3JVHA

Crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 8395
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3jvhA00
1H48A 1JN1A 1VH8A 3ESJA 3IEWA 4C8EA 3B6NA 3IKEA 3IEQA 3KE1A 3Q8HA 1IV2A 1YQNA 3GHZA 3P10A 4C8IA 1U40A 2UZHA 4C8GA 1JY8A 3MBMA 3ELCA 2AMTA 2GZLA 3RE3A 5B8FA 1U3PA 2PMPA 3EORA 1IV1A 3FBAA 3K14A 3T80A 3FPIA 3F6MA 3JVHA 1W57A 3F0GA 1VHAA 1T0AA 1IV4A 1KNJA 1U3LA 3QHDA 1KNKA 3K2XA 1H47A 3F0DA 3IKFA 3ERNA 4C82A 4C81A 1IV3A 3P0ZA 1W55A 1GX1A 3F0EA 1U43A 3F0FA
chains in the Genus database with same CATH superfamily
1VQKF 4PWTA 2HS3A 5HXZA 5FJ4C 3LMEA 1YQNA 4O2AA 3GHZA 5CB4A 1IPAA 4C4WC 2VAWA 3JALB 1DT9A 3J7AR 3N4ZA 4LNUB 3WGLA 3LYBA 5JVDA 1Q81H 3D01A 5FLXM 1TUBA 3N2GB 4IHJA 3WPXA 5AVMA 1QAHA 4HNAA 3ERNA 3JAWB 4EI9A 1UI9A 2RB9A 1GX1A 3K12A 3CC7F 2B33A 4YJ3A 3S0HA 2VGMA 4TV9B 3G4SF 3JAMM 4E6EA 4ZHVA 5HY1A 1UFYA 4X1IA 3JASA 2JNBA 2BO1A 5EIBD 1JFFA 1W5FA 3FBAA 5CB4B 4NWOB 3VYSC 1RQ2A 1VQNF 5JVDB 4B46A 5GAPK 4O2BB 2VAMA 2HP0A 4IHJB 2I6DA 4BT2A 1KC8H 5LP6A 4HNAB 4NQ3A 4RHAA 5GIOC 3BYQA 4X3LA 5LA6A 2PHNA 3LWOC 1W5BA 5JQGB 3CCSF 2H8CA 5EAZA 1SA0B 4X1YB 1XHOA 4YJ3B 5EWRA 3R0PA 3RYFA 3NMUC 3M1XA 4X1IB 2IAFA 1JFFB 3LWVC 3CMEF 5EB1B 2RHJA 4TV8A 5KX5B 4BVQA 4X1KA 3WGKA 4O4HB 5HY0A 5G4VC 1W5EA 4LCKA 2FC3A 4B45A 4R40B 1JN1A 3HWUA 2HP0B 4RQOA 3IR9A 3WJPA 1QVFF 5LP6B 2OTJF 3P4EA 2RHHA 5IYZA 3JATB 3E20B 5LA6B 3MBMA 2AMTA 3MDOA 1RLUA 1Z5WA 5B8FA 2VAPA 1U3PA 2PMPA 5EZYA 3SIUA 1W42A 2AIZP 2R751 1VHAA 4ZK7A 4I50A 5GIPC 1FFXA 1JJ2F 3J81M 3E1YA 2UYJA 3TD5A 4WBNA 1VQ5F 4TV8B 3F0FA 3AGKA 1VQ7F 4X1KB 3VCZA 3HTNA 1YITF 2VGNA 2FGYA 4X3MA 3OBWA 3B6NA 3D00A 3IEQA 5HY4A 5GANK 3TD4A 3OBYA 4ZHWA 1CN7A 3SIVA 2UYKA 1CK2A 3CB2A 3HKEB 5IYZB 1Q8RA 3S03A 1KQSF 3RYHB 5EZYB 1X7PA 2BTQB 3QHDA 3K2XA 2CSLA 3RYCA 1VQOF 4O4JB 4BT7A 1FFXB 2DYYA 5JH7B 2YYEA 5IJ9A 1GO0A 5EO3A 2LBTA 3HJWC 3VYUC 4WBNB 1PXWA 4DRXA 4FFBA 4I4TA 1K9MH 1CLIA 3NK6A 4G4ZA 4C8GA 1GO1A 3HKCA 2ALEA 3RE3A 3CPWF 3CCVF 3RA6A 5GONA 3I55F 2RHOA 3VO8A 3WJRA 5J2TB 4DXDA 1W2BF 2OZBA 3OW2F 3HAXD 1X52A 1SDSA 3LWQC 2I6RA 3VTIC 3C8LA 