1XRGA

Conserved hypothetical protein from clostridium thermocellum cth-2968
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
YIEVVKTNKAPEAIGPYSQAIVTGSFVYTSGQIPINPQTGEVVDGGIEEQAKQVLENLKNVLEAAGSSLNKVVKTTVFIKDMDSFAKVNEVYAKYFSEPYPARSCVEVSKLPKGVLIEIEAVAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation initiation inhibitor, yjgF family
publication title Conserved hypothetical protein from Clostridium thermocellum Cth-2968
rcsb
source organism Clostridium thermocellum
molecule tags Structural genomics, unknown function
total genus 34
structure length 125
sequence length 125
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1xrgA00
2UYPA 2CW4A 1X25A 3I3FA 2DYYA 1QAHA 2CSLA 2CHSA 1ODEA 3K12A 1UI9A 5HP8A 3VCZA 1NQ3A 3K0TA 2B33A 3M1XA 3V4DA 3ZP7A 1XRGA 1COMA 3GTZA 3L7QA 1XHOA 3KJKA 3R0PA 2UYNA 1J7HA 1ONIA 3LYBA 2CWJA 3LMEA 2OTMA 3KJJA 3QUWA 2CVLA 3M4SA 3MQWA 1FNJA 1QD9A 1QU9A 2EWCA 2UYKA 1DBFA 4NWOB 5HP7A 3D01A 1FNKA 2CHTA 3ZP4A 3I7TA 1PF5A 2UYJA 2UYNB 3ZO8A 1UFYA 1JD1A 2IG8A 4ZK7A 3ZOPA
chains in the Genus database with same CATH superfamily
3HKDB 4ZI7A 3TD4A 3K12A 3ZO8A 1QAHA 3S0WA 3LWOC 1ODEA 3K0TA 3NK7A 5EB1B 4EI8A 4BT3A 3VYUC 5GIOC 1YQNA 4BT6A 3RYCA 1K9MH 3RE3A 3GHZA 3JALB 1H48A 1FFXA 1SA0B 3VYSC 5FJ4C 4U39A 5B8FA 2UYJA 2HP0A 3JASB 2MQEA 1KD1H 2IQQA 4B5CA 1Z5WA 4FFBB 2W8BC 3RYIA 1N8RH 4O2AB 3JATB 1Q7YH 2RB9A 4TUYB 1KNJA 5J2UA 1CK2A 3HKEA 2RHOA 3C8LA 3ON1A 3C9TA 3I56F 3SIVA 5C8YA 3CCJF 2UYKA 5AVMA 5LP6C 3J7AR 3V7EA 3JATA 4X1YB 2H8CA 4TUYA 2NMUA 5CA1A 4HNAA 1JD1A 3WGKA 4O4IB 5CA0B 5LP6A 2H6LA 3P0ZA 3TD5A 1XV2A 1Z5VA 4IIJA 3VTIC 1YI2F 4NQ3A 3OONA 1YITF 5GINC 4PWTA 2HQSC 1ONIA 5HWEA 3TD3A 3VYTC 3N2KA 1DT9A 1S72F 5JQGB 3M84A 3S02A 3F0EA 3CCVF 1GX1A 4O4JB 4BVSA 1K73H 1U3LA 1E7KA 4G4YA 1GO0A 3CG6A 3CYQA 4I4TB 3VO8A 1VQ9F 4X20A 2HX0A 2IG8A 2QTPA 3V3TA 5KMGB 1OAPA 4O4JA 3JAMM 1W41A 5JCOC 1H7MA 1U43A 3WXMB 4ZHWA 2P6YA 2AIFA 3HKCB 3VIUA 4TZZA 1FNJA 2GZLA 4G4VA 3VOAA 5EYPA 1IV2A 5HY2A 2CHTA 3WGNA 4IHJB 5EZYB 5KMGA 5GONA 3D00A 5LYJA 1VQVA 3CC7F 5LA6B 3HAXD 5DCVA 3E1YA 2RHJA 1ZWZA 2UYPA 3C9RA 3LFOA 1X25A 2K1SA 3CCRF 4E6EA 1CLIA 2HS4A 5HXUA 3CB2A 3KHNA 