3JALB

Cryo-em structure of gmpcpp-microtubule co-polymerized with eb3
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
429
structure length
429
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Origin of Microtubule Dynamic Instability and Its Modulation by EB Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 150
structure length 429
sequence length 429
chains with identical sequence D, F, G, H, I
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3jalB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3jalB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3jalB01
3N2KB 4I50B 4M8IA 5KX5B 1TVKB 4X1YA 3RYHA 2RHLA 4O4LB 1TUBA 3HKDA 4DRXA 4TV8A 4YJ2A 3WGMA 4X1IB 3WGJA 4O4HA 1Z5VA 3UT5B 3HKEA 4TUYB 1JFFB 3JARB 5M7EA 4X20B 5LA6A 5JCOC 4TV9A 3JAWB 4X1IA 3C8LA 4YJ2B 4X20A 4EI8A 4FFBB 5C8YB 3HKEB 4TUYA 4B46A 4U39A 4O4HB 3UT5A 2R751 4ZHQB 5JH7A 4IIJA 5LYJB 3R4VA 2RHHA 4TV8B 2VAMA 3M8KA 2Q1YA 4O4LA 4HNAA 5KX5A 4I50A 3JALA 3RYCA 3WGKA 4ZI7B 4DXDA 4WBNA 4IIJB 3N2GA 5JH7B 4FFBA 5C8YA 4O4JA 5EZYA 3JAWA 5LA6B 3HKBA 1JFFA 4KWEA 5FNVB 5J2UB 3V3TA 5IYZA 4E6EA 5EIBD 5CA1A 4X1KB 4LNUA 1TVKA 4X1YB 4ZOLB 5IJ9A 4U3JB 4IHJA 1W5AA 5JVDB 1SA0A 1RLUA 5GONA 2GVIA 3RYIA 4O2AB 5JQGB 2BTOA 5CA0B 3JAKA 5ITZA 4I55A 3E22B 5KMGA 5CB4A 3JASA 3VO9A 5LP6B 3JASB 5MN4A 1W59A 4F6RA 5LXTA 3RYFB 4O2AA 5JQGA 3JATA 5J2TA 3RB8A 1SA0B 5LOVA 5JCOA 4EB6A 4U3JA 5EYPB 5IJ9B 1W581 4ZOLA 1FFXA 1W5FA 3VOBA 5EYPA 4LNUB 3HKCB 4EB6B 4O2BA 5LOVB 1RQ2A 3WGLA 1W5EA 4XCQA 5MN5A 2BTQB 3JATB 4O4IA 4O2BB 3RYFA 3HKCA 5J2TB 3ZBPA 3M89A 4I4TA 5BMVB 5IJ0A 3CB2A 1FSZA 5LXTB 1RQ7A 3WGNA 5ITZB 2VXYA 2VAPA 3VO8A 5BMVA 5IJ0B 4I4TB 5LP6C 4ZI7A 3E22A 3JALB 3RYCB 3JAKB 2VAWA 5CA0A 4HNAB 3VPAA 1OFUA 4O4IB 5CA1B 5GONB 5EIBC 2BTQA 3ZBQA 5IYZB 5LYJA 5J2UA 5FNVA 3VOAA 1FFXB 2RHJA 3ZIDA 4B45A 2XKBA 3HKBB 4X1KA 4EI9A 2R6R1 4TV9B 3JARA 4F6RB 2RHOA 2Q1XA 5LP6A 4WBNB 5EZYB 4O4JB 3HKDB 1TUBB 4DRXB 5CB4B 4I55B 3RYHB 3N2GB 5KMGB 1W5BA 5MN6A 3N2KA 4YJ3B 3RYIB 4EI7A 5JVDA 2XKAA 4ZHQA 4IHJB 4YJ3A 1Z5WA
chains in the Genus database with same CATH superfamily
1BN7A 1E6UA 3QGMA 3JAMA 1O9GA 3KLNA 4CM5A 1KYVA 4D6YA 2EP5A 2I7VA 1R18A 1MENA 2BFBB 2NPOA 4KR6A 2GAOA 1VYTA 4RABA 1UBEA 1L7QA 1ILEA 5F5LA 2FPWA 5CFQA 1QDLB 3LVRE 3CD6V 3BRQA 3ZXIA 1OBFO 1DIOB 3DL0A 3ZU4A 1V5EA 1X7OA 5HJ7A 2VUTA 1X8XA 2H8KA 2H8GA 1MZVA 2V6IA 3KSZO 4JGGA 3IIJA 4XJVA 4XOIA 4AKGA 1TJPB 1U8UA 1R0YA 2FXVA 4MS3A 5BSTA 3AQ4A 1YI8A 1ATZA 1EFLA 2R4TA 2ZRKA 4MP6A 1Y42X 2GLUA 2IYEA 3HDJA 5DOZA 3IUNA 1K7XB 1OA1A 4Y0VA 1KEEA 1OU4A 3DOOA 2BIFA 2WTNA 3P0IA 3VGPA 4C82A 2E5LO 2N1MA 4G4GA 4CM7A 1W2WB 2CZCA 5JFGA 5SZKB 4DR1O 4WVFA 3WGUA 3CJHB 1SHLA 1Z8FA 2LBXA 4KQJA 1HQDA 3CV3A 4DCGA 1YHQF 1N32B 2E4VA 1JYEA 3ECSA 4QTYA 4LF5B 1YS6A 1MTOA 2JL1A 2ZI4A 5DNDA 4EG0A 1VL0A 5IRCD 2ACKA 2QGFA 3M6WA 4NDZA 2MYNA 4URUR 3BD9A 4CDNA 1JFSA 3QE4A 1PT9A 1FDWA 3IYLW 1I2MA 3FG9A 3QVWA 4RCZA 1U7HA 4FFRA 4DV2B 2NNWB 3L5KA 3RK4A 4P35A 5HIKA 2VDJA 5AVQA 1UK8A 2JRIA 1GA1A 1Q91A 1N2IA 3FI9A 3GN1A 3LT1A 4S12A 4BHTA 3CLTC 3KAKA 1DO8A 1KO1A 3WGOA 1RXSA 3C41J 2W0FC 1UXIA 2C92A 3ZY6A 4L72A 4OUDB 1DUIA 5AI8A 2I62A 2PLNA 2IUEA 5FPTA 4ASUG 2CUTA 2YXEA 4RA9A 2A94A 3JASA 5FL7G 1RPJA 1YIAA 2OP1A 2X5OA 4J76A 4GZRB 2OCBA 5DTIA 1BC5A 3ENWA 3GB9A 4FDTA 1NLMA 4F6RA 1HE5A 5ALLA 2DFPA 1PCXA 3NDBB 2A5FA 3B1JA 3ZN1A 4HDMB 1SKQA 3T4ZA 1JV2B 2F9ZC 1QLHA 2ARKA 2W93A 4IT5A 3KO8A 4GBMA 4BWFB 3UENA 2B34A 3ITNA 4J9ZB 3CCQV 5MDHA 3UJNA 4IW3B 3V33A 3EDCA 2VZ9A 3LHIA 2JKZA 3RRZA 5DN6A 3B9PA 4MUNA 3C6ZA 3AG7A 4UOEA 1I3OA 3AG1B 1RWBA 1S1CA 2GK6A 3OHPA 2ZZNA 4JL5A 2OBFA 5B3JC 2BL4A 4GUNA 4P4TA 2GM9A 2SNIE 4B3RO 1S2IA 1VJGA 2ZR2A 2P27A 2QRZA 3HWWA 3PQ8A 5AK3A 1KR5A 2GZ1A 1OLUA 2ATVA 2FR8C 3MJSA 1HYQA 5A0VA 3ZV3A 1SNYA 3ZCCA 2JANA 3AKZA 2DC1A 1OZHA 1PT8A 2VH1A 4BLSA 3MCUA 3SMVA 3R3UA 2FSUA 1S3JA 3OKPA 3DEKA 1I7LA 1B1AA 2C61A 3FPAA 1IATA 2XAGA 1S3FA 1F38A 4OHPA 5K0SA 1UFQA 4XD7D 4NH4A 2Z6UA 3K9WA 5TVGA 5F7XA 4M99A 5DCLA 3JW8A 5KWSA 4U2BA 3TO5A 2IOQA 5IP5A 4P3OA 4QQKA 2PGJA 1XLTA 4TQ9A 4UZFA 1P60A 5B1OA 2JH9A 1K8RA 2NUTB 2VQFB 2YIMA 2ZVPX 3O8QA 4FNGA 4JLUA 4P92A 3NX4A 3WYEA 5JQWA 1JR9A 5M29A 2OAGA 4N0EA 9MHTA 2PBFA 3FOBA 4C06A 2FMFA 1H2KA 1AHHA 2PD6A 3L0YA 4I4IA 3DWFA 3VHXB 1DQRA 1PHRA 1X77A 1YDHA 3ZHUA 3QBTA 3V4PB 5JNWA 5HF5A 4QVGA 1WJGA 3NASA 2XUIA 1EZVH 5KDOA 2FX3A 3CB4A 2MT9A 1B1CA 1GZ0A 1H3NA 3O94A 1A76A 4OFWA 2PH1A 3QJGA 4W6ZA 5AI9A 1SBTA 2W48A 2GAFA 2WKQA 1KC3A 3QUQA 3S99A 3NV9A 3PPYA 2F95B 3QXCA 3R6DA 2ILVA 4E4EA 4G1EB 3G89A 3HFGA 3BWDD 4G9EA 4N40A 4Z9FA 1U8ZA 1RYHA 2FN4A 1XTKA 2VKTA 3MUFA 1QPGA 4IY1A 4JJ7A 4UUNA 3SN6A 1TM5E 4B35A 1VPDA 2HG5C 1CS0B 2FNAA 3FDZB 1F7YA 1F51E 4WFFA 3DFFA 3IAM6 3P71T 4HBGA 5CT8A 1UZLA 3K14A 1C3XA 2W00A 2ZSJA 3RSZA 5ITWA 3TKLA 4O4IF 2A0UA 4V24A 1K1EA 2OC4A 1CS4C 2C00A 2B33A 1M8GA 1N5JA 1RPNA 3PUIA 4IDNA 2VJYA 3AK1A 2OHIA 4B3GA 2BO1A 3DZJA 3WLJA 5B55A 4G1BA 2O2HA 3HJUA 1YQXA 1IMJA 3UFBA 1XNQB 1ZRNA 3FTDA 2I3BA 3G5LA 5BWCA 1GTJ1 5LD2C 3AR7A 5ILGA 4PVDA 4DLSA 4EW2A 2H92A 1DIHA 