1XRGA

Conserved hypothetical protein from clostridium thermocellum cth-2968
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
YIEVVKTNKAPEAIGPYSQAIVTGSFVYTSGQIPINPQTGEVVDGGIEEQAKQVLENLKNVLEAAGSSLNKVVKTTVFIKDMDSFAKVNEVYAKYFSEPYPARSCVEVSKLPKGVLIEIEAVAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation initiation inhibitor, yjgF family
publication title Conserved hypothetical protein from Clostridium thermocellum Cth-2968
rcsb
source organism Clostridium thermocellum
molecule tags Structural genomics, unknown function
total genus 34
structure length 125
sequence length 125
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1xrgA00
2CWJA 2UYNB 1FNJA 1NQ3A 2UYNA 3QUWA 3VCZA 2CSLA 3ZO8A 2CHSA 3L7QA 2UYJA 2CW4A 1DBFA 1QD9A 1JD1A 2OTMA 1XRGA 2CHTA 1UI9A 1X25A 3I3FA 3K0TA 2IG8A 1QAHA 3GTZA 4NWOB 3KJKA 3ZOPA 1QU9A 3R0PA 2CVLA 2B33A 2EWCA 1UFYA 2UYKA 4ZK7A 1XHOA 3M4SA 5HP8A 1J7HA 2DYYA 3KJJA 3MQWA 3LMEA 3I7TA 1ONIA 3V4DA 1ODEA 2UYPA 3K12A 3LYBA 5HP7A 3D01A 3ZP4A 3ZP7A 1COMA 3M1XA 1FNKA 1PF5A
chains in the Genus database with same CATH superfamily
1FFXB 5IJ0A 3LWQC 2G9IA 3ZO8A 4BVRA 3CYPB 5A2QM 5LP6A 4M8IA 5BMVB 3DDNA 3E22B 3CB2A 4IIJA 1X52A 2VGNA 5JH7A 3C9UA 4B46A 3VMFB 5ITZA 5IYZA 3V7QA 1KNJA 3LWVC 2DT4A 3CMAF 3CC4F 5HP8A 5CA1B 1J7HA 4C8GA 4PWTA 3WGJA 3PLAC 4TV8B 2Z1EA 4DRXB 1H7MA 4O4IB 3ZP4A 2KTUA 1PF5A 4BVQA 1E7KA 3IR9A 1W3EX 5CA0B 1XRGA 3MDOA 3RE3A 2HRYA 5EAZA 4ZI7A 3AGKA 2LBWA 3JATB 3P10A 3CXCF 3CPWF 3C9TA 3HKCA 5LA6B 5EB1B 2LCAA 4E6EA 3G6EF 2DYYA 3VOBA 4X1KA 1R1MA 3RYHB 2HQSC 1YI2F 1W5BA 4WBNA 2HVYD 1SA0B 5EIBC 3CCEF 3LDTA 1NQ3A 4X3LA 5J2UA 2ZODA 2CW4A 1K73H 2CHTA 5EB0A 3WJPA 3LWOC 3S0WA 1NMUB 2HX0A 5MN5A 4RHAA 5CB4B 4O4LB 2W8BC 2B33A 2VXYA 2UZHA 3M4SA 4ZHWA 3TD5A 1YGYA 3C8LA 3RYFA 1GX1A 3VOAA 5C8YA 1VQ9F 3K12A 3JAWA 3RA5A 4I50A 3DC2A 3N2KB 2QEXF 5IJ0B 3F6MA 4YJ2A 1T0AA 1FNJA 5FLXM 3LWRC 1JFFA 1T0KB 2PMPA 4G4YA 3VI6A 1RQ2A 5G4VC 3WGKA 1FSZA 3TD3A 4IIJB 1H47A 5JH7B 4O2AB 3BYQA 5ITZB 1VQOF 3C9SA 4NWOB 2HP0A 2GLZA 5IYZB 3HTNA 4BVSA 2Z01A 2EWCA 5JCOA 3UT5B 3HJWC 1Z5VA 2I6DA 3IKFA 3D00A 2H8EA 4B5CA 1VQKF 3VTIC 3CCSF 1W57A 3JAKB 3MCAB 4NQ3A 3B6NA 