3JALB

Cryo-em structure of gmpcpp-microtubule co-polymerized with eb3
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 150
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jalB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jalB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jalB01
5J2UA 3JATB 4KWEA 4TV9A 4EB6B 2RHLA 5IJ0B 2VAMA 5GONA 3RYFA 1RQ7A 4I50A 4IIJA 4O4IB 3VO9A 4EI7A 4TUYA 5IYZB 3VOBA 5KMGB 4O2BB 3WGNA 5ITZA 1FFXA 1W5FA 5GONB 3RYFB 3HKBA 3WGMA 1W59A 5LYJA 5J2TB 4YJ3B 4F6RA 5LXTB 5LOVB 4DXDA 3R4VA 5LA6B 4U3JA 5EYPB 4YJ3A 4F6RB 1W5BA 4DRXB 5J2TA 1W5EA 3E22A 3N2GB 4ZHQA 3UT5A 5CA1B 1JFFB 5JH7A 3JASA 5BMVA 4E6EA 3HKDB 4O2BA 2VXYA 4U39A 4EI8A 2RHHA 1W581 5CA0A 4LNUB 3ZBPA 3ZBQA 3RYIA 3V3TA 3JAKB 5EZYA 5JCOC 3RB8A 3HKBB 1FSZA 3HKCB 3JARB 1Z5WA 4B45A 1FFXB 3E22B 4ZHQB 4X1IA 4FFBB 3JAKA 5JVDB 3ZIDA 4I50B 3JAWA 4O4IA 4IHJA 4U3JB 4X20B 5LOVA 5LA6A 4O2AA 3RYHB 5MN4A 5CB4B 4LNUA 2R751 3RYCA 2XKAA 5LP6C 1TUBA 3N2KB 4YJ2A 1OFUA 2R6R1 3WGLA 3HKDA 3WGJA 4TUYB 5IYZA 4EI9A 3HKCA 3JARA 3RYCB 4ZI7B 3VO8A 3HKEB 3N2GA 5JQGA 2VAPA 5IJ9B 5EZYB 3JATA 2XKBA 2BTQA 3RYIB 5LYJB 4TV8A 4X20A 3HKEA 5JQGB 4I55B 4FFBA 5C8YA 5JVDA 5EIBD 5ITZB 4X1KB 1SA0A 1JFFA 4I4TA 2Q1XA 1TVKB 4O2AB 5MN5A 5IJ0A 4O4JA 3JAWB 2BTQB 4B46A 4IHJB 5EIBC 1TVKA 5MN6A 4O4HB 4HNAA 4X1YA 5FNVA 4ZI7A 3JASB 5LP6B 3UT5B 5CA1A 5JH7B 3JALA 2VAWA 5KX5B 4O4LB 4IIJB 1RLUA 5CA0B 4TV8B 2GVIA 3CB2A 2RHJA 5KX5A 5J2UB 5JCOA 1SA0B 4X1KA 4I4TB 5BMVB 1W5AA 3VPAA 4ZOLB 3C8LA 5KMGA 4O4HA 4X1YB 3VOAA 5FNVB 4YJ2B 4I55A 5EYPA 2Q1YA 2RHOA 1RQ2A 4EB6A 4O4JB 3M89A 1Z5VA 4O4LA 5CB4A 5LXTA 5IJ9A 3RYHA 4WBNA 3JALB 3WGKA 5LP6A 4X1IB 5M7EA 4M8IA 3M8KA 1TUBB 2BTOA 3N2KA 5C8YB 4XCQA 4DRXA 4ZOLA 4WBNB 4TV9B 4HNAB
chains in the Genus database with same CATH superfamily
2XMPA 1KI8A 4GKJO 1PR4A 1UZNA 1U4SA 2PVPA 2Q5QA 3EFOA 3FTNA 4MA0A 3I83A 2YEVA 3RUEA 4L0MA 3BICA 4NSNA 2BM9A 3O4GA 1E1QG 2YIBD 1IJEA 2V55B 4ENVA 4BVSA 3FD8A 5CG1A 4EPTA 4UFPA 2PMFA 4P2GA 1BWRA 5IE9A 3DNFA 1W75A 3F7OA 4B4KA 4ZIRB 1JP7A 1GARA 2FWBA 2OBFA 5FJIA 3CC2V 3QSGA 3AEIA 4IT5A 1A9PA 1G6HA 1RM0A 2J6CA 3PNKA 2MU1A 2Q5LA 3CB4A 3O1JC 4JYMA 4MYDA 3OAAA 4E15A 4ZJUA 4Y1GA 2HDNB 1JFRA 3H2BA 3PQ5A 1AOXA 1QYIA 4XWTA 3TVTA 3QVWA 4PONA 5FWYA 1C7RA 1GPYA 1BQ0A 1FS0G 1DTEA 4YGXB 4AZTA 5HY1A 1DAHA 5AW9A 2NPIA 1OTHA 1T10A 4D3SA 5B1EA 5BYAA 2O5EA 4FPXA 4OHCA 1L4KA 4C6HA 2BZSA 2AQ8A 1QOQB 3TX2A 3NBYC 1NQXA 2CLSA 2DPLA 3JVVA 3ST7A 4C2UA 2OVFA 4G4YA 2YZNA 2HRDA 4R8KA 4PYOA 2QMOA 3VU8A 2BJVA 1RPRA 2BLLA 1A9YA 1RXEA 2IP2A 2JRCA 3GLQA 4PAWA 2XLCA 4BNUA 5I8PA 5HP7A 3SM9A 4EKYA 2RHTA 3NWPA 2BFMA 1M1NB 3G02A 3AFMA 3VR0A 1H0KA 5ENDA 4F72A 3SR0A 2R1ZA 1QYCA 2MTBA 4Y2QA 3K9AA 2Q3BA 4MGYR 2GUZB 2HO5A 2F55A 3KQSA 1RYZA 2OZEA 1YHZA 4EI9A 3GJRA 4I9NA 2WM8A 1X7HA 4DZRA 1A5ZA 2H6LA 3PUVA 5AK5A 1K6MA 1LV7A 2RIPA 3HFRA 4OX9B 2GWHA 3LF1A 3NTLA 4H0CA 1KC3A 1ZFNA 3BE6A 3KL2A 4CQJA 3H1BA 4N0QA 2V7TA 3PVSA 1H48A 2RB9A 3IEIA 1WXHA 3ZWVA 1S5PA 2OLKA 4MK4A 2GZMA 4WEQA 3ORRA 4GP9A 2JJMA 2QVCA 4FDAA 4E31A 5L51A 4UB6Z 1NF9A 4DR1O 4GZRB 1YJNF 2JRIA 4ABMA 1Z0SA 3AFHA 2QI9C 4QYMA 1GWNA 2HU2A 3FAZA 1WVMA 1NVMB 1NBMD 3HDYA 4Z8YA 4IR7A 1DVRA 1YMUA 3AUFA 3X3HA 3SJQC 1QIFA 3EZ2A 4E70A 3OPVA 3C1UA 1DCMA 3D5TA 4L08A 4E5SA 5JQWA 2PX4A 1GSAA 1L7QA 1UEIA 3OQVA 1S2GA 3WNZA 2GKOA 3W8EA 3L1JA 5C7IO 2F9FA 4ZU1X 3I09A 4RK7A 3U60B 1K5PA 1AG9A 4MINA 1FRNA 4FS8A 3GMSA 3HUFA 5BN5B 3THRA 5TQJA 3T99A 3DTTA 4CG2A 5BR4A 2PANA 4HF7A 1GN2A 3C7DB 1AKNA 1KKLA 2VYNA 3DMGA 4NH4A 5GZ6A 4QGSA 1Z2GA 1YZGA 5JWRA 5EJEA 2CMKA 1LFDB 2V65A 3DHNA 4IIVA 2QE6A 2YV3A 4P4SB 5FFNA 2OPHA 3UHOA 4KAAA 1NW3A 4JI1B 1RD4A 1B1CA 1RYHA 3ITNA 5EHGA 5JR3A 4GVXA 4R81A 4O4JB 2XNSA 3KO8A 4ZT2A 1XFDA 5CBPA 5IDXA 2VQFB 4KDRA 3I55F 3JWGA 2GN4A 2HSGA 3FJYA 1YBHA 2P1DA 3DO5A 1HGXA 3CCQF 4C4WC 3BD8A 1GQRA 3W5VA 4JV5O 1MIOA 4XCQA 3M4JA 4Z9FA 4F93B 2ERXA 1J1UA 2GBGA 2JFXA 3C85A 1MQ9A 2N05A 1W2HA 1C3XA 4LF9O 1U8YA 4JGSA 2APJA 2OESA 3HVIA 1P5RA 3LX5A 1LI4A 3D5EA 5LUBA 3TM5A 5I7EA 4MW9A 1BT8A 2D2VA 3FSGA 1XI1A 4IY1A 5BQPA 3S2GA 5C9ZA 1EWRA 1U3TA 3MLEA 1WV1A 1M6VA 3D6TB 1QHXA 2QZZA 5E7IA 3W3AA 8GPBA 4M0PA 2OT5A 3R65A 1JR3D 1MNQA 1JKFA 2I4RA 2XTNA 4GUDA 1RJEA 2RGBA 2ZJ7A 3ZE0B 2NYUA 1DAEA 1VG1A 4JL8A 1W5TA 1QGUA 2PBFA 4XIJA 4YCDA 3ENQA 4LGCA 4MVJH 1R18A 4QJIA 3UJPA 2FX2A 4WBNF 2XB2A 3EEQA 4M6WA 3KUCA 3I9V1 1I5OA 1OIVA 3ASVA 1AV7A 5M34A 4NXMB 1H9AA 2O23A 1MW8X 1S0UA 4XDGA 2ICAA 3PQCA 4QUEA 4W8GA 3TLKA 2J59A 2VYQA 2NACA 1GL7A 3A9VA 1AA9A 2WDPA 4CCYA 1HBJA 3GTZA 3SGIA 1BHBA 3MFQA 3PVZA 4TT3A 1XXHA 4C4YA 5JROA 3B1WA 4HS4A 1NULA 1GL9B 1QHGA 2V6JA 3WGGA 1NRXA 3O90A 1VLLA 4U4AA 3DMYA 2YOHA 1UBGA 1KBHA 3UQZA 3ENKA 4HADA 2OSBA 3EFFK 1B6RA 1U96A 1VIYA 4RHTA 2BH2A 1F2VA 1YDEA 1ACMA 5H59A 4BRUA 1IBRA 3PEWA 2ONCA 1IBLB 1FSGA 1KYVA 2PX8A 3NR2A 4GMDA 3ZVNA 4MKHA 2EWMA 4JC8A 2WIAA 4FI3C 2EZOA 2UUCO 1ORRA 3K31A 3JQAA 4Z1OA 3RYCB 1N0JA 3ZD9A 3BEDA 3FPCA 3K73O 4Y2TA 3TW8B 1XZLA 3EFOB 1YK0A 3TETA 1M6EX 1A7AA 1RRMA 1KKDA 2NVWA 