1KGSA 2H11A 3EEFA 4KVAA 5EIEA 2PX3A 1ICIA 4UD2A 4MW1A 1TJ3A 3NUZA 4M87A 4ZRNA 3UAGA 5BN1A 3OPNA 4Z0TA 2CTRA 1U2GA 1BYUA 2X86A 1IY2A 5DB4A 1NE2A 3G2JA 4PX2A 4F3CA 5ALEA 1GGVA 3N6VA 3CZRA 5ALKA 4EJFA 4TTRA 1M6VA 2JI6A 3FB8C 4DLUA 3NFRA 4BS9A 3WLEA 1XQYA 5EZ6B 5JVDF 2CV0A 3L7BA 3O0TA 5CB4A 3WKBA 2H1OA 4YI3A 4AD8A 4AZWA 4Z3OA 1YNSA 3DEZA 4S1NA 4JQSA 1YTFD 3U7HB 1ULBA 4FB4A 4FOOA 4MI3A 1SA0B 2QVLA 2CZWA 1T35A 4A36A 2GN8A 1DEKA 2QLTA 4CGYA 5J59A 4TKMA 2JG3A 3RSGA 3TL2A 3G2NA 4FQ8A 1DC4A 1G5HA 4O2BB 2C2BA 3AEYA 4YMVA 2XYGA 1QBKC 2X0LA 2PJZA 1MHTA 3DMTC 1JVBA 3A3NA 4KR0A 2HK8A 4RNCA 3T3OA 1E3MA 3H2HA 3BHMA 2JS7A 4MPRA 5C3UA 2K7ZA 1T5IA 3TRJA 1DXHA 4K28A 4F9EA 3EPKA 3DBLA 2JLAA 1U90A 1FUYB 1K5HA 2YUAA 4CNQA 1FJ2A 1TO2E 4QGBA 4Z1OA 1E2QA 2LVBA 3CRZA 4NENA 5DVZA 1KPIA 3REFA 4ZYUA 1OIWA 4J6EA 3ZJUA 4OFBA 4UDXX 2VPYA 2YMLA 4KXLA 1VJ1A 2V8BA 5IYZB 5GM1A 3B77A 4U3FH 1GQQA 5B3SC 4KPUA 1OY1A 3EGDB 3KZOA 4KX3A 4MUGA 3PBKA 5AKGA 3O75A 4BBJA 2CJYA 4TKVB 3LA8A 1FP6A 5ENDA 1ZC4A 4ZAWA 2HSWA 3D3QA 1OGJA 3V8QA 1Z6XA 4YT4A 5C46F 2HS4A 3DQPA 3SF0A 1EBOA 1KJIA 1UM9A 5P8WA 1RKVA 4DABA 1XL0A 1ZNQO 1GUBA 1NLZA 4KE8A 3WE7A 2O3TA 4WK0B 2J3DA 2ANBA 2BLLA 4HD8A 4DLWA 5BXYA 3BCCH 1D1TA 4YT2A 4QAJA 2FSPA 1LV8A 4DPLA 3ENZA 2JJMA 1GO1A 1K8ZB 4FR2A 1VHWA 1KI9A 4M38A 3ZXXA 1KNXA 1LPOA 4HNUA 4RQAA 4BO9A 3IA2A 3R4CA 4PLZA 3TJRA 4F2GA 4YCNA 1TVKB 3R2JA 4P31A 3EQ6A 1DDOA 3N28A 4X61A 4PYKA 1NLYA 4YN3A 4F4FA 1ZM2A 2GK3A 4JBLA 4YXFA 3ZMUA 4WXYB 3M6VA 2QUIA 4XM1A 5BSWA 2Y6UA 1SC4A 2ONYA 5DYNA 2IPNA 4JYCA 1HETA 5HDBB 4DKJA 2JIPA 2B36A 3EZGA 3NHSA 5CH8A 3L82B 5JISA 3VYWA 1TM7E 4NS1A 3PITA 3CW9A 1IEQA 5DNAA 4JBWA 4HYQA 4CMJA 1PNOA 1ZM3A 2BP7B 1L5NA 4X60A 4DMCA 3ZY3A 5IANA 4PY2A 3H5TA 2NLJC 3PEVA 3PIDA 4Q4HB 3SLRA 4ZVKA 1WQ4A 3S0JA 1Q0PA 4KWHA 4B17A 4P0QB 2P5UA 5DYYA 3JALA 1NP7A 3MBMA 1R8XA 1Q6HA 2HFEC 2BHTA 2XTAA 3C7KA 2DKOA 4K9OA 1ZN2A 1ESEA 2INGX 1EFRG 1N78A 2VHJA 1UBNA 1J9ZA 4WXMA 5AVVA 1SEVA 1YA4A 1IDSA 1ZDMA 4LHXA 3O2JA 4EB8A 1N5OX 2XCUA 4B6SA 1JBKA 1E1QA 1V2GA 4X8LA 4AI8A 4QSHA 3I56F 2Y2UA 3JQFC 7MDHA 5HRCA 2QR2A 1G8KA 4I6EA 3AR6A 3GGCA 1M56C 4Q1EA 3VSEA 3JPWA 4Z0NA 5F64A 3UGKA 5C7OO 5I9LA 1YRAA 3TG2A 1ZNXA 2QMYA 4D96A 1V0JA 4YMIA 3IKMB 3JQBC 5LMZA 3GWGA 3HCBA 4NEGA 4HX5A 5E3JA 4PNEA 3JYCA 4JI0O 1O94C 3EGOA 1P39A 4G5GA 1W0JG 2XUPA 4RCYA 5KLVH 1XREA 2PUVA 1YE8A 1VRVA 2HZ7A 2RH9B 2WDZA 3PT5A 3HVIA 1NY5A 1Q92A 4P4GA 4X6UA 4PO9A 5DU2A 2X2OA 2XT6A 4I50F 5A05A 2BM8A 2C54A 3KEOA 3UV7A 4ZEOA 1VSTA 4HMPA 4MR7A 3BWYA 5EQTA 2CZQA 2HQ1A 4HOYA 5JUWA 1M2OB 3FSJX 3CNBA 2RAVA 1FDVA 2IYNA 3QUBA 4R31A 4RHFA 3WLQA 5FWYB 4ZOLA 3LBYA 1HM5A 5BN4B 3T35A 4AJIA 4CODB 5EUBA 4YI5A 1T2AA 3CS3A 1E4VA 2D00A 3CW2A 3HB0A 4E5KA 3HWSA 5E1BA 3QVLA 4RHTA 4JBGA 1TQHA 2QMHA 1RQLA 4B43A 3IHTA 1E2KA 4MVJE 2PSFA 2EARA 1E7SA 2CMFA 2I7DA 3DTVD 3DW3X 1OI4A 2VDPB 2ZUWA 3AP1A 2HQOA 4FC7A 3JD2A 4DDVA 4MIOA 5BURA 1C9NA 1ZK0A 4X0EA 2JBAA 3HJNA 2Y0EA 1H6AA 4HNHA 4F5WA 1MO5A 4HNGA 2XNHA 4YIPA 1YZ3A 2G5TA 4HPJB 4NECA 1QIMA 3REOA 1YJAA 3EXG2 4CF3A 2HVKC 2PS9A 1P2FA 3AY6A 3CWZA 3ESBA 5C1IA 2QX8A 4JT4A 2HC9A 4IYJA 5CPFA 4OGLA 4XVRA 2WWRA 1QK5A 1OC4A 5DTEA 3S06A 1S2LA 3T3DA 3ELYA 4HT3B 3TUZC 2QF7A 3ED5A 5LZ5A 4NULA 3H1PA 2FZKA 3TSYA 3L92A 3OLZA 3CCJF 1NV8A 3ROKA 2QXTA 1Q82H 1LJLA 3QTYA 2IHZA 1OAOA 3IC5A 4PO8A 1Y0BA 1KDRA 3B3QA 3FB6C 2QD4A 4I55B 1PKEA 2R6DA 1QE3A 1YMUA 2E4WA 2WKSA 3LGXA 4BFUA 3W3AD 2VGMA 2ZUDA 2J30A 4FMDF 3IR9A 4QOFA 4FYYA 4TWJA 2IJJA 4YRGA 2VLIA 2NTVA 5H82A 4XW2A 1J56A 3OU6A 4YMGA 3JQ6A 1M57B 3UUFA 4IHJF 1G8SA 3WZ2A 2ZRAA 1GRNA 3DMHA 1E9DA 3LT2A 5H5JA 5I9SA 1JA9A 1CFJA 4I3FA 3WLTA 3O65A 1Y67A 4WCDA 4P32A 3ZWCA 4PG8A 2I6FA 1NVBA 3VYVA 1OASA 1PV2A 4XX0B 2YJGA 2VEOA 1U5CA 2ID9A 4M1WA 4XARA 5FUYA 3DZDA 3JQRA 2B4KA 2CXQA 2XYVA 2VJMA 3ZYCA 4RX1A 3AG3B 2IZ7A 4KEAA 1JILA 2DWCA 4CH5A 2Q4BA 1ZXXA 2VXOA 2IA5A 1EK1A 3D6MA 1YVUA 3VR5H 1K6XA 2G9RA 4FHFA 1KMNA 2JCGA 2A5JA 2EIJB 3AFGA 1SCDA 1COWD 2ZBRA 4JLBA 3RM3A 1E8DA 3T3IA 1IIBA 3I0ZA 3PVSA 3WDLA 5JAHA 4F5DA 4O29A 4Y6GB 2WSIA 5AXAA 4W99A 4DKXA 4YRLA 5AW9A 5KYWA 2Q7XA 3CVVA 1A5AB 3CUEF 4IUBS 2R8OA 3RC3A 3DMYA 4MEJA 3UFXB 1U3CA 4RMJA 4DLRA 4W5JA 2QKCA 3PT9A 2VR1A 2LGQA 1C0KA 3HV2A 3WIUA 4AG5A 4Y0NA 2W2LA 4JAUA 1FMCA 3ODGA 4UTOA 2GPYA 4PZPA 5ICFA 4LZNA 3JD4A 5C5IA 3ZLTA 2WG2A 3WL4A 3IVGA 2DQ4A 1BGXT 4GOMD 5L3CA 2UUCB 1WCXA 2B1RA 1VP3A 3A1DA 5UKDA 4L8VA 2J31A 2VPTA 2NO6A 1Q77A 5HE8A 2X77A 3MTAA 2WICA 3R0QA 1EDOA 4YLGA 4IJVA 5DBEX 4C88A 5L3SA 3O92A 4NTZA 5FFMA 3RHSA 3UA3A 5I5EA 5EB1B 3VNUA 1TQDA 1W0JD 2OZPA 4PPGA 4ARIA 3ICPA 3PNLA 4Q7JB 1TAQA 2JLQA 4WBXC 2I80A 2E1RA 5B30A 2Y1WA 4KIUA 4L8LA 3TLEA 3LVQE 4HGOA 1P84F 4G65A 3LCMA 1X9HA 5AM0A 1U11A 4KIWA 5AVYA 1BXGA 3R5FA 5I7EA 2AMVA 1PS8A 3DYIA 3G7NA 1D4AA 2ZS8A 5BR7A 1Q7YH 4CL0A 2VZ8A 3ILHA 2PUGA 1KARA 1VQLF 4JKIA 2CK3A 2X42A 3W7WA 2GK7A 4WCFB 1L5HA 4UTNA 4E22A 3DL7A 1Y4DE 2CFSA 4W7IA 4YK7A 5DEIA 1U04A 3ETHA 4UTVA 4RVDA 2BELA 3ED1A 1ZOLA 1NQUA 1GN3A 2JAPA 3C3YA 3HWX1 1S01A 4JASB 5KSOA 1XVIA 3T52A 5AW2A 1GAXA 2QRKA 1UH5A 1UK9A 4QXQA 