3JVHA

Crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 8395
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3jvhA00
1H47A 1KNKA 3K2XA 3F0EA 1VHAA 2UZHA 4C82A 1U40A 1U3PA 1IV4A 2PMPA 3F6MA 1U43A 4C8IA 1W55A 1GX1A 3IKEA 1IV3A 3FBAA 1W57A 3IKFA 3MBMA 3QHDA 4C8GA 1VH8A 3B6NA 3F0GA 1YQNA 3P0ZA 3GHZA 3T80A 1JY8A 2GZLA 1IV1A 3FPIA 1T0AA 1IV2A 3F0FA 5B8FA 3EORA 3P10A 1KNJA 3IEQA 3ERNA 3ELCA 3K14A 1U3LA 3JVHA 3ESJA 3F0DA 1H48A 3KE1A 4C8EA 3Q8HA 2AMTA 3IEWA 4C81A 1JN1A 3RE3A
chains in the Genus database with same CATH superfamily
1W40A 1H47A 3VIUA 3CCVF 1UFYA 1T0KB 1GZ0A 2DYYA 4ZHVA 1VQNF 4I50A 4NQ3A 3M4SA 1W55A 3P0ZA 1TUBB 3JAWB 3V7QA 3VYTC 1R1MA 2B33A 1J7HA 5EWRA 5HP8A 4NWOB 3JAKA 5HY0A 3F0DA 4ZI7B 1KC8H 5JCOA 5JH7A 3WGMA 4M8IA 3JASA 3SIUA 5CA1A 4O4LA 1U40A 2KTUA 2JNBA 4ERHA 4BVQA 2HQSC 3G4SF 1KQSF 3D00A 3IMPA 2ZVYA 3FFMA 3CCJF 5EZYA 5J2TB 2CW4A 5EB0A 1GO1A 1VQKF 4WBNA 2LBXA 3BYQA 2KTVA 1PXWA 4BT7A 1SZQA 3CYPB 5KMGA 2YXZA 5LOVA 2VAPA 4O4LB 3CCLF 2PMPA 1CN7A 4O2BB 3WXMB 4PWTA 3IKEA 5LA6B 4I4TA 2RHJA 3O85A 5FNVA 5CA0A 5JVDA 3IR9A 1Z5VA 3F0FA 3EORA 4LNUA 5EZYB 1M1KH 4KWEA 1QAHA 2W8BC 2ZODA 4WBNB 5BMVA 2ALEA 3K0TA 2BTQB 1W2BF 4BT3A 4TUYA 2AIFA 4E6EA 5IJ0B 1VHAA 3RYIA 5LOVB 3J80M 2CZWA 1QVFF 4U3JB 4DRXA 4C4WC 3HKBA 2LBTA 2QI2A 4I4TB 3M84A 5CA0B 3LWVC 3OBYA 5JVDB 1QU9A 3VCZA 4BT2A 5IJ9A 2IQQA 3E22A 3S02A 3I56F 3OW2F 4XCQA 4X20A 4LNUB 1FNJA 1W5BA 2VGNA 5BMVB 3IEWA 3JALB 2HS0A 1JN1A 3WGNA 2WALA 3HKCB 3VI6A 2RHLA 1YGYA 4ZHYB 5J2UB 3UT5B 3PLAC 4G88A 5AVMA 1FSZA 1W41A 3C8LA 1IV3A 3MBMA 3D54A 1E7KA 1DT9A 5C8YB 1SDSA 3JAWA 1XHOA 2HP3A 4NUTA 1IV2A 4B62A 3ZO8A 5IJ9B 3ERNA 2BTUA 1U3LA 3KHNA 2VGMA 3E1YA 4X20B 3Q8HA 2AMTA 4ZI7A 1Z5WA 3D01A 3JARB 1K9MH 3LYBA 1KNKA 3DC2A 5EYPA 4BT5A 5LP6B 5A2QM 3PAFA 3N4YA 5FLXM 5G4VC 1Q86H 4X1YA 1Q81H 1W57A 3C9SA 3N2KB 2FC3A 3GHZA 2IAFA 1CLIA 1T0AA 2I6RA 3IEQA 5J2TA 3I3FA 3N2GB 3WJQA 2HRUA 3G6EF 1JJ2F 1JFFB 5GIPC 1H48A 1VK3A 1VQPF 1H7MA 3VYUC 3V3TA 3S03A 1TVKA 1OFUA 4IIJB 5GIOC 2N48A 3OONA 5HP7A 1YJWF 5EYPB 3RA6A 2L26A 1X7OA 2ZAUA 3TD3A 2KG4A 