3JVHA

Crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 8395
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3jvhA00
5B8FA 2AMTA 1IV3A 3Q8HA 2UZHA 3P0ZA 3ESJA 1VH8A 3KE1A 3ERNA 3ELCA 1IV2A 4C81A 2GZLA 1T0AA 3FPIA 1U3LA 4C8GA 3IEWA 3F6MA 1W57A 3P10A 1U40A 3F0GA 3B6NA 1YQNA 3RE3A 3EORA 3IKEA 1JY8A 1KNKA 1U43A 1KNJA 1IV1A 3F0EA 3F0DA 3T80A 4C8EA 3K2XA 3MBMA 1IV4A 3QHDA 4C8IA 4C82A 3GHZA 1GX1A 3F0FA 3JVHA 3K14A 1W55A 1U3PA 1JN1A 1H47A 2PMPA 3IKFA 3IEQA 3FBAA 1VHAA 1H48A
chains in the Genus database with same CATH superfamily
1Q81H 3HKCB 4O2BB 2R751 3G71F 5ITZA 3NK7A 2H8CA 4I50A 3WXMB 2GZLA 4C8GA 3ZO8A 1U43A 3LWRC 3WGKA 3F0EA 3C9UA 1K9MH 2UYKA 3PLAC 4C4WC 4ERHA 3G6EF 3NVKE 3GHZA 4WBNA 5G4VC 3CMEF 3N2GB 3LMEA 3DDNA 4O4HA 2HVYD 1J7HA 3IEQA 2I6RA 3ON1A 1W2BF 5J2TA 5C8YB 1TVKA 3NK6A 1IV2A 1T0AA 1YITF 2B33A 2QI2A 1E7KA 2CHSA 5G4UC 3E22B 4O4IA 3MCAB 4X20B 5GONA 3WGMA 5KX5A 3C9RA 1S72F 5IJ9B 5HY2A 3HKBB 3V7QA 5JVDA 3D00A 2CHTA 3ZP4A 1W55A 1M1KH 1H47A 2YXZA 4X3MA 3FFMA 2BTUA 4ZHWA 1N8RH 2N48A 3S02A 3QUWA 3SIUA 2W8BC 4ZI7A 5JCOA 1VQPF 3TD5A 2UYNB 1Q86H 5JQGA 1QVFF 3FPIA 5HWEA 1VQVA 5CA1A 1W5EA 4O4JB 4BT5A 4ZHYB 2ZVYA 1Q8RA 3S0HA 3JARA 2OTMA 3RE3A 4EB6A 3JALB 4G4VA 1Q7YH 2P6YA 1FNKA 1JY8A 2FC3A 1YHQF 1VQOF 1XV2A 3BYQA 3RYHB 2CZWA 3JAKB 3K14A 4G4WA 4EI7A 1DBFA 3JASA 2KTVA 5HY4A 1QAHA 4O4HB 1Z5VA 1W5FA 5JH7A 3SIVA 1SA0B 5EIBD 1COMA 1TVKB 2L26A 5EYPB 4TV8A 3F6MA 2K1SA 3E1YA 4LCKA 2LBTA 4X1IB 3RYCA 1YJ9F 1YJWF 3V7EA 4M8IA 3CCEF 5KX5B 4B5CA 5GONB 2QEXF 3CPQA 1XRGA 2BTQB 3OW2F 5JVDB 1CN7A 3CCQF 4G4ZA 5CA0A 3AGKA 3JAWA 5FNVA 1SDSA 4I4TB 2OTLF 2Q1YA 4F6RA 1VK3A 2JNBA 2VAWA 2Z1FA 4BVSA 2FGYA 3CG6A 3N2KB 1VQ7F 5EZYB 4BY9D 3F0GA 4HNAB 3B6NA 4TV9A 3J80M 5CA1B 5HP8A 1KD1H 5MN6A 5HXUA 3D54A 2Q1XA 1CLIA 1XHOA 5LP6C 3TD4A 1FFXA 1JN1A 4IHJA 4NQ3A 1QVGF 1VQKF 2VGNA 1QD9A 3K12A 5IYZB 3TD3A 1JFFB 3I55F 5LXTA 5JH7B 1U3LA 2UYJA 3J81M 3UT5B 4X1YA 2LBXA 4I55B 2V9YA 3FD5A 1Z5WA 3C9SA 4TV8B 5LYJA 3IKEA 3RYCB 4G4XA 4C8EA 1ONIA 3JATB 3QHDA 1W3EX 1VQ6F 2HP0B 3CXCF 2F9ZC 4X3LA 3CYQA 5LP6A 2CVLA 