3BMCB 2H08A 2AVDA 2GXQA 4J42A 5EKSA 1U3PA 4J2OA 1U3UA 2HSJA 1DINA 1XHFA 3OJLA 4FUTA 3M99B 3SIVA 2OESA 4Y2SA 2BSXA 5J40A 3D3KA 2HJDA 2PH5A 3WQSB 1GR1A 4UCSA 3ONVA 4YUXA 5KTRA 3ORRA 1QHXA 1TIKA 1Z4LA 3KHSA 2XB4A 3FE2A 3B1WA 3DAFA 4EKGA 1FYWA 1SKYB 2MINA 3FYCA 1Y66A 2YICA 2HWXA 1K5QA 5HWSA 1EQUA 1NV9A 2Q1XA 2VF5X 4OYLA 1E6WA 3DDOA 3MT7A 2OHHA 2VHVA 3UATA 5TQJA 3ZY4A 2ZYHA 4FI3C 2CDAA 3L46A 3RSFA 3JRWA 4CEHA 1HTTA 4CR7A 1SUBA 1HSOA 2C2WA 2F3SA 2VNSA 2ZBEA 4IJMA 3ZD8A 1Z4IA 2Q5QA 4HDKA 5HKKA 1LPSA 4DSZA 3GJ8A 3E9CA 3OO1A 5ARBA 1J8FA 1IFXA 1KPHA 4YC7A 4OK5A 4A0HA 4BPBA 1NSYA 2CVPA 2EFYA 4OGKA 3WGJA 3EPPA 1X8LA 1G8MA 2FLWA 3HKEA 3A2MA 3BIWA 3THOA 7ABPA 1IWBB 2WSSG 2HP8A 4IX9A 1SXIA 1WVMA 3A4MA 4QIWF 1BS1A 1WU7A 4P0TA 5CBPB 3DWIA 4B32A 1TF7A 5H4GA 2NTJA 3V4RA 2Z1FA 3HGQA 5IX8A 3PKZA 4EITA 3X2SA 3VHQA 3MHHC 1DI0A 1KEVA 4K6CA 1M54A 1XVAA 5CTJA 3O8OA 2Q1YA 1AB5A 1H8EG 3CUTA 4BNUA 2ECOA 4Q48A 4G28B 1SUEA 2VPQA 2LW7A 2BN4A 3GQVA 3S02A 2NYRA 5IBCA 1V45E 4F85A 1VB3A 2E1PA 3WZMA 4BKQA 1Q12A 5FI1B 2X3UA 4FN5A 4IV0A 2VH5R 4AQYB 1B3RA 1I3MA 1UAGA 5FNZA 4PG6A 1D5AA 2XYRA 4UM9D 4BNJA 4C07A 2ZXUA 2QE6A 5ERYA 2GTHA 1B04A 1TEXA 2VHEA 4ARBA 1PZXA 3NIDB 1NWHA 3OX4A 1K7YA 4O0MA 4PA7A 1A9RA 5KYYB 2BF4A 3GFSA 3KAJA 2B6NA 1KA9H 5FNVB 4G86A 3EZXA 3S2SA 4AYWA 4AO7A 1J9GA 1R74A 5CURA 4YAGA 3J81A 1NUHA 3E8SA 2GLXA 4K3UA 4N65A 4NQRA 3JQGB 3H7IA 3MGAA 1TEVA 2QI2A 1KYXA 3RVYA 2V1UA 2OK7A 1U9IA 2HXSA 2P78A 4X7BA 4OYHA 3S3WA 4S0ZA 2C2HA 3B85A 4OI4A 1J2YA 5JTUA 4KK3A 1J99A 1BKSB 2PX5A 1NF2A 3ML1A 5A02A 3WK8A 3ZDEA 3A36A 1VHJA 3DYVA 2I9PA 3AEUB 1C3JA 2ZXWC 1QH1B 2PZEA 2RSLA 3F3MA 3AI2A 3F9RA 3G2MA 4FMTA 4K6FA 4MUAA 1KHHA 1A69A 4J7KA 2QP3A 1Y5LA 2TRSB 3QVKA 1EWKA 4OIFA 2H7VA 4Q3AA 3TUJC 3IOEA 421PA 4U3JA 1N57A 4ARZB 5MFZA 4XJSA 3FMPB 1KYZA 1V6SA 3K20A 1W5FA 4L8WB 1W57A 4ZKEA 3CD6F 4CF6A 2WQZA 1KYIA 4PYIA 5HKAA 3FKJA 2BVNA 2EJUA 2NT4A 3OONA 3G17A 3I12A 1W4ZA 1D5WA 1TTHA 5F7ZA 2H8PC 2IJIA 1W88B 3SJZA 1GFWA 2NU7B 3EVCA 5CHYA 3I62A 1DIRA 4LYAA 1BXRB 3U7IA 3FAZA 3ETLA 3R41A 1B26A 2H4YA 3AM3A 1YUBA 1ONNA 2XUJA 4R2LA 2IUUA 2VAPA 2O8BA 1L5VA 3K6RA 4KE6A 4B0PA 2Z4SA 5HQ3B 5D7BA 2M32A 3P96A 3ZVMA 4BGUA 4JUDX 4AN1A 5KYTA 3GEEA 5JAUA 3ZS8C 3ZMSA 2BTQA 4Y0AA 1PJCA 4CM6A 1T36B 1F51A 4LFBB 4IILA 4J16C 1D6MA 4FLYA 2M6SA 3ZE0B 3UAOA 3WQHA 4Q9HA 1E3WB 2FSVA 4A2WA 4XXHA 4TV9B 1YXMA 2HU5A 1I24A 2E4YA 4P2ZA 3H4IA 3QELB 4LOIA 5FL7D 2HJRA 3WBJA 1RLJA 2A9KA 2P35A 2CFTA 3W8NA 3AM5A 3BEHA 3VR2D 1NYRA 2Q9CA 3L0BA 3FOFC 4TKLA 1ECPA 3BXZA 1DQNA 1UJ5A 3L7CA 5B36A 4LF7B 1VJDA 4TN1A 1AQNA 1MJNA 1LA2A 3C90A 2ETXA 4MWGA 4TRRA 2OMEA 2A1UA 1VL8A 1RHJA 3LWZA 5ENVA 3CYQA 1B8OA 3R8XA 5LU8A 3HHEA 4UVHA 1J49A 1E1RD 5JI2E 1CRQA 4C2AA 2H1SA 2ODBA 2R5NA 1SRYA 5CBFA 4FBMA 3CA8A 5ALDA 4BLOA 1SXJB 3RI3A 4RGYA 4UU8A 4Z9YA 1FDIA 2HLPA 2QYHA 1QQTA 1VA5A 3B53X 2D1TA 2LRHA 3JSLA 5C5CA 1C5KA 2QV0A 2DPMA 3H2KA 4TWAA 5LSAA 4TUYA 4JI2O 1HL3A 2B94A 2BM9A 1UPGA 1EUCA 2G17A 4IQFA 1QB7A 2QTCA 1OAKA 4AJHA 3ZHXA 4JVOA 1GZUA 3KSMA 2B20A 2E6UX 2EIHA 2J41A 1TJ5A 4JC4A 1ULTA 1W4LA 1E3DA 3D4OA 4JEUA 2XDQB 2Q2VA 2P6UA 3KPUA 3EWSA 1NI4B 1ZX1A 2JFWA 5JO9A 1KWGA 3L7IA 1GZDA 2AF4C 3D4BA 8OHMA 1QCDA 4W7HA 1K2VN 1RSZA 1ZJZA 2NPIA 2D2XA 1ECCA 1YL6A 4I1UA 4JIMA 4MEAA 5J5CA 1RM1B 3KVYA 1QYVA 1H2AS 2VA9A 3PD7A 3CS5A 3COPA 4M2LA 2LIPA 4YJGB 3CLSC 4Q3DA 5BW6B 3E0XA 5F23A 1SULA 4MLPA 1XTIA 3HXLA 2DWEC 1W5SA 1UXJA 2QJRA 5B3AA 1DB3A 1UJBA 4U3JB 2WKPA 3KS9A 1YB4A 2X8WA 5A2QA 2J0VA 4L5YA 1Y1PA 4D0SA 2PY5A 3HK2A 2DCUA 2AXTZ 1G59A 4DCJA 1PGPA 4JQZA 3RU7A 4CC5A 1NBEA 1Q6YA 4QTUB 1I3CA 4MPDA 2YTZA 4R2WA 3OSZA 3E35A 4Q20A 1I6WA 1LPMA 1U0JA 3ONEA 1UT6A 1DS6A 3H2YA 3MWKA 2PANA 1JKXA 4KVFA 2C07A 3KDPA 4POAA 3ZKAA 3ZY2A 1WM1A 1T29A 3UUEA 1TAEA 3D3IA 5K8VA 4JYAO 3EPRA 2PL9A 4MARA 1FSGA 5JCZA 2I3DA 3EGVA 4RMIA 3ZH2A 1H4TA 2XTZA 3F5TA 2OHGA 2G4CA 1TEZA 2B9ZA 2GBGA 3WIBA 1PK7A 1OZ0A 1VKHA 1NBWB 1M56B 1HF3A 1JU3A 1HEIA 3GZTB 1FU4A 3F6BX 3N07A 3NGXA 1NZ6A 3AV3A 4MUFA 4R9UC 3SX4A 4DBVO 3GY0A 3OUZA 4DMRA 5BNFA 5INTA 3V5NA 2Y76A 4ZKDA 3V9PA 3WO0A 1Y3FE 2WLTA 3A05A 3WDMA 1EXNA 4BNWA 3UGQA 1EE9A 5IW8A 4B7CA 1V96A 2VCHA 5EIWA 4D3XA 2QRVB 3E7WA 4FT2A 5K0GA 1WA8A 1R0KA 1J1UA 3HGMA 3MJEA 1TM3E 4G4WA 3X2QB 3VPAA 2EQAA 3UCXA 5CA1B 1VF5B 1IB6A 1PBNA 5J2UA 2N9UA 3HCCA 2GEUA 4IJKA 2G72A 2ZB2A 4XB6B 4QYIA 2XKBA 4R0VA 1RACA 1QRTA 1MDBA 5A1JA 1L7OA 2C0PA 3TZLA 2UKDA 2XCQA 3ONFA 1WB8A 1F0YA 1TW3A 2V58A 3I9MA 4ZMRA 1FQWA 4RSMA 1NTRA 2MCFA 2GBCA 4LF4B 1F5NA 1QQAA 1VYUA 1NQVA 1VI5A 2W6NA 1FX1A 4JQCA 3ROPA 1W1WA 4LGCA 1ZEMA 3EF0A 1NBMD 4R1UA 3WIVA 2XE4A 3CF6R 4LF7O 4CT5A 4GZMA 3ANXA 1I9GA 3JS5A 3CH5A 3ZV4A 4NHEA 3INNA 3RJZA 5HVNA 2QORA 3JQ7B 1K2WA 2X14A 1LJUA 3C1AA 3S0WA 3OCJA 4A5OA 1DJMA 5JE8A 3WGMA 1JTVA 3CC4V 2P9FA 2BR3A 2HADA 4YJGA 4DIFA 3CEPB 3O7MA 1I80A 2JIQA 2EQBA 4P84A 3WG9A 4HMQA 1JIIA 4XYBA 5M04A 4DA4A 5ESWA 3TEFA 1XHLA 1ZOIA 5IY5B 3F0DA 4QXAA 3WXMA 2IYAA 3EA0A 4I9FA 5AXBA 4B4OA 4DG8A 3GAMA 2O2JA 4WHMA 2HLHA 4RQOA 3F2VA 5LL6Y 2O1EA 3N05A 4XQ0A 4BZQA 4Y2GA 1IBKB 1B93A 4BMOB 