3F6MA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase ispf from yersinia pestis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
NAMRIGHGFDVHKFGENGSGPLIIGGVRIPYEKGLLAHSDGDVALHAATDALLGAAALGDIGKLFPDTDPAFKGADSRGLLREAYRRILAKGYKLGNLDITIIAQAPKMAPHIPQMRVNLAEDLQCHMDDINVKATTTEQLGFTGRGEGIACEAVVLLVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF from Yersinia pestis
rcsb
source organism Yersinia pestis
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f6mA00
1U3PA 1H48A 3FBAA 3K2XA 1IV4A 4C8EA 3ELCA 1IV2A 5B8FA 1KNKA 2PMPA 3F0DA 3GHZA 3JVHA 1H47A 3QHDA 1VH8A 1KNJA 4C8IA 1IV3A 3F0GA 3IEWA 2UZHA 1T0AA 3ERNA 3T80A 4C8GA 3B6NA 1W57A 3Q8HA 2GZLA 1U40A 3K14A 1IV1A 1VHAA 3F0FA 3EORA 1U3LA 3IKFA 3RE3A 1YQNA 3P0ZA 3ESJA 3FPIA 3F0EA 3P10A 2AMTA 1GX1A 3F6MA 4C81A 3IEQA 3IKEA 1U43A 1JN1A 1JY8A 1W55A 3KE1A 3MBMA 4C82A
chains in the Genus database with same CATH superfamily
1H48A 3P4EA 2QTPA 1JJ2F 1IV4A 1SA0A 3JARA 1OAPA 4EI9A 4ERHA 3RA5A 1VQ5F 3CCJF 4EI7A 4I4TA 1VQMF 1IV3A 4YJ3B 2YYEA 4O4LA 5GONB 3JAWB 1PXWA 3NMUC 5EIBC 5HP8A 3RYIB 3CCLF 1W3EX 3HKCA 2ZODA 3HKBB 4NUTA 3JATB 2Z1TA 5LOVB 3F0EA 4TUYA 5IJ9B 2HQSC 3LWPC 2P6YA 5LP6C 4I50B 2L26A 1UI9A 4M8IA 4X1YA 3UT5B 3NK7A 3QUWA 1VQVA 4DXDA 3HJWC 3HKEB 4O4HA 2PMPA 5BMVA 1RA4A 2HS0A 2EWCA 4BT2A 5HY4A 1TVKB 2CW4A 1T0AA 3GTZA 4IHJA 5IJ0B 3VMFB 1J7HA 2GVIA 3VOAA 1ODEA 2Z01A 2H6LA 2I6RA 3JAMM 2HP0B 3LDTA 4ZHQA 3OBWA 4G4XA 4TV9B 4G4VA 1M1KH 4B46A 5IYZA 3N2GB 4ZI7A 3WGLA 3FD5A 3KJKA 2MQEA 3RYFA 3JALB 4BW0B 3JASA 5CA0B 4EI8A 1Q8RA 5J2TB 1W581 1W57A 2LCAA 4BT5A 5EYPA 3KIZA 1SDSA 1T0KB 2YXZA 4NWOB 5C8YA 1N8RH 5EO3A 4WBNA 3MCQA 3LWQC 2RB9A 3RYHA 1QVGF 3WPWA 3MDOA 5LA6B 3J81M 3KE1A 5LXTB 2Q1YA 1VQ6F 1W40A 3K2XA 5DCVA 4O4IB 4C8EA 4YJ2A 4O2BB 3D54A 3GHZA 5MN6A 1H47A 3CYPB 4X1KB 5FNVA 1W5EA 3I3FA 3S0YA 3FD6A 4C4WC 2BO1A 4I55B 3C9RA 3B6NA 1FNJA 3G4SF 2GLZA 2RHLA 3JAWA 3VO8A 4LCKA 1NMUB 4BVTA 3WJPA 3HKBA 3N4ZA 5LYJB 1RQ2A 2Z1UA 5GINC 1JN1A 1JY8A 1W55A 3WXMB 3TD3A 3PAFA 1GZ0A 4ZOLB 1JD1A 5G4VC 1W5AA 2UYNA 3CMEF 2RHJA 4RHAA 2CZWA 1S72F 3G71F 3F0DA 5ITZB 3JVHA 1VQ8F 2AIZP 2JNBA 4FFBB 3J7AR 3OBYA 