2L26A 3N4YA 1YIJF 1W42A 3FD5A 3ESJA 2UYJA 1VQVA 4BT7A 5JQGA 3FBAA 1KD1H 1GO1A 4ZI7B 1UI9A 1X25A 2I6RA 5HY2A 3KHNA 2FC3A 3OBWA 3ERNA 1KQSF 2K1SA 4BY9D 3F0GA 3FFMA 4O4JA 4ZK7A 2IQQA 1SDSA 3E20B 2ALEA 4X1KB 3RYCA 3MCQA 1CK2A 3J7AR 1IPAA 4X1IA 3V4DA 5J2TA 1U40A 3M1XA 3E1YA 5J2UB 3T80A 5LOVA 3I3FA 3WJQA 4B45A 5EWRA 1YJNF 4C4WC 4FFBB 5IJ9A 2VAWA 4O2BA 3TD4A 3WGLA 3IEWA 4X1YA 2OZBA 3RYFB 3MQWA 5C8YB 5KMGA 3N2GA 3JAWB 2HS3A 4I50B 2YXZA 3CD6F 3HKBA 3I56F 4I55A 3ZP7A 1Q8RA 1X7OA 1TVKA 1JFFB 5HXUA 5JVDA 2CSLA 3RA6A 3WPWA 3S0YA 4YJ3A 3I55F 3NVKE 3FD6A 1W2BF 1Q86H 1NJIH 2HP0B 3JARA 2HS0A 5EYPB 3GYQA 1GZ0A 1Z5WA 2NMUA 2AIZP 1IV2A 1VQ4F 2VGMA 1IV4A 2HS4A 1N8RH 1CN7A 3F0DA 4TV9B 5EZYA 4TUYA 1VQ8F 5IT9M 2RB9A 5JQGB 1W59A 3L7QA 3JALB 2BTQB 4G4VA 1JD1A 2Z1FA 1Q81H 1SZQA 1TUBA 5MN6A 2WALA 3CCQF 4IHJA 4O4JB 2RHJA 5HXZA 1YJ9F 4ZHQB 4X1IB 4G4ZA 5J2TB 3OW2F 1VQ5F 1VQPF 1W40A 5GONA 3J81M 4U3JB 3LYBA 3VYSC 3M84A 2ZF8A 2N48A 3VYUC 4ZOLA 3WGMA 4X20A 1W5EA 4NUTA 3ON1A 2AIFA 2UYNA 1W5FA 3JAMM 4ZHVA 1DBFA 5LP6B 2OTMA 5LYJA 2LBXA 4XCQA 3E22A 1XV2A 5EO3A 5IJ9B 3G4SF 2Z1TA 1W55A 4BT2A 2H8CA 3CCUF 4X1YB 1U43A 1U3LA 5KMGB 1YJWF 3N2GB 2Q1YA 5HY0A 1RQ7A 3I7TA 3V7EA 3HKBB 5DCVA 2UYPA 2KGWA 4I55B 3C9RA 5FNVA 2JNBA 5HY1A 1TVKB 5JVDB 4BT6A 4YJ3B 2KG4A 5LXTA 2IAFA 3JARB 5KX5A 1M90H 1OFUA 3R0PA 2V9YA 2CVLA 3HKCB 3JASA 3HAXD 1S72F 4I4TA 3CG6A 1RLUA 2GZLA 1K8AH 4HNAA 1IV1A 1VQ7F 2F9ZC 3U0OA 1M1KH 1YITF 3NMUC 3CYQA 4WBNB 2AMTA 3D01A 2VAMA 5EZYB 3CPQA 4TUYB 5FJ4C 5MN4A 2R6R1 5GANK 1VQMF 1CLIA 3GHZA 2FGYA 3IEQA 3QUWA 2RHOA 2MQEA 4LNUA 2BTOA 2BO1A 1TUBB 3QTYA 1PXWA 5HY4A 3WPXA 4BT3A 3D54A 3GTZA 4IHJB 3KJKA 1XBIA 3Q8HA 4O4LA 3CCJF 2OTLF 3HKDA 4G4XA 3CCMF 3CCVF 3O85A 1IV3A 4ERHA 5GONB 3K2XA 1YQNA 3G71F 2BTUA 3S06A 1OAPA 4ZOLB 4B62A 4X20B 4YJ2B 1GO0A 2CWJA 2UYNB 3F0FA 2QA4F 4EI7A 4TZZA 1KNKA 5LYJB 5EIBD 1QD9A 1JY8A 3PAFA 2OTJF 4O2AA 3JCMM 1KC8H 4EI9A 4O4HA 3RYIA 3UT5A 2CZWA 3JVHA 3KJJA 3CCRF 4F6RA 2ZVZA 2R751 3LMEA 1ODEA 5FNVB 4BT4A 5HP7A 1YHQF 1JJ2F 1RA4A 4BVTA 3LWPC 2RHLA 3WGNA 4EB6A 3JAKA 3VCZA 2QI2A 2CHSA 5LXTB 5LP6C 1VK3A 5KX5B 1K9MH 3S0HA 4G88A 5AVMA 3JASB 3NVIB 4BT5A 4I4TB 3CCLF 1X7PA 4LCKA 3VYTC 2YYEA 