4O2BA 5IT9M 2Q1XA 1U43A 3RYFA 2RHOA 5LA6A 3S0HA 4X1YB 3DDNA 4DXDA 5IYZA 2CSLA 2Z1TA 3C9UA 3NVKE 2VAMA 1XBIA 3LFOA 1S72F 1VQ9F 4RQOA 3VMFB 1FFXB 5MN4A 4O2AB 5JCOC 4IHJA 1KD1H 1TVKB 3WGKA 5IJ0A 3RYHB 4X3MA 2ZOVA 3I7TA 2BTOA 3QUWA 4U3JA 3NK7A 1XV2A 4BVTA 3RYFB 3FBAA 4BT6A 1RLGA 5IYZB 3K12A 1RQ2A 1GO0A 5KX5A 1IV1A 3HKDA 3U0OA 3VO8A 4I55A 1YJNF 1W59A 3CC4F 3JALA 5JQGA 3HKCA 4IHJB 3GYQA 3F0EA 4O4JB 2NMUA 3NVIB 3WGLA 3UT5A 3JATB 5J2UA 2RB9A 3HKEB 3CC2F 3MCQA 4TV8B 1SA0A 4X3LA 2EWCA 2RHHA 3MDOA 4HNAA 3CPWF 3F6MA 4G4VA 3ON1A 3CPQA 3WJPA 5CB4A 5HXZA 3IKFA 3I55F 5C8YA 2HS3A 1VH8A 2PHNA 3FPIA 5KX5B 3HKDB 2CHTA 2G9IA 3ESJA 3VOBA 2QA4F 4I55B 1X7PA 3MCAB 2OHWA 3WPWA 3JARA 2CWJA 4U39A 4YJ3A 5JQGB 5EIBC 4O4IA 5LP6A 4X1KA 4F6RA 2ZVZA 3HWUA 1SA0B 4LCKA 4HNAB 5CB4B 3N2KA 5HWEA 3CB2A 3T80A 5GAPK 4BT4A 5B8FA 4B5CA 2CHSA 4G4XA 1KNJA 2Z1FA 3QTYA 3N2GA 3K14A 1VQLF 2HS4A 1JFFA 3CD6F 3KJJA 1W42A 4IIJA 4YJ3B 3K2XA 3S06A 1IPAA 3V4DA 1Q8RA 2R6R1 3NMUC 1CK2A 1OAPA 4O4IB 2IG8A 3VYSC 4X1KB 4F6RB 1YIJF 3FD6A 1GX1A 1NJIH 1VQ6F 5MN6A 1VQVA 1VQ7F 3CCRF 3LWPC 1YQNA 2H8EA 2KGWA 2V9YA 3NK6A 2OTMA 3CCEF 3P10A 4EI8A 1QVGF 4ZOLB 3TD5A 1VQMF 3VTIC 2UYNB 1FFXA 4TV9A 1ZWZA 4O2AA 5EB1B 1COMA 2CVLA 3KJKA 3RYHA 3E20B 1NQ3A 3GTZA 3CG6A 3S0WA 1ONIA 2YYEA 5LYJA 1YI2F 1YITF 5GANK 5DCVA 3CCSF 4G4YA 3F0GA 2UYKA 3ZP4A 1RA4A 2H8CA 1PF5A 3ZOPA 4X1IA 3N4ZA 4ZHQA 3JCMM 4B45A 2F9ZC 1XRGA 3HAXD 1ODEA 1QD9A 3G71F 3WGJA 2OTLF 2K1SA 4TV9B 4B46A 1VQ8F 3CYQA 5EAZA 4O4JA 3J81M 3JATA 3HKEA 2H6LA 4TV8A 5FJ4C 2GLZA 1N8RH 4I50B 5GONA 3RA5A 3C9RA 4R40B 4C8IA 5LYJB 1K73H 2UYJA 3HTNA 3WPXA 3OBWA 3J7AR 3JAKB 1K8AH 3AGKA 4X1IB 1DBFA 5HY4A 4C8EA 4ZHQB 3CMAF 2Z1UA 2DT4A 1NMUB 4ZHWA 1YHQF 3CMEF 3RE3A 3CXCF 5JH7B 3RYCA 2FGYA 3JASB 4EI9A 2UZHA 5CA1B 5ITZA 2LBWA 1M90H 1IV4A 4FFBA 3TD4A 3HJWC 5GONB 2HVYD 2AIZP 4G4ZA 3CCMF 3KIZA 3QHDA 2HX0A 5HXUA 2QEXF 1JY8A 3FD5A 4ZK7A 3ELCA 2R751 4EB6A 5HY1A 2LCAA 4BY9D 4BVRA 2ZF8A 2VAWA 4RHAA 2HRYA 1YJ9F 1X52A 5G4UC 4C8GA 2OTJF 3CCQF 4YJ2A 4TZZA 3RYCB 2GVIA 5KMGB 3MQWA 4C82A 3LWOC 1X25A 3C9TA 5ITZB 1W581 5EIBD 