3F6MA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase ispf from yersinia pestis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
NAMRIGHGFDVHKFGENGSGPLIIGGVRIPYEKGLLAHSDGDVALHAATDALLGAAALGDIGKLFPDTDPAFKGADSRGLLREAYRRILAKGYKLGNLDITIIAQAPKMAPHIPQMRVNLAEDLQCHMDDINVKATTTEQLGFTGRGEGIACEAVVLLVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f6mA00
1JY8A 3K2XA 3ERNA 1IV1A 3MBMA 1VH8A 3RE3A 4C8EA 4C8GA 3ESJA 1GX1A 2AMTA 1W55A 3IKEA 3P0ZA 1H48A 1VHAA 2GZLA 1IV2A 4C8IA 3FBAA 2PMPA 1U3LA 3FPIA 1JN1A 3KE1A 4C81A 1U43A 3ELCA 1IV4A 1H47A 3F0GA 1T0AA 1U3PA 3T80A 3F0DA 1YQNA 1KNKA 3IEWA 3QHDA 4C82A 3F6MA 1W57A 2UZHA 3F0EA 3IEQA 3P10A 3EORA 3B6NA 3IKFA 3Q8HA 5B8FA 1KNJA 1IV3A 3F0FA 3K14A 3GHZA 3JVHA 1U40A
chains in the Genus database with same CATH superfamily
1W5BA 3MBMA 1FSZA 1OAPA 3OW2F 1VQ4F 4BT3A 5GINC 2YXZA 3G4SF 1W5EA 5LYJA 1SA0A 3CPWF 5MN4A 2OTLF 3ZP7A 5EAZA 1IV4A 1T0AA 5EWRA 3F0DA 5IYZA 1W3EX 2VAPA 3CC7F 2HP0B 4YJ3A 3K12A 3S0HA 3RYCA 4NWOB 1JJ2F 1KC8H 3CCUF 1DT9A 4ERHA 3SIVA 1VQKF 1UFYA 1QAHA 2Q1YA 3DDNA 3JAWB 5LXTA 3VOAA 5CA0B 3MQWA 1X25A 5BMVB 1H48A 4X1KB 4O2BA 2VXYA 2ZVYA 3CCSF 3UT5B 5J2UB 1UI9A 5EYPA 5LOVB 2JNBA 4HNAB 2KTVA 4U3JB 4R40B 3FFMA 1ONIA 4O4LB 3IR9A 3G6EF 3QHDA 1W57A 2CSLA 4G4ZA 2UZHA 3L7QA 3EORA 4I50A 3HKEA 3WXMB 5KMGB 5GIOC 3GHZA 2UYKA 2B33A 4ZOLA 3JARB 2F9ZC 3I3FA 4TV8A 2HRUA 3RYIA 1GO1A 3E22A 5CB4B 1XRGA 4B5CA 1OFUA 4O4HA 3FBAA 3CCJF 1M1KH 4FFBA 1TUBB 1TVKA 3RYFA 2CVLA 3WJRA 3S06A 2FGYA 2R6R1 3RYCB 2LBXA 4ZHYB 1YHQF 1VQ7F 1VQNF 3M84A 2CHSA 3VI6A 4F6RB 3QUWA 3O85A 4KWEA 2HP3A 2ZODA 3IEWA 4G4VA 2Z01A 1W5AA 1IV3A 5AVMA 4YJ2A 3JVHA 5KX5A 4RQOA 2IQQA 3RYHB 4O2AA 1YJ9F 3RA6A 1JD1A 3J80M 4TV9B 4U39A 3BYQA 1R1MA 3LWOC 4I50B 1H7MA 1U43A 2RHLA 3TD5A 3VOBA 3C8LA 4NQ3A 4WBNB 1NMUB 4ZOLB 5ITZB 1W5FA 5GONB 5FNVB 2I6RA 4BT2A 3DC2A 1JY8A 3CG6A 2GLZA 4O4HB 2HP0A 3HKDA 1GX1A 2VAWA 5IJ9B 4ZK7A 3LWPC 2LCAA 2NMUA 3C9UA 2UYNB 1U3LA 3HKCB 1CK2A 2ZVZA 3JAWA 5HXUA 3E1YA 5CA0A 4PWTA 2N48A 3U0OA 4ZHVA 1X7OA 3VMFB 2WALA 1Z5VA 1K8AH 1XBIA 3CXCF 5J2UA 5C8YB 3ON1A 2RHJA 4O2AB 5JH7B 5LOVA 4HNAA 4U3JA 2K1SA 