3RYCB 5GIPC 4HNAB 3SIUA 3WJRA 3F0EA 4C81A 3NK7A 4ZHYB 3OBYA 3HKEA 3VIUA 4C8IA 2GVIA 3J80M 5GINC 3IMPA 1W581 3CC2F 1FFXA 4C8EA 4LNUB 3VO8A 1VQ6F 4R40B 4KWEA 3HWUA 5LOVB 3NK6A 2ZAUA 1QAHA 3LFOA 5BMVA 1FNKA 2LBTA 5GAPK 3OONA 4FFBA 3HKDB 4O2BB 3MBMA 3KE1A 3S03A 1ZWZA 1VQNF 3SIVA 5CA1A 3FPIA 1ONIA 1VHAA 4EI8A 2VAPA 1VQLF 4TV8A 4DRXA 3ELCA 2H6LA 4O4IA 4BW0B 3EORA 2QTPA 3N4ZA 4G4WA 3K0TA 5CA0A 1VH8A 2IG8A 4RQOA 2P6YA 4O4HB 3RYIB 3JATA 5EYPA 4DXDA 1Q82H 2HP3A 2UYKA 2Z1UA 1RLGA 5LA6A 1XHOA 4F6RB 1W5AA 3S02A 2ZVYA 3P0ZA 3RYHA 2OHWA 1H48A 1COMA 2HRUA 3IKEA 3QHDA 1Q7YH 4TV9A 5G4UC 3CMEF 4EB6B 1SA0A 3WXMB 3V3TA 3P4EA 1W41A 3JALA 5GIOC 2Q1XA 1QVFF 1U3PA 5HWEA 4U39A 1QU9A 5JCOC 2RHHA 5CB4A 1UFYA 2ZOVA 1DT9A 2KTVA 2PHNA 5B8FA 3CC7F 4ZHQA 4X3MA 3HKEB 3KIZA 4U3JA 1JN1A 3K14A 1QVGF 4C82A 3N2KA 3ZOPA
chains in the Genus database with same CATH topology
2CWJA 2UYNB 1FNJA 1NQ3A 2UYNA 3QUWA 3VCZA 2CSLA 3ZO8A 2CHSA 3L7QA 2UYJA 2CW4A 1DBFA 1QD9A 1JD1A 2OTMA 1XRGA 2CHTA 1UI9A 1X25A 3I3FA 3K0TA 2IG8A 1QAHA 3GTZA 4NWOB 3KJKA 3ZOPA 1QU9A 3R0PA 2CVLA 2B33A 2EWCA 1UFYA 2UYKA 4ZK7A 1XHOA 3M4SA 5HP8A 1J7HA 2DYYA 3KJJA 3MQWA 3LMEA 3I7TA 1ONIA 3V4DA 1ODEA 2UYPA 3K12A 3LYBA 5HP7A 3D01A 3ZP4A 3ZP7A 1COMA 3M1XA 1FNKA 1PF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWJ A;  2UYN B;  1FNJ A;  1NQ3 A;  2UYN A;  3QUW A;  3VCZ A;  2CSL A;  3ZO8 A;  2CHS A;  3L7Q A;  2UYJ A;  2CW4 A;  1DBF A;  1QD9 A;  1JD1 A;  2OTM A;  1XRG A;  2CHT A;  1UI9 A;  1X25 A;  3I3F A;  3K0T A;  2IG8 A;  1QAH A;  3GTZ A;  4NWO B;  3KJK A;  3ZOP A;  1QU9 A;  3R0P A;  2CVL A;  2B33 A;  2EWC A;  1UFY A;  2UYK A;  4ZK7 A;  1XHO A;  3M4S A;  5HP8 A;  1J7H A;  2DYY A;  3KJJ A;  3MQW A;  3LME A;  3I7T A;  1ONI A;  3V4D A;  1ODE A;  2UYP A;  3K12 A;  3LYB A;  5HP7 A;  3D01 A;  3ZP4 A;  3ZP7 A;  1COM A;  3M1X A;  1FNK A;  1PF5 A; 
#chains in the Genus database with same CATH topology