3P4EA 2MQEA 5LXTA 2VXYA 3CC7F 4FFBB 3L7QA 5FNVB 1RLUA 3B6NA 5MN5A 4O4HA 1FNKA 2GZLA 1VQOF 1W3EX 4BW0B 3LWQC 2HP0A 4ZOLA 3SIVA 4EB6B 3R0PA 1Q82H 2UYNA 1W5EA 4C81A 1RQ7A 1Q7YH 4TUYB 1VQ5F 2OZBA 5LP6C 2UYPA 3VOAA 3RYIB 4YJ2B 3CCUF 3S0YA 4G4WA 1U3PA 1UI9A 4BVSA 1JD1A 2Q1YA 4EI7A 1VQ4F 3V7EA 2QTPA 4DRXB 5LXTB 3HKBB 1TUBA 3LWRC 3ZP7A 5EO3A 1W5AA 2Z01A 2BO1A 4O4HB 2P6YA 3E22B 2I6DA 5GINC 1W5FA 3JVHA 5HY2A 3JAMM 2HP0B 3KE1A 3WJRA 2Z1EA 3LDTA 3M1XA 3LMEA
chains in the Genus database with same CATH topology
1H47A 1KNKA 3K2XA 3F0EA 1VHAA 2UZHA 4C82A 1U40A 1U3PA 1IV4A 2PMPA 3F6MA 1U43A 4C8IA 1W55A 1GX1A 3IKEA 1IV3A 3FBAA 1W57A 3IKFA 3MBMA 3QHDA 4C8GA 1VH8A 3B6NA 3F0GA 1YQNA 3P0ZA 3GHZA 3T80A 1JY8A 2GZLA 1IV1A 3FPIA 1T0AA 1IV2A 3F0FA 5B8FA 3EORA 3P10A 1KNJA 3IEQA 3ERNA 3ELCA 3K14A 1U3LA 3JVHA 3ESJA 3F0DA 1H48A 3KE1A 4C8EA 3Q8HA 2AMTA 3IEWA 4C81A 1JN1A 3RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H47 A;  1KNK A;  3K2X A;  3F0E A;  1VHA A;  2UZH A;  4C82 A;  1U40 A;  1U3P A;  1IV4 A;  2PMP A;  3F6M A;  1U43 A;  4C8I A;  1W55 A;  1GX1 A;  3IKE A;  1IV3 A;  3FBA A;  1W57 A;  3IKF A;  3MBM A;  3QHD A;  4C8G A;  1VH8 A;  3B6N A;  3F0G A;  1YQN A;  3P0Z A;  3GHZ A;  3T80 A;  1JY8 A;  2GZL A;  1IV1 A;  3FPI A;  1T0A A;  1IV2 A;  3F0F A;  5B8F A;  3EOR A;  3P10 A;  1KNJ A;  3IEQ A;  3ERN A;  3ELC A;  3K14 A;  1U3L A;  3JVH A;  3ESJ A;  3F0D A;  1H48 A;  3KE1 A;  4C8E A;  3Q8H A;  2AMT A;  3IEW A;  4C81 A;  1JN1 A;  3RE3 A; 
#chains in the Genus database with same CATH topology
 1W40 A;  1H47 A;  3VIU A;  3CCV F;  1UFY A;  1T0K B;  1GZ0 A;  2DYY A;  4ZHV A;  1VQN F;  4I50 A;  4NQ3 A;  3M4S A;  1W55 A;  3P0Z A;  1TUB B;  3JAW B;  3V7Q A;  3VYT C;  1R1M A;  2B33 A;  1J7H A;  5EWR A;  5HP8 A;  4NWO B;  3JAK A;  5HY0 A;  3F0D A;  4ZI7 B;  1KC8 H;  5JCO A;  5JH7 A;  3WGM A;  4M8I A;  3JAS A;  3SIU A;  5CA1 A;  4O4L A;  1U40 A;  2KTU A;  2JNB A;  4ERH A;  4BVQ A;  2HQS C;  3G4S F;  1KQS F;  3D00 A;  3IMP A;  2ZVY A;  3FFM A;  3CCJ F;  5EZY A;  5J2T B;  2CW4 A;  5EB0 A;  1GO1 A;  