3G0CA 3F4BA 3D2CA 3LDHA 1XEWY 3MT0A 3RJ9A 5TJ9A 4EVQA 2CDNA 5A9GA 1ODKA 1QWSA 2JLRA 2NUPA 3DT9A 4FJ2A 4LX8A 1Z4MA 4I4CA 4LWOA 3SZRA 2IE0A 4CIDA 3ZIAD 1RRMA 2IPLA 1N9ZA 1LK5A 2NQTA 2JFHA 1NN0A 4PVCA 4R5MA 3RUCA 2HDOA 1D3AA 2R65A 1ZVJA 2ICAA 3QH4A 1DF4A 1YJNV 1ABEA 4OHKA 3RD5A 4Q7EA 3KC2A 2OV4A 3FHOA 4LVUA 4TN5A 2VDUE 3KTAA 4J6FA 4JJFA 1O5TA 1A2KC 4OB8A 4BX3A 1H48A 5J2UB 3HXQA 1XCOA 1UT5A 4BDTA 1F7VA 4HEHA 5DE3A 1GPDG 4U2CA 3OFJA 4OA5A 2IKSA 2W42A 3I09A 2ZVZA 1JG4A 2UUCO 2OLKA 3RUIA 3B5EA 2WSLA 3QMMA 3ADOA 1ZTEA 4QRDA 1VMIA 4BVBA 4E0BA 4MJ7A 2ONCA 5LN1A 4OXYA 3CINA 1T3SA 3UMCA 4EI2A 1YOVB 1QUEA 2NWQA 1FUUA 1IXZA 2VIIA 3CKYA 4XD2A 2DTXA 3L8GA 1O94D 4KYIB 1BE6A 1CUIA 2ZIWB 3OJCA 3B8EA 3E83A 1TDJA 2FMKA 3EG9B 3KOWA 1R8SA 4M1ZA 4PU0A 2XF8A 4RVCA 4R0MA 2K1EA 1ENVA 1BFDA 4E88A 2B4TO 4F4JA 1U2SA 2IQQA 2KSDA 2CLHB 4JROA 2X4GA 3BF8A 5NULA 1T9DA 4UVAA 1I0ZA 4OL0A 3EGEA 5F1PA 1JAZA 2XXBA 2H85A 1NJ2A 1PNVA 3DZGA 3ETJA 1W93A 3OTGA 3QQPA 3OMXA 1VPWA 1QIFA 1FBNA 1SVWA 5FWYA 2W6QA 3I92A 2G9VA 2H8EA 3ABZA 2OFFA 2CL7X 5BMVF 5LXTB 1PVDA 1EJ2A 3IJRA 3QYPA 4P3KA 2ODPA 1M2VA 5HS6A 4CMKA 1OH5A 5ALYA 5GQSA 2LBTA 4BVSA 2VUSA 3EHBB 3LPLA 1SC1A 1NONA 4X5OA 4HDNA 1ADGA 3LE8A 2G7MC 1U4SA 3SZMA 2K7FA 1PDOA 2GSMB 4BX0A 1R6VA 2GESA 2FKAA 3JQFA 5M3BA 3ZIDA 2QM4A 3LCVB 4C7KA 1L2TA 1QHYA 1QH0A 3BAFA 1C3OB 1CUZA 3MLEA 3NIWA 3L3BA 1U8FO 1JXAA 1QZUA 1VQKV 4U2KA 4B8YA 4ER7A 3KTAB 3ZMZA 2EATA 3HQ4O 3FAVA 2JBWA 3RKSA 3S2EA 3DPIA 1P9NA 2YNMA 3WMEA 4EPVA 4B3IA 2BC9A 3OMWA 1H22A 3OOHA 5FL3A 4B84A 4BAYA 1BW9B 3Q4HA 1BS9A 3CZ5A 3LYUA 4PPQA 3N86A 1NUUA 2DECA 4PRKA 3W5JA 3WK5A 4BY9D 1QDEA 5ARDA 5AJXA 2UDPA 3GG2A 4RWZA 1W96A 3D43A 3WFIA 3ZXUB 1CZUA 3S8YA 4FK5C 4ZK2A 4DMFA 2QI9F 3QA3E 5KX5B 1DRJA 3ER8A 2PA0A 4UASA 5J1TB 1PP9H 1Q95A 2E6KA 2IHUA 1MO2A 3O8BA 3DM5A 4QNNA 5LBIA 3QE3A 4K35A 2KMLA 2ZBVA 2ZP1A 4OU5A 5KOIA 3SYAA 5KYYA 3NRJA 2HA4A 3EW7A 3A0BZ 4FFVA 4IRMA 1SDSA 1DEOA 1YDGA 2Q0HA 4IXWA 1U80A 3N27A 1DEXA 3PL5A 4JVLA 3TX2A 2QPLA 3VPBA 1P2TA 2D2EA 5EWMB 3KOYA 4HN9A 2C5SA 3OD5A 1USKA 4N6OA 5DLEA 5TQ2B 1L0BA 4C78A 4X65O 2PK3A 2ZUFA 1Z63A 3B51X 2A8YA 1Q0HA 2VYFA 3NM5A 5IWCA 4XCVA 2P0YA 2ZCVA 1T6ZA 2HF9A 2Q1SA 3SC2B 1NR5A 6AT1A 1UP6A 2FJPA 3W7VA 2XUFA 1QGUB 1PGNA 2RHRA 4GOJA 1LPBB 4RBNA 5TB5A 2GN2A 3ID6C 5CFMA 1DWPA 5H16A 1FFWA 2WWVD 1VLHA 2PGLA 1YZHA 3L79A 4AFNA 5SZHB 1MDFA 2JJ8A 3K0CC 1D2MA 4AZVA 2ECFA 3LSSA 4EKEA 2UZ3A 3QO5A 5EQJB 3AR2A 4QLBA 2HF8A 3CEAA 2GM5A 3GDHA 4OJMX 4P7KA 3EC2A 3OPVA 2GETA 3U4DA 3L8MA 1H2WA 1TKCA 3W5HA 4X7MA 1PLLA 5BYKA 3H2JA 1ORIA 3QPUA 4I9UA 5KVSA 4PM4A 2D2CB 2AR7A 1E0KA 3GRCA 3G5MA 2OTLV 4J41A 2ZT9B 2O2DA 2AB0A 1OYWA 3JAKA 3E5HA 3FNHA 4FE7A 4QC2A 2ZTHA 4KJXA 4H3SA 3QPWA 1JJ2U 3ZBTA 2IZOA 1AF7A 4G24A 2G77B 3JZIA 2F9MA 2UYJA 1VP9A 2H7YA 4GWKA 1YGPA 4JEHA 4E5DA 3R9XB 3G1UA 2Y4TA 1R88A 2QD5A 1N0IA 4NYKA 2PL3A 2W8ZA 4UEOA 4E5UA 3U44B 2XEDA 1L8QA 3V7YA 1RAEA 3FYUB 5IJ9B 2VXBA 2IY9A 4EY5A 4LV6A 4YROA 4O2BA 3R66A 2QLLA 3EVFA 4TYWA 4AUMA 3F6PA 3K5MA 2QAGB 4KO8A 1FU7A 4KXVA 3RLIA 1A9TA 4F4HA 2UUBO 3SHTA 1CP9A 4LBZA 5DO9A 1VQNF 2ZWIA 3T4XA 2JI4A 3DVQX 1GPUA 1TKAA 2X76A 4J9YB 3TECE 2QENA 2RAFA 1FNJA 3KQMA 2CGEA 3B12A 4Q1AA 5JT1A 1EGHA 3A6KA 4F8JA 4URVR 5BMVA 3N4YA 4X6YA 1OAOC 1W30A 1GCIA 4M9RA 2N0SA 2OM6A 1S7GA 4IH1A 1HG1A 4EUEA 4HBZA 1HI9A 2R60A 2FC3A 4LUCA 1RI4A 1W2HA 4RIHA 4QT0A 4Z4EA 1JIJA 1GUAA 1WDMA 3E70C 4E1VA 1ZUWA 3GRUA 2JIMA 3IULA 3MINB 4CTJA 3O2SB 1N4DA 3I8OA 3B1FA 3K04A 1PR9A 3M7IA 2FP3A 1UIRA 5T67A 1E3TA 1ZD5A 3TS1A 4AQYO 3W5BA 3F2IA 2ZJ2A 1I7QB 3FTPA 1NN1A 4LC9A 1FXKB 4CG1A 2DH5A 2E4XA 3PI7A 4ETNA 5IT5A 2LV8A 2VDOB 1GZ4A 4M7PA 4OGFA 2PJDA 3N2GB 1XQ1A 5EC8A 4M8NE 1SU6A 4BMZA 3DG9A 5DMXA 2FHPA 2OQIA 3D6VA 4ROTA 3DP9A 1YDWA 3BGWA 1QIDA 4N3AA 3VR1A 4NOLA 5I8PA 2HEGA 3F0TA 4W4LA 1CY7A 2YZ2A 2PRIA 2I2FA 4RS3A 1V5FA 1UCFA 1KJQA 1U81A 2A9VA 4MW2A 2QP9X 2BFFB 2UYHA 3QFRA 4PQFA 5DYIA 4HXEB 3QK7A 2GCEA 4BMDA 3C3XA 3GH3A 3QX8A 5E6RB 3VC3A 5M7EA 5GINC 2BJVA 1R3IC 4MUBA 1M5TA 1KVSA 2K5UA 3E8BA 2OO5C 3HPRA 3Q40A 5JBQA 10MHA 3PS9A 3L4BA 1SOMA 1P4JA 3V4FA 3H5NA 4YP0A 1PR5A 5DNCA 5LFAA 3IMPA 3EIOA 4XUDA 4J0IA 2A79B 2FFAA 3MERA 1CJBA 2G9IA 3NANA 4NABA 5E2IA 3UHPA 3QEKA 3AJEA 2BGTA 4KFRA 1F23A 1UKYA 2IBMA 4DXDA 3B38A 1L4GA 3KZKA 2PQ2A 2ODMA 3KLMX 4N7MA 2IXTA 2ZT7A 1BGYH 4BZPA 3A31A 3L6OO 5IMSA 4G0WA 1SO8A 3AVVA 2AQHA 2W2NA 1OT3A 2PNFA 2RGXA 3CRVA 4C6TB 4MAAA 3W2HA 4MUIA 1TADA 3NP7A 2F59A 1YVEI 3RAGA 1RI2A 1DEAA 3AB3A 5ALNA 4GG1A 1XMIA 3DLCA 3U4QA 2FUNB 1G6OA 1N6IA 3ST7A 5AUOB 3IKLA 3H1EA 1GPWB 1VIDA 1W0KA 2HJGA 2OV1A 1C9EA 4UHEA 3E84A 4WH0A 4S1PA 3CZPA 4O02B 5EVCA 2F3PA 2F1IA 2WFLA 1QTRA 3LBHA 2I3AA 2V7TA 4DREA 3OIVA 2V9YA 3EGWA 1MOPA 3SLGA 4NCHA 4OQPA 3V2IA 4B2YA 1K8AW 5KYVA 4YAUA 2VBIA 4CXMA 2NXWA 3VVLA 2YUTA 1MO3A 3X44A 1SVOA 1UC8A 1H2LA 5KVAA 4DZRA 3L6CA 5DK4A 1KFCB 2I4OA 3ET5A 1DADA 1SD2A 4JLSA 2ST1A 1JJFA 3O9MA 4Y30A 4YRPA 3SJAA 3T4EA 3UCFA 2PCJA 4YHBA 3X1KA 2HJWA 1I1NA 1OCOB 2HU8A 2RAPA 2Z43A 1P4SA 3GEIA 4BCDA 4CL8A 1LFDB 1SZJG 4GXRA 5CFLA 5IAOA 2D3WA 4G09A 4R84A 