4C82A 3OONA 4IIJA 3L7QA 1U43A 1VQMF 5JCOA 3QTYA 5BMVA 5HY2A 2CW4A 2BTOA 2QA4F 1NJIH 4EB6A 5A2QM 2QEXF 5LYJA 3MCAB 4X20A 5C8YA 3V7QA 1M1KH 1J7HA 4DRXB 4FFBB 4B5CA 4I4TB 1R1MA 1FNJA 4O2AB 3VMFB 1W41A 1X7OA 3HKCB 3JCMM 2Q1YA 2DT4A 5MN6A 3GTZA 1YI2F 3NVIB 3CCMF 3CXCF 3F0DA 2K1SA 1TUBB 3C9TA 4BVRA 1Q86H 3U0OA 3WGMA 5HXUA 4BW0B 3PAFA 3S02A 2LCAA 3DDNA 4IIJB 4G4XA 3CMAF 4NUTA 1IV2A 3LWPC 3KJJA 4BVTA 4O4LA 4C8IA 1U40A 1QD9A 3ZP7A 1JY8A 1H7MA 4EB6B 2H6LA 2Z1TA 2Z1EA 3M4SA 2EWCA 3QUWA 3VI6A 5LYJB 1YJNF 3O85A 3ON1A 3JASB 3CCUF 1VQ8F 4TUYA 2Z1FA 4C81A 4YJ2B 3F0EA 5FNVA 2GLZA 5EYPA 3CC4F 1YGYA 2CZWA 5ITZA 2RHLA 2CHTA 1ZWZA 2P6YA 1YJ9F 2ZOVA 2OTLF 2BTUA 3CC2F 3HKDA 5DCVA 3FD5A 3WJQA 4BT4A 1N8RH 3V4DA 1OAPA 2L26A 3VOBA 3T80A 2LBWA 1VQ6F 3CCJF 1COMA 3J80M 1U3LA 5CA1A 1GZ0A 1KNKA 2HQSC 3RYFB 5JCOC 1XBIA 3WGNA 2G9IA 3P0ZA 4TUYB 5LXTA 1FSZA 5CA0A 3JARA 3N4YA 2VXYA 4C8EA 3E22A 3Q8HA 5EYPB 3I7TA 3D54A 5ITZB 5IJ0A 4U3JA 3LFOA 1TVKA 3DC2A 3ZO8A 3HKDB 1Q82H 3CYQA 3N2KA 4F6RA 2OHWA 4YJ2A 2KTUA 2KTVA 2Q1XA 3S06A 4I50B 5CA1B 1ONIA 1T0KB 1H48A 2KGWA 1VH8A 3CCEF 2IQQA 3IEWA 1W40A 1M90H 3RA5A 4LNUA 3FFMA 5CA0B 3JARB 4ZOLA 2ZVYA 4G4WA 1OFUA 3E22B 5EIBC 1XV2A 1KD1H 3I56F 3FPIA 4ZHQA 2HRYA 4O4IA 4U3JB 1S72F 1TVKB 3JAWA 1VK3A 3NVKE 2YXZA 1VQVA 5HWEA 5HP8A 1VQPF 3IKFA 3N2KB 1SZQA 3G6EF 4F6RB 2V9YA 4ZHYB 2NMUA 3LWRC 4BVSA 2Z01A 1YHQF 2HX0A 3RYCB 4ZI7A 3VYTC 2LBXA 3ZP4A 3KE1A 5IJ9B 1VQ9F 1NMUB 1ODEA 5J2UA 3C9SA 3V3TA 3CCQF 3IMPA 4ZOLB 1DBFA 3NK7A 1YIJF 4O2BA 1W57A 1JD1A 2IG8A 3C9UA 2KG4A 1RQ7A 1X25A 4ZHQB 1K73H 4O4IB 5GONB 3KIZA 2HS4A 3S0YA 3UT5A 5JQGA 3WPWA 3GYQA 1SA0A 4X1YA 4G4VA 2ZF8A 1XRGA 4M8IA 3G71F 4ZI7B 5BMVB 2GVIA 5LOVA 1RA4A 4U39A 4G4YA 4B62A 3EORA 1IV1A 5J2UB 4X20B 5C8YB 5KX5A 5G4UC 3M84A 4O4HA 4BT6A 3CCLF 3ZOPA 2N48A 5MN5A 3WGJA 3VIUA 1Z5VA 1W55A 3C9RA 4KWEA 4BT5A 2HRUA 3JATA 3MQWA 3ESJA 2ZODA 3UT5B 2HVYD 5EB0A 2CVLA 2F9ZC 2UZHA 2W8BC 3ELCA 1W581 3FD6A 5GINC 5HP7A 5LOVB 4XCQA 4O4LB 1E7KA 1RLGA 1K8AH 5KMGA 4ERHA 3K0TA 3TD3A 1T0AA 2CHSA 3HKBA 2ZVZA 3V7EA 2CWJA 3CPQA 1VQ4F 2H8EA 4TZZA 5IT9M 