1XRGA

Conserved hypothetical protein from clostridium thermocellum cth-2968
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
YIEVVKTNKAPEAIGPYSQAIVTGSFVYTSGQIPINPQTGEVVDGGIEEQAKQVLENLKNVLEAAGSSLNKVVKTTVFIKDMDSFAKVNEVYAKYFSEPYPARSCVEVSKLPKGVLIEIEAVAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative translation initiation inhibitor, yjgF family
publication title Conserved hypothetical protein from Clostridium thermocellum Cth-2968
rcsb
source organism Clostridium thermocellum
total genus 34
structure length 125
sequence length 125
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1xrgA00
1X25A 2CHTA 4ZK7A 1DBFA 1JD1A 3K12A 1PF5A 2CW4A 1NQ3A 3ZP7A 2UYNB 3LMEA 1FNJA 3D01A 2UYNA 4NWOB 2CSLA 2B33A 3GTZA 2UYPA 3M1XA 1XRGA 1QU9A 2DYYA 1J7HA 3ZOPA 5HP7A 2EWCA 1ONIA 3VCZA 5HP8A 2CVLA 2OTMA 1COMA 2UYKA 1UFYA 1ODEA 3KJJA 3LYBA 1UI9A 3I7TA 3QUWA 2CWJA 1XHOA 3I3FA 3MQWA 1QD9A 1QAHA 2CHSA 2UYJA 3K0TA 3KJKA 3L7QA 3M4SA 3V4DA 3ZO8A 2IG8A 1FNKA 3ZP4A 3R0PA
chains in the Genus database with same CATH superfamily
3N2GB 5G4UC 1RA4A 1FSZA 4G4YA 3RYIB 1TVKB 1FNJA 3JARB 5MN4A 2HVYD 1FFXB 1W57A 4X3MA 1YHQF 4G4XA 1Q81H 2CVLA 1U3PA 3I55F 4X20B 1IPAA 4C82A 3VMFB 3CCVF 1K8AH 1W40A 1VQ9F 5LOVA 5GONB 2PMPA 1Q86H 3V4DA 5KMGB 2ZAUA 3WJRA 5IYZB 4YJ2A 3ERNA 4F6RB 3VYTC 3RA6A 2CZWA 4EB6A 2B33A 3HWUA 5C8YB 2BTOA 2I6DA 1DT9A 1QVFF 4X1YB 1RLUA 1COMA 1ZWZA 3JAWB 3HKCA 3CCRF 1SZQA 3JAMM 4B46A 2QEXF 2VAPA 2FC3A 3S0WA 3RYHB 1IV4A 5CA1A 5EO3A 2LCAA 3T80A 4B45A 3K2XA 2VGNA 3OW2F 3J81M 4NWOB 4R40B 5JQGB 2ZF8A 3S0HA 3RE3A 3ON1A 5IJ9B 3WGKA 4X3LA 4LNUB 4B5CA 5B8FA 3HKBA 2OTMA 1YI2F 1RQ7A 1IV3A 4U3JB 4O4LB 2CWJA 2GLZA 2N48A 1GO1A 2R6R1 4IIJA 1Z5WA 4G4ZA 2AIFA 3KJKA 4TV8A 4C8GA 5FNVB 2MQEA 3E22A 2HP3A 5EB1B 3HJWC 4M8IA 1XBIA 3WPXA 5FJ4C 2Z1FA 3CPQA 3S02A 4BT5A 3FPIA 3P0ZA 3TD5A 3GHZA 1X7PA 3DDNA 4O4IB 1KNKA 3RYCA 1N8RH 3JAKA 5EYPA 3OONA 5IJ0A 3MQWA 4BW0B 1JJ2F 3NVKE 1FNKA 4G4WA 3HTNA 1OAPA 4I4TB 4ERHA 3JASA 3CCMF 4O4JB 3JCMM 1K9MH 4O2BB 3MCQA 4TV9B 2VAMA 4ZOLB 3WPWA 3E1YA 5HY1A 3VOBA 5J2TB 3CCEF 1TUBA 3D01A 3JATB 4I50B 5LA6B 2HS0A 4WBNB 3FD5A 5BMVA 4FFBA 4KWEA 2Z01A 5JVDB 5A2QM 