3V4DA 3OW2F 4B46A 2YYEA 3BYQA 1COMA 5EZYA 2BTUA 3HWUA 3RYFA 4YJ3B 3IKEA 4ZI7B 3Q8HA 5GANK 1W2BF 1RA4A 3RYHB 3KE1A 3D54A 3JCMM 1IV3A 5LOVA 1IV1A 1TVKA 2ZVYA 4O2BA 1VK3A 4BVQA 4G4WA 4TV9A 2V9YA 2YXZA 3S03A 1VHAA 4O4LA 3RYCB 3N4ZA 3ZOPA 2FC3A 3CCSF 3I3FA 2DYYA 3N4YA 1YJWF 3RYHA 1FFXB 4X1IA 1VQMF 4R40B 2R751 2HP0B 4C82A 5HY4A 2ZVZA 2BO1A 2OTMA 3C9UA 3RYIB 3HJWC 4NUTA 4B45A 5BMVA 1U3PA 5JVDA 3CCQF 2JNBA 3ELCA 5J2UB 3IEQA 1YHQF 2QA4F 3HKEB 5IJ0B 4TV8A 1VH8A 3IMPA 3WGLA 3T80A 4ZK7A 3G4SF 5C8YB 5JH7B 4I55A 2KTVA 4C8GA 4G88A 4M8IA 1CN7A 5GIPC 3V7QA 4HNAB 5CA1B 2KGWA 2GLZA 3IEWA 5IJ0A 1IV4A 1R1MA 2BTOA 3E22A 4KWEA 3PAFA 3JAWA 3FPIA 5LP6B 3F0GA 5MN4A 3CCUF 1VQ8F 4IIJB 3J80M 1NMUB 3N2GA 1DBFA 5JH7A 5EB0A 2AMTA 3CCLF 4LCKA 3S0YA 4I50A 1RLUA 3N2KB 1W5BA 3QHDA 5J2TA 3CCMF 3E20B 5MN6A 5G4VC 2ZOVA 4O4HA 5IJ9A 3AGKA 4X20B 2OTJF 2UYNA 3JAKA 1Q82H 3M4SA 3J81M 1W581 3S06A 3WGJA 5GAPK 1QD9A 3ESJA 3JARA 3D01A 1KC8H 1XBIA 4C8EA 2F9ZC 4DRXA 1PF5A 1M1KH 1T0KB 1VQ4F 4C8IA 2AIZP 3MCQA 3WJPA 2DT4A 2VAPA 4BVTA 1M90H 5EYPB 3DC2A 3F0DA 1T0AA 5GONB 5LYJB 3G6EF 1TUBA 5EIBD 2Z1TA 4BT7A 2VGMA 5ITZA 2KG4A 3U0OA 5JCOA 3RA6A 3ZP4A 2RHHA 2N48A 3PLAC 1JY8A 3NK6A 3RYFB 3ERNA 3EORA 1VQOF 2ZAUA 3WJQA 3S0HA 3G71F 4EI9A 5LOVB 1OFUA 2CW4A 2LBTA 4DXDA 5CB4A 1K8AH 4ZHQA 1TVKB 3VCZA 2I6RA 4O2BB 2B33A 3FFMA 4C81A 1SZQA 4F6RB 4TV9B 1KQSF 3OBWA 4O4LB 3UT5B 2Q1YA 2ZF8A 2PHNA 1JFFA 3P4EA 5IT9M 2VAWA 3KIZA 4X1IB 2Z1UA 4BVRA 4F6RA 3B6NA 4X3LA 3VI6A 1W57A 3UT5A 3JVHA 5BMVB 5EIBC 3CYPB 1QVGF 5JVDB 2LBXA 1RLGA 1XRGA 1W42A 3DDNA 4X3MA 3KJKA 4TV8B 3I55F 3NVKE 2VXYA 3OBYA 1SDSA 5EWRA 2HVYD 3IR9A 4I55B 1QU9A 2G9IA 4NWOB 3FBAA 5HXZA 2ZODA 4ZHYB 1PXWA 2LCAA 1W59A 5FNVA 3FD6A 5FLXM 4ZHVA 1YIJF 2FGYA 3E22B 3JAWB 4BY9D 3O85A 3N2GB 1U40A 2CSLA 4EB6A 1JN1A 1X7PA 4RHAA 4X1KB 3GTZA 3GYQA 1NJIH 4I50B 3MBMA 1RQ7A 1W5FA 4BT2A 2CWJA 5LXTA 3IKFA 5KX5A 5J2TB 2WALA 2Z1EA 3HKDA 4C4WC 5IJ9B 4O4HB 5EAZA 4U3JB 3FD5A 1KNKA 1FNKA 3QTYA 3WPXA 3LWPC 2UYNB 3F6MA 4X1KA 3JAKB 3CXCF 3VOBA 3VMFB 1H47A 2Z01A 5IYZB 2RHLA 2Q1XA 3JALA 3JARB 3M1XA 4ERHA 2HS3A 3ZP7A 4U3JA 1W3EX 4DRXB 1SA0A 1XHOA 2HRUA 3LYBA 3WPWA 3CMAF 4BT4A 3JASA 2H8EA 3MQWA 4FFBA 1VQKF 