3Q8HA 3S06A 3K14A 3F0FA 2CHTA 3V7QA 5IJ0A 1XRGA 1JFFB 3VIUA 2FC3A 3TD4A 2KTVA 4X20A 3WJQA 1U43A 2HP0A 3M4SA 2HX0A 3JAKB 2G9IA 5HY1A 1QVFF 2ZF8A 4G4YA 1UFYA 1Z5VA 1Q82H 1KC8H 1QD9A 1ZWZA 1GO0A 2F9ZC 3ZP7A 2OTMA 2CSLA 2ZVZA 4RQOA 3VOBA 4O2AA 3QTYA 3C9TA 4IIJB 1VQ9F 3VI6A 5CA0A 3VTIC 5CB4B 3S02A 2CHSA 5JH7A 1VQKF 4R40B 5J2UB 5EAZA 5KMGB 1H7MA 3ON1A 2HS4A 1X25A 1W5FA 5EZYB 3RYCB 3OONA 4BY9D 5HXUA 1RLGA 4O2BA 2HRYA 3V3TA 4O4JB 1FFXA 2N48A 3CPQA 4TZZA 2HVYD 3CMAF 1PF5A 3N2KB 3CB2A 3LWOC 2KTUA 3P0ZA 3FPIA 3CCEF 4HNAB 3M84A 5KX5A 3WJRA 5JQGB 5AVMA 5LP6B 3CCRF 4B45A 2OHWA 2LBTA 3ELCA 5B8FA 3I56F 1Q7YH 2H8CA 3C9SA 2VAWA 3IMPA 2HP3A 3HKDB 4DRXA 4U3JA 4F6RB 5ITZA 5GIOC 3TD5A 4TV8B 3CC2F 2RHOA 2NMUA 1Q86H 4ZHYB 3EORA 2ZAUA 3MCAB 3CXCF 2LBWA 3VYSC 1GX1A 4LNUA 1RQ7A 3IEQA 3IKEA 1SA0B 3JARB 1K8AH 3S0WA 3VCZA 1YHQF 3D01A 1CN7A 1U3PA 1YGYA 3C8LA 1IV2A 1YJ9F 3JCMM 3PLAC 1SZQA 3LMEA 2QEXF 2V9YA 3F0GA 1VQOF 1FSZA 3ERNA 3CCMF 2AIFA 1W5BA 3OW2F 1M90H 3CC7F 4YJ3A 4BVRA 3E22B 1U3LA 3IKFA 4X1IB 3RE3A 2VAMA 5GANK 1K9MH 5GONA 3ESJA 1CK2A 1TUBB 3RYIA 4BVSA 5JVDB 3WPXA 2PHNA 1X7OA 4O4HB 1VQPF 3JATA 3J80M 4BT7A 5LOVA 2ZVYA 5IJ9A 3I55F 5EWRA 1FNKA 1XV2A 3KJJA 4I50A 1CLIA 4IHJB 3UT5A 3L7QA 2RHHA 3D00A 1W59A 3HKEA 1YIJF 5HWEA 4ZHVA 3T80A 1E7KA 3IR9A 5FLXM 4G4ZA 2OTLF 1IV1A 1TVKA 4G88A 4ZHQB 4C81A 5IYZB 4ZI7B 4U39A 3WGJA 3RYFB 4HNAA 5EB1B 3WGMA 3E1YA 3KHNA 5EB0A 2QA4F 2I6DA 3QHDA 4TV9A 1KNJA 4C8IA 3N2GA 5EYPB 5HP7A 1VQ4F 3JALA 5C8YB 3CPWF 4C8GA 4WBNB 5FJ4C 3V7EA 5HY0A 1NJIH 4EB6B 5J2TA 2Z1FA 1YQNA 3S03A 5HXZA 2VXYA 3VYUC 2VGNA 1XHOA 3LYBA 3CCSF 1ONIA 4YJ2B 2KGWA 2VAPA 5CA1B 3MBMA 3BYQA 3K0TA 1YITF 2VGMA 3FBAA 2DYYA 5GAPK 2IG8A 5FNVB 2UYPA 5LA6A 5LXTA 1VQ7F 1VH8A 2Q1XA 4O4IA 3NVIB 4XCQA 1RLUA 5MN5A 4X1KA 1U40A 3HWUA 4I55A 1VQLF 2AMTA 1YJNF 5IT9M 3E22A 3F6MA 4X1IA 4BT4A 1QAHA 2UYNB 3CCVF 2BTUA 3CYQA 3VYTC 1TUBA 3ZOPA 5JVDA 3CD6F 5LYJA 1VK3A 2K1SA 3SIUA 4B5CA 1KNKA 4ZOLA 2R6R1 4KWEA 5MN4A 3S0HA 4X3MA 4NQ3A 1YI2F 1W42A 5A2QM 5JCOA 1VQNF 3ZP4A 4FFBA 4E6EA 4X20B 1XBIA 2W8BC 3HTNA 2UYKA 2ALEA 3C9UA 2H8EA 1X7PA 1YJWF 1JFFA 3LWRC 3WGNA 4ZK7A 3V4DA 4I4TB 4O2AB 1Z5WA 