1ODEA 3S06A 5KX5A 1Q82H 4RQOA 4ZI7B 5CB4A 5HY0A 2QI2A 2I6RA 3CCSF 3WJPA 2AMTA 4O2AA 5GAPK 2CHSA 3C9SA 1RQ2A 5EWRA 3OBWA 1U3LA 1T0AA 2VGMA 3VO8A 4C81A 5ITZA 2ZVYA 3ZP4A 3LFOA 5LYJA 3F0EA 4X1KA 4ZHVA 3F0FA 5DCVA 2UYNB 5GIPC 2FGYA 2ALEA 3HKDA 1Z5VA 3UT5B 1YIJF 2Z1UA 3U0OA 3RA5A 3CB2A 1VQNF 2Z1EA 5LOVB 4NUTA 1VQ8F 4YJ2B 2HP0A 4TUYA 3NMUC 3PLAC 3CMEF 1NMUB 3N2KA 2CHTA 1JD1A 3QHDA 4RHAA 5EIBD 3O85A 5EZYA 4HNAA 2IAFA 1TVKA 2H6LA 1H47A 1NJIH 2K1SA 3DC2A 3IEWA 3CMAF 5HP8A 3MBMA 3HKCB 3KJJA 3BYQA 3ESJA 3JVHA 1M90H 1W5BA 3M4SA 2KGWA 1VK3A 5CA1B 5KMGA 3FFMA 1T0KB 5JCOA 3QTYA 4C8IA 2P6YA 4EI9A 4EI8A 4LCKA 4I55A 2GZLA 5IT9M 2JNBA 2LBXA 3CPWF 1SA0A 3HKBB 2GVIA 1W59A 1YGYA 4IIJB 2KG4A 2QA4F 3QUWA 3CCQF 4X1IB 1VHAA 5MN6A 4TV8B 3E22B 4DRXA 1VQMF 3IKFA 3WGNA 2IG8A 3VOAA 1IV1A 4ZHQA 5GANK 1YJWF 1W3EX 3N4YA 4G88A 1DBFA 2CW4A 3RYFA 3LMEA 3G71F 3VYUC 3CG6A 2H8EA 3EORA 3C8LA 5HXUA 3RYCB 1W2BF 3N4ZA 1UFYA 2HS3A 4BVTA 1XV2A 4O4LA 2BTQB 5HY4A 5LP6A 2VXYA 2ZODA 1PXWA 3HKEA 1W42A 3WXMB 3K0TA 2OTLF 1U43A 2Q1XA 3MCAB 3NK6A 2LBTA 3CXCF 1Q8RA 2RHOA 2H8CA 1E7KA 3VIUA 4C4WC 4BVRA 3K12A 1TUBB 1NQ3A 3VI6A 3IEQA 1VQ4F 4YJ3B 5JH7A 5G4VC 5BMVB 2YXZA 4IHJA 4FFBB 3M1XA 2UYPA 5LXTA 1IV2A 1QU9A 5HY2A 3V7EA 5KX5B 3VYSC 2UYKA 3OBYA 4XCQA 5MN5A 3LYBA 4ZHWA 3I7TA 5CA0A 1S72F 3CD6F 3P10A 5J2UA 2RHLA 2Z1TA 2UYJA 2Q1YA 3L7QA 1H48A 3KIZA 3J80M 4X1KB 1CN7A 3CYPB 3TD4A 5GIOC 1X25A 2OZBA 3LDTA 4EI7A 2ZOVA 3LWQC 3HKDB 1CK2A 3M84A 1VQ6F 1VQVA 3JATA 3S0YA 3G4SF 1RLGA 2EWCA 3CC7F 2ZVZA 1H7MA 1JFFA 3CC2F 1YJNF 3I3FA 1YITF 1SDSA 1QAHA 2QTPA 3ELCA 5HWEA 3N2KB 3IKEA 2KTVA 2HX0A 4O4HA 3JALA 5HXZA 5EZYB 4HNAB 3N2GA 5FLXM 4EB6B 2UYNA 3J7AR 2CSLA 2G9IA 2IQQA 1CLIA 2WALA 3JARA 3RYIA 4BY9D 2RHJA 1X52A 2DYYA 2R751 4G4VA 3P4EA 4PWTA 1FFXA 1OFUA 3UT5A 3LWRC 1VQKF 4X20A 1GX1A 1W41A 3CC4F 3IMPA 3WJQA 1R1MA 4BT4A 4BT2A 3D54A 1X7OA 2LBWA 5GONA 1W581 2HS4A 5IYZA 3S03A 4F6RA 4ZHYB 1YQNA 3F0DA 4BVQA 4I55B 2OHWA 3ZP7A 1K73H 1M1KH 1W5FA 1VH8A 1SA0B 1XRGA 4DXDA 5HP7A 5C8YA 2PHNA 3FD6A 2V9YA 4E6EA 2KTUA 2NMUA 4X1YA 1UI9A 1Q7YH 2AIZP 3JAWA 1XHOA 3LWVC 4DRXB 2RHHA 2OTJF 3LWOC 3SIVA 3KHNA 4ZHQB 1JN1A 1KD1H 1KQSF 3RYHA 3RYFB 4BT3A 