2J3KA 3HKEA 1IMOA 1KI3A 2XECA 3FNBA 3GARA 4MKGA 3SJCA 3TQCA 4F3TA 3WDSA 1L3BA 2JIZA 2P9BA 1VCMA 3BH7A 1H2RS 2R2GA 3R5JA 4UOQA 4ZWNA 4HZUB 4Y67A 1CRWG 1PV2A 4WQMA 2FNAA 2QSYA 4CR7A 2LVBA 2DKFA 2JGNA 2Z5FA 4HL6A 1SB8A 3FBGA 3FOFC 1P4HA 1TIPA 1W85B 2F17A 2FGJA 2OYQA 1J2JA 1LX7A 1WZUA 3JXEA 4TRMA 2CDRA 4K40A 1OREA 5J5CA 4YRKA 2ZBGA 3I12A 4ACBA 2AC2A 3G79A 5F35A 2C7PA 4INPA 4KCGA 4EW1A 1IOLA 2DECA 3E18A 5AG2A 2D3OW 1XEWY 3NHPA 1PNVA 5JCZA 2P6RA 1LX6A 1HTBA 1WCWA 4DQUA 1J0CA 3IUSA 3IOEA 5ICMA 5K2MA 2ISQA 3ZEIA 1E5TA 3LDCA 3SZ3A 1P1IA 1XD8A 2NO5A 4F6EA 3IIIA 3WB1A 4NI5A 4ND7A 3I4CA 1T5TA 1R74A 2C4HA 3D4BA 2F8SA 1NWHA 3IHLA 4L5CA 3FNGA 3DXZA 2B1IA 1R4ZA 2XAAA 4WK6A 1S1CA 3R3VA 4UUJC 3PVCA 4H7EA 5FTMA 2PLFA 4N7RA 1TLFA 2ZRIA 2J6HA 4E6PA 2PGOA 1KEKA 4BVQA 1KAHA 4JI7B 1CQJB 1PZFA 4JC0A 2QU8A 3LWQC 4L1KA 1YHNA 5LR6A 4ESEA 1GNLA 3CO5A 4BP9A 4TXJA 1Z6ZA 4HS9A 4JEUA 3NWEA 2A58A 4OQQA 4WKGA 5K3AA 3UJ9A 4URVR 1A5SB 1JSCA 4MUMA 2GZ3A 4OFZA 4X8HA 2DEUA 4JQSA 2WJYA 1Y48E 1L4YA 1LNZA 1WY5A 3L6DA 1IJKA 1R0RE 2D0PB 3GYQA 1J97A 5JAMA 2X76A 2AEMA 2IIBA 3LPCA 3NHBA 3TSAA 1ADCA 4PLPA 1AJNA 1JIJA 1JVNA 5I3CA 3A2KA 4OXRA 4XRRA 4XEUA 4JBWA 3PFFA 2HQOA 4IZ6A 4DV7B 1GL3A 1NPDA 2GARA 4OAQA 2YWJA 1JQEA 4YP1A 5TS3A 1M0SA 1I10A 4R2IA 1ENZA 4Q7KA 3WLTA 3M6FA 2Z09A 1VQ5F 4X7PA 4U2BA 4Z4EA 2W37A 4N5NA 3GA7A 4I6GA 4Y2RA 3R66A 1ZONA 4WSOA 3W4IA 3WL3A 3WLLA 5H4GA 3JASA 2P0AA 5K0NA 3CZAA 1BCSB 3HJAA 5L7YA 1PT6A 4EB8A 2C9YA 4JJGA 1PV0A 2DQ4A 2REQA 3L8GA 2I1VB 4R31A 3NR7A 3OZEA 4MUAA 1V1JA 5ELMA 5IDVA 4G25A 1U8FO 2UYJA 3OE1A 1TAHA 4DUYB 5CCXA 2L35A 2QEQA 3ND8A 2IUYA 4YV1A 4L4SA 1R1MA 1LDMA 3ANLA 4HDMA 4QUKA 1OCOB 4KUMA 1YJNV 5JS7A 1Y33E 3M5CA 1A76A 2VK4A 4K9LA 2XYGA 5HFJA 3H7IA 4ZMRA 2QE7A 2QA4V 2PRYA 4IGIA 2VP3A 1CK4A 3LYUA 5EWRA 3OSUA 4LYDA 2FZWA 1MN6A 2F8MA 3DM5A 2OYCA 1ADBA 3RUPA 4CM6A 1BDHA 3A1UA 4DM7A 2VDOB 4TUYB 1LVHA 1LQ2A 3N8NA 3GAFA 2D06A 5EKUA 1E1QA 3C7AA 3FUTA 4Q34A 4KPUB 4CIXA 1OCRC 2B0CA 3AYXB 4OHVA 3UUGA 3NG1A 3UUWA 3H01A 5E9AA 4MSWC 5ALFA 4A0RA 2HSDA 2O8CA 2ODBA 1F9AA 4HJXA 1A2KC 2PZAA 3BMOB 1Q3KA 5AVOA 1E2DA 4NZ9A 4B7EA 3W5AA 3ABTA 4DV4B 1CUCA 1HY3A 1T34A 5EIFA 2X1LA 5P21A 3NUZA 1DKLA 1PJ2A 4YRTA 2M1ZA 3KNZA 1K63A 1XK7A 4LV8B 4WH0A 2NXEA 3ZJYA 4EYQA 3RIEA 4UQPA 4DWOA 1LV8A 1UPTA 2HV9A 4FWTA 2O20A 4IHJB 1C4XA 1E6MA 3BEOA 4ZK2A 3GLFB 1UAGA 3OM3B 1X3LA 2JS5A 3EIFA 5I4BA 3D6MA 1Z7WA 5FUBA 3NW9A 4MRNA 1GSHA 2QAJA 1SKAA 4GX2A 4FLWA 3OCZA 3CMEV 3ETQA 1N0VC 4JEHA 4R2HA 4Z9BA 5EXTA 1Y5NA 2C3MA 3E23A 1A8IA 1V7ZA 3VC1A 3SXUA 2H1LA 2V1DA 1SKYB 3CB2A 1C3VA 4KLNA 1VQ4F 1QZUA 3F5DA 1CG6A 2DKOA 4Q12A 2OK8A 5IBCA 2HR1A 2YH2A 1T0BA 3JR7A 4KAXA 1QGZA 2P9EA 1QYDA 2BV3A 3HZHA 3M82A 3O2SB 5CXQA 4HZIA 4JXZA 2DFNA 1XTKA 3D01A 3MB8A 5ANRB 4MRPA 3SYPA 2GBLA 2M9MA 4GF5A 5AR1A 2R9IA 2X5KO 3G2OA 3LQKA 2Y69C 4F4UA 2JLZA 4ALNA 1VFNA 2X0IA 2X4DA 2XIQA 2EWWA 2M1XA 3H2HA 4FGJA 4IDPA 4OJYA 1RZRD 4DUGD 4JASA 2AXQA 3FZYA 4WW0A 3TCUA 4B4DA 1LPOA 2YI9A 4HWOA 2G72A 2J5BA 4Z4GA 1OI4A 3GDWA 1CVRA 4IWXA 4E51A 4AJ2A 3KR0A 3TLYA 1BHJA 4M0LA 1WY7A 3F0FA 4ZT6A 5JFTA 5KNLA 4G6ZA 4IRMA 3G67A 4IZOA 4HD8A 4U2FA 4CF3A 5K8TA 3TIXB 4OYYA 2H9YA 2R60A 3NNDA 1FQOA 4UM7A 5LLSA 4D6TH 1C7EA 2ZTUA 3O93A 2RN9A 3S1LA 1JLHA 1RRFA 3WISA 3Q87B 5A5DA 5KDOA 3EMKA 1PWXA 4B6RA 3DONA 5M2QA 1XP8A 3RVRA 5GTDA 5KNDA 4CKCA 1RXUA 2BGJA 4YPVA 3CYPB 1ZGJA 2JAXA 3EEYA 4M9RA 2PMKA 1TT5A 3VHXA 3S1AB 3HUDA 3V4OA 5CDUA 2O7RA 4RIHA 2VPIA 3COVA 4QKQA 4BW0B 1AT1A 1H05A 3I8XA 3B5IA 1VGVA 4PVDA 2JGEA 4YCMA 2WNIA 4UB8Z 3MWDB 1MLDA 5JCOC 3QFSA 4R01A 1U1GA 1KAEA 3M2PA 1XELA 3T1YO 5BV0A 1JDTA 2JVKA 4LV6A 3IOBA 3CYFA 1JE1A 3LI2A 3TK1A 1HMPA 2YTZA 3QKIA 2QRQA 3A4YA 5AVKA 3VV3A 2LCIA 2WPDA 5EJIA 3Q9UA 2GCPA 1GO0A 2O2ZA 3KLBA 4CFYA 3CN9A 3GDOA 2PVSA 3AHCA 2G71A 2WIKA 4FFWA 4RY2A 2PSFA 2Y3IA 4DV6B 1ZCZA 1Z0JA 4J7XA 3BCHA 4LWQA 3NMUF 4JL6A 4A5SA 3WFJA 2VJDA 2ZAMA 2PTGA 1PGJA 5HSGA 5FLXA 2X77A 1F7VA 3OW2F 4XFDA 1UXIA 4P3OA 4PZEA 4KBYA 4YONB 4K0RA 4HQNA 5EZYB 2NO7A 4WXPA 2BT4A 5LYJB 4MWZA 3B77A 4MQMA 2YXDA 2YJ3A 1FX0B 3FZGA 5JAZA 2WT8A 5BSMA 4ETMA 1WBDA 4RHXA 3EGWA 3T3HA 4INZA 3I6MA 4HNGA 5J59A 2YR0A 1ETHA 2EARA 4RKEA 1AKMA 1B2RA 5DHTA 2OYRA 4ZCMA 1NMQA 1E1YA 2WSBA 3LA8A 4L27A 4PBRA 3EMBA 3FH0A 4WGGA 4IYRA 1L7DA 1Z37A 3GYBA 3V48A 2IV2X 2XRMA 5DT9A 4JOSA 5FYDA 1DLJA 1GLGA 1PR9A 1SMKA 2Q9UA 1O6BA 1TUEA 2O6LA 1ZXXA 3IDFA 3NANA 4K9DA 2C31A 3U3DA 2HA5A 1I30A 4LQDA 4D41A 3RM3A 4B8ZA 4E5DA 4W5RA 4KVZA 3UAVA 1QU3A 2AE2A 4XGNA 4AO8A 5LP6B 3FNFA 3OHSX 4CU5A 3ORHA 1AKYA 3AQ4A 3H5LA 4RA6B 3TLGA 3BILA 1RNLA 1SB9A 3FUWA 3GCGA 2XYPA 3IE0A 3PC3A 3A1FA 1FDUA 3PGMA 5C34B 3BRSA 1JHMA 5H3HA 3DUWA 1US6A 3E3AA 4I4NA 1WDTA 1DG3A 4HC4A 3H5VA 4HI0E 3C2QA 3DR5A 3GJ3A 1VI6A 5C81A 4UDYX 4L4RA 3O94A 2CLDX 3RSFA 1I3CA 3V7QA 2ERCA 2QJWA 5KTNA 2EZPA 1P5JA 5A9SB 1E2EA 4K9KA 4UTOA 1ZRSA 4UOEA 4RZSA 3OZTA 3TFQA 1VQ5V 1E6LA 3LUCA 4HQ0A 1FP6A 4K6CA 5FO0A 3ZU3A 3D1VA 3Q3CA 5JFGA 3M7IA 3CLHA 1KK1A 1Y3HA 2GHTA 4NZYA 2QR3A 4N7BA 3IS3A 1UMCB 3DE2X 5G1NA 3TQRA 