4IV5A 3KSDO 4B9AA 1CEXA 1QVGU 1AGYA 1GNLA 1R0BA 4K87A 4PTYA 3H13A 3N8KA 3HCPA 5JASA 3AW8A 1ZN8A 5DXAA 5C9ZA 3T9CA 4MUMA 3BWVA 1JEEA 1Z16A 1H2MA 1Z7GA 2OD7A 4G8DA 5LA6F 2BTUA 5G4KA 4P3NA 3R6TA 4K8OA 2FMHA 2VPIA 1PNMA 4LY3A 3MXOA 3UW1A 2IHVA 1TKRA 3EEBA 3WGGA 1NXTA 3D2BA 4OQFA 4WASA 2VQSA 4D3DA 2YC2C 1TC1A 2QZSA 1EGAA 2P77A 3R5TA 1K68A 4Q3BA 5K3EA 2Z8YM 4BIMA 2FPIB 2YEVA 4P3PA 2P91A 3GYBA 2QEXF 3KPVA 3O38A 5GTIZ 3OQHA 3WLRA 1G7SA 4D9BA 5KX5F 2C4MA 3ZJZA 3BBPA 4FZ1A 2DYYA 1FRNA 4FX5A 4L1KA 3U1BA 1JPUA 5K1PA 1H5UA 1X2BA 4ER0A 5HIMA 3GP8A 1FSSA 1NW3A 3EZLA 4TLMB 2AFIA 3QWFA 3ROTA 2L35A 3GAAA 2TMDA 3G9TA 3RUAA 2BCEA 2QG4A 1HFKA 4G85A 5F3RA 2Y1FA 4Q5IA 4YRKA 1XQXA 2H1VA 1VL1A 1RQXA 1IHXA 2A4KA 4QUAA 4UHJA 4PCVA 1LSSA 3OLWA 2QDOA 5CGQB 3T5BA 5B7QA 2XRFA 3EGIA 5DTJA 1L9KA 1MMFB 1N2HA 3VISA 4Q82A 1NG9A 3JTEA 3ESYA 1PGJA 2B99A 1YRBA 1GT6A 4GXNA 1FNCA 4I3HA 4JJEA 5A4KA 3E05A 3GJ0A 4OM7A 3M4XA 5FFFA 3NIBA 1Y7LA 2UUPA 1P75A 3KCNA 3OEHA 2G76A 1PT5A 1EB9A 1ORHA 2GUWA 3FUCA 3OLYA 3U4AA 1R9NA 1PIWA 3M7MX 3K3PA 2GKOA 4ZC1A 1CF2O 2D5BA 2GDSA 2V3WA 2QN6A 4NNPA 3OOWA 4QG3A 5B8FA 4YMUA 2PBRA 3VMMA 3NGLA 1ZJWA 3AJAA 4HN2A 2UXDO 4MO2A 3VX3A 4F86A 2O8DA 4IMPA 1XJ5A 5REQB 1F20A 4QOJA 4DUGD 3T61A 3DNMA 4XPIB 1LQUA 4J7AA 3V7EA 1ISJA 4KYUA 3I2JA 2J3HA 2XD4A 4CH3A 5IT0A 2P62A 1WS6A 1QTIA 2C83A 3ASVA 4RD4A 1VIYA 2ZE8A 3C5CA 1SOUA 5AIAA 4BB0A 3SYOA 1GFSA 3WXMB 3H8JA 2JKYA 2UZ4A 4OQEA 2AKEA 1PQWA 5FX2A 4IJWA 4FE4A 4W9NC 1YJ8A 1MV5A 2PX0A 4IDBA 3DOEA 5GJBA 1UAYA 2P4VA 4HZ3A 3ZD9A 2V8OA 1IV3A 3OW2F 2GPWA 5KJCA 3FTEA 4DADA 1YZVA 5JBIA 1SD1A 4L5JA 4W9NA 4F6CA 3VA7A 3D6AA 3RVQA 1KI4A 3I01M 2AHYA 3IB6A 4R8VA 5FPYA 4Z5XA 3FSGA 5BSGA 4C6RA 4EVIA 1MGOA 4BECA 2QSJA 2Y1CA 5K4AA 1QHGA 1HNZB 4PC3A 4QD3A 3GLIB 3R3YA 3GIDA 4P80A 4PSCA 4Q7KA 3VHLB 5LPNA 2EL9A 3N0WA 2DQ0A 3UCSC 4FMPA 4YONB 1AX9A 2FJUA 5ALVA 8AT1A 2BJWA 1E60A 4LJ7A 1UOQA 2QL6A 2GBIA 2Z1TA 4IFIA 5AKXA 2OXRA 4UARA 5E2AA 3KT3A 3R3WA 4N8DA 3U16A 3WK7A 1WHSB 3HO6A 4BFCA 1L0LH 4OXIA 1NF9A 1UWKA 1JR4A 1ZSPA 1C81A 3KB1A 5G40A 3C3SA 2OYSA 1SQ6A 4NMHA 4RZIA 5AMXA 4E07A 3GRKA 5J4VA 5K8JB 1YBFA 2D74A 2J7PA 2KTVA 5EY5B 5FD8A 1FXUA 3WGQA 1FNNA 3Q7QA 4D0RA 4AG3A 3AYZB 2ACWA 3OTOO 3I5UA 4GM4A 5F9MA 4C30A 2GR9A 4UC0A 3ETCA 3RUEA 2J3KA 1XB2A 5ITZB 2QR3A 3T9DA 3KXLA 2ORIA 3QIAA 2GYYA 4F5YA 2CWWA 2X1VA 3QVUA 4DDTA 4ZQIA 2Y4OA 3U3MA 3UQZA 2OE2A 3HFSA 5IJWA 2WU0A 2WG1A 3CO5A 1F06A 4FFSA 3IP9A 1OREA 4M1MA 5ALGA 3QVVA 4M6WA 2WAOA 1VEWA 3ESZA 3BT7A 2QZPA 1VC2A 3OOSA 1GZ5A 4PTZA 2CLIB 4EY6A 4YHHO 5BWMA 4MV5A 2AXNA 3PEFA 5GIOE 4RTRA 2JA1A 3O91A 2Z56A 1ZGZA 2ECQA 2HUNA 3CCMV 4EZBA 5EZ5A 2GEBA 1XV5A 4PFJA 5EHIA 3UXEA 2Z5UA 3HKDB 5KSWB 5EE3A 1K33A 3K5IA 2VPZA 1OV6A 3QUAA 3AEIA 1Z2EA 1B2RA 4DV2O 3L18A 3VHRA 5FBWB 4DIUA 3DR3A 3GD7A 2FWMX 5F12A 3K5HA 4CBVA 3FB7C 4CEHB 1TA4A 5FQNA 2ZCUA 2EX4A 5EE9A 3IBSA 4O4LB 3IPLA 1TUBA 1L7BA 4D43A 5K9ZA 5ISMA 2DXIA 2UUBB 2R1VB 4IKOA 5EJAA 2J45A 1E2LA 4CLOA 3DULA 4NYJQ 3WA7A 2XUHA 4FDUA 2O59A 4M37A 4F7DA 1T8UA 5JANA 4TROA 5BRJA 2OV2A 4OI2A 2N74A 1GNVA 3L7YA 4U2GA 3FCAA 3BHPA 2GPSA 3HB5X 2PKCA 4YRTA 3S2FA 5IK2D 1NQAO 4IIJA 4ER6A 2G70A 2GPAA 3IAUA 2I67A 2ZSHA 3KLOA 1E4EA 1N6NA 2ZUBA 2BSQA 5KX5A 1P8AA 2RI1A 2VTBA 4NU5A 2AQKA 4AXXA 4WFHA 1YJCA 3DL2A 1TGOA 2GH1A 4N48A 2M7WA 1NKSA 3KKEA 3BWXA 5LGNA 4KLCA 5SYMA 1JRLA 5EPEA 4JGBA 1BH2A 1U28C 2Y71A 3V4LA 3OBIA 4YRNA 4LF8B 3STLC 4XDZA 3I34X 3PSHA 2WA2A 3IIEA 4LHWA 3ABIA 2CJPA 2VS1A 2WM3A 2IYOA 2XMCA 121PA 1A9SA 2ZPAA 4CV3A 4LECA 4EECA 2C5FA 4YCLA 5TISZ 3WBFA 1RSOB 4EA7A 3IT2A 4Q39A 2G8NA 1ESDA 5GPBA 2F3RA 1BS3A 2C31A 2W58A 3BFPA 3C5WP 3ANMA 4OBEA 1A1VA 1A8SA 4IUCS 1LNZA 5TC4A 2GBOA 5H6QA 1BCSA 3IPCA 1G8GA 3LW8A 3O82A 4XIGS 3DTYA 5CVVA 4RHXA 4UBOA 3VZRA 4TYNA 3FNIA 3RA6A 2X22A 2NP6A 3BWCA 4WSOA 1TGVA 3D02A 1C7IA 1E2GA 1Z45A 2C7GA 3F9IA 2RGRA 2LR0A 1I51A 3C4VA 3RYFB 4E3WA 5KHOC 4I0WB 3ZIUA 1TE2A 3O4IA 4P2BA 4B3TO 4PZAA 5CBHA 2QP4A 3I9V1 2VJAA 5BXZA 2PA3A 3IBYA 5JR3A 1NXWA 5HP4A 2GFHA 1OPRA 5BV2P 1XDWA 4YT8A 1A5BB 1JQ3A 4HCJA 4BQIA 1AKTA 2GVDC 5C7LO 2BTQB 1THTA 3SS8A 3N2YA 2EKLA 1XOUA 4CS3A 5G3YA 2W83A 1JR6A 3T7SA 3N3BC 3S6JA 1V8DA 2X9LA 3HY3A 4J1TC 1OLUB 1BEEA 3QMWA 4NEHB 2EWCA 2ODNA 4NCIA 2GLZA 4RVGA 1Y8CA 1SVKA 4LYEA 4YJHB 1UAAA 3HU5A 4RJJA 5HGJA 1RM4A 3IUMA 3LHSA 4P7GA 4FLZA 1QRDA 3ZOPA 1UADA 2PX8A 2X0FA 2M6RA 2B3TA 1R37A 3W2FA 3ZCQA 2JHCA 5GAJA 2BCCH 3RVZA 1R9JA 3CNLA 3NVAA 3S2YA 4K40A 1UBSB 4MRVA 1R3UA 3EBOA 4FLXA 1Z2GA 1LZLA 4QGPA 2DBZA 1QP8A 2O20A 3K2IA 2A14A 2EZOA 1PD1A 3QPCA 1CXZB 4YS6A 3CPWF 5JXIA 3A2FA 3R44A 2DHQA 1EHCA 4H7EA 1L8OA 1AUPA 1KBOA 2QJTA 1FDSA 1ORDA 1OGYA 5FOVA 1A4UA 2WB2A 5JD4A 1GFIA 1NJGA 4JI6O 1QGDA 3OZDA 4ZREA 2B7BA 4I2VA 1XPUA 3NAGA 5HP8A 4JFAA 5EMKA 2DE0X 3ZE6A 3TUIC 1UBGA 1JA0A 1QFMA 1R5JA 2WFLB 2BUBA 2R47A 3GEDA 5FJJA 5GWXA 5TQ0A 1PR1A 3LMKA 4LZLA 2XUDA 3AWIA 4L8YA 4Y98A 1WZUA 4JL6A 1R2QA 4ZT5A 4BVKA 1Q6ZA 2Q5LA 3GAFA 5HBRA 3QW2A 2EBFX 4ZZ1A 2YXPX 3MJTA 4PQRA 2O2CA 3RBZA 1T3LA 3TFOA 2KB1A 4N0QA 1DWOA 1VPVA 4UAGA 5JAPA 3U3XA 3H1JH 1P80A 2ZKIA 