2ZOVA 3V3TA 3CMAF 5HP7A 2CWJA 2UYPA 4ZOLA 1W5AA 2KGWA 3M1XA 5CA0B 1GO1A 5HXZA 5FNVB 4G88A 1VH8A 3LFOA 1QU9A 4FFBA 1VQNF 2AIZP 2ZAUA 3WGLA 2KG4A 1H7MA 3V4DA 3OONA 2CW4A 3NVIB 1OFUA 2R6R1 3M4SA 3CCVF 3OBYA 4TV9B 1KNJA 1IV1A 4IIJB 3T80A 1TUBB 1VQ8F 5EB1B 1GX1A 2OHWA 2Z1EA 3HKEA 3S03A 4IHJB 2VGMA 3U0OA 4B62A 3CCMF 5HY1A 3LWPC 4DRXA 5BMVA 1YI2F 5ITZB 3VYUC 2ALEA 1PF5A 4LNUA 5LXTB 4O2AA 2LCAA 4I50B 3CCRF 1IPAA 2I6DA 5GANK 2EWCA 1VQ9F 2KTUA 2RHOA 3QTYA 3CCLF 3P4EA 3GYQA 2VXYA 3F0FA 2VAMA 2QTPA 5IJ0A 4YJ3A 3C9TA 2H6LA 3N4ZA 4BVRA 4ZHQA 1IV3A 4WBNB 3NMUC 3M84A 2RHLA 4NWOB 1XBIA 2RB9A 1W42A 4ZOLB 5J2TB 1FSZA 3C8LA 3CB2A 3LWVC 4FFBB 4U3JA 3ZOPA 1U40A 1YIJF 3RA6A 1KNKA 2HS0A 3F0DA 3CYPB 3LDTA 4X1KA 3J7AR 1YGYA 2Z1UA 3MBMA 1IV4A 4C82A 5LA6A 4O4IB 4YJ2A 3LYBA 3VYTC 3S06A 1RLUA 1GZ0A 3L7QA 1VQLF 5EO3A 3HKCA 3PAFA 4EI8A 4O2BA 2GLZA 1H48A 3RYIA 3G4SF 4PWTA 4NUTA 5MN5A 3KJJA 4BT4A 1JJ2F 2HS4A 4XCQA 3LWQC 2CSLA 3IMPA 4ZI7B 2PHNA 1W57A 5JQGB 5AVMA 1M90H 4BT3A 5EWRA 4LNUB 2YYEA 2AIFA 3JCMM 4U39A 3VMFB 3CCSF 3JARB 4EB6B 4C8IA 5GAPK 1T0KB 2HP3A 1ZWZA 4TUYA 2PMPA 5C8YA 3WJPA 2ZVZA 3IKFA 3VCZA 3FBAA 1GO0A 3CC7F 3JASB 2OTJF 4ZHQB 1W59A 1NQ3A 1DT9A 3JAMM 2DYYA 5CB4A 3E22A 5EAZA 2BTOA 4EI9A 5IJ9A 4DXDA 2Z01A 1PXWA 3WGNA 3VIUA 2HRYA 3VOBA 3HJWC 1U3PA 4KWEA 5LA6B 3HKDA 5LOVA 5EIBC 5B8FA 1Q82H 4G4YA 2UYNA 3RYIB 3KIZA 3JAWB 4O4LA 4O4JA 3WJQA 3KE1A 4R40B 3ELCA 4RHAA 4F6RB 3JALA 1YJNF 1X52A 1ODEA 5GINC 3P10A 3RYHA 3JAKA 1VQMF 4ZHVA 3E20B 3IR9A 1NJIH 3DC2A 3JVHA 1RQ2A 2IQQA 3CC4F 4B45A 1VQ4F 3I7TA 5EB0A 4TUYB 1SA0A 1X25A 3LWOC 1FFXB 3MCQA 5J2UA 5JCOC 3Q8HA 5EYPA 1X7PA 3ERNA 4C81A 4X1IA 3WPXA 3CPWF 1KQSF 3IEWA 3RA5A 3N4YA 3WPWA 5CB4B 1VQ5F 1CK2A 1R1MA 1YQNA 3K0TA 4X1YB 5GIOC 3K2XA 3CD6F 3S0WA 1JD1A 2HX0A 5LYJB 3VTIC 5FJ4C 4I4TA 3VI6A 5IT9M 2VAPA 1W5BA 3CC2F 2MQEA 3RYFA 4ZK7A 1VHAA 2Z1TA 3O85A 2AMTA 3N2KA 3HKDB 5LP6B 5LOVB 3GTZA 3OBWA 1UI9A 3P0ZA 3ESJA 3VOAA 3FD6A 4BT2A 5EZYA 1W40A 2GVIA 4HNAA 4O4LB 3MDOA 3ZP7A 3WGJA 5GIPC 4BVTA 3EORA 2ZODA 4RQOA 2QA4F 4BT6A 2HS3A 5KMGA 3HAXD 3CCUF 3MQWA 4E6EA 2OZBA 