4L2IB 2DWEC 1S72V 1HYHA 2IXBA 4PLCA 5ICSA 1NONA 5CT6A 2DH6A 1JEYA 3C41J 3U7EB 4CS3A 1QBKC 3SJCC 4WECA 1PX0A 3GIWA 4MV3A 4QJ5A 1RXVA 2IHNA 1PR3A 1GQFA 4PDRA 1WUHS 1XKLA 1DO8A 3MPOA 2NNLD 5FNZA 2PXHA 4MROA 5H83A 4BCBA 4FW8A 3RWBA 2GXSA 2AF4C 1U5AA 1YULA 1LD3A 1V26A 1RQXA 1U8XX 2Q2VA 3PQDA 3T12A 4AMBA 5B66Z 2BN4A 1BKDR 1PAUA 1VCHA 2X3FA 4B3RB 3NMUC 3R4VA 5FOVA 4DA0A 4BQFA 3KETA 1B2LA 3W9YA 3ZWNA 2X8JB 2GAIA 3IGAC 2ESRA 2HLNA 2D74A 3O2QB 4UE2A 4YP7A 1RWBA 5M29A 2AEEA 5FCDA 3ZJ5A 3VCZA 5A1TA 5F7OA 1T26A 5LQKA 2ONJA 3DG9A 1Y8QA 3W7TA 3I6QA 3RC9A 3EGVA 1GYQA 3V2UA 1LCIA 5JWHA 1ZNWA 5DEDA 1RP1A 3U17A 1DT9A 3UY4A 1DE0A 4HAXA 4MS4B 1XK6A 4L5IA 1SR8A 2GFQA 2A1UA 1XDUA 2B6HA 3BIOA 2YI8A 2EIJB 1B0PA 4FJ0A 3X1DA 4BGDA 3S1SA 4D26A 1BCCH 3MCQA 2I2DA 3WLOA 2QDOA 1QQAA 2A0UA 2D59A 3LRTA 4ZJPA 4BOYA 4AURA 3FBTA 4B87A 4BVFA 4YX9A 3GG9A 3ZBHA 1KOFA 2IIQA 3VPGA 1W25A 1K2VN 1E4OA 4KK4A 1YCGA 3G68A 5CVJA 5DTRA 3LE8A 2ZUUA 5HS6A 4PVCA 1KK2A 4BDSA 4BQIA 1BDIA 2QEXF 5DYNA 5C7YA 3U7HB 4GHWA 1PNKA 3DV0B 3U26A 3ICQB 1RHRA 1TUBA 1HQKA 1KPHA 4LJ7A 4EY5A 4H0LB 4C0AC 5H8WA 4BPBA 3KM0A 4G85A 1NOIA 2OQIA 4PTYA 2EQAA 4EW6A 5INTA 5JIBA 1SHLA 3RHTA 1DELA 3INRA 3R20A 3CVVA 4HEA6 1ZC3A 5G4UC 1VMAA 4OGKA 3KHUA 5IUNC 5K8CA 5IEJA 3AHHA 4OK3A 3U7GA 1YFLA 1WZNA 3HACA 5DP2A 3AX6A 3JD1A 3AO0B 2VS0A 5I7RA 3T1YB 2GZSA 2J87A 3PI6A 5AJTA 4NQZA 5EY5B 3W34A 1H6CA 2G3YA 4H59A 3UJDA 3ZX4A 2PUSA 1M0EA 3STUA 3NRCA 3I05A 5EE5B 3WYDA 3L4BC 4KQ9A 3AKCA 1CRQA 3TRJA 1J2RA 2Q7DA 3GLGB 3KOWA 5AKLA 1M6YA 1R8JA 1WIWA 4M9UA 3PIIA 2JCXA 3C97A 5HQTA 3HP1A 1TT5B 4IYHA 1AGYA 2G1UA 2V6FA 3ES9A 4RY9A 3RT1A 3UPDA 2EULA 1HORA 2PZMA 5TQ2A 1VBFA 3D6VA 1MF7A 1MX5A 3UA3A 2FLVA 3DYIA 2B34A 1KNKA 1S9HA 1MDBA 1HH4A 4QBHA 3WSVA 2REBA 4CR8A 3THWB 1PT9A 4WIAA 5ELXA 2P5SA 3FVRA 4FP9A 2G63A 4OLHA 3MTEA 5EA2A 2F23A 2L17A 3ESCA 1TK9A 2C54A 2BP7B 3WG7B 3O8QA 3V1TC 4B31A 1UFQA 3GP8A 3QH4A 3QEJA 1TJYA 4BNNA 2JGUA 2JKVA 3GLUA 3OUFA 3F5SA 3R2JA 1NXSA 2NUBA 1JE0A 1Z33A 2B82A 3ID6C 4KO4S 5EIHA 2SKCA 4RF2A 1I7FA 3MD9A 2LRHA 2X0KA 4TVBA 3M8KA 3CLRD 1LW6E 3NBZC 3MS7A 2JEUA 2FEMA 1Q0SA 1UINA 3FIUA 3QKUA 3E83A 2QTPA 4G4IA 2VUSA 3B2NA 1NTMH 4AN1A 4PGMA 3QKRA 5BUZA 3M8AA 4NDZA 1KS9A 1Z7BA 3FDJA 3TOCA 3Q3EA 3MGKA 4IFTA 4O33A 3A9TA 4LOJA 4UAUA 2QZSA 1DWPA 2XHZA 3O95A 4OV6B 1YOVA 4J9VA 4NBRA 2CZWA 1F38A 4NZNA 2G0AA 3KVNA 1DQPA 3CLUD 1SIBE 2A67A 5LMNB 1IZ7A 5JU6A 1GQSA 3FN4A 3TCNA 2IEBA 1GUDA 2VI5A 1AQUA 5T6BA 3R9KA 3UHFA 4B48A 2BSQA 1MJNA 4LF4O 3EQ9A 1YI1A 4DUGA 1XNRO 3MBKA 3R7NA 3T7RA 1GM9A 2QGFA 4WEOA 2VQEO 1PFYA 2QTOA 2XYQA 4PZ0A 1N8TA 1NRJB 4KQEA 2MQEA 1VQ1A 2VPYA 4MHSA 4RIEA 2ZPUA 3G2MA 4RVCA 1YQ9A 1ZPDA 4M83A 1QK5A 3I9MA 5HQJA 1IRXA 1AUPA 2YW9A 3MWYW 4L75A 1CDDA 3V8RA 3ZP7A 2EBHX 3EMVA 5HY4A 1NS1A 4LWPA 4M0KA 2VAXA 5FA8A 1KFJB 5F2KA 2R84A 4DV4O 4HRAA 1BTOA 1P2VA 1YC5A 4UU8A 4QGPA 2W2KB 2HQSC 4BT6A 2AJCA 2PM8A 3JAWA 1O9BA 1JEAA 5D3ZA 1JZSA 3AB8A 4F8EA 1I6LA 1CEZA 3EFEA 1HE4A 5H7XA 2P0YA 4LYAA 5JSKA 2AOUB 3KDSE 2CFIA 4M60A 2YHIA 2YZ7A 1KYQA 5F64A 1AF4A 4NWOB 2A5FA 2GZDA 4TQDA 1R6NA 3OTGA 4KR6A 3AZPA 4HH4A 3LPAA 3CD6V 3STXA 3JRNA 1QZZA 3K72B 4FOPA 1TM7E 3DKVA 2DOKA 2PH7A 1QFMA 1XDCA 5E2IA 3CPSA 1T4BA 3NEAA 5DK6A 2VH5R 4RZ3A 2VAPA 3WLMA 4JNCA 3EBPA 1DADA 3I5YA 3PC2A 3H16A 1WBBA 2JGAA 4GSKA 4EMSA 4TROA 3GFBA 2EBUA 1LFAA 1N6OA 3NASA 2Q7EA 5EIBD 4IGEA 1VQKV 7AT1A 4I4TA 5C53B 4LFCO 3WG9A 5KJFA 1YFKA 4QHYA 1TVKB 2V96A 1PK9A 5ARDA 3UJ3X 3IUNA 1JR3A 5KOJA 2I80A 1CC1S 1GCOA 1JA9A 1HDXA 1VSBA 3EA5A 3HVKA 3QE4A 1DRKA 4QNMA 4X6YA 4LSGA 1J0BA 4PXYA 2Y9PB 1INLA 1HNNA 2E1PA 1PFQA 2NQTA 4HQOA 5SZIA 2V1XA 3BE8A 2HJWA 1R3DA 1YR6A 1ACJA 5K7SA 1ODJA 2BR4A 2G04A 3BB1A 2VHEA 2Q27A 4DANA 4RGBA 4IBOA 1B4DA 5JCOA 3AHEA 3OOSA 5EK0A 3HAXD 3UG6A 2IDJA 5ETJA 5KMGA 5CRIA 1KE2A 4ZZ2A 3DFUA 3WRYC 1UP4A 1X8JA 1LC3A 1OZGA 4BTLA 1NBAA 4NLLA 3MELA 3REQB 1FNNA 1OLSB 3VBEA 1N6IA 4K6HA 3RKRA 4M37A 1IXZA 1S1MA 1S5JA 1AURA 3B78A 5DECA 3OC0A 3QEOA 2RSLA 3QUTA 1DBIA 3R23A 4FTWA 5FOXA 3AI7A 3G8CA 3O9MA 4CM7A 4JP8A 2IBTA 2GJKA 3ZN0A 5EZQA 1Y3BE 9LDTA 2I6RA 3C4QA 4JWTA 4AZ0B 1ECFA 1U0TA 3BEHA 1W96A 4XZ3A 1WA8B 2H2AA 2WINI 4R83A 5DI3B 1WJGA 2GDJA 1YRBA 4FQ7A 2XA1A 3UFXA 4JY7A 3I28A 1C3EA 2DMRA 4FVTA 1TUGA 3SDZA 5C7LO 4M1WA 1FS4A 1T6XA 4JR1A 5FI5A 5BW8A 1I7LA 3DAPA 3OIUA 3ASOB 2AC4A 1BZYA 1JEDA 2BUAA 2H17A 1FVHA 3PL1A 3QA3E 3T9EA 3R7WB 1UKAA 2HSWA 2FP3A 4POOA 3G1WA 3MRSA 3QEBZ 2V7QD 2Y1KA 4UHCA 1TPZA 3ITEA 2E4ZA 3OF5A 1JVSA 4KQGA 4Q9DA 3V9AA 4YJ3A 3Q7PA 4A03A 1W3EX 5E9WA 1W5SA 4ES6A 1YITV 5KDDA 4ZHQA 1T36A 5E1OA 2H08A 2PA3A 2AFIE 1W2WB 5KTOA 4A36A 4TPKA 2MYUA 3WLJA 4X66B 2FMKA 2GD6A 5KNBH 1XMXA 2W6IA 1YZNA 5IY5B 3REFA 1AJQA 3UCXA 5LUAA 4WF9V 4TZ0A 2ZRJA 4CV1A 3DBLB 2QP4A 1RM1C 4GMHA 3T7SA 5CPBA 5JO9A 1HDZA 4L87A 5HFLA 3B9QA 1XPOA 5JVDB 1O94C 3KT3A 2WD9A 4QDKA 4JI2O 4UKDA 4H27A 4J0FA 4X97A 4HNSA 3CCVF 2QTWB 2QVZX 4NBNA 2EL7A 4IYIA 5ILGA 4K9PA 3L4JA 4OAOA 5KS2A 5LQAA 1Z45A 4O4JF 3D8UA 4RM2A 1A9TA 2EJTA 4KFCA 1E2HA 3SPHA 3BGVA 5E0KB 4MTCA 