3HAXD 3Q8HA 3NVIB 4BT6A 5JQGA 1VQPF 2BTUA 5JCOC 1J7HA 2W8BC 3ZOPA 5IJ9A 3LWPC 4LNUA 1W5EA 3JAKB 3IR9A 5EYPB 5LP6B 1JY8A 3CCJF 3HKEB 3GYQA 5IJ0B 4X1IA 4U3JA 1KC8H 2DT4A 3G6EF 1VQOF 1W55A 1QD9A 4TZZA 1KNJA 2VAWA 3AGKA 4BT7A 4U39A 3C9UA 3R0PA 1GZ0A 5FNVA 3JASB 1VQ7F 2HRYA 3V3TA 4ZK7A 1GO0A 5JH7B 1U40A 2YYEA 4IHJB 2L26A 3I56F 3C9RA 5LXTB 3K14A 3GTZA 5EB0A 3B6NA 1ONIA 1QVGF 3CCUF 5CA0B 3PAFA 4O4IA 5CB4B 1YJ9F 4C8EA 5J2UB 2UZHA 3FBAA 4O2AB 3CYQA 2BO1A 5ITZB 5GINC 3ZO8A 4B62A 5LYJB 2HRUA 5EAZA 5LP6C 4BVSA 3WGJA 4I4TA 1PF5A 4O4JA 4O2BA 3CCLF 4TV9A 3D00A 4ZOLA 4YJ3A 3WGLA 5J2TA 3F6MA 5EIBC 1W5AA 5LA6A 4I50A 4WBNA 1VQ5F 4NQ3A 3VCZA 2HQSC 3VTIC 3KE1A 5JVDA 1VQLF 2F9ZC 3C9TA 1JFFB 4ZI7A 3TD3A 3WGMA 3V7QA 3SIUA 3F0GA 2HP0B 3MDOA 4TUYB 4O4HB 2RB9A 3JALB 5AVMA 3E20B 3NK7A
chains in the Genus database with same CATH topology
1X25A 2CHTA 4ZK7A 1DBFA 1JD1A 3K12A 1PF5A 2CW4A 1NQ3A 3ZP7A 2UYNB 3LMEA 1FNJA 3D01A 2UYNA 4NWOB 2CSLA 2B33A 3GTZA 2UYPA 3M1XA 1XRGA 1QU9A 2DYYA 1J7HA 3ZOPA 5HP7A 2EWCA 1ONIA 3VCZA 5HP8A 2CVLA 2OTMA 1COMA 2UYKA 1UFYA 1ODEA 3KJJA 3LYBA 1UI9A 3I7TA 3QUWA 2CWJA 1XHOA 3I3FA 3MQWA 1QD9A 1QAHA 2CHSA 2UYJA 3K0TA 3KJKA 3L7QA 3M4SA 3V4DA 3ZO8A 2IG8A 1FNKA 3ZP4A 3R0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X25 A;  2CHT A;  4ZK7 A;  1DBF A;  1JD1 A;  3K12 A;  1PF5 A;  2CW4 A;  1NQ3 A;  3ZP7 A;  2UYN B;  3LME A;  1FNJ A;  3D01 A;  2UYN A;  4NWO B;  2CSL A;  2B33 A;  3GTZ A;  2UYP A;  3M1X A;  1XRG A;  1QU9 A;  2DYY A;  1J7H A;  3ZOP A;  5HP7 A;  2EWC A;  1ONI A;  3VCZ A;  5HP8 A;  2CVL A;  2OTM A;  1COM A;  2UYK A;  1UFY A;  1ODE A;  3KJJ A;  3LYB A;  1UI9 A;  3I7T A;  3QUW A;  2CWJ A;  1XHO A;  3I3F A;  3MQW A;  1QD9 A;  1QAH A;  2CHS A;  2UYJ A;  3K0T A;  3KJK A;  3L7Q A;  3M4S A;  3V4D A;  3ZO8 A;  2IG8 A;  1FNK A;  3ZP4 A;  3R0P A; 
#chains in the Genus database with same CATH topology