1P1HA 3Q3IA 1L7AA 1GSOA 5K2MA 4L0MA 4H17A 3FROA 3T3HA 3UG6A 5FWXA 4FFDA 4GRAA 4EEXA 3DBHB 1ZI6A 2ZRBA 4GBGA 3KTDA 1EFKA 4L4RA 4DQKA 4J0CA 2OA0A 3UV3A 2L42A 3FYDA 2Z2KA 4PZUA 1H66A 4BTVA 3C43A 4Q4DA 3TBFA 2DYSC 4GP7A 2QA4V 1V95A 2Q5CA 2OT3B 5CXXA 5F76A 3WWOA 1MN6A 1PYOA 2JBAB 5ALXA 4GZ6A 4OMDA 4YRFA 4BVHA 2DCMA 2SHKA 3OZSA 4LFCB 3WI7A 2WU3A 4P34A 1Y8QA 2P2NA 3F71A 1Z18A 1IEXA 3RHTA 1G7RA 3GEHA 3BMXA 3RC2A 5AW4A 2RG1A 4JI7B 3RTGA 4Y7DA 2QPOA 2OILA 4FC6A 2WA4A 4UQPA 3TTYA 1JAIA 4JDPA 1J8QA 4V0ME 4F3KA 4CM4A 1XEXB 2ZI5A 1FFDA 3GRAA 1BX3A 1H6DA 1JSZA 2IF0A 1L7NA 4LJAA 3R6LA 4N5HX 4QPJC 1NVKA 2AF3C 1PGQA 1U0HC 1ZD3A 3V34A 4NS4A 1TLTA 1V71A 3M4NA 4CC6A 4OXSA 3SEQA 1U1IA 2C98A 5JJEB 1B41A 1O0BA 4IH4A 1K4YA 5CFPA 2OGSA 3UJBA 4XDJA 2DFLA 1CPYA 1SKYE 4TZ6A 1YIDA 3WQQA 3GGOA 4P4SB 3D7KA 4TMZA 4DCPA 4KH1A 3ZK9A 3TG8A 3IE1A 5IEBA 4NKGB 1RLOA 2QBYB 1M73E 4UUQA 1DAMA 2UAGA 1L4BA 5D7NA 3P0RA 2W7TA 4UU0A 3HBJA 2YIBA 4E09A 4WKNA 1OQAA 3RIXA 3NKVA 2JATA 4BAUA 3NM6B 1T6XA 2O7QA 2A0LA 4H1UA 3V4VB 2WUFA 5JS6A 1AA6A 1DKPA 2VUHB 2PQ6A 1P9RA 3BAZA 4XDLA 2FMLA 3F98A 1P3DA 1EVQA 1R64A 3EFOA 3N8DA 3NI2A 5EP3A 5FT9A 5B3JA 3RU2A 4L3WA 3GVPA 5LR6A 1FYJA 2H1WA 4MAMA 5C7YA 1Y98A 5JROA 3MWEA 3QX3A 1WB4A 1CIJA 5FBHA 4JV5B 2YZKA 1IZ8A 2DW4A 1XO1A 3CCJV 3J7AR 2Z83A 3D0QA 4Q4JA 1ISMA 3W3AH 4E11A 4BCBA 2GARA 2VCEA 4BKPA 2DB3A 1YK0A 3IODA 2BONA 2Z9BA 3HKBB 2GS9A 3HR7A 3SMQA 3GL9A 1U94A 4CU5A 3RSLA 2L0XA 1Z2AA 4KREA 1HV8A 1YR7A 4PZLA 4FSHA 3VOUA 1YASA 4KO1S 3BXXA 2C57A 5JSYA 1M1KH 5LZ9A 2XTNA 4RIGA 5GM2A 4JB3A 3KOZA 3LUJA 2ERXA 3BWEA 3LQQA 4DRXB 2WSSD 3N5CA 3SPCA 4DUZB 1C7FA 1M74A 3LYAA 4MKIA 4D9KA 3AM4A 2Y1GA 4PG4A 4IWXA 4IXMA 3MTQA 3CEHA 2YWBA 1VPLA 4CEIB 4MPJA 3AHEA 3P26A 4D3YA 2IPAB 3W3ZB 3P2OA 1USWA 1GM8A 3CUVA 4OSEA 5JZBA 5HFMA 5CLQA 3PJFA 1NC3A 5AVKA 2PI4A 1WU8A 2R00A 3E53A 1XPRA 1DKQA 3ZHCA 3MIZA 5FPQA 3MS7A 1EWVA 1Q11A 1RWKA 4IVQA 4XR9A 4HUJA 3R75A 1W1UA 3GWOA 1U3GA 3DE5X 2IFTA 4YEDA 3WB0A 3UT6A 3RC9A 4LNHA 2G06A 3FYIB 1E9CA 4P54A 1G4AE 1T9ZA 3KEGA 3M8KA 3NBKA 5C34B 1HA3A 2EHJA 3JPYA 1N0NA 5BT8A 2Y69C 4F9GA 3AM1A 3DCJA 1COWG 3AL0C 1F4VA 1Q0SA 1JY8A 2XDWA 2HM7A 3PC8A 3B7GA 2QL5A 1X3SA 4KR7A 1A5ZA 1LJ8A 5NLLA 4LDPA 2GO7A 2P3LA 4PLGA 1RFYA 3C74A 4JHLA 3H2SA 2A5LA 2Q62A 4LFBO 1RMQA 2V54A 3CTMA 3NTOA 4XAQA 3FSRA 3GVXA 4TMXA 3SJQC 2V45A 4UNPA 2BT4A 1RPTA 3REGA 1JDPA 4BUCA 1I7PA 1H65A 1K92A 4G8CA 4DV0B 3ROGA 4OD0A 5ECDA 2EGGA 4YO7A 4DUYB 1KO8A 2Q5HA 1USIA 3HP1A 1FOEB 2NW6A 2POQX 3LX6A 1DOZA 4ENQA 3ZRWA 2DT5A 2AH5A 4BT7A 3TW8B 4YP1A 3IEMA 1YU6A 1SETA 1AGRA 3Q3GE 4K8RB 3TI9A 3UMFA 3ZV6A 4Q4LA 1DTWB 3CF2A 1D4OA 3V8PA 3KXKA 4DR5B 3R3JA 4OQXA 4PD4F 4J07A 3VKVA 1VI6A 4PGFA 4YIOA 2IS2A 3HH8A 2J33A 4MRSA 4M0FA 1Y5NA 4DK0A 1S8OA 2DLDA 2CYAA 2AC4A 2F9FA 2QMQA 2JHGA 3I5MA 2CHQA 3LT5A 4DILA 4F04A 3SD7A 3IDAA 2BEJA 2DSTA 4HP8A 2WQ6A 1PZMA 1A7AA 2HA0A 4KQ1A 2HU7A 1QO9A 2WF5A 4AVYA 1SHKA 4BX8A 1ZU5A 2IOYA 4QDZA 3DLBA 4MW5A 3SQOA 3GJ4A 3MOIA 3T41A 3ZEDA 2EDCA 2FWJA 2BI4A 3V48A 1E3LA 2X6TA 4IEEA 5C1OA 4XUGB 1II8A 3WNQA 4EKWA 1EX6A 4N76A 2R96A 3QMPA 3PEUA 4KQIA 4RJLA 1G63A 2MIIA 1E9FA 4JV5O 3D4IA 1NUTA 4CDGA 5KNBA 5B3LA 1Y8ZA 1Y4ZA 2L18A 5EIBC 1GGEA 4HTFA 5LYJA 3CR7A 1N8TA 2G04A 5I7UA 1PW5A 3WHKA 4X8HA 2DYRB 4B44A 3F97A 2FW6A 1ZCJA 2IOFK 4LEIA 4OOEA 4XI9A 2XH8A 1A5TA 2WIGA 2D59A 1E6KA 1LBSA 3DE1X 1J6UA 4WZBA 1RXWA 4K9RA 1YSCA 1ZIYA 2GBFA 4PPFA 2JIDA 4X3PA 3TQQA 3VDNB 3A9WA 3QLUA 3RVDA 4GFDA 4Z4HA 1EFRD 4KLRA 2VT6A 1YK1A 4EHDA 1AQUA 4TZKA 3BRWA 2F8SA 4F12A 4B4UA 1NRIA 2QR5A 1YOVA 2KWIA 1CC1S 2QEQA 1CUUA 3Q87B 4PJ0Z 4IOJA 3COSA 4XVQA 3OKFA 4Z8YA 4G2TA 1KEPA 5EFOA 4ND8A 2JIOA 4DK1A 1I14A 3TMAA 4DBLE 2PKRA 5EXDA 1CNEA 2XY4A 4UV9A 3DHNA 3WWPA 4EENA 1Z4OA 2CVLA 2V6GA 3GUCA 3RVLA 1NS1A 2E37A 3WHLA 2CMHA 2ADOA 5AKKA 3N76A 4OGGA 2PDAA 3IOCA 3FLEA 1LH0A 1RE0A 1IIRA 2AG0A 4KYVA 4ZOAA 3JARB 3I01A 5B3KA 1TUEA 3M33A 2A5GA 3FFXA 5LA6A 4KAXA 7GPBA 1EFAA 3BICA 2BR5A 2V0NA 5DHAA 1N9GA 1U3TA 5EI5A 4EFDA 2AXQA 1DRWA 1IYZA 3I9JA 3IJPA 1M2JA 5F21A 1VE5A 3QM1A 2FOXA 4WECA 1UMBA 3GMSA 4GDMA 5IAKA 3TDKA 4OHCA 3OM9A 1Z35A 3O3NB 4FEEA 1CVRA 4XWWA 5AJVB 5A9RA 4IFTA 1U8CB 1U65A 2VWQA 4ECEA 2XB2A 2E5LB 2BSKA 1JQ5A 4G5HA 3PQ4A 4ZC8A 5BSRA 1VIVA 2E49A 1L5YA 2Q5IA 4IOMA 1V39A 5FTNA 3SR4A 3H1HH 2HWUA 1B0UA 4DV1B 2NVOA 2PWYA 3FOWA 4KUEA 4M9UA 3W8RA 1Y9ZA 5D86A 1BT8A 4LXIA 2BV3A 1ADYA 4KE7A 1EFUA 3AX6A 3LUHA 4G6ZA 3B9BA 3E18A 1HQKA 3H9QA 3EC7A 5FPPA 4JBYA 1OI2A 2H06A 3GJZA 5L3EA 3F0GA 3KJKA 4WEOA 1IAVA 1YI0A 5C0OE 2LXNA 4NDAA 3TIFA 1GQYA 2A3RA 4O5OA 1IV2A 1N92A 6YASA 1KAGA 4LMRA 1QHNA 4Z1MA 5CVCA 1QVRA 1W85B 1K34A 1YWGO 1XJCA 3G23A 1I1OA 4JAVC 4QFDA 1T4DA 2PTMA 3BH6A 3R7DA 5DLPA 3DTNA 2J5XA 3ZYZA 4AS2A 3GLGB 1HW7A 4LF9O 3CVUA 5GJVC 2FWNA 2VSFA 2XCOA 1E6EA 3DA8A 3NHRA 4R81A 3HZZA 4JQOA 5IT9A 4LP8A 1VQNV 4K9MA 3O4RA 1UFYA 4TLCA 4LBEC 3CMMA 3T3MB 3EGDA 4MTLA 3HDHA 3HVRA 2B7LA 1PFWA 3JQ9C 3D00A 1Y5RA 2B25A 3OA2A 5BQFA 3U3OA 4CTKA 1U0EA 2H31A 3BL5A 1R6TA 4HAVA 4JSYA 3E8HA 5LMUB 2H1FA 3PRHA 1PQYA 3Q72A 4GYWA 1NJ1A 3UKMA 