2QLFA 4IHJF 4MCHA 3EULA 1N75A 2UUCB 1Y8QB 4UHKA 1U0OC 3VKHA 2FFQA 1IZZA 1S8AA 1E3TA 1L5SA 1YZYA 2OB1A 1U9YA 4L76A 1UJ2A 3C7KA 3F6MA 2LR0A 4PIPA 3ZIAD 1RQLA 3R9XA 3AYZB 3JQ8B 5CX1A 5ESRA 4EGSA 5BN5A 1U7ZA 2RJOA 2WJGA 2Y1FA 3E7WA 3QYJA 1Y7PA 4P92A 3CIOA 1H2SB 4EJ0A 5ADWA 4A1OA 2ZT6A 4EUKA 1XU7A 4AFNA 3GZJA 3NTVA 3RK1A 2GD0A 1E1NA 4A3SA 2YXEA 1S3GA 3H0EA 3IVRA 4D6YA 2BI7A 4QU9A 3BXHA 1KR5A 2EAUA 2NUTA 4RGQA 4ALIA 2XMBA 3QFTA 3E03A 1N7IA 1XLTC 3R7AA 2A79B 3KHKA 3WKEA 2JFFA 4TWBA 5JMWA 1WV0A 4LNAA 1MOFA 1TZBA 1Q7CA 4MPRA 4O29A 5J4KA 4N4AA 4AKGA 4B44A 2CSLA 1EWVA 1VDZA 3X1XA 1NTKH 3C39A 4RABA 2XUQA 1ZBQA 2UZ0A 1O4VA 1BFDA 1AN0A 2NU6A 3O8DA 5E4JA 3X1MA 2ZBPA 1ABEA 3TJTA 2CYAA 2ZJYA 5EHIA 4AUMA 5CFPA 1SA0B 1Y89A 1ZGGA 1GG8A 3I73A 5T64A 3UTCA 4F3NA 1E2BA 4TZZA 4NESA 4K03A 2JFPA 3CG6A 1GX1A 2GHQA 1GAXA 3ZX5A 1DC5A 2N0SA 1IY2A 1XVVA 3CZ9A 4DWWA 2XKJE 4XWOA 3O8CA 1C29B 3OU6A 3BTUA 2VHWA 1N1EA 3WHPA 4LH7A 2QI9F 3KZIZ 1EFPB 3IP6A 1PEKE 1ISIA 2P9CA 3TQHA 3UJ6A 1KC8H 1EZZA 4CFZA 5AFSA 2E85A 1OUMA 3LC7O 2ZRBA 3FB1A 3G8YA 3MJDA 3MJEA 3PYMA 3RBVA 3IBSA 3FAVB 2C0PA 4GMFA 5AICA 4AUEA 4CMKA 3IMFA 4ZFNA 4MJ3A 4RC9A 2HLPA 4UTZA 4PFKA 3T0IA 3ZNOA 3ZZ1A 4D98A 5LQMA 1T3TA 1NI4A 1P2UA 5JADA 4IIJA 1LWNA 1ZUNB 3UIEA 5G4LA 3PKZA 4BB9A 1QKIA 2VF5X 5T4EA 4ZEMA 1PZXA 3RABA 4DSZA 5KNCH 3FD5A 3KU1A 3BIFA 1RPZA 1IY8A 2KLBA 5TSDA 5A4IS 5KQPA 3FKQA 1CNEA 3MCVA 2EG9A 3I6ZA 2RH5A 3Q0TA 4ND2A 2V1UA 4R1SA 3ZK8A 3WQHA 5K8IA 3ABLC 4QGFA 2Z9DA 1HG0A 1VLQA 5H3CA 4QM7A 2ZSUA 3NETA 3OMIB 3CD6F 3M81A 3CLTC 1YF3A 2FUG1 1DV1A 3UXHA 1GJRA 3D3NA 4LDQA 3ZRSA 4LTNA 2H1VA 4QGGA 3AI3A 4CKCB 1SCUB 1Y1PA 3E9ZA 3O4IA 1NYQA 3PF8A 4JNKA 1QYXA 4P7KA 1U8CB 4Q1EA 1LR1A 3VAZA 1VOTA 4Z4HA 4J43A 1C3JA 2GCOB 2X6QA 3CZRA 1ESCA 4U7WA 5AUPB 1Q6ZA 4KQ2A 1AK9A 1H2WA 1G8SA 2HPHA 4NBSA 4YAIA 2PUBA 3CBGA 3AOEC 1YOVB 3NHJA 1YJAA 2C94A 3CS3A 1E60A 1PHPA 3DB2A 1M8GA 2QY9A 4YDHB 1JECA 2C1XA 2GO1A 1MSDA 2HRQA 4WZBA 3CU5A 1D4ZA 2ZIEA 5G0SA 1P9NA 5CN0A 4DBZA 5CFQA 3L7AA 1CJTC 4N39A 4M0FA 5ER9A 3VTIC 5EHQA 3ZRWB 3N2KB 3IA2A 1CY0A 4F06A 1G3QA 4GOXA 1NXQA 5DXFA 3KE1A 1DRWA 4B0OA 4GRDA 5AHRA 2D5BA 2QNIA 2VXCA 3D8HA 3RUHA 3LT5A 4JUDX 4OKIA 1UUFA 1OYWA 1YAHA 2QS9A 2VDNB 1JHUA 3BTOA 3LYLA 3GLHB 1VSTA 4TV8F 1B0ZA 2GZHA 3UW1A 3AJAA 5L7WA 4JBYA 1DJNA 1I80A 3GELA 2N1MA 4EAAA 3FYIB 1UJ5A 2ZJ3A 3AVUA 3N4ZA 1FDSA 1MR3F 1R4NA 1W30A 1MG5A 2IHUA 2UYQA 4OOEA 1BMQA 3AK2A 1S7GA 2NPOA 4G1MB 2W8ZA 3VR6D 1HURA 5CNKA 1N2OA 2AOUA 3VQWA 2DHCA 3GEEA 2LGJA 4IO0A 3VSDA 1N1MA 4D3FA 1U3PA 1T0AA 1P8AA 2NWQA 3DOIA 1G21A 3CW2A 3Q1LA 4NZPA 2P5YA 1QLJA 3V97A 5K09A 1G5RA 2ZQ5A 1C1HA 3TLBA 4UDNA 1HNWO 2YUIA 3PDIA 4U1RA 3LUTB 1R5JA 3SIUA 1SVKA 3ROMA 3TL6A 2FWMX 3SVLA 5B2EA 3BCUA 1VQ7F 2WF8A 2YDXA 3PEUA 2ZW9A 1V35A 3F71A 1IHYA 2HXGA 3CXUA 3R0QA 4LKOA 5BV8A 5MGNA 3DLTA 3R77A 2QR2A 3FKSG 1KD1W 4BZPA 3RASA 4RVGA 1V9SA 1X1CA 1BH2A 3PJDA 3I5MA 2BHNA 2PYIA 1ORHA 3JX9A 5JC1A 2A8YA 2V7VA 4MRMA 3VZCA 4ME6A 5FEUA 1XKQA 2HWKA 1RM1B 1JX6A 4MB0A 1DKOA 4RETA 1CUEA 3RT7A 4HVCA 1SKYE 5LOVF 2H65A 1U2GC 1C0LA 3LLSA 4QTTB 2OCYC 3UWDA 821PA 1G64A 2GT1A 3IQGX 1II9A 4QUHA 2WSSG 1Q7TA 1L7BA 3MYYA 4C82A 1IC6A 3QPBA 4UC0A 4MGIR 3MQ2A 3D2CA 1LK0A 1LC0A 2RK6A 4QATA 3UK7A 1DC8A 5EWLA 3T3NA 2X0LA 4BW9A 3CCMV 5E1DA 3QX3A 3Q9SA 1XDGA 1S8OA 2Y66A 4TT8A 3QLUC 2EJCA 1VE3A 5J2UA 1B8OA 3ZW9A 2XT0A 4I8IA 5FUMA 1THGA 1NY6A 2J0QA 4OMDA 3N2YA 3IMEA 3SQOA 1QCYA 3O4JA 3KT8A 4Q3LA 3HNPA 2GZ1A 4LOIA 5KMGB 2HA7A 1NFFA 2I3GA 1GH6A 1XTPA 4HDMB 4JYPA 2J9FA 2CXUA 5CA1F 4C9BA 3L2OB 5DNVA 3G8AA 4ARBA 4EX7A 4XRGA 3L49A 1XFAA 4YIPA 2FPRA 2NTVA 4FDVA 4CC5A 1GCGA 2O8EA 3LIPA 4C6TB 3N6XA 2FTKA 1FXUA 1NBHA 3NDPA 4G5OA 1B43A 3TS1A 3WDMA 1IDN1 3FCAA 4HWRA 3RC1A 1QYRA 5KAFZ 1B3RA 4K3UA 1S2DA 3VPFA 3Q4HA 1XNRB 2PZGA 5CH3A 4EY4A 1DV2A 4EGAA 1W41A 4PLZA 5EKSA 5BYBA 1WHSA 2H5IA 3MMZA 4LNUB 4UXNA 1C9JA 3CJTA 3AUAA 1J7HA 1X86B 3LRPA 2MT9A 2E18A 3TZQA 4HAOA 4BT4A 1QG6A 4NMWA 3CKMA 5K4AA 4OD0A 3JARB 3NGLA 5KAPA 4DCPA 4OY3A 2P7HA 3GV0A 2PZLA 2D4HA 3L4KA 3V8BA 3CPEA 1FF9A 2Z3WA 4MLZA 3PQ4A 1K97A 3NK7A 1ISHA 2WJVA 1GZDA 2DH5A 3OQPA 4QPPA 5ULLA 3X2EA 4CDRA 3T1NA 1Y9DA 2HRZA 4C5BA 2FN9A 4EUHA 5JRJA 2B36A 2BCGY 2Z2YA 3NWJA 1ORWA 4M0EA 4RZ2A 4ARUA 3TIGA 2I4IA 1ZNQO 3ENVA 1QVGF 4NF2A 1OCCB 1JOYA 3GJTA 3LDTA 1MO3A 3CFYA 1K9VF 4ONEA 4ZANA 2ZZNA 4J7UA 3F96A 2GUGA 3PGVA 2P8SA 2VATA 3FWNA 3FPEA 4FIZA 3AL0C 4XSVA 4HAYA 4NPCA 1ZRHA 3WO0A 2VUIB 3L1KA 3OPNA 4MQEA 5D3KA 4A8JB 2UUPA 2FW6A 2HH9A 2IZ7A 3BYZA 4D9NA 4KIGA 4ND8A 3PE3A 3V34A 3VMMA 1UPUA 1ISPA 5BSEA 4H16A 4PZUA 4TLLB 4DV5O 3WL5A 3IVCA 4JLBA 5C8XA 3AR7A 4MUJA 4ER5A 5JCPA 1BE3H 4EYSA 5JEEA 2PT6A 4QT0A 4HNVA 4B3SB 3E20B 2WYOA 1IHDA 2IYOA 4BBAA 1WQ1R 4BLSA 2D0IA 4ZAWA 3HR7A 4B74A 5LYJF 4XIYA 2VJMA 4JEIA 3B7WA 3IDZA 2WJHA 4E46A 2OFFA 1W88A 3GLKA 1JJFA 4LDNA 4IKEA 3WNBA 2R72A 1ECCA 2DGDA 1TTHA 4GICA 5AKJA 3FHLA 3PUJA 1KOLA 3K0KA 4BO2A 1VHDA 3ULKA 3CLKA 2VTKA 4QQFA 5JPDA 2I6UA 5TRTA 1H4QA 3TZHA 2P6PA 1NLFA 2RHDA 2IKSA 4X1YB 3CGGA 3NAMA 3EVGA 4Q4LA 