2EWCA 4B62A 3LWQC 1Q8RA 4O2AA 3F0FA 5IYZA 2R6R1 1TUBB 3MDOA 3NMUC 1UFYA 2UZHA 5ITZB 1VQPF 1JJ2F 2OZBA 2PMPA 5MN5A 2L26A 3CC4F 4WBNB 1VQNF 4X1YA 3R0PA 3CPWF 1J7HA 1Q81H 3LMEA 3KJJA 5HY1A 1YJNF 5CB4B 4O4IA 1RQ2A 4ZHQB 1W40A 2HP3A 5CA0A 2LBWA 1QVFF 1VQ6F 2HS0A 4G4XA 3I7TA 2BTQB 3WJRA 3LDTA 4LNUB 4WBNA 1JFFB 1GO1A 2VAMA 5JQGA 1UI9A 1NQ3A 1W5AA 1IPAA 1VQLF 3RA5A 2I6DA 2Z1FA 3CMEF 4EI7A 5A2QM 1X52A 4I4TA 3QUWA 4LNUA 3CC2F 3WGMA 3CPQA 1W5EA 5HP7A 2QI2A 3C9SA 1YGYA 3HKBB 1VQ5F 4BW0B 3CD6F 2ALEA 4RQOA 4YJ2B 1Q86H 2VGNA 5G4UC 3HKCA 5HP8A 2CHSA 2OHWA 3K14A 2CZWA 5EO3A 2IAFA 2HRYA 3CCEF 1X7OA 3NVIB 4IHJA 4ZOLB 5FNVB 1W55A 3HKBA 5HY0A 3SIUA 4YJ2A 5LA6A 3K2XA 1VQ7F 2CVLA 4G4ZA 2GVIA 3P10A 1FSZA 1GZ0A 1YJ9F 4EB6B 4BT5A 3LWRC 3HTNA 3LWVC 3MCAB 2KTUA 4XCQA 4ZOLA 5LXTB 2OTLF 2QEXF 5KX5B 4YJ3A 3L7QA
chains in the Genus database with same CATH topology
2UYPA 2CW4A 1X25A 3I3FA 2DYYA 1QAHA 2CSLA 2CHSA 1ODEA 3K12A 1UI9A 5HP8A 3VCZA 1NQ3A 3K0TA 2B33A 3M1XA 3V4DA 3ZP7A 1XRGA 1COMA 3GTZA 3L7QA 1XHOA 3KJKA 3R0PA 2UYNA 1J7HA 1ONIA 3LYBA 2CWJA 3LMEA 2OTMA 3KJJA 3QUWA 2CVLA 3M4SA 3MQWA 1FNJA 1QD9A 1QU9A 2EWCA 2UYKA 1DBFA 4NWOB 5HP7A 3D01A 1FNKA 2CHTA 3ZP4A 3I7TA 1PF5A 2UYJA 2UYNB 3ZO8A 1UFYA 1JD1A 2IG8A 4ZK7A 3ZOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UYP A;  2CW4 A;  1X25 A;  3I3F A;  2DYY A;  1QAH A;  2CSL A;  2CHS A;  1ODE A;  3K12 A;  1UI9 A;  5HP8 A;  3VCZ A;  1NQ3 A;  3K0T A;  2B33 A;  3M1X A;  3V4D A;  3ZP7 A;  1XRG A;  1COM A;  3GTZ A;  3L7Q A;  1XHO A;  3KJK A;  3R0P A;  2UYN A;  1J7H A;  1ONI A;  3LYB A;  2CWJ A;  3LME A;  2OTM A;  3KJJ A;  3QUW A;  2CVL A;  3M4S A;  3MQW A;  1FNJ A;  1QD9 A;  1QU9 A;  2EWC A;  2UYK A;  1DBF A;  4NWO B;  5HP7 A;  3D01 A;  1FNK A;  2CHT A;  3ZP4 A;  3I7T A;  1PF5 A;  2UYJ A;  2UYN B;  3ZO8 A;  1UFY A;  1JD1 A;  2IG8 A;  4ZK7 A;  3ZOP A; 
#chains in the Genus database with same CATH topology