 1FFX B;  5IJ0 A;  3LWQ C;  2G9I A;  3ZO8 A;  4BVR A;  3CYP B;  5A2Q M;  5LP6 A;  4M8I A;  5BMV B;  3DDN A;  3E22 B;  3CB2 A;  4IIJ A;  1X52 A;  2VGN A;  5JH7 A;  3C9U A;  4B46 A;  3VMF B;  5ITZ A;  5IYZ A;  3V7Q A;  1KNJ A;  3LWV C;  2DT4 A;  3CMA F;  3CC4 F;  5HP8 A;  5CA1 B;  1J7H A;  4C8G A;  4PWT A;  3WGJ A;  3PLA C;  4TV8 B;  2Z1E A;  4DRX B;  1H7M A;  4O4I B;  3ZP4 A;  2KTU A;  1PF5 A;  4BVQ A;  1E7K A;  3IR9 A;  1W3E X;  5CA0 B;  1XRG A;  3MDO A;  3RE3 A;  2HRY A;  5EAZ A;  4ZI7 A;  3AGK A;  2LBW A;  3JAT B;  3P10 A;  3CXC F;  3CPW F;  3C9T A;  3HKC A;  5LA6 B;  5EB1 B;  2LCA A;  4E6E A;  3G6E F;  2DYY A;  3VOB A;  4X1K A;  1R1M A;  3RYH B;  2HQS C;  1YI2 F;  1W5B A;  4WBN A;  2HVY D;  1SA0 B;  5EIB C;  3CCE F;  3LDT A;  1NQ3 A;  4X3L A;  5J2U A;  2ZOD A;  2CW4 A;  1K73 H;  2CHT A;  5EB0 A;  3WJP A;  3LWO C;  3S0W A;  1NMU B;  2HX0 A;  5MN5 A;  4RHA A;  5CB4 B;  4O4L B;  2W8B C;  2B33 A;  2VXY A;  2UZH A;  3M4S A;  4ZHW A;  3TD5 A;  1YGY A;  3C8L A;  3RYF A;  1GX1 A;  3VOA A;  5C8Y A;  1VQ9 F;  3K12 A;  3JAW A;  3RA5 A;  4I50 A;  3DC2 A;  3N2K B;  2QEX F;  5IJ0 B;  3F6M A;  4YJ2 A;  1T0A A;  1FNJ A;  5FLX M;  3LWR C;  1JFF A;  1T0K B;  2PMP A;  4G4Y A;  3VI6 A;  1RQ2 A;  5G4V C;  3WGK A;  1FSZ A;  3TD3 A;  4IIJ B;  1H47 A;  5JH7 B;  4O2A B;  3BYQ A;  5ITZ B;  1VQO F;  3C9S A;  4NWO B;  2HP0 A;  2GLZ A;  5IYZ B;  3HTN A;  4BVS A;  2Z01 A;  2EWC A;  5JCO A;  3UT5 B;  3HJW C;  1Z5V A;  2I6D A;  3IKF A;  3D00 A;  2H8E A;  4B5C A;  1VQK F;  3VTI C;  3CCS F;  1W57 A;  3JAK B;  3MCA B;  4NQ3 A;  3B6N A;  2L26 A;  3N4Y A;  1YIJ F;  1W42 A;  3FD5 A;  3ESJ A;  2UYJ A;  1VQV A;  4BT7 A;  5JQG A;  3FBA A;  1KD1 H;  1GO1 A;  4ZI7 B;  1UI9 A;  1X25 A;  2I6R A;  5HY2 A;  3KHN A;  2FC3 A;  3OBW A;  3ERN A;  1KQS F;  2K1S A;  4BY9 D;  3F0G A;  3FFM A;  4O4J A;  4ZK7 A;  2IQQ A;  1SDS A;  3E20 B;  2ALE A;  4X1K B;  3RYC A;  3MCQ A;  1CK2 A;  3J7A R;  1IPA A;  4X1I A;  3V4D A;  5J2T A;  1U40 A;  3M1X A;  3E1Y A;  5J2U B;  3T80 A;  5LOV A;  3I3F A;  3WJQ A;  4B45 A;  5EWR A;  1YJN F;  4C4W C;  4FFB B;  5IJ9 A;  2VAW A;  4O2B A;  3TD4 A;  3WGL A;  3IEW A;  4X1Y A;  2OZB A;  3RYF B;  3MQW A;  5C8Y B;  5KMG A;  3N2G A;  3JAW B;  2HS3 A;  4I50 B;  2YXZ A;  3CD6 F;  3HKB A;  3I56 F;  4I55 A;  3ZP7 A;  1Q8R A;  1X7O A;  1TVK A;  1JFF B;  5HXU A;  5JVD A;  2CSL A;  3RA6 A;  3WPW A;  3S0Y A;  4YJ3 A;  3I55 