4AY2A 3V32A 3OQBA 4C4RA 4B2PA 2FKXA 2C5HA 4ZVQA 2AFRA 1YR8A 1JV2B 1K92A 3FR8A 2FLWA 3KT6A 3LTEA 3LXUX 2OKCA 3VRHA 1EI9A 2IEAA 5IAEA 3KK0A 3MGCA 4GR4A 5JSHA 1Q0LA 2XD9A 2A4KA 1GIAA 3QMWA 4WBXC 4NBVA 4U7TB 1GP2A 3DGFC 3ACDA 3NYWA 3GRUA 5JVDF 1NVDA 4HAVA 1HDGO 1BN7A 2C82A 2RGYA 4H1WA 4DV2O 2QHXA 4TLCA 1GN4A 3NHKA 4DLSA 4HX5A 1IUOA 4MGEA 1QTRA 4CBVA 1K0FA 5EIEA 2QRZA 1LJUA 1QJ4A 1LI7A 1FFGA 2HIHA 3GVIA 3KQYA 3U4IA 4NE2A 4TYPA 3RYFA 4KQHA 1H5NA 1IHOA 4REQB 2GM3A 4EI7A 2JAOA 1DK1A 3K8ZA 3ND5A 3JCZA 2ZSKA 1DX6A 4OG2A 4QQ8A 1V16B 3GGGA 2XMDA 2R79A 1E98A 5DKFA 3WWOA 5DYGA 2FN4A 1MT0A 2FPUA 3UMFA 1RWPA 3R6WA 2I2BA 1YA6A 3PE6A 1EM8B 4G07A 1NLUA 2O7VA 3OT5A 4WXRA 1KAGA 3DPUA 2FW1A 1G0OA 1F0NA 4C8GA 3CG4A 3VKUA 1TEZA 2E6UX 2NAFA 4QDUA 4KUHA 3N2GB 3Q2IA 2YWGA 3E81A 3LCMA 1RI1A 5CAEB 5E2AA 1JXMA 1OLUA 2VHVA 3P7MA 2OG2A 3W7UA 1I6WA 2IHYA 5KCMA 3CCSV 3T5CA 5GVSA 4RORA 5GIPE 2IG8A 2XOKD 1T4GA 4I4IA 2F9LA 2PWPA 5MFPA 3AHIA 2ZT9B 3PKJA 4UU0A 3DHVA 1CBUA 1NDQA 4BQOA 2ZDQA 3OJWA 2NU9B 2CE4A 3O4FA 3DBOB 1HR0B 1II8B 4V0NA 2OHJA 1VHLA 4NJMB 1PVOA 5F98A 1G20B 3CR3C 4L57A 2OE2A 1I2CA 3BHPA 4JXKA 1TO1E 3BE5A 4GKJB 3Q88A 2V5VA 4LSWA 4P5PA 1AHHA 1YCHA 2Q5HA 1PD1A 2HRCA 3DOCA 3HL4A 3O3NB 4TTAA 4MTGA 3QELA 4YMIA 1SPXA 5FPQA 2HBYA 2JCVA 1NJIW 2PXCA 3DBRB 1KAQA 4ZYYA 4CKWB 2W2OA 2PPVA 3OEHD 4UMDA 2I2WA 3HXOA 2QW8A 4NU8X 4UNPA 3DKIA 3NJ8A 4IHKA 3UYLA 2ZYAA 5B1AC 2OAGA 1E9VA 4L51A 3TTTA 5IZCC 5LJLA 2G76A 1HR0O 4PNZA 3CCUV 1IM2A 2G4VA 4DR4O 1HMYA 1QIGA 1H1DA 4BFTA 3SR2C 5AM0A 2X0EA 2J9FB 1UMBB 2HLDD 1R8XA 4NCJA 1L7OA 1CNFA 2QSAA 3AEXA 4X65B 2ONKA 2H63A 1APBA 3QFFA 1G9XA 4WACA 4YMLA 5CDGA 2C5FA 2BBOA 3ZHVA 1R5OA 2PGAA 2XWJI 3FHOA 2IH1C 4X1YA 5DEIA 1JYFA 2WUEA 3PGKA 3ROEA 4D81A 4F91B 2YWCA 3QW4B 4PZCA 1G1XB 3EUEA 4KXNA 1DO0A 1MJFA 2AFHE 4HX2A 3KJXA 4PXSA 3VMFB 2Q0SA 4MTLA 4MMXB 4TUYF 4TN1A 4YMSA 5DM1A 3LUAA 1ULHA 1KWGA 4C14A 5EHXA 4GI1A 2WAXA 2GCNA 3LY8A 3COPA 4RPCA 2J5QA 2ZROA 5ICFA 1Q21A 4ABTA 4JL5A 2QWQB 1U7DA 4V0QA 3NHFA 3AOEA 3T8YA 3OR7C 1P4SA 3FI0A 3L4SO 3LPNA 3KCYA 2CNDA 1YJ8A 3KYDA 3I56F 4P0TA 4D2IA 1I6KA 3HXQA 3WU2Z 1J5XA 2HF8A 2QTTA 2HMSA 2BOVA 3N4YA 4OX9O 1GA4A 4FDUA 1T8WA 4FLEA 4JI0O 4B3TO 2LNDA 1MB3A 3LT2A 3WFZA 4OHFA 3OESA 4FBMA 1S4QA 1V16A 4DJ5X 1W6UA 5FXMA 3P30A 2ODWA 2P11A 3QKWA 3EF0A 1HQDA 2FWPA 3UHPA 4ZKEA 2VT2A 4G1CA 4TTVA 5SICE 3SYTA 4Q9KA 2DULA 2ZRNA 5IFKA 1JD1A 4NJOA 4K81B 2WA2A 4RV4A 2AZMA 2G9ZA 2WSSD 4ND3A 1E2UA 1V8ZA 2RH4A 2WLHA 4RKRA 1NUPA 1JDBB 2H7VA 1GFIA 2YXYA 5KVAA 3T1TA 4XGQA 2HREA 5JJ5A 4AJHA 1ABBA 1H8EG 5B4TA 2QYSA 4B76A 5I01A 2ZRKA 3CNBA 3CZQA 4LZNA 1A0OA 4MXDA 2Q2NA 5B12A 4R9UC 3C9UA 2IM9A 2OHIA 5U9CA 4KLRA 2J3MA 3CCLF 4ALMA 2QA4F 2OQRA 1K3FA 1GUYA 3RWMB 3KKEA 3VTZA 2HZ7A 1J2YA 4FFPA 3G5TA 2ZR9A 4LBZA 4X8LA 1Z5NA 3FA2A 3EQ6A 4C0SA 1O6ZA 4UCVA 2JHAA 3MWEA 4RH0A 1X7PA 4RMJA 5CVEA 5KYVA 1UBHS 4MIYA 4P2BA 3U80A 2Q7GA 3EEBA 1P17A 2QYTA 1FNSA 1UFVA 5AD1A 4MRVA 4NYIR 1KY3A 1EDDA 3TJZA 4JX9A 5KTTA 4OPHA 1XWWA 5GIPC 2NQ2C 3A26A 1P1CA 1E5XA 3F4LA 1Z5PA 5DGHA 5JSYA 2CV1A 4URXR 3P9RA 1U6KA 1XRJA 2YWRA 4G2NA 2YYAA 2CMHA 3ZS8C 1RE1A 1ULUA 2P40A 1GNQA 3NI2A 5LP6F 5IH7A 1M34B 1VDMA 1I4EB 1VKOA 2DWCA 2WIDA 4I50B 3GT4A 1A8SA 2R5NA 2Q2OA 4ZARA 4MW5A 4GFDA 5HP8A 1TQHA 3WMXA 3EHBB 4Y7CA 3USZA 4EHDA 1KRWA 1H2EA 1EX9A 3OZFA 3R8FA 1CE8B 4IFBA 4NABA 4WLUA 4LJ6A 1W49A 2QPTA 1OR8A 3RWRD 1Q12A 3N0VA 4OKSA 1X74A 4PO3X 1D1PA 3LKZA 4GBGA 5REQB 3ABIA 3CMEF 3TW4A 5HHTA 4ZI7B 4WKNA 1B26A 5FTNA 1RRPA 3K0FB 2P4UA 4LK3A 4L3OA 4BKMA 1MB9A 4AG5A 3S2ZA 1VQ4V 1ZI8A 3V33A 5KOYA 2CHGA 4HRYA 2ZKOA 2XAUA 4IFEA 4A8PA 5JHGB 4KZKA 4N40A 4Z0TA 2JLYA 3TQIA 1OTYA 3ERNA 2Q50A 3BH6A 3ORQA 4Y0AA 5I4CA 1NTZH 4LW8A 5LZ4A 4IUBS 3UMCA 4M4SA 3OGIB 3E8XA 4UE6A 5LZ7A 1R0KA 4CTKA 4EZEA 2JDIG 5IUJC 3AG5A 2CJYA 2AKEA 1DAMA 5ESDA 3P9SA 2NXWA 4US1R 2DWDC 1TJ3A 4Y2JA 1O54A 2H2IA 3GWZA 1JWLA 1YXMA 3C6KA 5FB3A 1OXVA 4UZEA 4XOUA 1E2QA 4B17A 4PPQA 3DAFA 4JC5A 2HBQA 3TTUA 4D96A 1HE3A 1I4TD 1Q57A 3PXBA 5KLVH 3L6CA 4D80A 4L8VA 4JYAO 1CRLA 2D5IA 3I8OA 2HW8A 5CA0B 5ICCA 3U1TA 1CF4A 1A4RA 2ZJ8A 4X9QA 4G63A 1SZCA 2O2CA 3GU3A 1DXQA 2GETA 2O4CA 4E4EA 2DM6A 4U2CA 4BYMA 2Q0HA 3M2TA 4BO6A 3CUVA 1K5HA 1UQUA 4HLUA 1WNTA 5GOZA 3WIVA 2QZPA 2BCCH 4G4SO 4I55A 3G4SV 3ZIAG 2LV8A 1XO1A 2AMJA 7GPBA 3AK1A 4EB6A 4RSMA 3ONDA 1BG6A 4FIPC 3L7KA 3HXLA 3PE4A 2QX8A 1JF8A 5IJ9A 1CNMA 1KO4A 1E58A 4PX2A 3SYAA 2G5GX 3VGJA 1CKEA 1S5HC 4B4OA 4V0ME 3RARA 3GLIE 4N0EA 1D4FA 4UFZA 4C06A 4NFSA 5LDHA 2Q5EA 1ML4A 4R05A 4MVXA 3DUFA 3H8SA 2C4KA 4AQ7A 1L8XA 2J9GA 5DK4A 2XUPA 3M3PA 1DPGA 4I0XA 2H54A 3S99A 5E4YA 2YNMA 1JEOA 4Q1DA 5HWEA 4CM8A 2PUCA 4CV0A 1IZYA 2CE7A 2VJBA 1SF9A 1CLIA 3N0XA 4YO8A 2HD4A 1NXWA 2W11A 1D1SA 4LE2A 1Q95A 4EVRA 1BWPA 3BKXA 2OY0A 1NRIA 3OHMA 4JUCA 4PQFA 5FPSA 2RJZA 3KELA 1I08A 3MUFA 4KQ1A 4IJMA 1UC4B 3AV3A 3E9CA 3ZWQA 3EIXA 5EJ6A 3LUHA 4R51A 5C1IA 1NSYA 4KE7A 3QEAZ 1ZMOA 2QTGA 2PZBA 4PC7A 5JE8A 3E2IA 5HKLA 2W6JD 2HLDA 1RMYA 1FNBA 2Y4NA 4GYJA 1NA5A 4M7WA 2GJAA 2BFDB 2I78A 4M1OA 2AZDA 4J76A 