1VQK F;  4WBN A;  2LBX A;  3BYQ A;  2KTV A;  1PXW A;  4BT7 A;  1SZQ A;  3CYP B;  5KMG A;  2YXZ A;  5LOV A;  2VAP A;  4O4L B;  3CCL F;  2PMP A;  1CN7 A;  4O2B B;  3WXM B;  4PWT A;  3IKE A;  5LA6 B;  4I4T A;  2RHJ A;  3O85 A;  5FNV A;  5CA0 A;  5JVD A;  3IR9 A;  1Z5V A;  3F0F A;  3EOR A;  4LNU A;  5EZY B;  1M1K H;  4KWE A;  1QAH A;  2W8B C;  2ZOD A;  4WBN B;  5BMV A;  2ALE A;  3K0T A;  2BTQ B;  1W2B F;  4BT3 A;  4TUY A;  2AIF A;  4E6E A;  5IJ0 B;  1VHA A;  3RYI A;  5LOV B;  3J80 M;  2CZW A;  1QVF F;  4U3J B;  4DRX A;  4C4W C;  3HKB A;  2LBT A;  2QI2 A;  4I4T B;  3M84 A;  5CA0 B;  3LWV C;  3OBY A;  5JVD B;  1QU9 A;  3VCZ A;  4BT2 A;  5IJ9 A;  2IQQ A;  3E22 A;  3S02 A;  3I56 F;  3OW2 F;  4XCQ A;  4X20 A;  4LNU B;  1FNJ A;  1W5B A;  2VGN A;  5BMV B;  3IEW A;  3JAL B;  2HS0 A;  1JN1 A;  3WGN A;  2WAL A;  3HKC B;  3VI6 A;  2RHL A;  1YGY A;  4ZHY B;  5J2U B;  3UT5 B;  3PLA C;  4G88 A;  5AVM A;  1FSZ A;  1W41 A;  3C8L A;  1IV3 A;  3MBM A;  3D54 A;  1E7K A;  1DT9 A;  5C8Y B;  1SDS A;  3JAW A;  1XHO A;  2HP3 A;  4NUT A;  1IV2 A;  4B62 A;  3ZO8 A;  5IJ9 B;  3ERN A;  2BTU A;  1U3L A;  3KHN A;  2VGM A;  3E1Y A;  4X20 B;  3Q8H A;  2AMT A;  4ZI7 A;  1Z5W A;  3D01 A;  3JAR B;  1K9M H;  3LYB A;  1KNK A;  3DC2 A;  5EYP A;  4BT5 A;  5LP6 B;  5A2Q M;  3PAF A;  3N4Y A;  5FLX M;  5G4V C;  1Q86 H;  4X1Y A;  1Q81 H;  1W57 A;  3C9S A;  3N2K B;  2FC3 A;  3GHZ A;  2IAF A;  1CLI A;  1T0A A;  2I6R A;  3IEQ A;  5J2T A;  3I3F A;  3N2G B;  3WJQ A;  2HRU A;  3G6E F;  1JJ2 F;  1JFF B;  5GIP C;  1H48 A;  1VK3 A;  1VQP F;  1H7M A;  3VYU C;  3V3T A;  3S03 A;  1TVK A;  1OFU A;  4IIJ B;  5GIO C;  2N48 A;  3OON A;  5HP7 A;  1YJW F;  5EYP B;  3RA6 A;  2L26 A;  1X7O A;  2ZAU A;  3TD3 A;  2KG4 A;  4O2B A;  5IT9 M;  2Q1X A;  1U43 A;  3RYF A;  2RHO A;  5LA6 A;  3S0H A;  4X1Y B;  3DDN A;  4DXD A;  5IYZ A;  2CSL A;  2Z1T A;  3C9U A;  3NVK E;  2VAM A;  1XBI A;  3LFO A;  1S72 F;  1VQ9 F;  4RQO A;  3VMF B;  1FFX B;  5MN4 A;  4O2A B;  5JCO C;  4IHJ A;  1KD1 H;  1TVK B;  3WGK A;  5IJ0 A;  3RYH B;  4X3M A;  2ZOV A;  