3F6MA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase ispf from yersinia pestis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
NAMRIGHGFDVHKFGENGSGPLIIGGVRIPYEKGLLAHSDGDVALHAATDALLGAAALGDIGKLFPDTDPAFKGADSRGLLREAYRRILAKGYKLGNLDITIIAQAPKMAPHIPQMRVNLAEDLQCHMDDINVKATTTEQLGFTGRGEGIACEAVVLLVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f6mA00
3P10A 3K14A 3Q8HA 3RE3A 2PMPA 4C8EA 3IEWA 2UZHA 3KE1A 1U3PA 3IEQA 1IV2A 3FBAA 1IV1A 3QHDA 4C8GA 3K2XA 3ERNA 3MBMA 1H47A 1U40A 3F0DA 1W57A 1IV3A 1U43A 3F0FA 2GZLA 3EORA 4C8IA 4C82A 3ESJA 3FPIA 3IKEA 3T80A 1U3LA 3F0EA 1VH8A 3JVHA 5B8FA 3P0ZA 1IV4A 1W55A 4C81A 1T0AA 1YQNA 3F6MA 3GHZA 1JY8A 1KNJA 1VHAA 1GX1A 3ELCA 2AMTA 1KNKA 1JN1A 3F0GA 3B6NA 1H48A 3IKFA
chains in the Genus database with same CATH superfamily
4O2BA 5CA0A 2YXZA 4IIJA 3HKBB 4C8EA 1JD1A 2OTLF 5EIBC 4HNAB 5IYZB 1TVKB 3WJRA 2IAFA 5KMGB 3RYCB 4BVSA 4O4HB 3I55F 1U40A 1IV3A 1NMUB 4DRXB 3J80M 3HAXD 3CMAF 4I4TB 2HVYD 3NVIB 3JARB 2ZVYA 3LWOC 2HS4A 2IQQA 3P0ZA 4LNUA 3C9TA 1T0AA 4WBNA 1YQNA 2VAWA 4EI9A 2AMTA 1KD1H 1H7MA 3E20B 1FNJA 4BT6A 2ZF8A 3JASA 1ONIA 3LWRC 1W581 5HY4A 3GTZA 5CA1A 3ESJA 3L7QA 1JFFB 2MQEA 5IJ9B 1GO0A 1M90H 3T80A 5HXUA 4F6RA 4ZHQA 3NK6A 3F0EA 3VOAA 5J2TB 3ZO8A 1W2BF 3I3FA 1XRGA 1CN7A 4BT5A 5FLXM 1VQ4F 4TV8B 5LXTA 4F6RB 4ZHQB 3R0PA 3HKBA 3I56F 4XCQA 1U3PA 2HP0A 2N48A 5EYPB 4EI7A 5LOVB 3DDNA 4ZK7A 1YJWF 3WPXA 3ZOPA 3CYPB 2H8EA 1SDSA 1Q81H 5LA6A 3HKEA 3JAWB 3N2GA 3G6EF 3VYSC 5B8FA 3HKEB 3C9SA 5LOVA 2BTUA 2RHJA 3JAKB 4X1IB 1RLUA 3NMUC 1ODEA 4IHJA 4B45A 3CD6F 2HX0A 4YJ3A 2ZODA 4G4VA 5JVDA 1DBFA 2UZHA 2Z01A 3CB2A 5CA1B 3C9RA 5FNVB 4ZOLB 5EIBD 1VQ8F 2R751 3V7EA 4G4YA 3PLAC 3ZP4A 1W5EA 1DT9A 1XBIA 5HP8A 3QUWA 1UFYA 4ERHA 1W5AA 1Z5VA 1W55A 2GVIA 1FNKA 2LBTA 3HKDA 3K14A 5LXTB 1FFXA 4G88A 1COMA 5LA6B 1IV2A 3N2KA 1W40A 3VI6A 4WBNB 2HP0B 5EYPA 2QTPA 5HP7A 1YI2F 3TD3A 1RLGA 1W42A 3E1YA 2KTUA 5HWEA 3SIUA 3M84A 5J2UB 5GAPK 5ITZA 4TV9A 3CCVF 2Z1TA 2Z1UA 5ITZB 3WPWA 1GX1A 3CG6A 3VO8A 4B46A 2OTMA 2L26A 3CCQF 2PMPA 3JALB 3D01A 5C8YA 5G4UC 2I6DA 5JCOC 5EZYB 5LP6C 1GO1A 3CMEF 3VTIC 2P6YA 2BO1A 3FFMA 3IKEA 5EB1B 3K0TA 4C81A 4NWOB 3GHZA 3MDOA 1JY8A 5CB4A 4BW0B 1TVKA 1JN1A 3JAMM 5LYJB 1TUBA 2QI2A 5JH7B 5CA0B 4DRXA 3S02A 