F;  3NVK E;  3FD6 A;  1W2B F;  1Q86 H;  1NJI H;  2HP0 B;  3JAR A;  2HS0 A;  5EYP B;  3GYQ A;  1GZ0 A;  1Z5W A;  2NMU A;  2AIZ P;  1IV2 A;  1VQ4 F;  2VGM A;  1IV4 A;  2HS4 A;  1N8R H;  1CN7 A;  3F0D A;  4TV9 B;  5EZY A;  4TUY A;  1VQ8 F;  5IT9 M;  2RB9 A;  5JQG B;  1W59 A;  3L7Q A;  3JAL B;  2BTQ B;  4G4V A;  1JD1 A;  2Z1F A;  1Q81 H;  1SZQ A;  1TUB A;  5MN6 A;  2WAL A;  3CCQ F;  4IHJ A;  4O4J B;  2RHJ A;  5HXZ A;  1YJ9 F;  4ZHQ B;  4X1I B;  4G4Z A;  5J2T B;  3OW2 F;  1VQ5 F;  1VQP F;  1W40 A;  5GON A;  3J81 M;  4U3J B;  3LYB A;  3VYS C;  3M84 A;  2ZF8 A;  2N48 A;  3VYU C;  4ZOL A;  3WGM A;  4X20 A;  1W5E A;  4NUT A;  3ON1 A;  2AIF A;  2UYN A;  1W5F A;  3JAM M;  4ZHV A;  1DBF A;  5LP6 B;  2OTM A;  5LYJ A;  2LBX A;  4XCQ A;  3E22 A;  1XV2 A;  5EO3 A;  5IJ9 B;  3G4S F;  2Z1T A;  1W55 A;  4BT2 A;  2H8C A;  3CCU F;  4X1Y B;  1U43 A;  1U3L A;  5KMG B;  1YJW F;  3N2G B;  2Q1Y A;  5HY0 A;  1RQ7 A;  3I7T A;  3V7E A;  3HKB B;  5DCV A;  2UYP A;  2KGW A;  4I55 B;  3C9R A;  5FNV A;  2JNB A;  5HY1 A;  1TVK B;  5JVD B;  4BT6 A;  4YJ3 B;  2KG4 A;  5LXT A;  2IAF A;  3JAR B;  5KX5 A;  1M90 H;  1OFU A;  3R0P A;  2V9Y A;  2CVL A;  3HKC B;  3JAS A;  3HAX D;  1S72 F;  4I4T A;  3CG6 A;  1RLU A;  2GZL A;  1K8A H;  4HNA A;  1IV1 A;  1VQ7 F;  2F9Z C;  3U0O A;  1M1K H;  1YIT F;  3NMU C;  3CYQ A;  4WBN B;  2AMT A;  3D01 A;  2VAM A;  5EZY B;  3CPQ A;  4TUY B;  5FJ4 C;  5MN4 A;  2R6R 1;  5GAN K;  1VQM F;  1CLI A;  3GHZ A;  2FGY A;  3IEQ A;  3QUW A;  2RHO A;  2MQE A;  4LNU A;  2BTO A;  2BO1 A;  1TUB B;  3QTY A;  1PXW A;  5HY4 A;  3WPX A;  4BT3 A;  3D54 A;  3GTZ A;  4IHJ B;  3KJK A;  1XBI A;  3Q8H A;  4O4L A;  3CCJ F;  2OTL F;  3HKD A;  4G4X A;  3CCM F;  3CCV F;  3O85 A;  1IV3 A;  4ERH A;  5GON B;  3K2X A;  1YQN A;  3G71 F;  2BTU A;  3S06 A;  1OAP A;  4ZOL B;  4B62 A;  4X20 B;  4YJ2 B;  1GO0 A;  2CWJ A;  2UYN B;  3F0F A;  2QA4 F;  4EI7 A;  4TZZ A;  1KNK A;  5LYJ B;  5EIB D;  1QD9 A;  1JY8 A;  3PAF A;  2OTJ F;  4O2A A;  3JCM M;  1KC8 H;  4EI9 A;  4O4H A;  3RYI A;  3UT5 A;  2CZW A;  3JVH A;  3KJJ A;  3CCR F;  4F6R A;  2ZVZ A;  2R75 1;  3LME A;  1ODE A;  5FNV B;  4BT4 A;  5HP7 A;  1YHQ F;  1JJ2 F;  1RA4 A;  4BVT A;  3LWP C;  2RHL A;  3WGN A;  4EB6 A;  3JAK A;  3VCZ A;  2QI2 A;  2CHS A;  5LXT B;  5LP6 C;  1VK3 A;  5KX5 B;  1K9M H;  3S0H A;  4G88 A;  5AVM A;  3JAS B;  3NVI B;  4BT5 A;  4I4T B;  3CCL F;  1X7P A;  4LCK A;  3VYT C;  2YYE A;  3RYC B;  5GIP C;  4HNA B;  3SIU A;  3WJR A;  3F0E A;  4C81 A;  3NK7 A;  4ZHY B;  3OBY A;  3HKE A;  3VIU A;  4C8I A;  2GVI A;  3J80 M;  5GIN C;  3IMP A;  1W58 1;  3CC2 F;  1FFX A;  4C8E A;  4LNU B;  3VO8 A;  1VQ6 F;  4R40 B;  4KWE A;  3HWU A;  5LOV B;  3NK6 A;  2ZAU A;  1QAH A;  3LFO A;  5BMV A;  1FNK A;  2LBT A;  5GAP K;  3OON A;  4FFB A;  3HKD B;  4O2B B;  3MBM A;  3KE1 A;  3S03 A;  1ZWZ A;  1VQN F;  3SIV A;  5CA1 A;  3FPI A;  1ONI A;  1VHA A;  4EI8 A;  2VAP A;  1VQL F;  4TV8 A;  4DRX A;  3ELC A;  2H6L A;  4O4I A;  4BW0 B;  3EOR A;  2QTP A;  3N4Z A;  4G4W A;  3K0T A;  5CA0 A;  1VH8 A;  2IG8 A;  4RQO A;  2P6Y A;  4O4H B;  3RYI B;  3JAT A;  5EYP A;  4DXD A;  1Q82 H;  2HP3 A;  2UYK A;  2Z1U A;  1RLG A;  5LA6 A;  1XHO A;  4F6R B;  1W5A A;  3S02 A;  2ZVY A;  3P0Z A;  3RYH A;  2OHW A;  1H48 A;  1COM A;  2HRU A;  3IKE A;  3QHD A;  1Q7Y H;  4TV9 A;  5G4U C;  3CME F;  4EB6 B;  1SA0 A;  3WXM B;  3V3T A;  3P4E A;  1W41 A;  3JAL A;  5GIO C;  2Q1X A;  1QVF F;  1U3P A;  5HWE A;  4U39 A;  1QU9 A;  5JCO C;  2RHH A;  5CB4 A;  1UFY A;  2ZOV A;  1DT9 A;  2KTV A;  2PHN A;  5B8F A;  3CC7 F;  4ZHQ A;  4X3M A;  3HKE B;  3KIZ A;  4U3J A;  1JN1 A;  3K14 A;  1QVG F;  4C82 A;  3N2K A;  3ZOP A; 
#chains in the Genus database with same CATH homology
 2CWJ A;  2UYN B;  1FNJ A;  1NQ3 A;  2UYN A;  3QUW A;  3VCZ A;  2CSL A;  3ZO8 A;  2CHS A;  3L7Q A;  2UYJ A;  2CW4 A;  1DBF A;  1QD9 A;  1JD1 A;  2OTM A;  1XRG A;  2CHT A;  1UI9 A;  1X25 A;  3I3F A;  3K0T A;  2IG8 A;  1QAH A;  3GTZ A;  4NWO B;  3KJK A;  3ZOP A;  1QU9 A;  3R0P A;  2CVL A;  2B33 A;  2EWC A;  1UFY A;  2UYK A;  4ZK7 A;  1XHO A;  3M4S A;  5HP8 A;  1J7H A;  2DYY A;  3KJJ A;  3MQW A;  3LME A;  3I7T A;  1ONI A;  3V4D A;  1ODE A;  2UYP A;  3K12 A;  3LYB A;  5HP7 A;  3D01 A;  3ZP4 A;  3ZP7 A;  1COM A;  3M1X A;  1FNK A;  1PF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...