 3HKD B;  4ZI7 A;  3TD4 A;  3K12 A;  3ZO8 A;  1QAH A;  3S0W A;  3LWO C;  1ODE A;  3K0T A;  3NK7 A;  5EB1 B;  4EI8 A;  4BT3 A;  3VYU C;  5GIO C;  1YQN A;  4BT6 A;  3RYC A;  1K9M H;  3RE3 A;  3GHZ A;  3JAL B;  1H48 A;  1FFX A;  1SA0 B;  3VYS C;  5FJ4 C;  4U39 A;  5B8F A;  2UYJ A;  2HP0 A;  3JAS B;  2MQE A;  1KD1 H;  2IQQ A;  4B5C A;  1Z5W A;  4FFB B;  2W8B C;  3RYI A;  1N8R H;  4O2A B;  3JAT B;  1Q7Y H;  2RB9 A;  4TUY B;  1KNJ A;  5J2U A;  1CK2 A;  3HKE A;  2RHO A;  3C8L A;  3ON1 A;  3C9T A;  3I56 F;  3SIV A;  5C8Y A;  3CCJ F;  2UYK A;  5AVM A;  5LP6 C;  3J7A R;  3V7E A;  3JAT A;  4X1Y B;  2H8C A;  4TUY A;  2NMU A;  5CA1 A;  4HNA A;  1JD1 A;  3WGK A;  4O4I B;  5CA0 B;  5LP6 A;  2H6L A;  3P0Z A;  3TD5 A;  1XV2 A;  1Z5V A;  4IIJ A;  3VTI C;  1YI2 F;  4NQ3 A;  3OON A;  1YIT F;  5GIN C;  4PWT A;  2HQS C;  1ONI A;  5HWE A;  3TD3 A;  3VYT C;  3N2K A;  1DT9 A;  1S72 F;  5JQG B;  3M84 A;  3S02 A;  3F0E A;  3CCV F;  1GX1 A;  4O4J B;  4BVS A;  1K73 H;  1U3L A;  1E7K A;  4G4Y A;  1GO0 A;  3CG6 A;  3CYQ A;  4I4T B;  3VO8 A;  1VQ9 F;  4X20 A;  2HX0 A;  2IG8 A;  2QTP A;  3V3T A;  5KMG B;  1OAP A;  4O4J A;  3JAM M;  1W41 A;  5JCO C;  1H7M A;  1U43 A;  3WXM B;  4ZHW A;  2P6Y A;  2AIF A;  3HKC B;  3VIU A;  4TZZ A;  1FNJ A;  2GZL A;  4G4V A;  3VOA A;  5EYP A;  1IV2 A;  5HY2 A;  2CHT A;  3WGN A;  4IHJ B;  5EZY B;  5KMG A;  5GON A;  3D00 A;  5LYJ A;  1VQV A;  3CC7 F;  5LA6 B;  3HAX D;  5DCV A;  3E1Y A;  2RHJ A;  1ZWZ A;  2UYP A;  3C9R A;  3LFO A;  1X25 A;  2K1S A;  3CCR F;  4E6E A;  1CLI A;  2HS4 A;  5HXU A;  3CB2 A;  3KHN A;  3V4D A;  3OW2 F;  4B46 A;  2YYE A;  3BYQ A;  1COM A;  5EZY A;  2BTU A;  3HWU A;  3RYF A;  4YJ3 B;  3IKE A;  4ZI7 B;  3Q8H A;  5GAN K;  1W2B F;  1RA4 A;  3RYH B;  3KE1 A;  3D54 A;  3JCM M;  1IV3 A;  5LOV A;  1IV1 A;  1TVK A;  2ZVY A;  4O2B A;  1VK3 A;  4BVQ A;  4G4W A;  4TV9 A;  2V9Y A;  2YXZ A;  3S03 A;  1VHA A;  4O4L A;  3RYC B;  3N4Z A;  3ZOP A;  2FC3 A;  3CCS F;  3I3F A;  2DYY A;  3N4Y A;  1YJW F;  3RYH A;  1FFX B;  4X1I A;  1VQM F;  4R40 B;  2R75 1;  2HP0 B;  4C82 A;  5HY4 A;  2ZVZ A;  2BO1 A;  2OTM A;  3C9U A;  3RYI B;  3HJW C;  4NUT A;  4B45 A;  5BMV A;  1U3P A;  5JVD A;  3CCQ F;  2JNB A;  3ELC A;  5J2U B;  3IEQ A;  1YHQ F;  2QA4 F;  3HKE B;  5IJ0 B;  4TV8 A;  1VH8 A;  3IMP A;  3WGL A;  3T80 A;  4ZK7 A;  3G4S F;  5C8Y B;  5JH7 B;  4I55 A;  2KTV A;  4C8G A;  4G88 A;  4M8I A;  1CN7 