3I7T A;  2BTO A;  3QUW A;  4U3J A;  3NK7 A;  1XV2 A;  4BVT A;  3RYF B;  3FBA A;  4BT6 A;  1RLG A;  5IYZ B;  3K12 A;  1RQ2 A;  1GO0 A;  5KX5 A;  1IV1 A;  3HKD A;  3U0O A;  3VO8 A;  4I55 A;  1YJN F;  1W59 A;  3CC4 F;  3JAL A;  5JQG A;  3HKC A;  4IHJ B;  3GYQ A;  3F0E A;  4O4J B;  2NMU A;  3NVI B;  3WGL A;  3UT5 A;  3JAT B;  5J2U A;  2RB9 A;  3HKE B;  3CC2 F;  3MCQ A;  4TV8 B;  1SA0 A;  4X3L A;  2EWC A;  2RHH A;  3MDO A;  4HNA A;  3CPW F;  3F6M A;  4G4V A;  3ON1 A;  3CPQ A;  3WJP A;  5CB4 A;  5HXZ A;  3IKF A;  3I55 F;  5C8Y A;  2HS3 A;  1VH8 A;  2PHN A;  3FPI A;  5KX5 B;  3HKD B;  2CHT A;  2G9I A;  3ESJ A;  3VOB A;  2QA4 F;  4I55 B;  1X7P A;  3MCA B;  2OHW A;  3WPW A;  3JAR A;  2CWJ A;  4U39 A;  4YJ3 A;  5JQG B;  5EIB C;  4O4I A;  5LP6 A;  4X1K A;  4F6R A;  2ZVZ A;  3HWU A;  1SA0 B;  4LCK A;  4HNA B;  5CB4 B;  3N2K A;  5HWE A;  3CB2 A;  3T80 A;  5GAP K;  4BT4 A;  5B8F A;  4B5C A;  2CHS A;  4G4X A;  1KNJ A;  2Z1F A;  3QTY A;  3N2G A;  3K14 A;  1VQL F;  2HS4 A;  1JFF A;  3CD6 F;  3KJJ A;  1W42 A;  4IIJ A;  4YJ3 B;  3K2X A;  3S06 A;  1IPA A;  3V4D A;  1Q8R A;  2R6R 1;  3NMU C;  1CK2 A;  1OAP A;  4O4I B;  2IG8 A;  3VYS C;  4X1K B;  4F6R B;  1YIJ F;  3FD6 A;  1GX1 A;  1NJI H;  1VQ6 F;  5MN6 A;  1VQV A;  1VQ7 F;  3CCR F;  3LWP C;  1YQN A;  2H8E A;  2KGW A;  2V9Y A;  3NK6 A;  2OTM A;  3CCE F;  3P10 A;  4EI8 A;  1QVG F;  4ZOL B;  3TD5 A;  1VQM F;  3VTI C;  2UYN B;  1FFX A;  4TV9 A;  1ZWZ A;  4O2A A;  5EB1 B;  1COM A;  2CVL A;  3KJK A;  3RYH A;  3E20 B;  1NQ3 A;  3GTZ A;  3CG6 A;  3S0W A;  1ONI A;  2YYE A;  5LYJ A;  1YI2 F;  1YIT F;  5GAN K;  5DCV A;  3CCS F;  4G4Y A;  3F0G A;  2UYK A;  3ZP4 A;  1RA4 A;  2H8C A;  1PF5 A;  3ZOP A;  4X1I A;  3N4Z A;  4ZHQ A;  3JCM M;  4B45 A;  2F9Z C;  1XRG A;  3HAX D;  1ODE A;  1QD9 A;  3G71 F;  3WGJ A;  2OTL F;  2K1S A;  4TV9 B;  4B46 A;  1VQ8 F;  3CYQ A;  5EAZ A;  4O4J A;  3J81 M;  3JAT A;  3HKE A;  2H6L A;  4TV8 A;  5FJ4 C;  2GLZ A;  1N8R H;  4I50 B;  5GON A;  3RA5 A;  3C9R A;  4R40 B;  4C8I A;  5LYJ B;  1K73 H;  2UYJ A;  3HTN A;  3WPX