3MQWA 5EIBD 2CVLA 3U0OA 5G4UC 4O4LB 2B33A 3E20B 3FFMA 4BT3A 3JAKA 1W2BF 3I7TA 3HKCB 2BTOA 5JH7B 1GO1A 3LFOA 1QU9A 3CG6A 4TUYB 1VHAA 3O85A 2FGYA 1R1MA 1KD1H 4IIJA 4B62A 2LBXA 2CWJA 4EB6A 3CCUF 5CB4A 2HS3A 3AGKA 4X1YB 2OTJF 1DT9A 4BT6A 3ZO8A 5CA1A 3R0PA 5HY2A 5BMVB 5J2UA 3GYQA 5KMGA 1FFXB 5JCOC 1OFUA 5EZYA 3RYCA 2UZHA 2IAFA 2WALA 3M1XA 3CC4F 1IPAA 5KX5B 3HAXD 3N4YA 4O4JA 2Z1EA 1DBFA 3RA6A 3N2KA 3CCQF 1W41A 3DC2A 1COMA 1Q81H 2BTQB 1KQSF 3G6EF 3JASB 5JQGA 3LWVC 5LP6A 4DRXB 4U3JB 5GIPC 3NVKE 3NK6A 2QI2A 4BVQA 3K12A 2UYJA 4PWTA 3SIVA 3IEWA 4G4WA 2ZOVA 1K73H 3DDNA 2GZLA 4LNUB 3HKDA 2R751 2DT4A 3RYHB 4F6RA 2OZBA 4TV8A 4ZHWA 1NQ3A 3P10A 2HRUA 2IQQA 2KG4A 1X52A 3WGKA 4C82A 4X3LA
chains in the Genus database with same CATH topology
1U3PA 1H48A 3FBAA 3K2XA 1IV4A 4C8EA 3ELCA 1IV2A 5B8FA 1KNKA 2PMPA 3F0DA 3GHZA 3JVHA 1H47A 3QHDA 1VH8A 1KNJA 4C8IA 1IV3A 3F0GA 3IEWA 2UZHA 1T0AA 3ERNA 3T80A 4C8GA 3B6NA 1W57A 3Q8HA 2GZLA 1U40A 3K14A 1IV1A 1VHAA 3F0FA 3EORA 1U3LA 3IKFA 3RE3A 1YQNA 3P0ZA 3ESJA 3FPIA 3F0EA 3P10A 2AMTA 1GX1A 3F6MA 4C81A 3IEQA 3IKEA 1U43A 1JN1A 1JY8A 1W55A 3KE1A 3MBMA 4C82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3P A;  1H48 A;  3FBA A;  3K2X A;  1IV4 A;  4C8E A;  3ELC A;  1IV2 A;  5B8F A;  1KNK A;  2PMP A;  3F0D A;  3GHZ A;  3JVH A;  1H47 A;  3QHD A;  1VH8 A;  1KNJ A;  4C8I A;  1IV3 A;  3F0G A;  3IEW A;  2UZH A;  1T0A A;  3ERN A;  3T80 A;  4C8G A;  3B6N A;  1W57 A;  3Q8H A;  2GZL A;  1U40 A;  3K14 A;  1IV1 A;  1VHA A;  3F0F A;  3EOR A;  1U3L A;  3IKF A;  3RE3 A;  1YQN A;  3P0Z A;  3ESJ A;  3FPI A;  3F0E A;  3P10 A;  2AMT A;  1GX1 A;  3F6M A;  4C81 A;  3IEQ A;  3IKE A;  1U43 A;  1JN1 A;  1JY8 A;  1W55 A;  3KE1 A;  3MBM A;  4C82 A; 
#chains in the Genus database with same CATH topology
 1H48 A;  3P4E A;  2QTP A;  1JJ2 F;  1IV4 A;  1SA0 A;  3JAR A;  1OAP A;  4EI9 A;  4ERH A;  3RA5 A;  1VQ5 F;  3CCJ F;  4EI7 A;  4I4T A;  1VQM F;  1IV3 A;  4YJ3 B;  2YYE A;  4O4L A;  5GON B;  3JAW B;  1PXW A;  3NMU C;  5EIB C;  5HP8 A;  3RYI B;  3CCL F;  1W3E X;  3HKC A;  2ZOD A;  3HKB B;  4NUT A;  3JAT B;  2Z1T A;  5LOV B;  3F0E A;  