2HP0A 4J7CA 1Z3IX 4X63A 1H5UA 4ZRMA 3V3TA 4HXGA 2XASA 4ZOLF 4WUVA 4NQ3A 2B4RO 1P62B 1XT6A 3CCUF 1PV1A 2O6HA 3KDPA 4KGVA 3HKBB 2PUVA 1BE0A 5CHEA 4AAYA 5HXAA 3RTEA 3I2GA 3P2MA 2N1BA 3DXFA 4AULA 3I42A 1EFVB 2HOQA 4AECA 1BVUA 1ZUD1 2WOJA 1O87A 1XZDA 1K8ZB 3SQXA 2WWIA 3ZU4A 4OLJA 4NUTA 5LHIA 4F6LA 3R9WA 4BT5A 4R1UA 5LP6C 1G5TA 1GRCA 1PTJA 1Y1LA 4NK5A 1AI6A 3A0HZ 3MCAB 1OJLA 1XQWA 2PTMA 4B08A 5LMUB 4J9UE 5DBOA 2PKEA 3FDXA 3MT8A 3SEZA 2EJVA 3DCNA 4RYDA 4P31A 3N6VA 4ASUA 2DQYA 2QTVB 3KR9A 2YIBA 2DUUA 2J8ZA 3QU7A 3TD2A 2FQ1A 4LMRA 3ZWKA 3E05A 2C3YA 4YPFA 4RKQA 2H2HA 2VNAA 3BRCA 3ZDBA 1M33A 1FRFS 1JSRA 4DXWA 3BABA 1BMDA 5ITZB 1Z2OX 2JHFA 2LDXA 2PMBA 2XYHA 3A6FA 3DD5A 4OXIA 2P3OA 3TJMA 4UCTA 3HJRA 2MSNA 2C5AA 2C9ZA 4HDQB 2DT5A 1N33O 4YQEA 1ZVVA 2DBZA 2FN7A 1FAFA 2FWNA 4LZJA 4CCWA 5LZ9A 5FNVA 1LJLA 3MILA 4OX9Y 3JASB 2O0KA 4ZI3A 1FRZA 1W8DA 3E9NA 4BLQA 3JVHA 1WEKA 5FR2A 2X15A 5L40A 4L28A 3S8YA 2P2DA 4DMGA 2J7PA 2PN1A 2QRLA 4MR9A 4YT5A 2IS2A 3ZGYA 1SVMA 3QY9A 1VIVA 3DV9A 3IR9A 3DLHA 4E4TA 5L3QB 4X65O 1T3LA 5KCZA 3ZHYA 2C78A 1JEYB 3L84A 1RAAA 1ZD2P 3I37X 3JAMA 2Y1LA 5ALSA 4QBKA 4K3AA 3HVRA 1GMGA 3AVWA 1Q3HA 4OXQA 1GKYA 3LNMB 5D5PA 1FC0A 2YHBA 3FNIA 4L22A 4U0JA 4DDMA 5G41A 3HR8A 3EW7A 3DZGA 3D7LA 4NXNB 2GFIA 4NBLA 4U5XA 2D54A 3D43A 3TR0A 5LSAA 1W19A 2J4FA 2P06A 1YI2V 4FMDF 3R3WA 3K9FC 1B76A 4QYIB 2W0FC 3I04A 2JGIA 2PGDA 2HDOA 2B5VA 2NZWA 1PJTA 2O2IA 2PR2A 1ELOA 3OD1A 1FKAO 4DNPA 5IZ4A 1VYTA 5M7EA 1T9AA 1GGEA 5C8YB 4W4LA 1SBZA 2GLXA 2OBNA 2E5FA 4X62B 1XCMA 1B7GO 2FHPA 2R2AA 4M54A 5JQGF 4AY6A 2Y0PA 1TZCA 4EF4A 1V1RA 1WEHA 1F3LA 3H7AA 4J90A 1I4OA 3WADA 5EJ9A 3JZMA 5P8WA 3H3XA 4OBXA 1C8BA 2XBLA 1G17A 3TG8A 4W9NC 3QSYA 1VP3A 2E5LB 4DOMA 1N36B 2F4VB 1KEZA 2IXDA 4C7XA 1NGSA 3DO8A 1YDXA 3JQBC 4TKZA 2J33A 5JCXA 3DZKA 4EBBA 3EVKA 1I7PA 3WX0A 4C8EA 2FUCA 2EZ4A 3HBLA 2V8OA 4ID9A 1C9YA 5FV7A 3RS4A 2F1MA 1IL0A 2H2GA 3QRWA 3ZMVA 2HFKA 2OHOA 3IAAA 2HHJA 3G2PA 5HFNA 3SKVA 3TH5A 2UYYA 2VHUA 1WWKA 1I94B 2WYIA 4Z4QA 4OQNA 3QVLA 4C3VA 1GPBA 3M1IA 3MAQA 5CA0A 3G80A 4UEWA 5B3KA 1CUBA 2ZATA 3PP8A 2H4JA 3DKKA 1P0QA 2ILTA 3DEKA 3GOQA 3PCXA 4IX1A 2PKXA 1KI6A 5EE0A 5JDCA 5L4NA 4DPMA 4MQUA 4HYTA 2P9JA 1E94E 1M2OA 4NYMR 1JQAA 4B45A 1EUDB 1YRWA 2UDPA 4QJBA 3QPCA 4WKPA 3UWMA 3U4MA 2Q8NA 4LEIA 4PEVA 5IX8A 4RTLA 2P90A 2R6AA 3B6MA 4MHOA 5C32A 1EESA 1U28A 3OWXA 4TTJA 3KZXA 2V7QG 4FEGA 4U2GA 4RTNA 1SHZA 1TYCA 4MB6A 5A06A 1TW3A 3LUGA 4X90A 4GMXA 1C4WA 5IYDO 2J45A 3WA6A 3T15A 1OFUA 4H37A 1G2PA 1P73A 4NNOA 3VX3A 3AWDA 2WJ3A 3OLZA 3Q10A 4ER6A 3EWIA 2P62A 5YASA 3EWSA 4MQFB 4I0XB 3UKOA 5F9FA 1GAEO 1KZ4A 1W4BA 3CMAV 4QL3A 2WWWA 2GPJA 1J4AA 2W58A 1DRUA 3AG1C 1ZJ6A 1ZX1A 4JI1O 4FDMA 5F1KA 4Z3DA 3WY9A 5C2JB 3T5AA 5EBLC 4NMHA 4FU0A 5B7GA 1SC9A 1W52X 4FINA 4EB0A 2WZCA 4D8YA 3SZGA 1GRVA 1LQUA 3V6LA 1G66A 1UBCA 1RHUA 4JJKA 5DU2A 4WASA 5T67A 4COOA 3V8QA 2H85A 3L7BA 1TADA 1U99A 3P9KA 1ZJ4A 1U9IC 5AI8A 2QLTA 4CGZA 3ZKWB 3COWA 1FS5A 3K5HA 1K3TA 1NT2B 2PIAA 2V0NA 4KUEA 4N0PA 4U9UA 2JFUA 3IEPA 3K9GA 4CUZA 1WTAA 4WK4B 1H2LA 5JXHA 3CXHF 3QFRA 3LVBA 1UPGA 2UXDB 1QH8A 2MOKA 2A84A 3NALA 4NMMA 3MCUA 3E3MA 4DWVA 4KGDA 2XVXA 4G8BA 3N3AC 4C0XA 3CVJA 1B00A 1SZTA 2LKDA 3SAJA 4F1JA 5A04A 2RBKA 4NAHA 4Q4HA 4J0KA 3TW8A 5A4DA 1M2GA 1VL0A 3E8GA 1Z83A 1A3CA 3MJTA 4HFJA 3WZLA 621PA 4MDFA 3FR7A 4CM9D 5J43A 4HDNB 1KOJA 5A3JA 3OA0A 4NDAA 4Q37A 5HG0A 2HWXA 1N4AA 4JI3B 2OM6A 1AJPA 3OMLA 3H2ZA 4BNDA 3K94A 4R8SA 1S3IA 1PZEA 4QE7A 1FYEA 1RI2A 2C9MA 2LPMA 4Y2VA 3D3JA 1DOHA 3A2FA 3GIDA 2ZBVA 3MCAA 4PYRA 3P9ZA 3RADC 2P5OA 2BZGA 4IDQA 3KPWA 4ZOLA 3IBYA 1KHTA 4FGUA 2WG1A 4MV9A 4QOJA 5FBZA 3EVAA 3TVYA 4C0LA 2PO7A 3IOYA 5K03A 2ZG6A 1I0HA 3MYRA 3HTNA 4KWEA 1N57A 3LLCA 2CK3D 2QM3A 3VQXA 3EXEB 3G9QA 3ICXA 3JYPA 5CM8B 3K53A 5H02A 4F3CA 4FB4A 5B57C 3BL6A 5BO5A 2VP4A 3IP5A 4DVJA 4K6MA 1CZRA 5EUMA 2M7WA 1W5FA 3FI9A 4JQCA 3RYFB 2EIJC 8MHTA 2C03A 3DDNA 2P22C 3FTDA 3TJRA 2QJOA 4HV4A 2R1TA 1LUWA 4WFKA 4ZIBA 1N32B 3WRVA 1N6LA 1VL6A 2XDAA 2HFEC 3AT1A 4O4IF 4OFBA 1QVVA 1XROA 5JG7A 1XU4A 1Y42X 1WM1A 1A1SA 3AJEA 1M8FA 4X7MA 3FNQA 2EIKC 4YP9A 16PKA 3X1KA 4DCVA 5AOCA 5KWVA 4G5HA 2EEZA 1GNRA 4G26A 4DR2O 1IJBA 3MN1A 3OP1A 2KG4A 4E5PA 3GUVA 1DGQA 1KS2A 3U6BA 4XASA 2PS3A 2Q4TA 3T94A 2DX7A 2FN3A 1QCCA 5BV1A 1PGNA 4OTZA 1OGJA 3GHHA 1C1DB 1BQ4A 5C5IA 2PHNA 2HGSA 1Z5WA 1IWOA 1KP2A 1YDGA 2BE9A 4QA9A 5DIZA 4HVLA 1W2BF 1JKMA 3JAKA 4BVRA 4J94A 2G08A 4KO2S 3SZMA 3DT9A 3I04M 1AKQA 1KU6A 2PX0A 1Z4IA 3K2BA 2TMKA 4O4LF 1AR1B 1ZTEA 1IIBA 4HDOB 4ARVA 1Z16A 1BS2A 1FFTB 1IQPA 3EIWA 2AL7A 3LP6A 1RKQA 4WZ6A 3N1UA 2PJUA 2QORA 1BHSA 3QZUA 2GB4A 4I99A 2EV9A 1JT2A 4CR6A 2V6GA 3UAZA 1VLHA 2PV0A 2XMRA 5CW1A 3SZRA 3MCZA 2RKBA 5KSWB 1X1DA 4MT8A 1SBCA 2IJJA 4NG4A 3I5DA 1IXRC 1IUNA 1GA6A 2MSCB 3DZBA 2WF6A 2OUIA 3N87A 1E4YA 3NHMA 5UKDA 3U9LA 2GBPA 2XZDA 3PYLA 2CK3G 1H4VB 1XJWA 4LS3A 5HM8A 2GTPA 1LVGA 3OWHA 4JYYA 3WI7A 4NOJA 1X87A 1F8FA 1QIMA 1VRVA 4I9GA 1RLMA 4ZI5A 2I34A 5LHHA 1MJ5A 3MSXA 4DNXA 3EPKA 1AHPA 2G9UA 3RC3A 5L8VA 3BMXA 1S4MA 1IV3A 