2V9YA 2H8CA 1RLUA 4I4TA 4B46A 4O4LA 4O4JB 4ZI7B 5KMGA 5JCOC 3CD6F 3NMUC 4ZHQB 4G4XA 5EZYB 4X20B 1W41A 4BT6A 3JARA 3LMEA 1XV2A 1RQ7A 1W59A 3FD5A 1U3PA 5A2QM 5CB4A 3OBWA 2HRYA 3I7TA 1VQ9F 1TUBA 3CCRF 2UYJA 4BVQA 3P10A 3NVIB 3OBYA 2MQEA 3HKDB 3V3TA 3VO8A 4ZHWA 5EIBD 4F6RA 2KGWA 1VQ6F 4B62A 3ERNA 3RE3A 2ZAUA 4TUYB 4BT7A 5DCVA 3ESJA 1T0KB 4BT5A 5MN5A 1VQOF 3VIUA 3WGNA 5HP8A 3I56F 4DRXB 3N2GB 3HKBB 3G71F 2VAMA 3CC2F 4EB6B 1VK3A 3RYHA 1JN1A 5JVDB 1X52A 2QI2A 3CC4F 1COMA 2YYEA 1YQNA 3LWRC 4TV9A 1X7PA 4I4TB 2QEXF 1W2BF 4BT4A 3NK7A 5EO3A 1VQPF 3D54A 1CLIA 2OTMA 3LDTA 2H8EA 3TD4A 2Z1TA 1YIJF 3C9TA 3WJQA 1U40A 3IKEA 4WBNA 5G4UC 4X1IB 2AMTA 1CN7A 5ITZA 3C9SA 5GONA 5FNVA 5LP6C 4C8IA 2BTOA 3VYSC 1DBFA 3IMPA 1S72F 3MDOA 1Z5WA 3WGJA 1QVFF 2HS0A 4C81A 5IJ9A 3JASB 3F0GA 3ZP4A 4NUTA 1Q86H 2DT4A 5GAPK 2UYNA 3WGLA 3F6MA 3HKCA 3F0EA 4BVRA 5HP7A 1Q7YH 1K9MH 1W40A 2OHWA 1SZQA 3AGKA 3F0FA 3FD6A 5HXZA 5IT9M 5CA1B 1Q82H 1FFXB 5C8YA 3S02A 3HAXD 3V4DA 5JH7A 1JFFB 3P0ZA 1FNJA 1QD9A 4I55B 2CHTA 4E6EA 3CMAF 3JALB 4O4JA 3P4EA 4ZI7A 3MCQA 3LWQC 4BVSA 2BTUA 2ALEA 2LBWA 4ZHQA 5EZYA 5HWEA 4X20A 2RHOA 3JATB 2Z1UA 3D01A 3N2KB 3B6NA 3IKFA 3TD3A 2VGNA 4M8IA 1RQ2A 2UYPA 4C8GA 3V7QA 3K0TA 1M90H 2GZLA 1VHAA 2HS3A 4O4IB 2Z1FA 2G9IA 4X1YB 4TUYA 3J7AR 1ODEA 3KE1A 5LP6B 3C9RA 2RB9A 3T80A 3I55F 4DRXA 3N2GA 3NK6A 3VCZA 3HKBA 5LA6B 4EB6A 3ZOPA 4C4WC 5JVDA 1KNJA 3M1XA 3OONA 5HY0A 3R0PA 3MCAB 3CCLF 1VQMF 1PXWA 1N8RH 5FLXM 4X1IA 3GTZA 3WPWA 3KHNA 1YI2F 3N4ZA 5JCOA 3Q8HA 3CYQA 4G4WA 3VYUC 3JASA 2BTQB 4LCKA 3VTIC 1KQSF 2I6DA 3HWUA 5EB1B 3KIZA 3LYBA 5EIBC 2KTUA 4X3LA 1VQ8F 5IJ0A 2L26A 5MN6A 2W8BC 1VQLF 5G4VC 3FPIA 5CA1A 5J2TB 1FFXA 1JFFA 2OZBA 1ZWZA 3S0WA 1RA4A 4I55A 1RLGA 3QTYA 1J7HA 3JALA 4C82A 3CMEF 1Q8RA 4G88A 1XHOA 3CCEF 2R751 1W581 3K14A 2DYYA 4BY9D 1IV1A 3JATA 2CW4A 5JQGB 3N2KA 4EI8A 4RHAA 4DXDA 3WPXA 2HS4A 3VYTC 4IHJB 4LNUA 3WJPA 3HJWC 2QA4F 3SIUA 1GZ0A 1NQ3A 2CZWA 2RHHA 3WGKA 4IIJB 3KJKA 3S0YA 3LWVC 4O4IA 3PAFA 1VQVA 4X1YA 1FNKA 2Q1XA 2ZOVA 5LP6A 2FC3A 5LYJB 2BO1A 4EI7A 1SA0B 5IJ0B 2H6LA 5LA6A 2IAFA 3LFOA 2KG4A 1QU9A 2GVIA 1W55A 2AIFA 5GANK 3JAKA 