2UYNA 3MCQA 3PLAC 2AIFA 3CCRF 3KHNA 3LDTA 4G88A 1W59A 3HKEA 3IKEA 5FNVB 3JAKA 3P10A 3RYIA 5MN4A 3RYHA 2UYPA 1Q7YH 3KJKA 4BT3A 3F6MA 4BY9D 4O4JA 2MQEA 4I55A 5JH7A 3WXMB 1IV4A 3CD6F 5KMGB 1QVGF 1PF5A 3I3FA 3VOAA 3S0WA 3HKBB 2QI2A 4EI7A 1W5AA 1YJWF 2WALA 1NQ3A 3CG6A 2UYNB 3JALA 2HS0A 5LXTB 1FNKA 1W3EX 2OTMA 2GZLA 5J2TA 3JAKB 2R6R1 3RYIB 3K14A 2ZAUA 3N2GA 5IJ0B 3JVHA 2QTPA 1QU9A 3F0GA 5LP6C 1VQLF 1KNJA 1H47A 2HP3A 4EI8A 4I55B 3CYPB 2Z1UA 1IV3A 4TV9A
chains in the Genus database with same CATH topology
1H48A 1JN1A 1VH8A 3ESJA 3IEWA 4C8EA 3B6NA 3IKEA 3IEQA 3KE1A 3Q8HA 1IV2A 1YQNA 3GHZA 3P10A 4C8IA 1U40A 2UZHA 4C8GA 1JY8A 3MBMA 3ELCA 2AMTA 2GZLA 3RE3A 5B8FA 1U3PA 2PMPA 3EORA 1IV1A 3FBAA 3K14A 3T80A 3FPIA 3F6MA 3JVHA 1W57A 3F0GA 1VHAA 1T0AA 1IV4A 1KNJA 1U3LA 3QHDA 1KNKA 3K2XA 1H47A 3F0DA 3IKFA 3ERNA 4C82A 4C81A 1IV3A 3P0ZA 1W55A 1GX1A 3F0EA 1U43A 3F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H48 A;  1JN1 A;  1VH8 A;  3ESJ A;  3IEW A;  4C8E A;  3B6N A;  3IKE A;  3IEQ A;  3KE1 A;  3Q8H A;  1IV2 A;  1YQN A;  3GHZ A;  3P10 A;  4C8I A;  1U40 A;  2UZH A;  4C8G A;  1JY8 A;  3MBM A;  3ELC A;  2AMT A;  2GZL A;  3RE3 A;  5B8F A;  1U3P A;  2PMP A;  3EOR A;  1IV1 A;  3FBA A;  3K14 A;  3T80 A;  3FPI A;  3F6M A;  3JVH A;  1W57 A;  3F0G A;  1VHA A;  1T0A A;  1IV4 A;  1KNJ A;  1U3L A;  3QHD A;  1KNK A;  3K2X A;  1H47 A;  3F0D A;  3IKF A;  3ERN A;  4C82 A;  4C81 A;  1IV3 A;  3P0Z A;  1W55 A;  1GX1 A;  3F0E A;  1U43 A;  3F0F A; 
#chains in the Genus database with same CATH topology
 1VQK F;  4PWT A;  2HS3 A;  5HXZ A;  5FJ4 C;  3LME A;  1YQN A;  4O2A A;  3GHZ A;  5CB4 A;  1IPA A;  4C4W C;  2VAW A;  3JAL B;  1DT9 A;  3J7A R;  3N4Z A;  4LNU B;  3WGL A;  3LYB A;  5JVD A;  1Q81 H;  3D01 A;  5FLX M;  1TUB A;  3N2G B;  4IHJ A;  3WPX A;  5AVM A;  1QAH A;  4HNA A;  3ERN A;  3JAW B;  4EI9 A;  1UI9 A;  2RB9 A;  1GX1 A;  3K12 A;  3CC7 F;  2B33 A;  4YJ3 A;  3S0H A;  2VGM A;  4TV9 B;  3G4S F;  3JAM M;  4E6E A;  4ZHV A;  5HY1 A;  1UFY A;  4X1I A;  3JAS A;  2JNB A;  2BO1 A;  5EIB D;  1JFF A;  