A;  5GIP C;  3V7Q A;  4HNA B;  5CA1 B;  2KGW A;  2GLZ A;  3IEW A;  5IJ0 A;  1IV4 A;  1R1M A;  2BTO A;  3E22 A;  4KWE A;  3PAF A;  3JAW A;  3FPI A;  5LP6 B;  3F0G A;  5MN4 A;  3CCU F;  1VQ8 F;  4IIJ B;  3J80 M;  1NMU B;  3N2G A;  1DBF A;  5JH7 A;  5EB0 A;  2AMT A;  3CCL F;  4LCK A;  3S0Y A;  4I50 A;  1RLU A;  3N2K B;  1W5B A;  3QHD A;  5J2T A;  3CCM F;  3E20 B;  5MN6 A;  5G4V C;  2ZOV A;  4O4H A;  5IJ9 A;  3AGK A;  4X20 B;  2OTJ F;  2UYN A;  3JAK A;  1Q82 H;  3M4S A;  3J81 M;  1W58 1;  3S06 A;  3WGJ A;  5GAP K;  1QD9 A;  3ESJ A;  3JAR A;  3D01 A;  1KC8 H;  1XBI A;  4C8E A;  2F9Z C;  4DRX A;  1PF5 A;  1M1K H;  1T0K B;  1VQ4 F;  4C8I A;  2AIZ P;  3MCQ A;  3WJP A;  2DT4 A;  2VAP A;  4BVT A;  1M90 H;  5EYP B;  3DC2 A;  3F0D A;  1T0A A;  5GON B;  5LYJ B;  3G6E F;  1TUB A;  5EIB D;  2Z1T A;  4BT7 A;  2VGM A;  5ITZ A;  2KG4 A;  3U0O A;  5JCO A;  3RA6 A;  3ZP4 A;  2RHH A;  2N48 A;  3PLA C;  1JY8 A;  3NK6 A;  3RYF B;  3ERN A;  3EOR A;  1VQO F;  2ZAU A;  3WJQ A;  3S0H A;  3G71 F;  4EI9 A;  5LOV B;  1OFU A;  2CW4 A;  2LBT A;  4DXD A;  5CB4 A;  1K8A H;  4ZHQ A;  1TVK B;  3VCZ A;  2I6R A;  4O2B B;  2B33 A;  3FFM A;  4C81 A;  1SZQ A;  4F6R B;  4TV9 B;  1KQS F;  3OBW A;  4O4L B;  3UT5 B;  2Q1Y A;  2ZF8 A;  2PHN A;  1JFF A;  3P4E A;  5IT9 M;  2VAW A;  3KIZ A;  4X1I B;  2Z1U A;  4BVR A;  4F6R A;  3B6N A;  4X3L A;  3VI6 A;  1W57 A;  3UT5 A;  3JVH A;  5BMV B;  5EIB C;  3CYP B;  1QVG F;  5JVD B;  2LBX A;  1RLG A;  1XRG A;  1W42 A;  3DDN A;  4X3M A;  3KJK A;  4TV8 B;  3I55 F;  3NVK E;  2VXY A;  3OBY A;  1SDS A;  5EWR A;  2HVY D;  3IR9 A;  4I55 B;  1QU9 A;  2G9I A;  4NWO B;  3FBA A;  5HXZ A;  2ZOD A;  4ZHY B;  1PXW A;  2LCA A;  1W59 A;  5FNV A;  3FD6 A;  5FLX M;  4ZHV A;  1YIJ F;  2FGY A;  3E22 B;  3JAW B;  4BY9 D;  3O85 A;  3N2G B;  1U40 A;  2CSL A;  4EB6 A;  1JN1 A;  1X7P A;  4RHA A;  4X1K B;  3GTZ A;  3GYQ A;  1NJI H;  4I50 B;  3MBM A;  1RQ7 A;  1W5F A;  4BT2 A;  2CWJ A;  5LXT A;  3IKF A;  5KX5 A;  5J2T B;  2WAL A;  2Z1E A;  3HKD A;  4C4W C;  5IJ9 B;  4O4H B;  5EAZ A;  4U3J B;  3FD5 A;  1KNK A;  1FNK A;  3QTY A;  3WPX A;  3LWP C;  2UYN B;  3F6M A;  4X1K A;  3JAK B;  3CXC