 3N2G B;  5G4U C;  1RA4 A;  1FSZ A;  4G4Y A;  3RYI B;  1TVK B;  1FNJ A;  3JAR B;  5MN4 A;  2HVY D;  1FFX B;  1W57 A;  4X3M A;  1YHQ F;  4G4X A;  1Q81 H;  2CVL A;  1U3P A;  3I55 F;  4X20 B;  1IPA A;  4C82 A;  3VMF B;  3CCV F;  1K8A H;  1W40 A;  1VQ9 F;  5LOV A;  5GON B;  2PMP A;  1Q86 H;  3V4D A;  5KMG B;  2ZAU A;  3WJR A;  5IYZ B;  4YJ2 A;  3ERN A;  4F6R B;  3VYT C;  3RA6 A;  2CZW A;  4EB6 A;  2B33 A;  3HWU A;  5C8Y B;  2BTO A;  2I6D A;  1DT9 A;  1QVF F;  4X1Y B;  1RLU A;  1COM A;  1ZWZ A;  3JAW B;  3HKC A;  3CCR F;  1SZQ A;  3JAM M;  4B46 A;  2QEX F;  2VAP A;  2FC3 A;  3S0W A;  3RYH B;  1IV4 A;  5CA1 A;  5EO3 A;  2LCA A;  3T80 A;  4B45 A;  3K2X A;  2VGN A;  3OW2 F;  3J81 M;  4NWO B;  4R40 B;  5JQG B;  2ZF8 A;  3S0H A;  3RE3 A;  3ON1 A;  5IJ9 B;  3WGK A;  4X3L A;  4LNU B;  4B5C A;  5B8F A;  3HKB A;  2OTM A;  1YI2 F;  1RQ7 A;  1IV3 A;  4U3J B;  4O4L B;  2CWJ A;  2GLZ A;  2N48 A;  1GO1 A;  2R6R 1;  4IIJ A;  1Z5W A;  4G4Z A;  2AIF A;  3KJK A;  4TV8 A;  4C8G A;  5FNV B;  2MQE A;  3E22 A;  2HP3 A;  5EB1 B;  3HJW C;  4M8I A;  1XBI A;  3WPX A;  5FJ4 C;  2Z1F A;  3CPQ A;  3S02 A;  4BT5 A;  3FPI A;  3P0Z A;  3TD5 A;  3GHZ A;  1X7P A;  3DDN A;  4O4I B;  1KNK A;  3RYC A;  1N8R H;  3JAK A;  5EYP A;  3OON A;  5IJ0 A;  3MQW A;  4BW0 B;  1JJ2 F;  3NVK E;  1FNK A;  4G4W A;  3HTN A;  1OAP A;  4I4T B;  4ERH A;  3JAS A;  3CCM F;  4O4J B;  3JCM M;  1K9M H;  4O2B B;  3MCQ A;  4TV9 B;  2VAM A;  4ZOL B;  3WPW A;  3E1Y A;  5HY1 A;  3VOB A;  5J2T B;  3CCE F;  1TUB A;  3D01 A;  3JAT B;  4I50 B;  5LA6 B;  2HS0 A;  4WBN B;  3FD5 A;  5BMV A;  4FFB A;  4KWE A;  2Z01 A;  5JVD B;  5A2Q M;  1ODE A;  3S06 A;  5KX5 A;  1Q82 H;  4RQO A;  4ZI7 B;  5CB4 A;  5HY0 A;  2QI2 A;  2I6R A;  3CCS F;  3WJP A;  2AMT A;  4O2A A;  5GAP K;  2CHS A;  3C9S A;  1RQ2 A;  5EWR A;  3OBW A;  1U3L A;  1T0A A;  2VGM A;  3VO8 A;  4C81 A;  5ITZ A;  2ZVY A;  3ZP4 A;  3LFO A;  5LYJ A;  3F0E A;  4X1K A;  4ZHV A;  3F0F A;  5DCV A;  2UYN B;  5GIP C;  2FGY A;  2ALE A;  3HKD A;  1Z5V A;  3UT5 B;  1YIJ F;  2Z1U A;  3U0O A;  3RA5 A;  3CB2 A;  1VQN F;  2Z1E A;  5LOV B;  4NUT A;  1VQ8 F;  4YJ2 B;  2HP0 A;  4TUY A;  3NMU C;  3PLA C;  3CME F;  1NMU B;  3N2K A;  2CHT A;  1JD1 A;  3QHD A;  4RHA A;  5EIB D;  3O85 A;  5EZY A;  4HNA A;  2IAF A;  1TVK A;  2H6L A;  1H47 A;  1NJI H;  2K1S A;  3DC2 A;  3IEW A;  3CMA F;  5HP8 A;  3MBM A;  3HKC B;  3KJJ A;  3BYQ A;  3ESJ A;  3JVH A;  