2H8EA 5IYZA 4TZZA 1JFFA 1OAPA 2RHHA 1RLGA 5A2QM 1FNJA 3HKEB 2UZHA 4B46A 5DCVA 5J2UB 3UT5A 2G9IA 2HRUA 2LBWA 2NMUA 1UFYA 3HTNA 4I55A 1KC8H 1RQ7A 3KHNA 4DRXB 1W581 5BMVB 3JATA 5FLXM 3I56F 1X7OA 2HP0A 2RHJA 2ZF8A 4O2AB 3N2GA 3CCJF 4BW0B 1K73H 3RYFB 5IJ0B 4YJ3B 2IAFA 5MN4A 1W41A 3S0YA 3VYSC 2IG8A 1NMUB 1SZQA 3KJKA 2WALA 4IIJA 2DT4A 1TUBA 4X20A 1RA4A 1K8AH 3HKBA 3VO8A 4BVQA 4U3JB 2HQSC 3D01A 4X1KB 3R0PA 3HWUA 5KMGB 4BT7A 2BO1A 3I3FA 3WJRA 4YJ2B 5HY0A
chains in the Genus database with same CATH topology
5B8FA 2AMTA 1IV3A 3Q8HA 2UZHA 3P0ZA 3ESJA 1VH8A 3KE1A 3ERNA 3ELCA 1IV2A 4C81A 2GZLA 1T0AA 3FPIA 1U3LA 4C8GA 3IEWA 3F6MA 1W57A 3P10A 1U40A 3F0GA 3B6NA 1YQNA 3RE3A 3EORA 3IKEA 1JY8A 1KNKA 1U43A 1KNJA 1IV1A 3F0EA 3F0DA 3T80A 4C8EA 3K2XA 3MBMA 1IV4A 3QHDA 4C8IA 4C82A 3GHZA 1GX1A 3F0FA 3JVHA 3K14A 1W55A 1U3PA 1JN1A 1H47A 2PMPA 3IKFA 3IEQA 3FBAA 1VHAA 1H48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B8F A;  2AMT A;  1IV3 A;  3Q8H A;  2UZH A;  3P0Z A;  3ESJ A;  1VH8 A;  3KE1 A;  3ERN A;  3ELC A;  1IV2 A;  4C81 A;  2GZL A;  1T0A A;  3FPI A;  1U3L A;  4C8G A;  3IEW A;  3F6M A;  1W57 A;  3P10 A;  1U40 A;  3F0G A;  3B6N A;  1YQN A;  3RE3 A;  3EOR A;  3IKE A;  1JY8 A;  1KNK A;  1U43 A;  1KNJ A;  1IV1 A;  3F0E A;  3F0D A;  3T80 A;  4C8E A;  3K2X A;  3MBM A;  1IV4 A;  3QHD A;  4C8I A;  4C82 A;  3GHZ A;  1GX1 A;  3F0F A;  3JVH A;  3K14 A;  1W55 A;  1U3P A;  1JN1 A;  1H47 A;  2PMP A;  3IKF A;  3IEQ A;  3FBA A;  1VHA A;  1H48 A; 
#chains in the Genus database with same CATH topology
 1Q81 H;  3HKC B;  4O2B B;  2R75 1;  3G71 F;  5ITZ A;  3NK7 A;  2H8C A;  4I50 A;  3WXM B;  2GZL A;  4C8G A;  3ZO8 A;  1U43 A;  3LWR C;  3WGK A;  3F0E A;  3C9U A;  1K9M H;  2UYK A;  3PLA C;  4C4W C;  4ERH A;  3G6E F;  3NVK E;  3GHZ A;  4WBN A;  5G4V C;  3CME F;  3N2G B;  3LME A;  3DDN A;  4O4H A;  2HVY D;  1J7H A;  3IEQ A;  2I6R A;  3ON1 A;  1W2B F;  5J2T A;  5C8Y B;  1TVK A;  3NK6 A;  1IV2 A;  1T0A A;  1YIT F;  2B33 A;  2QI2 A;  1E7K A;  2CHS A;  5G4U C;  3E22 B;  4O4I A;  3MCA B;  4X20 B;  5GON A;  