4G4YA 3CYPB 5IYZB 3J81M 4YJ3B 3JCMM 1YJNF 1GO0A 1VQ5F 3RA5A 2EWCA 2AIZP 3KJJA 2LBTA 2OTJF 5LXTB 1QVGF 3CPQA 4O2BB 3E20B 3K2XA 2VGMA 4LNUB 1VH8A 1YGYA 2IG8A 5EYPB 4X3MA 1SDSA 1IV2A 1YITF 3NVKE 2PMPA 1YJWF 3CCMF 3N4YA 3HKEB 1E7KA 1PF5A 1KD1H 3S03A 3JAMM 5HY1A 3ELCA 1H47A 2CWJA 3CB2A 4BW0B 2P6YA 1K73H 4TV8B 5J2TA 3RYIB 5B8FA 2ZF8A 3E22B 4BVTA 4TZZA 3JAKB 3V7EA 4FFBB 4C8EA 1TVKB 3M4SA 3RYFB 4B45A 5FJ4C 3GYQA 3WGMA 2HQSC 3CCVF 5EB0A 5HY4A 1NJIH 3HTNA 5JQGA 3PLAC 2HVYD 5BMVA 3CCQF 1Q81H 4X1KA 4XCQA 4EI9A 3ZO8A 2HX0A 4YJ2B 1KNKA 4IHJA 5KX5B 2Z1EA 3UT5A 3IEQA 1W42A 2PHNA 3D00A 2QTPA 5GIPC 4IIJA 1IPAA 5HY2A
chains in the Genus database with same CATH topology
1JY8A 3K2XA 3ERNA 1IV1A 3MBMA 1VH8A 3RE3A 4C8EA 4C8GA 3ESJA 1GX1A 2AMTA 1W55A 3IKEA 3P0ZA 1H48A 1VHAA 2GZLA 1IV2A 4C8IA 3FBAA 2PMPA 1U3LA 3FPIA 1JN1A 3KE1A 4C81A 1U43A 3ELCA 1IV4A 1H47A 3F0GA 1T0AA 1U3PA 3T80A 3F0DA 1YQNA 1KNKA 3IEWA 3QHDA 4C82A 3F6MA 1W57A 2UZHA 3F0EA 3IEQA 3P10A 3EORA 3B6NA 3IKFA 3Q8HA 5B8FA 1KNJA 1IV3A 3F0FA 3K14A 3GHZA 3JVHA 1U40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY8 A;  3K2X A;  3ERN A;  1IV1 A;  3MBM A;  1VH8 A;  3RE3 A;  4C8E A;  4C8G A;  3ESJ A;  1GX1 A;  2AMT A;  1W55 A;  3IKE A;  3P0Z A;  1H48 A;  1VHA A;  2GZL A;  1IV2 A;  4C8I A;  3FBA A;  2PMP A;  1U3L A;  3FPI A;  1JN1 A;  3KE1 A;  4C81 A;  1U43 A;  3ELC A;  1IV4 A;  1H47 A;  3F0G A;  1T0A A;  1U3P A;  3T80 A;  3F0D A;  1YQN A;  1KNK A;  3IEW A;  3QHD A;  4C82 A;  3F6M A;  1W57 A;  2UZH A;  3F0E A;  3IEQ A;  3P10 A;  3EOR A;  3B6N A;  3IKF A;  3Q8H A;  5B8F A;  1KNJ A;  1IV3 A;  3F0F A;  3K14 A;  3GHZ A;  3JVH A;  1U40 A; 
#chains in the Genus database with same CATH topology
 1W5B A;  3MBM A;  1FSZ A;  1OAP A;  3OW2 F;  1VQ4 F;  4BT3 A;  5GIN C;  2YXZ A;  3G4S F;  1W5E A;  5LYJ A;  1SA0 A;  3CPW F;  5MN4 A;  2OTL F;  3ZP7 A;  5EAZ A;  1IV4 A;  1T0A A;  5EWR A;  3F0D A;  5IYZ A;  1W3E X;  2VAP A;  3CC7 F;  2HP0 B;  4YJ3 A;  3K12 A;  3S0H A;  3RYC A;  4NWO B;  1JJ2 F;  1KC8 H;  3CCU F;  1DT9 A;  4ERH A;  3SIV A;  1VQK F;  1UFY A;  1QAH A;  2Q1Y A;  3DDN A;  