3FUUA 3IMCA 4B62A 3PCTA 5LN1A 1EFTA 4QEKA 1UDAA 4RQBA 1HNWB 3QVVA 2FZ4A 4AD8A 1L4FA 1JAZA 1TFRA 3F7MA 4J3JA 4UU1A 3D36C 3VR2D 5KNBD 1ULZA 5K0JA 2ZE7A 1JX9A 4MULA 1KHHA 4TLEA 5E6RB 3VSCA 1DJMA 1UMDA 1BO6A 1WSAA 1XEFA 1PR1A 5C4GB 2CD9A 4JOCA 3STZC 3OBYA 5DZSA 3D4OA 3VC3A 1ZYUA 4YYEA 4OBWA 5LB4A 3FPHA 1K88A 2BKEA 3B2QA 4V0RA 3VPAA 1H1LB 3ZRWA 1FP7A 4YJ2B 1T2VA 2IYWA 3KB2A 4RKYA 2EBOA 2VCEA 1CB0A 3DYBA 1GTL1 1FYFA 1XPRA 3EH2A 4E2LA 4XIGS 1XEXB 3ZQ6A 4ZQGA 1MT3A 4BIUA 3PC8C 1YJ9F 2VQSA 4KWTA 2WLTA 4XFKA 3MJCA 3LY7A 4RDXA 2HVKC 1YACA 3E7DA 4EZBA 3O2JA 3MQFA 4IV8A 2VO1A 4WXYB 2NXCA 4AU1A 4CE6A 2OM2A 3JRXA 4MWTA 2DPGA 1K33A 5EJFA 1CF2O 4DA8A 2UUBO 2QAIA 2QD5A 3K20A 2PJRA 4BLTA 1AHNA 2C5SA 3NGMA 2PLRA 4US2R 2F8LA 3CHXA 4FEYA 4HFNA 3LUPA 4DV1O 2YBDA 3ITDA 2WVHA 3EZFA 1ZKDA 1E32A 2VK8A 1XZBA 3KFXA 1TM3E 3QWAA 2LP4Y 4N9WA 1YZQA 4KHZA 3NONA 1BOFA 1M57B 1GU1A 5COQA 1CPYA 1R3UA 4DPLA 3EX7C 2OBBA 3HCEA 2X2PA 5BSWA 5LOVB 2NP7A 2YS7A 4R68A 5KUMA 3D00A 3FBWA 5IN5A 3W7VA 1X42A 1MEEA 2OTJV 2BRUC 4KYVA 4UU7A 1GKUB 2NOAA 1OI2A 2D7CA 4KX5A 3ZK9A 5JNLA 4JLNA 1FUYB 2ST1A 1HRDA 3N6RA 4MW4A 2PGGA 1Z62A 3NIBA 1G63A 4RPGA 4FUTA 1JKJB 4PWTA 3K59A 1E2PA 3DR3A 4RHUA 2YUAA 3MMXA 4MVJG 2QD4A 3DULA 4WXMA 5KUTA 1ODTC 2ZZKA 4LY0A 1U0EA 3VA7A 3PXDA 8ABPA 2ODAA 1FXWA 3OMWA 5AK0A 3DL4A 2IU3A 5HZHA 3M5WA 4EJ6A 1QTNA 1H42A 2L19A 1IWPB 2Z2ZA 3ADCA 3DFMA 2ZS8A 3E0XA 1E1RD 3QTYA 1M8JA 4QPKA 4HZ3A 1OAOC 4TKLA 2Y1DA 4YP6A 5F4BA 1YDFA 1PFGA 3NEJA 3DP7A 3EPJA 1PD3A 1K0UA 1G60A 1U7XA 3ILYA 1NQAO 1RC0A 3RKUA 3WL4A 4R8MA 1XZFA 3TGPA 2HRYA 1H8ED 3NVAA 5FBWB 4FCCA 2PGIA 5EKXA 1OXTA 2JLVA 3F0DA 1GG9A 2J9ZB 2BSKB 3AG4C 3VO8A 4RVUA 4XB1A 3W6ZA 4FNAA 2UYNB 5K0ZA 4W5TA 2GK6A 1RM4A 4E2ZA 1NTOA 1T4DA 4YRLA 2ZZMA 3HRKA 2GJ4A 1K7YA 1L9XA 2IYPA 4EI2A 4Z51A 1QFYA 4TQGA 2JS7A 3NKLA 2JFVA 3WGHA 1T8YA 4LVUA 5BP7A 2OD7A 4DCTA 1WABA 3GBVA 1UBUS 2OCIA 4IMRA 1U6JA 4IEIA 5IJAA 2EXXA 1IEXA 3U1BA 3ZV7A 4CT5A 1DF5A 4C01A 3I58A 3JQBA 4N01A 1H9BA 5KOJB 4OP3A 2ZUFA 1SOUA 1EVIA 4E14A 1TCAA 3WV4A 1GOTA 2XB8A 2ZJFA 4L0CA 4Q9LA 1YIJF 4MLPA 2ECPA 3TCXB 2ZIWB 2YIMA 3IMKA 1DIHA 2PEYA 2Q1SA 2Q9BA 2V3WA 3JQPA 5ALNA 4C7JA 1G2OA 3RSHA 3IP8A 3UANA 5FX2A 3CRRA 3FJ1A 3FETA 2Z98A 3Q6IA 4KXVA 2GEKA 4YY3B 1RABA 2Q0XA 2AGVA 1GZSA 2I22A 3P19A 4R5MA 2OSVA 1M2HA 3HE3A 3JYOA 5AI6A 3ROZA 3CHYA 3ZOZA 1XTRA 2CWJA 4EQ6B 3DHEA 1FB5A 2CVPA 1O6GA 4PPNA 2RGUA 3PXCX 4AJ1A 1QM5A 2R00C 1PT8A 4YJKA 1W4LA 2MHCA 2V4MA 1AXRA 3GPLA 5EXSA 2AFHB 3OZCA 3RBAA 3TWOA 1Q3TA 3AF0A 1RTKA 1JPVA 4RF3A 1Q5OA 5AKGA 5ALPA 1M74A 3O75A 1V48A 2GPSA 2JZOA 4P3KA 2NT4A 1CZOA 4BR6A 3CEMA 1ZOLA 3ZZ0A 2K87A 2VWKA 2DBRA 1GR0A 2Q46A 3G59A 5CD1A 4BLOA 1D5CA 2AV6A 2B30A 3H86A 4ZQFA 3OJXA 2QTAA 4DQ0A 4BB0A 5AM4A 2ZEJA 4TL8A 1XDBA 1I4WA 2KJQA 4DA7A 121PA 1QNFA 1WLYA 4QNNA 4BKQA 3JATB 4BO9A 1JR9A 5JBIA 1KYOF 3ZWCA 1LI5A 1JR4A 1U5BB 3IQXA 2EF1A 1X2EA 2VHYA 3H99A 1Y4UA 5BSVA 3R7WA 2ORVA 2P7IA 2R96A 4AJPA 1VP9A 1H2HA 1T5IA 2Q6TA 4LJSA 1M2JA 2FWAA 3B89A 5CBFA 1EFRA 3IDSA 3BMQA 3U9TA 4CTNA 4YJ3B 4NCNA 2V74B 4OL9A 4BGUA 1G20A 3TR5A 5LA6B 3P9YA 4KLCA 2H7YA 2WF9A 2ZYHA 3QPVA 3L77A 2IU4A 4C7BA 1U9IA 1J9GA 2Q9CA 1BA3A 4OQLA 4FOLA 4KPUA 4NE7A 1LKZA 5H5JA 5TPWB 1QF6A 2BGMA 4MWGA 2N47A 3R6LA 4DUPA 2I2XB 3HKDB 1A9RA 1SXHA 2E3JA 5LGTA 3EGEA 4Q7JB 3L0DA 4J1QA 4XYBA 1L4HA 3TRFA 3ZGOA 3CONA 4AZ3A 1ACLA 5CXSA 4DJDC 5LQSA 2QN8A 3OX3A 1JBQA 1Z36A 2UKDA 2I6DA 1FTNA 2G82A 3KWFA 5BRNA 1LW7A 2HP8A 3QJ5A 5DOZA 1P31A 2RNBA 1Y9EA 3IGFA 2XE7A 1IBKO 1FLNA 2OT3B 1K98A 1UBNA 1V3TA 5D1NA 4QGBA 4WOBA 2JIPA 1MNAA 4FZJA 1FZQA 2X3UA 2IY8A 3Q6NA 3KKKA 1QRTA 1ODLA 3IKMB 4LNUA 2Z9CA 4IKOA 4X60A 4B3FX 4KG7A 4MUGA 1ZG3A 2WUWE 4FX5A 3W5UA 3NAQA 4OLBA 3N2EA 5JALA 3L1HA 3M6UA 4H2DA 2PHZA 1NVBA 4AWAA 3E2EA 3JARA 1W87A 1X13A 2ZNJA 5IRCD 3LQ4A 2IP1A 3GNLA 3CF4G 1PR0A 1TVCA 1F2DA 1JWAB 2AJTA 3SJAC 4LI0A 2HWUA 5DN9A 2D5CA 3RFTA 5TGZA 5LMCA 5L4SA 2IOFK 5G0TA 1XAGA 3KOYA 1MD9A 1YL7A 4JLVA 3CH6A 3T3DA 2DPHA 3J81k 1SZJG 3WWYA 2EW2A 4MQ5A 3U0BA 2XCIA 3NX4A 4EDHA 3C0KA 3PPWA 1F06A 4UCFA 2E5WA 3A4TA 1Q6HA 5MN5A 4DA9A 2AZTA 5KYUA 4Y1EA 4HCJA 1AQ6A 2OGUA 2ZXWC 1C3LA 2FR8C 5EC2C 1P9RA 2XEXA 3BK7A 1GZHB 3FPFA 3EGOA 3IC7A 3R3YA 4Q1VA 3K1AB 5AK6A 3V1UA 4FCWA 5JH7B 2UZ1B 3EH1A 1H8HD 1QK4A 2Y92A 3ZC3A 4EA6A 4BIMA 2QLNA 4LZOA 3DEAA 5EP1A 3W4JA 4Q9NA 1AKTA 5JNTA 2O2YA 3E15A 3OF3A 2CDYA 4ZCIA 3A7EA 4IH9A 2NV0A 1FXSA 2QQ5A 3UWKA 1ISMA 3H1HH 3DE6X 3LSTA 4ZYUA 4LRTB 4L8JA 1T5SA 1M83A 1FLVA 1NV9A 3HEMA 3T4ZA 1J1ZA 1QU7A 3JQAD 2EHJA 1Z6TA 3HHPA 4KVGA 4BBZA 4ENRA 3BZBA 2PRJA 1XKTA 1A9ZA 1ZR4A 4FOTA 4TZKA 3RJ9A 4GKKB 2I62A 1BMFG 1TK3A 5JPIA 1TAGA 4E08A 3MZ0A 1XCJA 4OI1A 1SXIA 2OTJF 3PLAC 3EQ2A 4MVWA 1J42A 1JHDA 2IYTA 3IDOA 3QYAA 1M9NA 1Z4PX 3F47A 4EIWA 3WBJA 1CHDA 4PX9A 4RGVA 4XM1A 3J7AC 1XAJA 5JS1A 2B1RA 1EK2A 3ONNA 1S3SA 1ZD4A 3TIVA 2EKDA 1MVOA 2G1JA 2DFVA 3LCCA 2XYVA 1GQYA 3OQIB 3QTBA 1JIIA 1PQWA 3GRFA 5KHKA 3HA7A 3A1SA 1MQ8B 5B3JC 2Q3DA 3R3HA 3C1AA 2X4IA 4OXXA 5C8DA 4OI0A 1ZESA 4BE9A 2R9VA 4BYGA 1USUA 5A02A 