4TUY A;  5IJ9 B;  2HQS C;  3LWP C;  2P6Y A;  5LP6 C;  4I50 B;  2L26 A;  1UI9 A;  4M8I A;  4X1Y A;  3UT5 B;  3NK7 A;  3QUW A;  1VQV A;  4DXD A;  3HJW C;  3HKE B;  4O4H A;  2PMP A;  5BMV A;  1RA4 A;  2HS0 A;  2EWC A;  4BT2 A;  5HY4 A;  1TVK B;  2CW4 A;  1T0A A;  3GTZ A;  4IHJ A;  5IJ0 B;  3VMF B;  1J7H A;  2GVI A;  3VOA A;  1ODE A;  2Z01 A;  2H6L A;  2I6R A;  3JAM M;  2HP0 B;  3LDT A;  4ZHQ A;  3OBW A;  4G4X A;  4TV9 B;  4G4V A;  1M1K H;  4B46 A;  5IYZ A;  3N2G B;  4ZI7 A;  3WGL A;  3FD5 A;  3KJK A;  2MQE A;  3RYF A;  3JAL B;  4BW0 B;  3JAS A;  5CA0 B;  4EI8 A;  1Q8R A;  5J2T B;  1W58 1;  1W57 A;  2LCA A;  4BT5 A;  5EYP A;  3KIZ A;  1SDS A;  1T0K B;  2YXZ A;  4NWO B;  5C8Y A;  1N8R H;  5EO3 A;  4WBN A;  3MCQ A;  3LWQ C;  2RB9 A;  3RYH A;  1QVG F;  3WPW A;  3MDO A;  5LA6 B;  3J81 M;  3KE1 A;  5LXT B;  2Q1Y A;  1VQ6 F;  1W40 A;  3K2X A;  5DCV A;  4O4I B;  4C8E A;  4YJ2 A;  4O2B B;  3D54 A;  3GHZ A;  5MN6 A;  1H47 A;  3CYP B;  4X1K B;  5FNV A;  1W5E A;  3I3F A;  3S0Y A;  3FD6 A;  4C4W C;  2BO1 A;  4I55 B;  3C9R A;  3B6N A;  1FNJ A;  3G4S F;  2GLZ A;  2RHL A;  3JAW A;  3VO8 A;  4LCK A;  1NMU B;  4BVT A;  3WJP A;  3HKB A;  3N4Z A;  5LYJ B;  1RQ2 A;  2Z1U A;  5GIN C;  1JN1 A;  1JY8 A;  1W55 A;  3WXM B;  3TD3 A;  3PAF A;  1GZ0 A;  4ZOL B;  1JD1 A;  5G4V C;  1W5A A;  2UYN A;  3CME F;  2RHJ A;  4RHA A;  2CZW A;  1S72 F;  3G71 F;  3F0D A;  5ITZ B;  3JVH A;  1VQ8 F;  2AIZ P;  2JNB A;  4FFB B;  3J7A R;  3OBY A;  3Q8H A;  3S06 A;  3K14 A;  3F0F A;  2CHT A;  3V7Q A;  5IJ0 A;  1XRG A;  1JFF B;  3VIU A;  2FC3 A;  3TD4 A;  2KTV A;  4X20 A;  3WJQ A;  1U43 A;  2HP0 A;  3M4S A;  2HX0 A;  3JAK B;  2G9I A;  5HY1 A;  1QVF F;  2ZF8 A;  4G4Y A;  1UFY A;  1Z5V A;  1Q82 H;  1KC8 H;  1QD9 A;  1ZWZ A;  1GO0 A;  2F9Z C;  3ZP7 A;  2OTM A;  2CSL A;  2ZVZ A;  4RQO A;  3VOB A;  4O2A A;  3QTY A;  3C9T A;  4IIJ B;  1VQ9 F;  3VI6 A;  5CA0 A;  3VTI C;  5CB4 B;  3S02 A;  2CHS A;  5JH7 A;  1VQK F;  4R40 B;  5J2U B;  5EAZ A;  5KMG B;  1H7M A;  3ON1 A;  2HS4 A;  1X25 A;  1W5F A;  5EZY B;  3RYC B;  3OON A;  4BY9 D;  5HXU A;  1RLG A;  4O2B A;  2HRY A;  3V3T A;  