3JAW B;  5LXT A;  3VOA A;  5CA0 B;  3MQW A;  1X25 A;  5BMV B;  1H48 A;  4X1K B;  4O2B A;  2VXY A;  2ZVY A;  3CCS F;  3UT5 B;  5J2U B;  1UI9 A;  5EYP A;  5LOV B;  2JNB A;  4HNA B;  2KTV A;  4U3J B;  4R40 B;  3FFM A;  1ONI A;  4O4L B;  3IR9 A;  3G6E F;  3QHD A;  1W57 A;  2CSL A;  4G4Z A;  2UZH A;  3L7Q A;  3EOR A;  4I50 A;  3HKE A;  3WXM B;  5KMG B;  5GIO C;  3GHZ A;  2UYK A;  2B33 A;  4ZOL A;  3JAR B;  2F9Z C;  3I3F A;  4TV8 A;  2HRU A;  3RYI A;  1GO1 A;  3E22 A;  5CB4 B;  1XRG A;  4B5C A;  1OFU A;  4O4H A;  3FBA A;  3CCJ F;  1M1K H;  4FFB A;  1TUB B;  1TVK A;  3RYF A;  2CVL A;  3WJR A;  3S06 A;  2FGY A;  2R6R 1;  3RYC B;  2LBX A;  4ZHY B;  1YHQ F;  1VQ7 F;  1VQN F;  3M84 A;  2CHS A;  3VI6 A;  4F6R B;  3QUW A;  3O85 A;  4KWE A;  2HP3 A;  2ZOD A;  3IEW A;  4G4V A;  2Z01 A;  1W5A A;  1IV3 A;  5AVM A;  4YJ2 A;  3JVH A;  5KX5 A;  4RQO A;  2IQQ A;  3RYH B;  4O2A A;  1YJ9 F;  3RA6 A;  1JD1 A;  3J80 M;  4TV9 B;  4U39 A;  3BYQ A;  1R1M A;  3LWO C;  4I50 B;  1H7M A;  1U43 A;  2RHL A;  3TD5 A;  3VOB A;  3C8L A;  4NQ3 A;  4WBN B;  1NMU B;  4ZOL B;  5ITZ B;  1W5F A;  5GON B;  5FNV B;  2I6R A;  4BT2 A;  3DC2 A;  1JY8 A;  3CG6 A;  2GLZ A;  4O4H B;  2HP0 A;  3HKD A;  1GX1 A;  2VAW A;  5IJ9 B;  4ZK7 A;  3LWP C;  2LCA A;  2NMU A;  3C9U A;  2UYN B;  1U3L A;  3HKC B;  1CK2 A;  2ZVZ A;  3JAW A;  5HXU A;  3E1Y A;  5CA0 A;  4PWT A;  2N48 A;  3U0O A;  4ZHV A;  1X7O A;  3VMF B;  2WAL A;  1Z5V A;  1K8A H;  1XBI A;  3CXC F;  5J2U A;  5C8Y B;  3ON1 A;  2RHJ A;  4O2A B;  5JH7 B;  5LOV A;  4HNA A;  4U3J A;  2K1S A;  2V9Y A;  2H8C A;  1RLU A;  4I4T A;  4B46 A;  4O4L A;  4O4J B;  4ZI7 B;  5KMG A;  5JCO C;  3CD6 F;  3NMU C;  4ZHQ B;  4G4X A;  5EZY B;  4X20 B;  1W41 A;  4BT6 A;  3JAR A;  3LME A;  1XV2 A;  1RQ7 A;  1W59 A;  3FD5 A;  1U3P A;  5A2Q M;  5CB4 A;  3OBW A;  2HRY A;  3I7T A;  1VQ9 F;  1TUB A;  3CCR F;  2UYJ A;  4BVQ A;  3P10 A;  3NVI B;  3OBY A;  2MQE A;  3HKD B;  3V3T A;  3VO8 A;  4ZHW A;  5EIB D;  4F6R A;  2KGW A;  1VQ6 F;  4B62 A;  3ERN A;  3RE3 A;  2ZAU A;  4TUY B;  4BT7 A;  5DCV A;  3ESJ A;  1T0K B;  4BT5 A;  5MN5 A;  1VQO