2QA4F 3KE1A 3RA6A 3WGLA 4R40B 4BVRA 3MBMA 1H47A 2CHSA 4BT3A 1VQPF 4C4WC 2GZLA 4IIJB 2VAPA 3NVKE 4B5CA 4YJ2A 1VQ9F 2F9ZC 2VXYA 3HTNA 1Q82H 2LBXA 1M1KH 5IJ0A 2W8BC 4TUYB 4X3LA 1S72F 2ZOVA 1SA0B 2K1SA 2HS0A 3HKCB 4X1YB 1NJIH 5A2QM 3RYHA 5AVMA 3QTYA 5JVDB 1OAPA 4TUYA 4C8GA 1KQSF 4LCKA 1VK3A 4RHAA 1OFUA 4EB6B 5C8YB 2HRYA 2GLZA 2Q1YA 3RYIA 5LP6B 5GIOC 3NK7A 3OBYA 3N4YA 1X7OA 3AGKA 2UYJA 1IV4A 3WJPA 4BVQA 4B62A 3HKDB 1W5FA 1ZWZA 2PHNA 3TD5A 3B6NA 5JQGB 3U0OA 1TUBB 5JH7A 3S0YA 1J7HA 4ZHYB 1NQ3A 4X20B 2OTJF 3M4SA 4I50A 5CB4B 2UYPA 1FFXB 1Z5WA 3CPWF 3E22B 1UI9A 4YJ2B 3VYUC 1N8RH 1VQLF 3HJWC 4C82A 3FPIA 3V4DA 2B33A 1YJNF 1QU9A 4U3JB 5J2UA 3VIUA 3F6MA 1VHAA 3F0GA 3LFOA 3CXCF 3KHNA 2OHWA 4G4XA 2ALEA 1Q86H 2WALA 3WGKA 1GZ0A 3HWUA 1YGYA 2KG4A 4I55A 4O4IB 2IG8A 3HKCA 4X1YA 3LDTA 3TD4A 2RHLA 1VQ6F 3S06A 3WJQA 3V7QA 3ZP7A 3S03A 3LWPC 2LBWA 2DYYA 2EWCA 1VQVA 1KC8H 1R1MA 5GANK 3VYTC 3VOBA 2H6LA 1VQKF 4O4IA 1KNJA 3G4SF 4DXDA 1X25A 1YHQF 5JQGA 3IMPA 5MN6A 5DCVA 4O4JB 5HY1A 1RQ7A 4NQ3A 4I50B 4BT4A 1JJ2F 5IYZA 4KWEA 2I6RA 2DT4A 4G4ZA 1IV1A 3QHDA 2HRUA 2JNBA 3ERNA 3LMEA 4O2BB 4EI8A 1W57A 2KTVA 4IHJB 2UYNA 1VQNF 4I4TA 3WGMA 3CCLF 2UYNB 4TZZA 2LCAA 3S0HA 1CLIA 3D54A 3MQWA 5BMVB 2FGYA 3UT5A 3K12A 2BTOA 4ZI7B 3MCAB 1K9MH 1H48A 3MCQA 2CZWA 3P10A 5FJ4C 2RHOA 4U3JA 5MN5A 1W41A 1RA4A 1IPAA 2BTQB 3JASB 2OZBA 3UT5B 4I55B 1X7PA 1XV2A 3KIZA 5EZYA 3C8LA 1Q7YH 1W5BA 4O4LB 1E7KA 3RYIB 5EB0A 3N4ZA 1VQMF 3CCJF 5HY0A 5IJ9A 3CPQA 2HQSC 3KJKA 4O2AB 3CYQA 2RHHA 5EAZA 4TV8A 2FC3A 5LP6A 4ZHWA 5J2TA 3VMFB 2HP3A 4O4LA 4PWTA 1PXWA 2CHTA 3N2KB 2Z1FA 3WGJA 2V9YA 2NMUA 4O4HA 3WGNA 1K8AH 3IEQA 3PAFA 3RA5A 4HNAA 3F0DA 3WXMB 2RB9A 2QEXF 4BVTA 1XHOA 2Q1XA 3OBWA 1CK2A 1U3LA 4LNUB 3V3TA 4ZHVA 5BMVA 3JAWA 3N2GB 5GONA 4X3MA 1K73H 2CSLA 3LYBA 5IJ0B 3LWVC 5GONB 1SZQA 5EWRA 3I7TA 1KNKA 3JATB 5IT9M 4X1KB 3RYFB 2G9IA 4NUTA 3FD6A 4E6EA 2HS3A 3Q8HA 3CC4F 3KJJA 1VQ5F 3JARA 5FNVA 4M8IA 2VGNA 3CC2F 5KX5A 1VQ7F 1W3EX 1QVFF 3K2XA 2CW4A 5HXZA 1VQOF 1JFFA 1U43A 3EORA 4C8IA 3CCSF 2KGWA 4ZOLA 4O4JA 4O2AA 1X52A 3P4EA 4EB6A 3J7AR 5KX5B 3ON1A 5LYJA 1PF5A 3OONA 5GINC 2YYEA 2AIZP 1YIJF 1QD9A 5EO3A 2H8CA 3FBAA 3E22A 2ZAUA 4U39A 1W59A 3OW2F 2UYKA 1SA0A 4TV9B 5G4VC 4BY9D 3IR9A 3CCEF 1RQ2A 3C9UA 2ZVZA 