3WGM A;  5KX5 A;  3C9R A;  1S72 F;  5IJ9 B;  5HY2 A;  3HKB B;  3V7Q A;  5JVD A;  3D00 A;  2CHT A;  3ZP4 A;  1W55 A;  1M1K H;  1H47 A;  2YXZ A;  4X3M A;  3FFM A;  2BTU A;  4ZHW A;  1N8R H;  2N48 A;  3S02 A;  3QUW A;  3SIU A;  2W8B C;  4ZI7 A;  5JCO A;  1VQP F;  3TD5 A;  2UYN B;  1Q86 H;  5JQG A;  1QVF F;  3FPI A;  5HWE A;  1VQV A;  5CA1 A;  1W5E A;  4O4J B;  4BT5 A;  4ZHY B;  2ZVY A;  1Q8R A;  3S0H A;  3JAR A;  2OTM A;  3RE3 A;  4EB6 A;  3JAL B;  4G4V A;  1Q7Y H;  2P6Y A;  1FNK A;  1JY8 A;  2FC3 A;  1YHQ F;  1VQO F;  1XV2 A;  3BYQ A;  3RYH B;  2CZW A;  3JAK B;  3K14 A;  4G4W A;  4EI7 A;  1DBF A;  3JAS A;  2KTV A;  5HY4 A;  1QAH A;  4O4H B;  1Z5V A;  1W5F A;  5JH7 A;  3SIV A;  1SA0 B;  5EIB D;  1COM A;  1TVK B;  2L26 A;  5EYP B;  4TV8 A;  3F6M A;  2K1S A;  3E1Y A;  4LCK A;  2LBT A;  4X1I B;  3RYC A;  1YJ9 F;  1YJW F;  3V7E A;  4M8I A;  3CCE F;  5KX5 B;  4B5C A;  5GON B;  2QEX F;  3CPQ A;  1XRG A;  2BTQ B;  3OW2 F;  5JVD B;  1CN7 A;  3CCQ F;  4G4Z A;  5CA0 A;  3AGK A;  3JAW A;  5FNV A;  1SDS A;  4I4T B;  2OTL F;  2Q1Y A;  4F6R A;  1VK3 A;  2JNB A;  2VAW A;  2Z1F A;  4BVS A;  2FGY A;  3CG6 A;  3N2K B;  1VQ7 F;  5EZY B;  4BY9 D;  3F0G A;  4HNA B;  3B6N A;  4TV9 A;  3J80 M;  5CA1 B;  5HP8 A;  1KD1 H;  5MN6 A;  5HXU A;  3D54 A;  2Q1X A;  1CLI A;  1XHO A;  5LP6 C;  3TD4 A;  1FFX A;  1JN1 A;  4IHJ A;  4NQ3 A;  1QVG F;  1VQK F;  2VGN A;  1QD9 A;  3K12 A;  5IYZ B;  3TD3 A;  1JFF B;  3I55 F;  5LXT A;  5JH7 B;  1U3L A;  2UYJ A;  3J81 M;  3UT5 B;  4X1Y A;  2LBX A;  4I55 B;  2V9Y A;  3FD5 A;  1Z5W A;  3C9S A;  4TV8 B;  5LYJ A;  3IKE A;  3RYC B;  4G4X A;  4C8E A;  1ONI A;  3JAT B;  3QHD A;  1W3E X;  1VQ6 F;  2HP0 B;  3CXC F;  2F9Z C;  4X3L A;  3CYQ A;  5LP6 A;  2CVL A;  2ZOV A;  3V3T A;  3CMA F;  5HP7 A;  2CWJ A;  2UYP A;  4ZOL A;  1W5A A;  2KGW A;  3M1X A;  5CA0 B;  1GO1 A;  5HXZ A;  5FNV B;  4G88 A;  1VH8 A;  3LFO A;  1QU9 A;  4FFB A;  1VQN F;  2AIZ P;  2ZAU A;  3WGL A;  2KG4 A;  1H7M A;  3V4D A;  3OON A;  2CW4 A;  3NVI B;  1OFU A;  2R6R 1;  3M4S A;  3CCV F;  3OBY A;  4TV9 B;  1KNJ A;  1IV1 A;  4IIJ B;  3T80 A;  1TUB B;  1VQ8 F;  5EB1 B;  1GX1 A;  2OHW A;  2Z1E A;  3HKE A;  3S03 A;  4IHJ B;  2VGM A;  3U0O A;  4B62 A;  3CCM F;  5HY1 A;  3LWP C;  4DRX A;  5BMV A;  1YI2 F;  5ITZ B;  3VYU C;  2ALE A;  1PF5 A;  4LNU A;  5LXT B;  4O2A A;  2LCA A;  4I50 B;  3CCR F;  1IPA A;  2I6D A;  5GAN K;  2EWC A;  1VQ9 F;  2KTU A;  2RHO A;  3QTY A;  3CCL F;  3P4E A;  3GYQ A;  2VXY A;  3F0F A;  2VAM A;  2QTP A;  5IJ0 A;  4YJ3 A;  3C9T A;  2H6L A;  3N4Z A;  4BVR A;  4ZHQ A;  1IV3 A;  4WBN B;  3NMU C;  3M84 A;  2RHL A;  4NWO B;  1XBI A;  2RB9 A;  1W42 A;  4ZOL B;  5J2T B;  1FSZ A;  3C8L A;  3CB2 A;  3LWV C;  4FFB B;  4U3J A;  3ZOP A;  1U40 A;  1YIJ F;  3RA6 A;  1KNK A;  2HS0 A;  3F0D A;  3CYP B;  3LDT A;  4X1K A;  3J7A R;  1YGY A;  2Z1U A;  3MBM A;  1IV4 A;  4C82 A;  5LA6 A;  4O4I B;  4YJ2 A;  3LYB A;  3VYT C;  3S06 A;  1RLU A;  1GZ0 A;  3L7Q A;  1VQL F;  5EO3 A;  3HKC A;  3PAF A;  4EI8 A;  4O2B A;  2GLZ A;  1H48 A;  3RYI A;  3G4S F;  4PWT A;  4NUT A;  5MN5 A;  3KJJ A;  4BT4 A;  1JJ2 F;  2HS4 A;  4XCQ A;  3LWQ C;  2CSL A;  3IMP A;  4ZI7 B;  2PHN A;  1W57 A;  5JQG B;  5AVM A;  1M90 H;  4BT3 A;  5EWR A;  4LNU B;  2YYE A;  2AIF A;  3JCM M;  4U39 A;  3VMF B;  3CCS F;  3JAR B;  4EB6 B;  4C8I A;  5GAP K;  1T0K B;  2HP3 A;  1ZWZ A;  4TUY A;  2PMP A;  5C8Y A;  3WJP A;  2ZVZ A;  3IKF A;  3VCZ A;  3FBA A;  1GO0 A;  3CC7 F;  3JAS B;  2OTJ F;  4ZHQ B;  1W59 A;  1NQ3 A;  1DT9 A;  3JAM M;  2DYY A;  5CB4 A;  3E22 A;  5EAZ A;  2BTO A;  4EI9 A;  5IJ9 A;  4DXD A;  2Z01 A;  1PXW A;  3WGN A;  3VIU A;  2HRY A;  3VOB A;  3HJW C;  1U3P A;  4KWE A;  5LA6 B;  3HKD A;  5LOV A;  5EIB C;  5B8F A;  1Q82 H;  4G4Y A;  2UYN A;  3RYI B;  3KIZ A;  3JAW B;  4O4L A;  4O4J A;  3WJQ A;  3KE1 A;  4R40 B;  3ELC A;  4RHA A;  4F6R B;  3JAL A;  1YJN F;  1X52 A;  1ODE A;  5GIN C;  3P10 A;  3RYH A;  3JAK A;  1VQM F;  4ZHV A;  3E20 B;  3IR9 A;  1NJI H;  3DC2 A;  3JVH A;  1RQ2 A;  2IQQ A;  3CC4 F;  4B45 A;  1VQ4 F;  3I7T A;  5EB0 A;  4TUY B;  1SA0 A;  1X25 A;  3LWO C;  1FFX B;  3MCQ A;  5J2U A;  5JCO C;  