F;  3VOB A;  3VMF B;  1H47 A;  2Z01 A;  5IYZ B;  2RHL A;  2Q1X A;  3JAL A;  3JAR B;  3M1X A;  4ERH A;  2HS3 A;  3ZP7 A;  4U3J A;  1W3E X;  4DRX B;  1SA0 A;  1XHO A;  2HRU A;  3LYB A;  3WPW A;  3CMA F;  4BT4 A;  3JAS A;  2H8E A;  3MQW A;  4FFB A;  1VQK F;  2EWC A;  4B62 A;  3LWQ C;  1Q8R A;  4O2A A;  3F0F A;  5IYZ A;  2R6R 1;  1TUB B;  3MDO A;  3NMU C;  1UFY A;  2UZH A;  5ITZ B;  1VQP F;  1JJ2 F;  2OZB A;  2PMP A;  5MN5 A;  2L26 A;  3CC4 F;  4WBN B;  1VQN F;  4X1Y A;  3R0P A;  3CPW F;  1J7H A;  1Q81 H;  3LME A;  3KJJ A;  5HY1 A;  1YJN F;  5CB4 B;  4O4I A;  1RQ2 A;  4ZHQ B;  1W40 A;  2HP3 A;  5CA0 A;  2LBW A;  1QVF F;  1VQ6 F;  2HS0 A;  4G4X A;  3I7T A;  2BTQ B;  3WJR A;  3LDT A;  4LNU B;  4WBN A;  1JFF B;  1GO1 A;  2VAM A;  5JQG A;  1UI9 A;  1NQ3 A;  1W5A A;  1IPA A;  1VQL F;  3RA5 A;  2I6D A;  2Z1F A;  3CME F;  4EI7 A;  5A2Q M;  1X52 A;  4I4T A;  3QUW A;  4LNU A;  3CC2 F;  3WGM A;  3CPQ A;  1W5E A;  5HP7 A;  2QI2 A;  3C9S A;  1YGY A;  3HKB B;  1VQ5 F;  4BW0 B;  3CD6 F;  2ALE A;  4RQO A;  4YJ2 B;  1Q86 H;  2VGN A;  5G4U C;  3HKC A;  5HP8 A;  2CHS A;  2OHW A;  3K14 A;  2CZW A;  5EO3 A;  2IAF A;  2HRY A;  3CCE F;  1X7O A;  3NVI B;  4IHJ A;  4ZOL B;  5FNV B;  1W55 A;  3HKB A;  5HY0 A;  3SIU A;  4YJ2 A;  5LA6 A;  3K2X A;  1VQ7 F;  2CVL A;  4G4Z A;  2GVI A;  3P10 A;  1FSZ A;  1GZ0 A;  1YJ9 F;  4EB6 B;  4BT5 A;  3LWR C;  3HTN A;  3LWV C;  3MCA B;  2KTU A;  4XCQ A;  4ZOL A;  5LXT B;  2OTL F;  2QEX F;  5KX5 B;  4YJ3 A;  3L7Q A; 
#chains in the Genus database with same CATH homology
 2UYP A;  2CW4 A;  1X25 A;  3I3F A;  2DYY A;  1QAH A;  2CSL A;  2CHS A;  1ODE A;  3K12 A;  1UI9 A;  5HP8 A;  3VCZ A;  1NQ3 A;  3K0T A;  2B33 A;  3M1X A;  3V4D A;  3ZP7 A;  1XRG A;  1COM A;  3GTZ A;  3L7Q A;  1XHO A;  3KJK A;  3R0P A;  2UYN A;  1J7H A;  1ONI A;  3LYB A;  2CWJ A;  3LME A;  2OTM A;  3KJJ A;  3QUW A;  2CVL A;  3M4S A;  3MQW A;  1FNJ A;  1QD9 A;  1QU9 A;  2EWC A;  2UYK A;  1DBF A;  4NWO B;  5HP7 A;  3D01 A;  1FNK A;  2CHT A;  3ZP4 A;  3I7T A;  1PF5 A;  2UYJ A;  2UYN B;  3ZO8 A;  1UFY A;  1JD1 A;  2IG8 A;  4ZK7 A;  3ZOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...