUA 2RGUA 3NVIB 2BONA 3DMGA 3NVMB 1D0VA 4KNVA 4RTPA 1TVMA 3FSGD 4LYHA 2G6TA 3KCXA 1Z7YA 3KZXA 4UVAA 2C1XA 2QG9A 1KQSU 1E1RA 3GWOA 2QZ4A 3NBQA 1SC5B 1B3RA 3L0PA 4DDKA 4AY6A 4BE9A 4BY9E 3RHZA 4JI8B 2X5JO 1HX7A 1GP2A 2QQ5A 5C4MA 3TLMA 1KTIA 4BR6A 5HM6A 1MAUA 3QJ5A 2W71A 1VCHA 2R96A 2XKBA 4I8XA 5E3JA 2H1OA 4ZHQB 2OO5C 4IDEA 3CCEF 5AFSA 3CW8X 2FGJA 5JCXA 1IXYA 3GEEA 3DQPA 5DE3A 3RS2A 2ZE6A 4YRPA 2AMLA 4R2MA 3U48A 3ADCA 1XJQA 3MJDA 3ZE8A 3E82A 4HEHA 2QTVB 3QKRB 3S44A 2RHMA 1L1QA 4R50A 2V4MA 5EJ4A 3IPAA 1MRNA 4J4BA 4WZBE 4ZICA 1BSVA 1A4RA 3BFVA 1TA4A 2XY4A 4ME6A 5D6OA 3GW8A 2E4ZA 2HZ7A 4US2R 3JS5A 4BDTA 3WWYA 4G01B 1KJYA 2O1EA 3H8VA 1KMNA 4GSLA 4PZEA 1V47A 1EWTA 2XQVA 4NMLA 2HO4A 4Q9JA 4YRMA 2CVHA 4X3OA 1EDZA 1J7JA 4DIMA 1U0LA 4P53A 1XC7A 1DWPA 2L17A 2QLTA 5EUQB 3H1BA 4P86A 3UOWA 3ISVA 3S2FA 3WK5A 3EVDA 2P9QA 2VHZA 2J5BA 1QLEC 4ZO8A 4FB4A 4RTNA 1NRJB 1LZLA 3PVCA 3CKLA 2ETNA 5KDDA 3ZHXA 1NVUQ 2RAUA 2AR7A 1ONNA 4IXDA 2A3QA 2YV5A 1U2DA 3BS4A 3WGMA 1DC5A 1I2BA 1CJSA 1HEUA 1LF0A 1SD1A 1WZNA 2X9GA 2Z6VA 3BD6A 3PR3A 2JIBA 5EWMB 5TJHA 4F2HA 1JSCA 4U7HA 2IS1A 1TJ4A 4JV5O 4XDJA 1AQIA 4CS4A 1Y76A 3T0IA 5DRYA 5GINE 2NW6A 1I3NA 1N33O 3KTFA 1DBWA 3ILYA 4MRMA 3FGOA 1BOOA 3PDIA 4LF7B 3ASNB 1BYUA 2DHDA 2JH3A 4NZOA 4QGBA 4YRCA 5KYXB 4MUGA 3BH7A 5DIZA 3OOWA 3UA4A 1PJAA 2GVIA 2GUWA 1V1JA 1PIWA 1KD1W 2RGNA 3PIIA 3Q3GE 2ZTUA 4I4TB 2G72A 1X2EA 3HLTA 4Y0AA 1C9JA 2WM3A 3K8ZA 2OXIA 2RDCA 1BD4A 1XCJA 2FFQA 1WTAA 2VS0A 2I54A 3WIEA 1MTZA 4NBUA 1XZLA 2HB6A 5EP2A 4PDMA 4D81A 3I1YA 4TXHA 1VXRA 3CMCO 3ET4A 4IZ6A 3PJFA 2FVXA 2A1TR 1R74A 2EERA 1X80B 3GUHA 2CWWA 3OT1A 3A7DA 4G2NA 5JCPA 2EILB 4XOUA 5AK6A 1VDMA 2X8JA 3R7BA 1NVBA 2B4QA 4NOJA 3U7GA 1L5GB 4CM9A 3B3GA 3TZLA 2JCVA 1CJTC 4JWKA 3MD0A 2ZKLA 3HP4A 2IE8A 4L3WA 2V1XA 3PBKA 4TMTA 5AHXA 5K3CA 3K0DA 3C70A 4ZAWA 4RTLA 1KEUA 1M7BA 3HU3A 3HYLA 4TKVA 4YJHB 2W2TA 1U4NA 1WNFA 4DEXA 3BT7A 1QZ3A 2P9CA 4WCVA 1ZH8A 3KSDO 4CT5A 1TDJA 3W90A 5JJCA 2QF7A 3ESBA 3E05A 4MJXA 3WMGA 3WYNA 4LTDA 5M29A 2VYQA 4LGCA 5AOVA 3T3NA 2YN0A 2HQRA 3ABLC 3QOYA 4Z86A 4YRAA 1S0VA 2AR0A 1HWYA 3DFUA 4KN5A 2PI4A 2GN2A 1YA4A 5MN4A 3OCYA 1OI4A 4D97A 1COZA 4UCRA 3HFRA 3JSXA 1KETA 2XCOA 2PKEA 1VKZA 4R6XA 3RSLA 4A5OA 4ZGWA 4P4NA 3ZG6A 3OZRA 3HPQA 1QVRA 3I2GA 4BNLA 5TB5A 1M57C 4DV7B 1W4LA 1WMDA 4BNWA 5FNVA 3AEXA 3CC4V 2EFGA 2QRJA 2YY5A 1X38A 2RHCA 2WM2A 2J08A 1K4CC 3D4PA 1DDOA 1XF9A 4F6CA 4K9SA 1ZD4A 5LZ9A 3LUHA 1IV2A 2G7ZA 4AJPA 1WA5A 1IK4A 4MV8A 1UFKA 2XE6A 5L7YA 4PZZA 1E2BA 3ICPA 1RJGA 3OPMA 1X92A 2N48A 3W9YA 1KKDA 3ROMA 2B2CA 3CB2A 3W1EA 4Q7KA 1DXOA 2B5OA 4LJYA 4EG1A 4R8CA 3HY3A 3RWMB 1C8BA 3UKOA 1HYQA 3Q7SA 3L0ZA 4QGSA 3E8BA 4REMA 2ZYUX 3P9RA 3U9SA 2XCRB 2DG2A 2ECPA 4XCQA 5JC8A 1NRIA 1JHAA 3QKUA 2ON6A 1XB2A 1N32O 2FF7A 3JAKA 2WD7B 4X88A 4QJFB 1SXJE 3D5TA 3I1IA 2FW7A 4RXUA 4TV9F 5J1SB 2AG6A 3IX7A 2WK1A 2AOWA 3P20A 3K20A 3UOGA 4D4JA