3A0UA 4NXNO 1S0UA 3BMQA 3QBEA 2RH4A 2G5GX 4AXBA 2GJAA 3O83A 3SE0A 3I42A 4ALNA 1Q3EA 4E32A 2CSUA 2I54A 4R3UC 1E1YA 2IU4A 2P9HA 3PDHA 2DZDA 1TKBA 4IMIB 5LLSA 4EHAA 4YVFA 2DX7A 4G26A 4UKDA 3BZBA 1GN6A 2EKPA 2A67A 1E3SA 1WD7A 2GYUA 1IQPA 2GJ9A 4L6IA 4RY9A 3Q12A 5E9WA 2JFPA 2A58A 1Z74A 4IUDS 4S05A 2A9QA 2GD2A 4YA6A 3KV1A 2JLCA 2HEIA 2YXNA 4DMKA 3BIXA 5CT5A 2H0AA 4LXGA 4DYHA 5LIPA 1KY2A 1FJHA 5CLIA 5E79Z 3D54A 3TPCA 3NK7A 3TVTA 4ZCTA 1E2EA 4XYEA 2GRAA 5FIUA 5B1YA 3R09A 2HCFA 2PKQO 4TUYF 3SIXA 1FUKA 3G9ZA 3LCUA 4KPEC 1Q44A 2XVMA 1TZCA 1EFDN 2QJFA 1P0QA 2O3RA 3GA7A 4MZXA 1U3LA 4YALA 2JLWA 4MDYA 3KT6A 4BW9A 2R48A 4RVNA 1Z5GA 1PK9A 4Q3CA 1TA9A 2H9IA 2NTNA 4BNKA 1W36D 2FSSA 3CQ9A 2SKDA 3O85A 4BQRA 1L4HA 1HYEA 1BRMA 1OCCC 1PBTA 1U2TA 3I1FA 3OEHD 4DHEA 2WVJA 3TD4A 3J7AU 1T1GA 3FETA 4XRRA 4A0SA 2H4JA 5LQAA 1RA4A 1CN7A 3A6GA 1S5LZ 4IJ5A 3RSOA 4JZ2A 3HCRA 5KA5A 5C81A 4CR8A 4B2PA 4MICA 1YRLA 1Z8HA 1S0VA 1CQPA 2C3YA 2Q73A 4RETA 4DC9A 2WAMA 1C8VB 3WLLA 1FE8A 3GQBB 4OVKA 4FR5A 3DXFA 3N2NA 2PRZA 3T5DA 3IHLA 5T4FA 1IY9A 1R3KC 1E2PA 2CUKA 2WIBA 3O93A 1ZGJA 3AETA 2IYFA 3HLTA 4I7EA 3GEBA 4Z7OB 1QNLA 4KNWA 4G4XA 4TL6A 4MVJA 3WV4A 1D04A 3MC1A 5TARA 1XZFA 5LA6B 3G2PA 3FD6A 5HDQA 5AM1A 1IRXA 1KHTA 2QROA 1ACMA 1H94A 2JW5A 3OT7A 2QA4F 1EWYA 1I13A 4KVZA 3C85A 1N2GA 1KKCA 1UXHA 3SIPA 1XZDA 1UJ2A 3AW9A 1M2FA 1OUMA 1AC5A 2BGKA 3O8LA 1MNGA 4M0PA 5FPSA 3QKTA 1PDVA 3P52A 3PF9A 4R83A 5GAPK 2QPTA 3AFNA 2AZMA 3FVTA 4YMWA 3DTVA 1FXKC 2BMEA 4ZJUA 4IM7A 2A57A 1VQ4V 4MW0A 5JWOA 4NOKA 3ZWWA 2FK7A 3K9HA 5K2OA 2PZBA 3DMRA 3HJAA 3PFHA 4G07A 1N7HA 3TW4A 4D5EA 1T2FA 1OVMA 4GOND 4JUCA 4U1RA 1MORA 4YAOA 5ADUS 3O74A 3HR8A 4EB6A 4ZO6A 5ICMA 4DGSA 5JAOA 1KC8H 1PZHA 2NXCA 5IBPA 3K8QA 5IUJC 1WBDA 2I6UA 3QNWA 2VHZA 3ZO8A 2WWWA 1Z2DA 1HEUA 1BKDR 1AP5A 2GT1A 2JAHA 2VK2A 2WIAA 4OP1A 2UXXA 3V6MA 2ZVQX 4RHYA 4UTZA 3K0GA 5KHIA 1PZEA 5DLDA 3BHJA 3ROFA 1PFUA 5HQ3A 1N3IA 2PT9A 2ZM5A 1JMYA 3IJ4A 1Y5MA 1NT4A 1Z0IA 2WWIA 1N6RA 2YHUA 1X42A 3DZ8A 4KZKA 3RVRA 4C4AA 2D6FA 1CVLA 4HWTA 1ZM7A 3PX2A 1M6VB 1RD4A 1PQUA 5FTWA 3H5IA 1WW3A 3D6JA 1XRSB 1HPLA 2BDEA 1YJBA 3TOZA 2J0UB 2BKEA 2UVQA 3O1LA 3NO4A 3KWMA 1ZO8A 4NMWA 2LD4A 1I30A 4FYMA 3LO8A 1NHGA 4QUGA 2I34A 1OLXB 3B8MA 2V97A 4Y1RA 1WMFA 4FSXA 3K0EA 2ZAUA 2WT4A 1V8ZA 2UUAO 3EXEA 3IAEA 4EPYA 3TTXA 2DFKB 1SZQA 2VZ0A 3COZA 3OZXA 1KAQA 4ZHWA 2YHAA 5G2OA 3DAGA 4LRXA 3TD6A 5A5FA 3IDOA 3SHWA 4B80A 2RCNA 1K8QA 1XDSA 1DCMA 3FNQA 2V9ZA 2YRXA 4I1IA 3PFKA 5KTKA 2XNKA 3ERCA 2WALA 2ANCA 1VKOA 4EI7A 4E31A 4YLYA 4W5NA 5REQA 3FZYA 4D99A 4NJEB 4BNZA 2V9PA 2FRDC 5BNIA 4MIEA 1RVDA 1SXPA 1PAUA 2RGNC 3C97A 1DIAA 2FGKA 1VB5A 2JKVA 1WXWA 1XWWA 4TV8A 4QQ8A 1QQ7A 5EIAA 4GDFA 2XKKA 4XQCA 4IBOA 4CM9A 3CLUC 2VKQA 1TIBA 1Q0UA 4AC9A 5KCZA 4TM7A 4MV4A 3G0BA 4DF3A 1ZRHA 1RABA 1UUFA 4KXQA 1QIKA 4MWCA 1Z28A 3HJFA 4WGFA 5FHQA 5EKXA 1LWOA 4GT1A 1TU3A 1HKUA 3O2NA 5JW6A 3MJHA 3OQVA 2QM0A 2FW7A 1V3UA 2OCKA 4PLFA 2ZRCA 1PG0A 3OZBA 4B3FX 1XCMA 2BFDA 3AFHA 1PN3A 4PN7A 2OWDA 4UNNA 4O4LA 1N0HA 4EYEA 4WZAE 2HZBA 4M22A 2ZM6B 1RXYA 2BOCC 4Y6RA 4UNRA 1RZVA 3AEXA 4PSKA 2JI8A 3PQCA 4OHRA 1M2VB 1NURA 4U4AA 1A4IA 3CKLA 3GI1A 2O19A 2JK5C 1EXWA 4KAAA 3DVAA 4M1OA 5CG1A 3HM9A 3H5VA 3U3JA 4EPWA 3ZN0A 3E5MA 1EZJA 4A8HA 2VWHA 4YAKA 1AVTA 4ISBA 3WRXC 5KSYA 2BFAA 3B1KA 2NSDA 4K3VA 4ZZ2A 5HUQA 1QLEC 1V11A 2H9AA 2I33A 3IQGX 3L1JA 2W2KB 1VE6A 3K70C 2Y4UA 1ABFA 1O95A 2Q21A 4EM6A 5AVRA 4DAEA 5LQSA 1EX7A 1M1YE 1XQ9A 2YHBA 3IJEB 3ZD6A 5I7SA 3OJXA 4Y9RA 4FIPC 4OLFA 3K32A 2PU7A 3CIOA 3D7LA 4F71A 5IN4A 2JHAA 2QVYX 2ZWOA 2V3VA 4MQMA 3WYBA 1RXVA 3VJKA 3OZ7A 5CJJA 4ZP1A 3VJMA 5EERA 3STZC 3BH0A 3TNLA 1YRQA 4MV3A 4R9RA 2VHTA 1O4WA 3HBFA 4EF4A 2UYNB 1RWWA 1P5FA 2WEKA 5AVTA 3QZUA 2X7JA 4EY4A 1SVIA 1XI2A 3F6YA 2QVBA 3FB5C 5EYPB 1WF3A 2P75A 5E6SA 1W6RA 4A5UB 3PQ3A 4RO0A 3CCUF 1IN5A 3SC4A 5K0NA 3F47A 4TS4A 2PUEA 3W4JA 3PQ6A 2QVGA 4H3HB 3L2OB 5AKEA 2JNBA 1JH9A 1N7JA 1WDLA 1RC8A 5FBLB 3MWEB 3S7ZA 3MRTA 5CDGA 3BCSA 1QYRA 5F2NA 4KPGA 4KFTA 3HJTA 4X71A 1MVLA 4IPTA 4PA6A 1NXSA 4ZXPA 5TPZA 2M6LA 1IBSA 3INYA 3KIPA 4NJMB 5G0TA 3TYXA 3EE6A 1XRMA 4HATA 4LJLA 4DMGA 4JZKA 3WDSA 2QTFA 4DJEC 4MRNA 1IJEA 4EHNA 3LFOA 5TPWB 4DMMA 2Z1MA 2FOLA 3Q7RA 5BYAA 5CLFA 1J1IA 1GL7A 2EC5A 3V4DA 1BGVA 1GG9A 2QDKA 3UJ3X 4HY3A 2VZLA 1A2BA 1WUYA 3SXPA 1AKMA 4FGWA 5EAIA 4KXYA 2C4VA 1P7WA 3IIKA 4I8XA 2DR3A 1T3HA 2HSGA 1W5TA 4JVSB 4LXUA 5IC6A 4JOQA 3D8TA 5I4CA 3IKTA 4LPSA 4PHGA 4KVGA 4WLUA 2A78A 5CUQA 2TS1A 3W6UA 2JGKA 2Z1EA 4QEDA 1NF8A 3PFIA 5IARA 4BPRA 2F64A 3I8SA 1F8UA 3LF2A 5LP6A 3TD2A 4TYYA 1UDBA 1BEUB 1UMDA 1GR0A 1FUEA 3NTVA 4X45A 2G40A 1KBQA 1F0PA 2I87A 2EJRA 2HR3A 1GKLA 4R8RA 4DIDA 3OM3B 1G5TA 2IYYA 4NMXB 2LCIA 3DD5A 5T57A 4CN9A 4F96A 5CLJA 4D3FA 3IPAA 2CLFB 4RD6A 3T1QA 4E2WA 3EOAI 4BUZA 1M6HA 3OQOA 1YF2A 3A0RB 2D06A 4UHKA 1RAFA 1DCFA 1FPMA 3KV3O 1V11B 3DGFC 4L7QA 3AHJA 5HILA 5HK8A 5B12A 2REQB 5GIPE 1FRVA 4X95A 1T5SA 1DCKA 4AJ9A 1AJEA 2COUA 2WSBA 3EUEA 3PQDA 3TRIA 3GJTA 3QLVA 4PR0A 2VXCA 3P4XA 4ZOCA 3GUUA 3ILSA 4EEQA 1XD8A 4PG7A 1LBHA 4MYDA 4E7OA 3ZCXA 4LHSA 2QL7A 