1F5SA 4P9OA 2PH1A 3OM0A 3WGNA 3OPYA 3SF8A 4M98A 2EFCB 1MGPA 1NBIA 5CBHA 3FWKA 2X2OA 3DS8A 2GEVA 4DR3O 1H22A 4KN5A 3S5JA 3AEUB 2POCA 3BJMA 2VYFA 1V9LA 1SOWA 3VJMA 1G55A 2R6DA 1MG0A 1BXKA 1HL3A 3BN3A 1IPEA 1ZHOA 3RS5A 5LBTA 1XL0A 1WQ3A 1H2FA 4GD3Q 5FBKA 3NVIB 3BTVA 3KSAC 1L5FA 5C8YF 4LF4B 1EDOA 2C4TA 3O82A 4DA6A 1PN3A 3RYIA 1FDWA 4MVJD 2WJWA 3VYTB 3LIIA 2FF7A 3U13A 2PY6A 4QSMA 5CH5A 4YBRA 4F4HA 1XR3A 3EMDA 4ENQA 5IKMA 3T3OA 4KDFA 3NDRA 2BW0A 3OT1B 4MLCA 3C3KA 4CH6A 3DCJA 3L7MA 4MQEB 3RROA 4A8JA 2BAGA 5JXGA 3ZY4A 2FMTA 4WLEA 3B1VA 5F77A 5LOVA 1X7DA 5DPMA 5ALMA 5CDSA 1P7CA 4JR2A 4W9RA 1QBGA 5MFZA 3T1HO 5H3LA 4RGYA 3TW0A 4WJLA 5JCJD 1P84F 1LPAB 3LBYA 5AXDA 2ZTMA 2JFHA 3FFXA 4U7FA 4N76A 2FPPB 4JEMA 2C92A 4LF5B 1GD1O 1IOZA 2VJMB 2G38A 1NC3A 4GPEA 4R1QA 4ER7A 5JARA 4JI7O 2Y93A 5CB0A 1QH9A 1CDEA 2WJAA 4IXWA 2B2NA 4QOEA 3P9PA 3WP0A 4EEXA 2HADA 5GPBA 5ICEA 2W43A 3CH7A 4R7ZA 3CTPA 2FZ5A 2ZANA 4PIVA 4PYKA 2ONZA 5LDGA 4BKUA 2PJZA 2EATA 2FMXA 3CUEF 5H9VA 2EQ5A 3OOJA 3VO2A 4H9GA 3UATA 1R3JC 3H1JH 5F2NA 1JHRA 4GX5A 3KZVA 3N75A 2QD3A 1FY2A 1YZKA 3D6UA 4YC7A 4KR9A 2WKRA 4ECEA 2R4TA 1H3NA 2CZQA 2VTDA 1HNZB 1RRVA 1K08A 3DDUA 1W85A 3F6YA 1LK5A 1WKVA 3RRNA 2PMCA 3LWDA 4XWWA 4YMHA 1RLOA 4P7FA 3WLHA 1SBTA 4UQOA 4GUNA 5AIBA 1SHTX 3BFVA 4OHPA 4DEXA 4WFIA 1GV0A 3KCQA 4ZYZA 1BE1A 2HAEA 2V8BA 5J40A 2PS9A 1YUBA 1ZIPA 2SCUB 5ENZA 4CH3A 1Z35A 1HG1A 2GF2A 2JHPA 2X9VA 5BYJA 3ZHTA 4DS3A 1QH8B 1ZK4A 2GCEA 2A59A 4MV5A 1PJRA 2AEJA 1B0AA 3GFVA 1G8MA 4RS4A 2QM4A 2FRXA 3PFGA 3DE3X 1ZH4A 2C1ZA 2X1MA 4QOSA 3CPQA 1VKZA 1Y1RA 2QRVA 4ZQIA 5C18A 4BRWA 5BUQA 3DSQA 3EGXA 3IVXA 3V4SA 1OAOA 1Z6QA 2YHUA 2WZDA 2VQ3A 5AOBA 2J3HA 4PGHA 4Q3OA 4BQRA 1IJFA 2K2WA 1L0LH 1YJQA 3EZNA 3M1AA 1CQPA 3OPYB 1SESA 4M8IA 2BTOA 5CA3A 1CZHA 3MJHA 4OXKA 4ZVOA 4LVNA 3RFVA 1K89A 3R9IA 3T7CA 4B3TB 3SJBC 4JI0B 1DDOA 2DUMA 1WAMA 3E1SA 3EW9A 3OLQA 4TL7A 2PUEA 4RVHA 3B6NA 4MVJI 1KF0A 3MSCA 3R5TA 4L5AA 4EKNB 2NQ8A 4UUBA 5KA5A 1G4YB 2J4CA 2WWXA 3EEIA 2LE0A 2C7VA 2HV8A 1SG0A 1KQSU 3H2JA 4RPKA 4BWYA 3C9SA 2VJOA 1FNCA 2QRHA 3DC7A 2D8AA 3VNAA 3ZI4A 3DZJA 3K96A 3RSZA 4UCXA 1IG3A 5IT9N 1Y37A 3UM7A 1NC1A 1HEYA 4RHAA 3RHSA 3ZDEA 2VDWA 3ZXSA 4YQFA 1GG5A 5AOVA 1N1DA 1EJ2A 2RGWA 3LC0A 4KPGA 3MBOA 5JH7A 2UZ1A 4CF5A 1QLWA 2JIZD 1LNSA 3B8MA 1E79A 4B3CA 1OY1A 1U0RA 1N6HA 3R5HA 1NQ5A 3ND7A 5KQSA 3GBSA 3GLHE 3KOZA 1JN0A 3L3BA 4E03A 3S55A 5LB2A 3EORA 1M3SA 1FDRA 2ZFUA 1AC5A 3B12A 3PF9A 3EUFA 5L3ZA 3WHLA 5DNYB 1B04A 1NU6A 2O14A 3DEZA 4ITUA 2R00A 3RVBA 2WVAA 3QHPA 2A2ZA 3O9OA 1E7WA 1PG0A 3HLTA 5BQOA 1A72A 2KX7A 3M4YA 5K8UA 5HIKA 1E8DA 2HUNA 3VSAA 1XA4A 3EIEA 3ND6A 4D57A 4DMCA 1VRCA 1U97A 1FK8A 5DRYA 3EUWA 4E11A 1KQGA 1F3OA 1QNLA 2FE4A 3WAGA 2AN9A 2QRMA 2EFJA 4J2OA 5HUJA 1YIDA 5I9NA 2JB9A 3LKVA 3PT9A 2JC3A 4CS4A 2CL7X 1K4DC 3DC6A 1VMGA 3RGGA 3F5WC 3C6QA 4KXMA 3THWA 1Q83A 5BVHB 3ZCQA 4OH1A 2P6YA 2KTUA 5GP1A 5ALHA 1E9AA 1TK2A 2WNHA 4Q15A 3SQMA 1T15A 2F3RA 1DZ3A 2FP4A 3M5DA 4M1EA 4N8DA 1AMNA 3AETB 3HYTA 4FLMA 2ZULA 3ROXA 2AG6A 5HK9A 3GEMA 1MG1A 1TF2A 2CK3A 2J9RA 3OOYA 4PTLA 1W2BU 1HDJA 1ZOSA 1L9KA 2QPAA 3JAMM 5FULA 5JTTA 4X85A 1PNMA 3Q15C 2C3PA 4GLFA 4EHKA 3S3TA 4W5WA 4W7SA 1YF2A 2BTQB 1U2TA 2EEPA 1RRKA 3OW2U 2XUMA 1TO6A 2JDIA 4HNAA 4FYVA 2XCSB 1FMLA 4C4ZA 3KXLA 2NYRA 2CTRA 4MRAA 2MDTA 4GOOD 4L78A 1NZDA 5E6SB 3PEVA 3FXAA 3H1GA 1WB8A 3B70A 521PA 4YV2A 1KQNA 2TMYA 5FL7A 4BZWA 4DLRA 3V4DA 1J9EA 6NULA 5AUQA 1PNLA 5BR7A 3KWLA 5JTUA 2YYZA 3TKAA 1FVOA 1SWVA 2CHEA 2D4AA 2FOIA 1XLUA 2WFZA 2C4NA 1UBTS 1GQOA 2NN3C 2WHRA 4ZV7A 3VDXA 3K06A 1M6NA 4XI9A 3N70A 4OQZA 5AESA 4R2WA 1XDWA 3O3CA 4I5FA 4EA8A 4L8WB 4RFSB 3ZWOA 1JLMA 4TKUA 4XTRA 5TX7A 2JGDA 3EG5A 3JQRA 4MVJA 2XNDA 1Y8RA 2C5GA 5D5QA 2Y0DA 3O4RA 1KXJA 2I7VA 4TXLA 3FPBA 3OZ7A 4YXWA 3OO1A 2VPPA 3ROPA 4AHCA 4CHGA 5GJBA 3BWVA 4DXAA 4JQOA 2LBPA 1WG8A 2Y69B 2VQFO 1GQQA 3GVXA 2NUAB 4GVPA 3AK4A 2HVYD 1TTTA 3HFGA 4FKBA 1XNQO 1CDZA 1DC7A 4EB6B 1YS9A 3B36A 4UTPA 1UH5A 3P5SA 3JQFA 4CI9A 5KHIA 2LXNA 3GMTA 1EWYA 2ZYRA 1PFKA 3OFSA 2XWQA 4XXHA 1IBKB 2CXPA 4ZOAA 2DR3A 4ESHA 3GH1A 1A82A 1Q16A 3IXQA 4QXQA 4DCJA 5DBEX 4ZV4A 2Q28A 4INAA 4ZAXA 3M1YA 2GN8A 4DR6B 5EPEA 5GQSA 4CNQA 4KRXA 2Z1NA 1SZXA 4FMDB 1DRJA 1PYDA 1USWA 3COYA 4PE5B 4QZVA 2A5YB 4OI2A 5BRJA 2O54A 4NCHA 3H4TA 4WFQA 1CR6A 3OUUA 3TKLA 3BERA 1OYOA 2GDSA 3QXHA 5EE1A 2XY4A 4BMOB 4KNVA 1ZU5A 3BXGA 5A3SA 5AM3A 2BJWA 1YJXA 1ZL8B 4JS0A 2ETVA 2VTVA 2VYVD 3NOXA 1WVGA 4H33A 3AVOA 1JA8A 3AL3A 4NPAA 2FSSA 1XVTA 3SS8A 3C24A 1UIRA 2ZQYA 1GY8A 1YA4A 3HB1A 4MCJA 2JIRA 3RW9A 3ZV3A 2F3UA 1HETA 1E89A 1G3UA 1R0BA 3UJAA 4L8YA 4IJQA 4NR0A 5ALRA 3NORA 2HIMA 1ZLXA 1RJFA 2C9CA 3K92A 4KTTE 3OQOA 2ONYA 1JXAA 3O38A 4J3FA 1ZMRA 2AIZP 3M3HA 2JFOA 3I62A 1WR8A 1E2KA 1Q0RA 2PLAA 1TAEA 3FJOA 2V4DA 3UM9A 4YMUA 2VBFA 2OYSA 3RU9A 2FDXA 4X93A 2VLBA 2WSMA 3RUDA 2I6SA 3URMA 2YWDA 3PLNA 1BQZA 2ATCA 2OENG 3NBKA 3QBVA 3PHJA 4DGSA 2W6IG 1GGFA 2B21A 2VWPA 3P3NA 3CC7V 3V8MA 1ND5A 2QVYX 4PA3A 2VDJA 4FWBA 1JDZA 4HWSA 3CCRV 1J8MF 4NHOA 2BSKA 1YB5A 1NVGA 1U0GA 3CNLA