F;  3VIU A;  3WGN A;  5HP8 A;  3I56 F;  4DRX B;  3N2G B;  3HKB B;  3G71 F;  2VAM A;  3CC2 F;  4EB6 B;  1VK3 A;  3RYH A;  1JN1 A;  5JVD B;  1X52 A;  2QI2 A;  3CC4 F;  1COM A;  2YYE A;  1YQN A;  3LWR C;  4TV9 A;  1X7P A;  4I4T B;  2QEX F;  1W2B F;  4BT4 A;  3NK7 A;  5EO3 A;  1VQP F;  3D54 A;  1CLI A;  2OTM A;  3LDT A;  2H8E A;  3TD4 A;  2Z1T A;  1YIJ F;  3C9T A;  3WJQ A;  1U40 A;  3IKE A;  4WBN A;  5G4U C;  4X1I B;  2AMT A;  1CN7 A;  5ITZ A;  3C9S A;  5GON A;  5FNV A;  5LP6 C;  4C8I A;  2BTO A;  3VYS C;  1DBF A;  3IMP A;  1S72 F;  3MDO A;  1Z5W A;  3WGJ A;  1QVF F;  2HS0 A;  4C81 A;  5IJ9 A;  3JAS B;  3F0G A;  3ZP4 A;  4NUT A;  1Q86 H;  2DT4 A;  5GAP K;  2UYN A;  3WGL A;  3F6M A;  3HKC A;  3F0E A;  4BVR A;  5HP7 A;  1Q7Y H;  1K9M H;  1W40 A;  2OHW A;  1SZQ A;  3AGK A;  3F0F A;  3FD6 A;  5HXZ A;  5IT9 M;  5CA1 B;  1Q82 H;  1FFX B;  5C8Y A;  3S02 A;  3HAX D;  3V4D A;  5JH7 A;  1JFF B;  3P0Z A;  1FNJ A;  1QD9 A;  4I55 B;  2CHT A;  4E6E A;  3CMA F;  3JAL B;  4O4J A;  3P4E A;  4ZI7 A;  3MCQ A;  3LWQ C;  4BVS A;  2BTU A;  2ALE A;  2LBW A;  4ZHQ A;  5EZY A;  5HWE A;  4X20 A;  2RHO A;  3JAT B;  2Z1U A;  3D01 A;  3N2K B;  3B6N A;  3IKF A;  3TD3 A;  2VGN A;  4M8I A;  1RQ2 A;  2UYP A;  4C8G A;  3V7Q A;  3K0T A;  1M90 H;  2GZL A;  1VHA A;  2HS3 A;  4O4I B;  2Z1F A;  2G9I A;  4X1Y B;  4TUY A;  3J7A R;  1ODE A;  3KE1 A;  5LP6 B;  3C9R A;  2RB9 A;  3T80 A;  3I55 F;  4DRX A;  3N2G A;  3NK6 A;  3VCZ A;  3HKB A;  5LA6 B;  4EB6 A;  3ZOP A;  4C4W C;  5JVD A;  1KNJ A;  3M1X A;  3OON A;  5HY0 A;  3R0P A;  3MCA B;  3CCL F;  1VQM F;  1PXW A;  1N8R H;  5FLX M;  4X1I A;  3GTZ A;  3WPW A;  3KHN A;  1YI2 F;  3N4Z A;  5JCO A;  3Q8H A;  3CYQ A;  4G4W A;  3VYU C;  3JAS A;  2BTQ B;  4LCK A;  3VTI C;  1KQS F;  2I6D A;  3HWU A;  5EB1 B;  3KIZ A;  3LYB A;  5EIB C;  2KTU A;  4X3L A;  1VQ8 F;  5IJ0 A;  2L26 A;  5MN6 A;  2W8B C;  1VQL F;  5G4V C;  3FPI A;  5CA1 A;  5J2T B;  1FFX A;  1JFF A;  2OZB A;  1ZWZ A;  3S0W A;  1RA4 A;  4I55 A;  1RLG A;  3QTY A;  1J7H A;  3JAL A;  4C82 A;  3CME F;  1Q8R A;  4G88 A;  1XHO A;  3CCE F;  2R75 1;  1W58 