5H1YA 4GP6A 7AT1A 3ENKA 1P3Y1 1JJOA 3II6X 9LDBA 3OAAG 1IPFA 4QASA 1YJ5A 2L69A 3HA2A 1E0DA 3I0NA 3L05A 1KD1W 5F77A 3T7TA 3PLAE 1KU9A 1KECA 1CSEE 2P90A 4PQYA 4WNAB 3RBAA 3ZDFA 3QWAA 4QUJA 3V2GA 4PPNA 2O1SA 3QY0A 4U5XA 4WZ6A 3UAYA 4N3CA 3RSSA 3NALA 4R1SA 4C21A 2H57A 1NL3A 3N53A 1XXHB 4LI3X 5THQA 3OX2A 4OLHA 1KVTA 5DNUA 1Y4UA 3BC1A 2ZT5A 4XJTA 1BKYA 2VHQA 2EF0A 3VR3D 1Y81A 3LC0A 3CXCU 1Z88A 2C29D 3COYA 1GILA 4N12A 4OJQA 2CNDA 1GPNA 2BHRA 4POOA 5FHRA 1TVMA 1GSIA 1UEJA 1Z6GA 2OV8A 4C7OB 1MR3F 2F43A 2OQVA 3DR5A 4NU8X 4H7PA 2Y93A 1EVLA 4FGKA 3OT1A 4C3OB 2YY5A 2PHNA 3CF4G 3WIDA 2YIDA 1VQPV 4DUGA 4WLEA 2IOFA 4EW6A 1OA0A 4ZOLF 1QLNA 1JIXA 3T7DA 3OIDA 3E82A 4PBSA 1Y6JA 5CIWA 3VSCA 1MB4A 2QWQB 3V2UA 4DN6A 2GHRA 2GMWA 2HPAA 1XCJA 3EY4A 4LRYA 3DXXA 5LDDC 3WPXA 4QSMA 1GM5A 3K9CA 1OCOC 4FPPA 5ITVA 3EX7C 5HZHA 3HCFA 3D8CA 1G3MA 1JJAA 2CXOA 4Q0MA 4RGVA 1X1DA 4TLEA 3L6UA 4TMFA 4BNDB 3DFMA 4UULA 1TTTA 1JU9A 2R62A 2MR6A 4CI9A 5GZ1A 3ACCA 1GCGA 2VZEA 3KT0A 3VKFA 1MRNA 3EWAA 4XA8A 1V8BA 4ZAXA 3GGJA 5IDJA 1OXSC 1VG1A 1K7CA 3WGZA 5AJWA 1VBMA 1F9EA 3QXSA 5HCIA 3RSHA 2HVJC 2F8LA 1JJBA 1FSZA 1LQTA 2Q7DA 1O96B 4BT3A 1EGMB 3AUFA 5A71A 5HY2A 1SPXA 2X19A 3BA1A 3KWLA 4HGYA 3K2BA 4PRZA 4PHHA 2F4NA 4W1QA 2PF4E 1KAHA 2W2PA 1NRJB 4YRMA 5BR8B 3PNBA 4OBXA 4FX2A 3ODPA 5B1BB 4IUYA 4JMPA 4O4HF 3UBMA 3UWOA 3WK4A 3ZX5A 4D9NA 1JPVA 1HYGA 5FAXA 4D4JA 5L95A 4G0VA 2J9GA 3IKJA 2IGBA 3TCXB 3DKKA 4P7JA 2W2KA 1CT9A 3LK6A 2GHTA 4NZPA 4R0NA 3TR5A 1C3LA 4QARA 4YO8A 5J43A 5KHAA 1NASA 1CHNA 3BRCA 2V03A 4LCUC 4JXJA 2Z09A 2HJ9A 3K30A 1TX4B 3FB4A 3K96A 2J0SA 2WZQA 2Q5ZA 1WSBA 2BCGY 2WUDA 2JBHA 1UT8A 1BE3H 3Q3HA 4RL6A 4H6PA 1P2GA 2WILA 2Z5LA 3COVA 4RJIA 5AJZA 5IM4A 5DHRA 3H4MA 2D7CA 4MTXA 1L0NH 1VQ6V 2TSYB 5TR9A 2EOAA 1J21A 1BCSB 4G89A 5FEMA 2XXJA 1MG0A 4LS3A 4GOXA 4K1LA 2OFXA 3K2XA 4RZSA 1CDZA 4QPDA 3ZHZA 2BGUA 2H6EA 4LX0A 5AVSA 1YA8A 3RS2A 1CQXA 1X9GA 1AK1A 2V7UA 1XALA 4HFJA 5K20A 4QPKA 1TLFA 4JK3A 1AKVA 3H8SA 3UOAB 3IQFA 1H7MA 1WP9A 1TMKA 2XQJA 3UO3A 3PQ2A 4GC5A 3AK3A 2GAAA 2XQIA 3AZPA 4M3NA 1EP9A 1JFFB 3PC4A 3ZHYA 3L1UA 1HDZA 1UOPA 4Q00A 3FPCA 2DFTA 3EIXA 4KGDA 2OYQA 2O3QA 3F49S 3JR7A 4HVAA 1JFVA 3GLHE 4IVPA 4DV3O 4W4KA 1D6SA 3LLMA 4X3CA 4ZHQB 2J8ZA 3T34A 3HYRA 3KUXA 3AERA 2XBLA 4J0HA 1NN3A 2G25A 2NO5A 4AKIA 2VRWA 2P7HA 3M8AA 1MC4A 4R9SA 2DOSA 4D6XA 4NWOB 2Q49A 1M90W 3UMSA 2F2TA 1KDOA 1JA8A 2IJGX 3DKIA 1DAGA 3HJHA 3KAPA 4QDJA 4BO7A 4BC1A 4DV5O 1K06A 1SESA 4DDWA 2V6BA 3M3HA 4II2A 2IBTA 3W1EA 1N8RH 4D4GA 1CY8A 2ZJ1A 3B2EA 4MQUA 4DIKA 1WW8A 4OIMA 1DNPA 1SHUX 2VDWA 1VQ5V 3FCXA 4L3OA 1EP2B 4LTNA 3SQLA 1K9MW 4OX9Y 5KYUB 3O4VA 3BRWD 4FJ1A 4PS1A 3AUYA 1CETA 1U2GC 3BB1A 3CUWA 3FM9A 3DE6X 3U61B 2OBYA 3ETGA 2CNLA 3R24A 3HWRA 3O8NA 3LXRA 1ES9A 4L22A 1L7EA 2OV3A 1GWNA 1BOFA 2JFYA 2ZDIA 4WUTA 5JAQA 3HZRA 2LTAA 3UKDA 3V7UA 2I2CA 2V3CC 1T3ZA 3CZAA 3M34A 3UQYS 4YXWA 2WHPA 1K3FA 3UV6A 3T5PA 1CJSA 1CY2A 4JOSA 1T43A 3CT4A 4DR6O 3RFTA 1HZJA 4C8EA 3NKLA 5L6LB 1AGNA 2XYHA 3JASB 2IDZA 4WXPA 1X8JA 5A2QN 3PRJA 3RVKA 3IS3A 3NDIA 2P9QA 4WUVA 1KBZA 1RS0A 1RJFA 1CYDA 1TMOA 1MB9A 2CNWD 2J9ZB 3GA5A 2WLNA 4GPTA 3V7WA 1G21A 4OJTA 4ZV4A 1SZXA 4D02A 3D1LA 2QHXA 1A8PA 1T4CB 1M2OA 1YZNA 2KB0A 2QW0X 2QZZA 1N75A 3JSAA 3R3SA 4G1CA 4QGGA 3BJEA 5GIOC 1ZXLA 2RJNA 1FVXA 1CZRA 3AKCA 3EBPA 4NH0A 4WXHA 1HFWA 3WO1A 4C4OA 5JYBA 1J0XO 3BHNA 3I2FA 1KXJA 2JEUA 1IMOA 3AFIA 2ZR3A 1AM4D 2FZCA 3ESDA 5F1YA 3TZHA 3WLKX 2ODQA 3EZ9A 3BIJA 2XPCA 3HJRA 1S89A 4Q12A 1JNYA 3OZUA 4RFSB 2OXIA 1E5VA 2O0HA 3TVYA 4EO9A 1ZWLA 4LWSA 1FAFA 2ZOVA 2OCPA 3K5WA 2XA2A 4PA9A 3W7AA 1RSOA 2YN2A 1KY4A 1DJLA 2O0LA 3SAJA 3I52A 3D01A 4TTAA 2XHZA 4V0LA 1YB7A 3HN7A 1J0CA 1Q1ZA 4R40B 4G1FA 2WNHA 3K0CA 1DIGA 3MJFA 4MQFA 2E3JA 1JJ7A 4B45A 1NTKH 1D4ZA 3BABA 2LCAA 1G21E 1J2EA 4PI2A 1H2FA 1AUQA 3K71B 3KZVA 3WLNA 2FGJA 2B3DA 2XTMA 3JAMM 2G28A 2JIZA 2WA1A 1F3LA 3LSQA 4TS3A 3MWFA 2VF8A 4B7EA 1AY0A 3V7FA 5H9WA 1ZG3A 2AEEA 2PO5A 2J5QA 1Y8QB 4MINA 4LF8O 4Q6BA 2XMRA 1ONSA 1BVUA 2BFBA 1UXGA 4GO1A 4H15A 4IXDA 5DI3A 2Z98A 1BDHA 4M9QA 3G82C 5LB2A 2QE7D 2X0JA 3FNRA 4QFMA 1ZJYA 3U3RA 1Q3KA 2ZYIA 3DUFA 1YAJA 2FTKE 3KCYA 2I99A 2OHXA 2YIJA 3MVEA 2EYQA 4RV5A 1YL5A 3CRMA 1LVUA 4DS3A 3PUZA 5KZMB 4LHYA 4Q02A 3GARA 2FI1A 1C0EA 1F2UB 1SXHA 4FCTA 5FXMA 2P5YA 4GVLA 3TCUA 3FGOA 4O5AA 2FYTA 1YS7A 1R4NB 4XWOA 1F2UA 2O4UX 2QW8A 2WSYB 1JIVA 1SIUA 1FLVA 2BMJA 3B48A 4HNSA 4A7PA 4D44A 5KJ6A 1L4LA 3ZG6A 2YJ4A 1VI2A 1LGYA 4JI2B 1Z0AA 1XAGA 2Q3DA 5JH7A 7REQB 5IFKA 3PL1A 1YA6A 2Q3BA 3IP1A 3F6RA 4B47A 4MVJM 4MH0R 5DNEA 4YH1A 1JG1A 3MWGA 4OREX 4R7GA 3WJQA 1KAEA 4JI3O 1T24A 2AE1A 2PIAA 4LRQA 1XTRA 4YJDA 5P21A 3KUDA 5SZJA 1BQ4A 1K5SA 2WAXA 1IHYA 4GYYA 5KTNA 4XKJA 5T6MA 3ZX4A 1I0HA 4UB6Z 2R7MA 1EM8A 3FUVA 3MFYA 1ID8A 2WIKA 4AY5A 3G71F 4R40A 3VZPA 3DWGA 5EAZA 1B8VA 1P4RA 2P4QA 2YYSA 2DT8A 2ZR9A 4BTEA 4DLVA 2QRGA 5JXJA 3PGVA 5AG2A 1DL5A 1NR7A 2OO3A 3FPBA 1NXQA 1NOKA 4PW0A 4YAIA 4Q01A 1RYNA 4H08A 3AG2C 4X8AA 4NP6A 1NZDA 4CMGA 5A7HA 5IZCA 3UO2A 1IBCA 5CTAA 1SQVH 4DLZA 5EE1A 5JDCA 1J0BA 2VSQA 3EYAA 4M0LA 1N6OA 4YAEA 3OLQA