1W5F A;  3FBA A;  5CB4 B;  4NWO B;  3VYS C;  1RQ2 A;  1VQN F;  5JVD B;  4B46 A;  5GAP K;  4O2B B;  2VAM A;  2HP0 A;  4IHJ B;  2I6D A;  4BT2 A;  1KC8 H;  5LP6 A;  4HNA B;  4NQ3 A;  4RHA A;  5GIO C;  3BYQ A;  4X3L A;  5LA6 A;  2PHN A;  3LWO C;  1W5B A;  5JQG B;  3CCS F;  2H8C A;  5EAZ A;  1SA0 B;  4X1Y B;  1XHO A;  4YJ3 B;  5EWR A;  3R0P A;  3RYF A;  3NMU C;  3M1X A;  4X1I B;  2IAF A;  1JFF B;  3LWV C;  3CME F;  5EB1 B;  2RHJ A;  4TV8 A;  5KX5 B;  4BVQ A;  4X1K A;  3WGK A;  4O4H B;  5HY0 A;  5G4V C;  1W5E A;  4LCK A;  2FC3 A;  4B45 A;  4R40 B;  1JN1 A;  3HWU A;  2HP0 B;  4RQO A;  3IR9 A;  3WJP A;  1QVF F;  5LP6 B;  2OTJ F;  3P4E A;  2RHH A;  5IYZ A;  3JAT B;  3E20 B;  5LA6 B;  3MBM A;  2AMT A;  3MDO A;  1RLU A;  1Z5W A;  5B8F A;  2VAP A;  1U3P A;  2PMP A;  5EZY A;  3SIU A;  1W42 A;  2AIZ P;  2R75 1;  1VHA A;  4ZK7 A;  4I50 A;  5GIP C;  1FFX A;  1JJ2 F;  3J81 M;  3E1Y A;  2UYJ A;  3TD5 A;  4WBN A;  1VQ5 F;  4TV8 B;  3F0F A;  3AGK A;  1VQ7 F;  4X1K B;  3VCZ A;  3HTN A;  1YIT F;  2VGN A;  2FGY A;  4X3M A;  3OBW A;  3B6N A;  3D00 A;  3IEQ A;  5HY4 A;  5GAN K;  3TD4 A;  3OBY A;  4ZHW A;  1CN7 A;  3SIV A;  2UYK A;  1CK2 A;  3CB2 A;  3HKE B;  5IYZ B;  1Q8R A;  3S03 A;  1KQS F;  3RYH B;  5EZY B;  1X7P A;  2BTQ B;  3QHD A;  3K2X A;  2CSL A;  3RYC A;  1VQO F;  4O4J B;  4BT7 A;  1FFX B;  2DYY A;  5JH7 B;  2YYE A;  5IJ9 A;  1GO0 A;  5EO3 A;  2LBT A;  3HJW C;  3VYU C;  4WBN B;  1PXW A;  4DRX A;  4FFB A;  4I4T A;  1K9M H;  1CLI A;  3NK6 A;  4G4Z A;  4C8G A;  1GO1 A;  3HKC A;  2ALE A;  3RE3 A;  3CPW F;  3CCV F;  3RA6 A;  5GON A;  3I55 F;  2RHO A;  3VO8 A;  3WJR A;  5J2T B;  4DXD A;  1W2B F;  2OZB A;  3OW2 F;  3HAX D;  1X52 A;  1SDS A;  3LWQ C;  2I6R A;  3VTI C;  3C8L A;  4C82 A;  3OON A;  4IIJ A;  3L7Q A;  1U43 A;  1VQM F;  5JCO A;  3QTY A;  5BMV A;  5HY2 A;  2CW4 A;  2BTO A;  2QA4 F;  1NJI H;  4EB6 A;  5A2Q M;  2QEX F;  5LYJ A;  3MCA B;  4X20 A;  5C8Y A;  3V7Q A;  1M1K H;  1J7H A;  4DRX B;  4FFB B;  4B5C A;  4I4T B;  1R1M A;  1FNJ A;  4O2A B;  3VMF B;  1W41 A;  1X7O A;  3HKC B;  3JCM M;  2Q1Y A;  2DT4 A;  5MN6 A;  3GTZ A;  1YI2 F;  3NVI B;  3CCM F;  3CXC F;  3F0D A;  2K1S A;  1TUB B;  3C9T A;  4BVR A;  1Q86 H;  3U0O A;  3WGM A;  5HXU A;  4BW0 B;  3PAF A;  3S02 A;  2LCA A;  3DDN A;  4IIJ B;  4G4X A;  3CMA F;  4NUT A;  1IV2 A;  3LWP C;  3KJJ A;  4BVT A;  4O4L A;  4C8I A;  1U40 A;  1QD9 A;  3ZP7 A;  1JY8 A;  1H7M A;  4EB6 B;  2H6L A;  2Z1T A;  2Z1E A;  3M4S A;  2EWC A;  3QUW A;  3VI6 A;  5LYJ B;  1YJN F;  3O85 A;  3ON1 A;  3JAS B;  3CCU F;  1VQ8 F;  4TUY A;  2Z1F A;  4C81 A;  4YJ2 B;  3F0E A;  5FNV A;  2GLZ A;  5EYP A;  3CC4 F;  1YGY A;  2CZW A;  5ITZ A;  2RHL A;  2CHT A;  1ZWZ A;  2P6Y A;  1YJ9 F;  2ZOV A;  2OTL F;  2BTU A;  3CC2 F;  3HKD A;  5DCV A;  3FD5 A;  3WJQ A;  4BT4 A;  1N8R H;  3V4D A;  1OAP A;  2L26 A;  3VOB A;  3T80 A;  2LBW A;  1VQ6 F;  3CCJ F;  1COM A;  3J80 M;  1U3L A;  5CA1 A;  1GZ0 A;  1KNK A;  2HQS C;  3RYF B;  5JCO C;  1XBI A;  3WGN A;  2G9I A;  3P0Z A;  4TUY B;  5LXT A;  1FSZ A;  5CA0 A;  3JAR A;  3N4Y A;  2VXY A;  4C8E A;  3E22 A;  3Q8H A;  5EYP B;  3I7T A;  3D54 A;  5ITZ B;  5IJ0 A;  4U3J A;  3LFO A;  1TVK A;  3DC2 A;  3ZO8 A;  3HKD B;  1Q82 H;  3CYQ A;  3N2K A;  4F6R A;  2OHW A;  4YJ2 A;  2KTU A;  2KTV A;  2Q1X A;  3S06 A;  4I50 B;  5CA1 B;  1ONI A;  1T0K B;  1H48 A;  2KGW A;  1VH8 A;  3CCE F;  2IQQ A;  3IEW A;  1W40 A;  1M90 H;  3RA5 A;  4LNU A;  3FFM A;  5CA0 B;  3JAR B;  4ZOL A;  2ZVY A;  4G4W A;  1OFU A;  3E22 B;  5EIB C;  1XV2 A;  1KD1 H;  3I56 F;  3FPI A;  4ZHQ A;  2HRY A;  4O4I A;  4U3J B;  1S72 F;  1TVK B;  3JAW A;  1VK3 A;  3NVK E;  2YXZ A;  1VQV A;  5HWE A;  5HP8 A;  1VQP F;  3IKF A;  3N2K B;  1SZQ A;  3G6E F;  4F6R B;  2V9Y A;  4ZHY B;  2NMU A;  3LWR C;  4BVS A;  2Z01 A;  1YHQ F;  2HX0 A;  3RYC B;  4ZI7 A;  3VYT C;  2LBX A;  3ZP4 A;  3KE1 A;  5IJ9 B;  1VQ9 F;  1NMU B;  1ODE A;  5J2U A;  3C9S A;  3V3T A;  3CCQ F;  3IMP A;  4ZOL B;  1DBF A;  3NK7 A;  1YIJ F;  4O2B A;  1W57 A;  1JD1 A;  2IG8 A;  3C9U A;  2KG4 A;  1RQ7 A;  1X25 A;  4ZHQ B;  1K73 H;  4O4I B;  5GON B;  3KIZ A;  2HS4 A;  3S0Y A;  3UT5 A;  5JQG