A;  3OBW A;  3J7A R;  3JAK B;  1K8A H;  3AGK A;  4X1I B;  1DBF A;  5HY4 A;  4C8E A;  4ZHQ B;  3CMA F;  2Z1U A;  2DT4 A;  1NMU B;  4ZHW A;  1YHQ F;  3CME F;  3RE3 A;  3CXC F;  5JH7 B;  3RYC A;  2FGY A;  3JAS B;  4EI9 A;  2UZH A;  5CA1 B;  5ITZ A;  2LBW A;  1M90 H;  1IV4 A;  4FFB A;  3TD4 A;  3HJW C;  5GON B;  2HVY D;  2AIZ P;  4G4Z A;  3CCM F;  3KIZ A;  3QHD A;  2HX0 A;  5HXU A;  2QEX F;  1JY8 A;  3FD5 A;  4ZK7 A;  3ELC A;  2R75 1;  4EB6 A;  5HY1 A;  2LCA A;  4BY9 D;  4BVR A;  2ZF8 A;  2VAW A;  4RHA A;  2HRY A;  1YJ9 F;  1X52 A;  5G4U C;  4C8G A;  2OTJ F;  3CCQ F;  4YJ2 A;  4TZZ A;  3RYC B;  2GVI A;  5KMG B;  3MQW A;  4C82 A;  3LWO C;  1X25 A;  3C9T A;  5ITZ B;  1W58 1;  5EIB D;  3P4E A;  2MQE A;  5LXT A;  2VXY A;  3CC7 F;  4FFB B;  3L7Q A;  5FNV B;  1RLU A;  3B6N A;  5MN5 A;  4O4H A;  1FNK A;  2GZL A;  1VQO F;  1W3E X;  4BW0 B;  3LWQ C;  2HP0 A;  4ZOL A;  3SIV A;  4EB6 B;  3R0P A;  1Q82 H;  2UYN A;  1W5E A;  4C81 A;  1RQ7 A;  1Q7Y H;  4TUY B;  1VQ5 F;  2OZB A;  5LP6 C;  2UYP A;  3VOA A;  3RYI B;  4YJ2 B;  3CCU F;  3S0Y A;  4G4W A;  1U3P A;  1UI9 A;  4BVS A;  1JD1 A;  2Q1Y A;  4EI7 A;  1VQ4 F;  3V7E A;  2QTP A;  4DRX B;  5LXT B;  3HKB B;  1TUB A;  3LWR C;  3ZP7 A;  5EO3 A;  1W5A A;  2Z01 A;  2BO1 A;  4O4H B;  2P6Y A;  3E22 B;  2I6D A;  5GIN C;  1W5F A;  3JVH A;  5HY2 A;  3JAM M;  2HP0 B;  3KE1 A;  3WJR A;  2Z1E A;  3LDT A;  3M1X A;  3LME A; 
#chains in the Genus database with same CATH homology
 1H47 A;  1KNK A;  3K2X A;  3F0E A;  1VHA A;  2UZH A;  4C82 A;  1U40 A;  1U3P A;  1IV4 A;  2PMP A;  3F6M A;  1U43 A;  4C8I A;  1W55 A;  1GX1 A;  3IKE A;  1IV3 A;  3FBA A;  1W57 A;  3IKF A;  3MBM A;  3QHD A;  4C8G A;  1VH8 A;  3B6N A;  3F0G A;  1YQN A;  3P0Z A;  3GHZ A;  3T80 A;  1JY8 A;  2GZL A;  1IV1 A;  3FPI A;  1T0A A;  1IV2 A;  3F0F A;  5B8F A;  3EOR A;  3P10 A;  1KNJ A;  3IEQ A;  3ERN A;  3ELC A;  3K14 A;  1U3L A;  3JVH A;  3ESJ A;  3F0D A;  1H48 A;  3KE1 A;  4C8E A;  3Q8H A;  2AMT A;  3IEW A;  4C81 A;  1JN1 A;  3RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...