4O4J B;  1FFX A;  2N48 A;  3CPQ A;  4TZZ A;  2HVY D;  3CMA F;  1PF5 A;  3N2K B;  3CB2 A;  3LWO C;  2KTU A;  3P0Z A;  3FPI A;  3CCE F;  4HNA B;  3M84 A;  5KX5 A;  3WJR A;  5JQG B;  5AVM A;  5LP6 B;  3CCR F;  4B45 A;  2OHW A;  2LBT A;  3ELC A;  5B8F A;  3I56 F;  1Q7Y H;  2H8C A;  3C9S A;  2VAW A;  3IMP A;  2HP3 A;  3HKD B;  4DRX A;  4U3J A;  4F6R B;  5ITZ A;  5GIO C;  3TD5 A;  4TV8 B;  3CC2 F;  2RHO A;  2NMU A;  1Q86 H;  4ZHY B;  3EOR A;  2ZAU A;  3MCA B;  3CXC F;  2LBW A;  3VYS C;  1GX1 A;  4LNU A;  1RQ7 A;  3IEQ A;  3IKE A;  1SA0 B;  3JAR B;  1K8A H;  3S0W A;  3VCZ A;  1YHQ F;  3D01 A;  1CN7 A;  1U3P A;  1YGY A;  3C8L A;  1IV2 A;  1YJ9 F;  3JCM M;  3PLA C;  1SZQ A;  3LME A;  2QEX F;  2V9Y A;  3F0G A;  1VQO F;  1FSZ A;  3ERN A;  3CCM F;  2AIF A;  1W5B A;  3OW2 F;  1M90 H;  3CC7 F;  4YJ3 A;  4BVR A;  3E22 B;  1U3L A;  3IKF A;  4X1I B;  3RE3 A;  2VAM A;  5GAN K;  1K9M H;  5GON A;  3ESJ A;  1CK2 A;  1TUB B;  3RYI A;  4BVS A;  5JVD B;  3WPX A;  2PHN A;  1X7O A;  4O4H B;  1VQP F;  3JAT A;  3J80 M;  4BT7 A;  5LOV A;  2ZVY A;  5IJ9 A;  3I55 F;  5EWR A;  1FNK A;  1XV2 A;  3KJJ A;  4I50 A;  1CLI A;  4IHJ B;  3UT5 A;  3L7Q A;  2RHH A;  3D00 A;  1W59 A;  3HKE A;  1YIJ F;  5HWE A;  4ZHV A;  3T80 A;  1E7K A;  3IR9 A;  5FLX M;  4G4Z A;  2OTL F;  1IV1 A;  1TVK A;  4G88 A;  4ZHQ B;  4C81 A;  5IYZ B;  4ZI7 B;  4U39 A;  3WGJ A;  3RYF B;  4HNA A;  5EB1 B;  3WGM A;  3E1Y A;  3KHN A;  5EB0 A;  2QA4 F;  2I6D A;  3QHD A;  4TV9 A;  1KNJ A;  4C8I A;  3N2G A;  5EYP B;  5HP7 A;  1VQ4 F;  3JAL A;  5C8Y B;  3CPW F;  4C8G A;  4WBN B;  5FJ4 C;  3V7E A;  5HY0 A;  1NJI H;  4EB6 B;  5J2T A;  2Z1F A;  1YQN A;  3S03 A;  5HXZ A;  2VXY A;  3VYU C;  2VGN A;  1XHO A;  3LYB A;  3CCS F;  1ONI A;  4YJ2 B;  2KGW A;  2VAP A;  5CA1 B;  3MBM A;  3BYQ A;  3K0T A;  1YIT F;  2VGM A;  3FBA A;  2DYY A;  5GAP K;  2IG8 A;  5FNV B;  2UYP A;  5LA6 A;  5LXT A;  1VQ7 F;  1VH8 A;  2Q1X A;  4O4I A;  3NVI B;  4XCQ A;  1RLU A;  5MN5 A;  4X1K A;  1U40 A;  3HWU A;  4I55 A;  1VQL F;  2AMT A;  1YJN F;  5IT9 M;  3E22 A;  3F6M A;  4X1I A;  4BT4 A;  1QAH A;  2UYN B;  3CCV F;  2BTU A;  3CYQ A;  3VYT C;  1TUB A;  3ZOP A;  5JVD A;  3CD6 F;  5LYJ A;  1VK3 A;  2K1S A;  3SIU A;  4B5C A;  1KNK A;  4ZOL A;  2R6R 1;  4KWE A;  5MN4 A;  3S0H A;  4X3M A;  4NQ3 A;  1YI2 F;  1W42 A;  5A2Q M;  5JCO A;  1VQN F;  3ZP4 A;  4FFB A;  4E6E A;  4X20 B;  1XBI A;  2W8B C;  3HTN A;  2UYK A;  2ALE A;  3C9U A;  2H8E A;  1X7P A;  1YJW F;  1JFF A;  3LWR C;  3WGN A;  4ZK7 A;  3V4D A;  4I4T B;  4O2A B;  1Z5W A;  3MQW A;  5EIB D;  2CVL A;  3U0O A;  5G4U C;  4O4L B;  2B33 A;  3E20 B;  3FFM A;  4BT3 A;  3JAK A;  1W2B F;  3I7T A;  3HKC B;  2BTO A;  5JH7 B;  1GO1 A;  3LFO A;  1QU9 A;  3CG6 A;  4TUY B;  1VHA A;  3O85 A;  2FGY A;  1R1M A;  1KD1 H;  4IIJ A;  4B62 A;  2LBX A;  2CWJ A;  4EB6 A;  3CCU F;  5CB4 A;  2HS3 A;  3AGK A;  4X1Y B;  2OTJ F;  1DT9 A;  4BT6 A;  3ZO8 A;  5CA1 A;  3R0P A;  5HY2 A;  5BMV B;  5J2U A;  3GYQ A;  5KMG A;  1FFX B;  5JCO C;  1OFU A;  5EZY A;  3RYC A;  2UZH A;  2IAF A;  2WAL A;  3M1X A;  3CC4 F;  1IPA A;  5KX5 B;  3HAX D;  3N4Y A;  4O4J A;  2Z1E A;  1DBF A;  3RA6 A;  3N2K A;  3CCQ F;  1W41 A;  3DC2 A;  1COM A;  1Q81 H;  2BTQ B;  1KQS F;  3G6E F;  3JAS B;  5JQG A;  3LWV C;  5LP6 A;  4DRX B;  4U3J B;  5GIP C;  3NVK E;  3NK6 A;  2QI2 A;  4BVQ A;  3K12 A;  2UYJ A;  4PWT A;  3SIV A;  3IEW A;  4G4W A;  2ZOV A;  1K73 H;  3DDN A;  2GZL A;  4LNU B;  3HKD A;  2R75 1;  2DT4 A;  3RYH B;  4F6R A;  2OZB A;  4TV8 A;  4ZHW A;  1NQ3 A;  3P10 A;  2HRU A;  2IQQ A;  2KG4 A;  1X52 A;  3WGK A;  4C82 A;  4X3L A; 
#chains in the Genus database with same CATH homology
 1U3P A;  1H48 A;  3FBA A;  3K2X A;  1IV4 A;  4C8E A;  3ELC A;  1IV2 A;  5B8F A;  1KNK A;  2PMP A;  3F0D A;  3GHZ A;  3JVH A;  1H47 A;  3QHD A;  1VH8 A;  1KNJ A;  4C8I A;  1IV3 A;  3F0G A;  3IEW A;  2UZH A;  1T0A A;  3ERN A;  3T80 A;  4C8G A;  3B6N A;  1W57 A;  3Q8H A;  2GZL A;  1U40 A;  3K14 A;  1IV1 A;  1VHA A;  3F0F A;  3EOR A;  1U3L A;  3IKF A;  3RE3 A;  1YQN A;  3P0Z A;  3ESJ A;  3FPI A;  3F0E A;  3P10 A;  2AMT A;  1GX1 A;  3F6M A;  4C81 A;  3IEQ A;  3IKE A;  1U43 A;  1JN1 A;  1JY8 A;  1W55 A;  3KE1 A;  3MBM A;  4C82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...