A;  3WPW A;  3GYQ A;  1SA0 A;  4X1Y A;  4G4V A;  2ZF8 A;  1XRG A;  4M8I A;  3G71 F;  4ZI7 B;  5BMV B;  2GVI A;  5LOV A;  1RA4 A;  4U39 A;  4G4Y A;  4B62 A;  3EOR A;  1IV1 A;  5J2U B;  4X20 B;  5C8Y B;  5KX5 A;  5G4U C;  3M84 A;  4O4H A;  4BT6 A;  3CCL F;  3ZOP A;  2N48 A;  5MN5 A;  3WGJ A;  3VIU A;  1Z5V A;  1W55 A;  3C9R A;  4KWE A;  4BT5 A;  2HRU A;  3JAT A;  3MQW A;  3ESJ A;  2ZOD A;  3UT5 B;  2HVY D;  5EB0 A;  2CVL A;  2F9Z C;  2UZH A;  2W8B C;  3ELC A;  1W58 1;  3FD6 A;  5GIN C;  5HP7 A;  5LOV B;  4XCQ A;  4O4L B;  1E7K A;  1RLG A;  1K8A H;  5KMG A;  4ERH A;  3K0T A;  3TD3 A;  1T0A A;  2CHS A;  3HKB A;  2ZVZ A;  3V7E A;  2CWJ A;  3CPQ A;  1VQ4 F;  2H8E A;  4TZZ A;  5IT9 M;  2UYN A;  3MCQ A;  3PLA C;  2AIF A;  3CCR F;  3KHN A;  3LDT A;  4G88 A;  1W59 A;  3HKE A;  3IKE A;  5FNV B;  3JAK A;  3P10 A;  3RYI A;  5MN4 A;  3RYH A;  2UYP A;  1Q7Y H;  3KJK A;  4BT3 A;  3F6M A;  4BY9 D;  4O4J A;  2MQE A;  4I55 A;  5JH7 A;  3WXM B;  1IV4 A;  3CD6 F;  5KMG B;  1QVG F;  1PF5 A;  3I3F A;  3VOA A;  3S0W A;  3HKB B;  2QI2 A;  4EI7 A;  1W5A A;  1YJW F;  2WAL A;  1NQ3 A;  3CG6 A;  2UYN B;  3JAL A;  2HS0 A;  5LXT B;  1FNK A;  1W3E X;  2OTM A;  2GZL A;  5J2T A;  3JAK B;  2R6R 1;  3RYI B;  3K14 A;  2ZAU A;  3N2G A;  5IJ0 B;  3JVH A;  2QTP A;  1QU9 A;  3F0G A;  5LP6 C;  1VQL F;  1KNJ A;  1H47 A;  2HP3 A;  4EI8 A;  4I55 B;  3CYP B;  2Z1U A;  1IV3 A;  4TV9 A; 
#chains in the Genus database with same CATH homology
 1H48 A;  1JN1 A;  1VH8 A;  3ESJ A;  3IEW A;  4C8E A;  3B6N A;  3IKE A;  3IEQ A;  3KE1 A;  3Q8H A;  1IV2 A;  1YQN A;  3GHZ A;  3P10 A;  4C8I A;  1U40 A;  2UZH A;  4C8G A;  1JY8 A;  3MBM A;  3ELC A;  2AMT A;  2GZL A;  3RE3 A;  5B8F A;  1U3P A;  2PMP A;  3EOR A;  1IV1 A;  3FBA A;  3K14 A;  3T80 A;  3FPI A;  3F6M A;  3JVH A;  1W57 A;  3F0G A;  1VHA A;  1T0A A;  1IV4 A;  1KNJ A;  1U3L A;  3QHD A;  1KNK A;  3K2X A;  1H47 A;  3F0D A;  3IKF A;  3ERN A;  4C82 A;  4C81 A;  1IV3 A;  3P0Z A;  1W55 A;  1GX1 A;  3F0E A;  1U43 A;  3F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...