1M90 H;  1W5B A;  3M4S A;  2KGW A;  1VK3 A;  5CA1 B;  5KMG A;  3FFM A;  1T0K B;  5JCO A;  3QTY A;  4C8I A;  2P6Y A;  4EI9 A;  4EI8 A;  4LCK A;  4I55 A;  2GZL A;  5IT9 M;  2JNB A;  2LBX A;  3CPW F;  1SA0 A;  3HKB B;  2GVI A;  1W59 A;  1YGY A;  4IIJ B;  2KG4 A;  2QA4 F;  3QUW A;  3CCQ F;  4X1I B;  1VHA A;  5MN6 A;  4TV8 B;  3E22 B;  4DRX A;  1VQM F;  3IKF A;  3WGN A;  2IG8 A;  3VOA A;  1IV1 A;  4ZHQ A;  5GAN K;  1YJW F;  1W3E X;  3N4Y A;  4G88 A;  1DBF A;  2CW4 A;  3RYF A;  3LME A;  3G71 F;  3VYU C;  3CG6 A;  2H8E A;  3EOR A;  3C8L A;  5HXU A;  3RYC B;  1W2B F;  3N4Z A;  1UFY A;  2HS3 A;  4BVT A;  1XV2 A;  4O4L A;  2BTQ B;  5HY4 A;  5LP6 A;  2VXY A;  2ZOD A;  1PXW A;  3HKE A;  1W42 A;  3WXM B;  3K0T A;  2OTL F;  1U43 A;  2Q1X A;  3MCA B;  3NK6 A;  2LBT A;  3CXC F;  1Q8R A;  2RHO A;  2H8C A;  1E7K A;  3VIU A;  4C4W C;  4BVR A;  3K12 A;  1TUB B;  1NQ3 A;  3VI6 A;  3IEQ A;  1VQ4 F;  4YJ3 B;  5JH7 A;  5G4V C;  5BMV B;  2YXZ A;  4IHJ A;  4FFB B;  3M1X A;  2UYP A;  5LXT A;  1IV2 A;  1QU9 A;  5HY2 A;  3V7E A;  5KX5 B;  3VYS C;  2UYK A;  3OBY A;  4XCQ A;  5MN5 A;  3LYB A;  4ZHW A;  3I7T A;  5CA0 A;  1S72 F;  3CD6 F;  3P10 A;  5J2U A;  2RHL A;  2Z1T A;  2UYJ A;  2Q1Y A;  3L7Q A;  1H48 A;  3KIZ A;  3J80 M;  4X1K B;  1CN7 A;  3CYP B;  3TD4 A;  5GIO C;  1X25 A;  2OZB A;  3LDT A;  4EI7 A;  2ZOV A;  3LWQ C;  3HKD B;  1CK2 A;  3M84 A;  1VQ6 F;  1VQV A;  3JAT A;  3S0Y A;  3G4S F;  1RLG A;  2EWC A;  3CC7 F;  2ZVZ A;  1H7M A;  1JFF A;  3CC2 F;  1YJN F;  3I3F A;  1YIT F;  1SDS A;  1QAH A;  2QTP A;  3ELC A;  5HWE A;  3N2K B;  3IKE A;  2KTV A;  2HX0 A;  4O4H A;  3JAL A;  5HXZ A;  5EZY B;  4HNA B;  3N2G A;  5FLX M;  4EB6 B;  2UYN A;  3J7A R;  2CSL A;  2G9I A;  2IQQ A;  1CLI A;  2WAL A;  3JAR A;  3RYI A;  4BY9 D;  2RHJ A;  1X52 A;  2DYY A;  2R75 1;  4G4V A;  3P4E A;  4PWT A;  1FFX A;  1OFU A;  3UT5 A;  3LWR C;  1VQK F;  4X20 A;  1GX1 A;  1W41 A;  3CC4 F;  3IMP A;  3WJQ A;  1R1M A;  4BT4 A;  4BT2 A;  3D54 A;  1X7O A;  2LBW A;  5GON A;  1W58 1;  2HS4 A;  5IYZ A;  3S03 A;  4F6R A;  4ZHY B;  1YQN A;  3F0D A;  4BVQ A;  4I55 B;  2OHW A;  3ZP7 A;  1K73 H;  1M1K H;  1W5F A;  1VH8 