1;  3K14 A;  2DYY A;  4BY9 D;  1IV1 A;  3JAT A;  2CW4 A;  5JQG B;  3N2K A;  4EI8 A;  4RHA A;  4DXD A;  3WPX A;  2HS4 A;  3VYT C;  4IHJ B;  4LNU A;  3WJP A;  3HJW C;  2QA4 F;  3SIU A;  1GZ0 A;  1NQ3 A;  2CZW A;  2RHH A;  3WGK A;  4IIJ B;  3KJK A;  3S0Y A;  3LWV C;  4O4I A;  3PAF A;  1VQV A;  4X1Y A;  1FNK A;  2Q1X A;  2ZOV A;  5LP6 A;  2FC3 A;  5LYJ B;  2BO1 A;  4EI7 A;  1SA0 B;  5IJ0 B;  2H6L A;  5LA6 A;  2IAF A;  3LFO A;  2KG4 A;  1QU9 A;  2GVI A;  1W55 A;  2AIF A;  5GAN K;  3JAK A;  4G4Y A;  3CYP B;  5IYZ B;  3J81 M;  4YJ3 B;  3JCM M;  1YJN F;  1GO0 A;  1VQ5 F;  3RA5 A;  2EWC A;  2AIZ P;  3KJJ A;  2LBT A;  2OTJ F;  5LXT B;  1QVG F;  3CPQ A;  4O2B B;  3E20 B;  3K2X A;  2VGM A;  4LNU B;  1VH8 A;  1YGY A;  2IG8 A;  5EYP B;  4X3M A;  1SDS A;  1IV2 A;  1YIT F;  3NVK E;  2PMP A;  1YJW F;  3CCM F;  3N4Y A;  3HKE B;  1E7K A;  1PF5 A;  1KD1 H;  3S03 A;  3JAM M;  5HY1 A;  3ELC A;  1H47 A;  2CWJ A;  3CB2 A;  4BW0 B;  2P6Y A;  1K73 H;  4TV8 B;  5J2T A;  3RYI B;  5B8F A;  2ZF8 A;  3E22 B;  4BVT A;  4TZZ A;  3JAK B;  3V7E A;  4FFB B;  4C8E A;  1TVK B;  3M4S A;  3RYF B;  4B45 A;  5FJ4 C;  3GYQ A;  3WGM A;  2HQS C;  3CCV F;  5EB0 A;  5HY4 A;  1NJI H;  3HTN A;  5JQG A;  3PLA C;  2HVY D;  5BMV A;  3CCQ F;  1Q81 H;  4X1K A;  4XCQ A;  4EI9 A;  3ZO8 A;  2HX0 A;  4YJ2 B;  1KNK A;  4IHJ A;  5KX5 B;  2Z1E A;  3UT5 A;  3IEQ A;  1W42 A;  2PHN A;  3D00 A;  2QTP A;  5GIP C;  4IIJ A;  1IPA A;  5HY2 A; 
#chains in the Genus database with same CATH homology
 1JY8 A;  3K2X A;  3ERN A;  1IV1 A;  3MBM A;  1VH8 A;  3RE3 A;  4C8E A;  4C8G A;  3ESJ A;  1GX1 A;  2AMT A;  1W55 A;  3IKE A;  3P0Z A;  1H48 A;  1VHA A;  2GZL A;  1IV2 A;  4C8I A;  3FBA A;  2PMP A;  1U3L A;  3FPI A;  1JN1 A;  3KE1 A;  4C81 A;  1U43 A;  3ELC A;  1IV4 A;  1H47 A;  3F0G A;  1T0A A;  1U3P A;  3T80 A;  3F0D A;  1YQN A;  1KNK A;  3IEW A;  3QHD A;  4C82 A;  3F6M A;  1W57 A;  2UZH A;  3F0E A;  3IEQ A;  3P10 A;  3EOR A;  3B6N A;  3IKF A;  3Q8H A;  5B8F A;  1KNJ A;  1IV3 A;  3F0F A;  3K14 A;  3GHZ A;  3JVH A;  1U40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...