3Q8H A;  5EYP A;  1X7P A;  3ERN A;  4C81 A;  4X1I A;  3WPX A;  3CPW F;  1KQS F;  3IEW A;  3RA5 A;  3N4Y A;  3WPW A;  5CB4 B;  1VQ5 F;  1CK2 A;  1R1M A;  1YQN A;  3K0T A;  4X1Y B;  5GIO C;  3K2X A;  3CD6 F;  3S0W A;  1JD1 A;  2HX0 A;  5LYJ B;  3VTI C;  5FJ4 C;  4I4T A;  3VI6 A;  5IT9 M;  2VAP A;  1W5B A;  3CC2 F;  2MQE A;  3RYF A;  4ZK7 A;  1VHA A;  2Z1T A;  3O85 A;  2AMT A;  3N2K A;  3HKD B;  5LP6 B;  5LOV B;  3GTZ A;  3OBW A;  1UI9 A;  3P0Z A;  3ESJ A;  3VOA A;  3FD6 A;  4BT2 A;  5EZY A;  1W40 A;  2GVI A;  4HNA A;  4O4L B;  3MDO A;  3ZP7 A;  3WGJ A;  5GIP C;  4BVT A;  3EOR A;  2ZOD A;  4RQO A;  2QA4 F;  4BT6 A;  2HS3 A;  5KMG A;  3HAX D;  3CCU F;  3MQW A;  4E6E A;  2OZB A;  2H8E A;  5IYZ A;  4TZZ A;  1JFF A;  1OAP A;  2RHH A;  1RLG A;  5A2Q M;  1FNJ A;  3HKE B;  2UZH A;  4B46 A;  5DCV A;  5J2U B;  3UT5 A;  2G9I A;  2HRU A;  2LBW A;  2NMU A;  1UFY A;  3HTN A;  4I55 A;  1KC8 H;  1RQ7 A;  3KHN A;  4DRX B;  1W58 1;  5BMV B;  3JAT A;  5FLX M;  3I56 F;  1X7O A;  2HP0 A;  2RHJ A;  2ZF8 A;  4O2A B;  3N2G A;  3CCJ F;  4BW0 B;  1K73 H;  3RYF B;  5IJ0 B;  4YJ3 B;  2IAF A;  5MN4 A;  1W41 A;  3S0Y A;  3VYS C;  2IG8 A;  1NMU B;  1SZQ A;  3KJK A;  2WAL A;  4IIJ A;  2DT4 A;  1TUB A;  4X20 A;  1RA4 A;  1K8A H;  3HKB A;  3VO8 A;  4BVQ A;  4U3J B;  2HQS C;  3D01 A;  4X1K B;  3R0P A;  3HWU A;  5KMG B;  4BT7 A;  2BO1 A;  3I3F A;  3WJR A;  4YJ2 B;  5HY0 A; 
#chains in the Genus database with same CATH homology
 5B8F A;  2AMT A;  1IV3 A;  3Q8H A;  2UZH A;  3P0Z A;  3ESJ A;  1VH8 A;  3KE1 A;  3ERN A;  3ELC A;  1IV2 A;  4C81 A;  2GZL A;  1T0A A;  3FPI A;  1U3L A;  4C8G A;  3IEW A;  3F6M A;  1W57 A;  3P10 A;  1U40 A;  3F0G A;  3B6N A;  1YQN A;  3RE3 A;  3EOR A;  3IKE A;  1JY8 A;  1KNK A;  1U43 A;  1KNJ A;  1IV1 A;  3F0E A;  3F0D A;  3T80 A;  4C8E A;  3K2X A;  3MBM A;  1IV4 A;  3QHD A;  4C8I A;  4C82 A;  3GHZ A;  1GX1 A;  3F0F A;  3JVH A;  3K14 A;  1W55 A;  1U3P A;  1JN1 A;  1H47 A;  2PMP A;  3IKF A;  3IEQ A;  3FBA A;  1VHA A;  1H48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...