A;  1SA0 B;  1XRG A;  4DXD A;  5HP7 A;  5C8Y A;  2PHN A;  3FD6 A;  2V9Y A;  4E6E A;  2KTU A;  2NMU A;  4X1Y A;  1UI9 A;  1Q7Y H;  2AIZ P;  3JAW A;  1XHO A;  3LWV C;  4DRX B;  2RHH A;  2OTJ F;  3LWO C;  3SIV A;  3KHN A;  4ZHQ B;  1JN1 A;  1KD1 H;  1KQS F;  3RYH A;  3RYF B;  4BT3 A;  3HAX D;  3Q8H A;  3NVI B;  4BT6 A;  5JQG A;  1VQP F;  2BTU A;  5JCO C;  1J7H A;  2W8B C;  3ZOP A;  5IJ9 A;  3LWP C;  4LNU A;  1W5E A;  3JAK B;  3IR9 A;  5EYP B;  5LP6 B;  1JY8 A;  3CCJ F;  3HKE B;  3GYQ A;  5IJ0 B;  4X1I A;  4U3J A;  1KC8 H;  2DT4 A;  3G6E F;  1VQO F;  1W55 A;  1QD9 A;  4TZZ A;  1KNJ A;  2VAW A;  3AGK A;  4BT7 A;  4U39 A;  3C9U A;  3R0P A;  1GZ0 A;  5FNV A;  3JAS B;  1VQ7 F;  2HRY A;  3V3T A;  4ZK7 A;  1GO0 A;  5JH7 B;  1U40 A;  2YYE A;  4IHJ B;  2L26 A;  3I56 F;  3C9R A;  5LXT B;  3K14 A;  3GTZ A;  5EB0 A;  3B6N A;  1ONI A;  1QVG F;  3CCU F;  5CA0 B;  3PAF A;  4O4I A;  5CB4 B;  1YJ9 F;  4C8E A;  5J2U B;  2UZH A;  3FBA A;  4O2A B;  3CYQ A;  2BO1 A;  5ITZ B;  5GIN C;  3ZO8 A;  4B62 A;  5LYJ B;  2HRU A;  5EAZ A;  5LP6 C;  4BVS A;  3WGJ A;  4I4T A;  1PF5 A;  4O4J A;  4O2B A;  3CCL F;  4TV9 A;  3D00 A;  4ZOL A;  4YJ3 A;  3WGL A;  5J2T A;  3F6M A;  5EIB C;  1W5A A;  5LA6 A;  4I50 A;  4WBN A;  1VQ5 F;  4NQ3 A;  3VCZ A;  2HQS C;  3VTI C;  3KE1 A;  5JVD A;  1VQL F;  2F9Z C;  3C9T A;  1JFF B;  4ZI7 A;  3TD3 A;  3WGM A;  3V7Q A;  3SIU A;  3F0G A;  2HP0 B;  3MDO A;  4TUY B;  4O4H B;  2RB9 A;  3JAL B;  5AVM A;  3E20 B;  3NK7 A; 
#chains in the Genus database with same CATH homology
 1X25 A;  2CHT A;  4ZK7 A;  1DBF A;  1JD1 A;  3K12 A;  1PF5 A;  2CW4 A;  1NQ3 A;  3ZP7 A;  2UYN B;  3LME A;  1FNJ A;  3D01 A;  2UYN A;  4NWO B;  2CSL A;  2B33 A;  3GTZ A;  2UYP A;  3M1X A;  1XRG A;  1QU9 A;  2DYY A;  1J7H A;  3ZOP A;  5HP7 A;  2EWC A;  1ONI A;  3VCZ A;  5HP8 A;  2CVL A;  2OTM A;  1COM A;  2UYK A;  1UFY A;  1ODE A;  3KJJ A;  3LYB A;  1UI9 A;  3I7T A;  3QUW A;  2CWJ A;  1XHO A;  3I3F A;  3MQW A;  1QD9 A;  1QAH A;  2CHS A;  2UYJ A;  3K0T A;  3KJK A;  3L7Q A;  3M4S A;  3V4D A;  3ZO8 A;  2IG8 A;  1FNK A;  3ZP4 A;  3R0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...