4YJ3B 5JCOA 5KMGA 3RYCA 4RQOA 2R6R1 1VH8A 3JVHA 3JALA 3JAKA 5GIPC 1YJ9F 3ELCA 4X1KA 3CCMF 2CVLA 3JATA 3M1XA 3RYHB 3CCUF 3RE3A 3G71F 1Q8RA 3DC2A 2AIFA 2VGMA 5MN4A 3IEWA 3O85A 3SIVA 4FFBB 5HY2A 1QAHA 3VCZA 3RYFA 1T0KB 3JCMM 4G4WA 4BT7A 3F0FA 4X1IA 3CC7F 2Z1EA 3LWQC 1YITF 4ZI7A 3CCRF 3GYQA 1FSZA 1QVGF 3S0WA 4FFBA 2VAMA 3FD5A 2CWJA 4BT2A 3J81M 3D00A 4X20A 3BYQA 3IKFA
chains in the Genus database with same CATH topology
3P10A 3K14A 3Q8HA 3RE3A 2PMPA 4C8EA 3IEWA 2UZHA 3KE1A 1U3PA 3IEQA 1IV2A 3FBAA 1IV1A 3QHDA 4C8GA 3K2XA 3ERNA 3MBMA 1H47A 1U40A 3F0DA 1W57A 1IV3A 1U43A 3F0FA 2GZLA 3EORA 4C8IA 4C82A 3ESJA 3FPIA 3IKEA 3T80A 1U3LA 3F0EA 1VH8A 3JVHA 5B8FA 3P0ZA 1IV4A 1W55A 4C81A 1T0AA 1YQNA 3F6MA 3GHZA 1JY8A 1KNJA 1VHAA 1GX1A 3ELCA 2AMTA 1KNKA 1JN1A 3F0GA 3B6NA 1H48A 3IKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P10 A;  3K14 A;  3Q8H A;  3RE3 A;  2PMP A;  4C8E A;  3IEW A;  2UZH A;  3KE1 A;  1U3P A;  3IEQ A;  1IV2 A;  3FBA A;  1IV1 A;  3QHD A;  4C8G A;  3K2X A;  3ERN A;  3MBM A;  1H47 A;  1U40 A;  3F0D A;  1W57 A;  1IV3 A;  1U43 A;  3F0F A;  2GZL A;  3EOR A;  4C8I A;  4C82 A;  3ESJ A;  3FPI A;  3IKE A;  3T80 A;  1U3L A;  3F0E A;  1VH8 A;  3JVH A;  5B8F A;  3P0Z A;  1IV4 A;  1W55 A;  4C81 A;  1T0A A;  1YQN A;  3F6M A;  3GHZ A;  1JY8 A;  1KNJ A;  1VHA A;  1GX1 A;  3ELC A;  2AMT A;  1KNK A;  1JN1 A;  3F0G A;  3B6N A;  1H48 A;  3IKF A; 
#chains in the Genus database with same CATH topology
 4O2B A;  5CA0 A;  2YXZ A;  4IIJ A;  3HKB B;  4C8E A;  1JD1 A;  2OTL F;  5EIB C;  4HNA B;  5IYZ B;  1TVK B;  3WJR A;  2IAF A;  5KMG B;  3RYC B;  4BVS A;  4O4H B;  3I55 F;  1U40 A;  1IV3 A;  1NMU B;  4DRX B;  3J80 M;  3HAX D;  3CMA F;  4I4T B;  2HVY D;  3NVI B;  3JAR B;  2ZVY A;  3LWO C;  2HS4 A;  2IQQ A;  3P0Z A;  4LNU A;  3C9T A;  1T0A A;  4WBN A;  1YQN A;  2VAW A;  4EI9 A;  2AMT A;  1KD1 H;  1H7M A;  3E20 B;  1FNJ A;  4BT6 A;  2ZF8 A;  3JAS A;  1ONI A;  3LWR C;  1W58 1;  5HY4 A;  3GTZ A;  5CA1 A;  3ESJ A;  3L7Q A;  1JFF B;  2MQE A;  5IJ9 B;  1GO0 A;  1M90 H;  3T80 A;  5HXU A;  4F6R A;  4ZHQ A;  3NK6 A;  3F0E A;  3VOA A;  5J2T B;  3ZO8 A;  1W2B F;  3I3F A;  1XRG A;  1CN7 A;  4BT5 A;  5FLX M;  1VQ4 F;  4TV8 B;  5LXT A;  4F6R B;  4ZHQ B;  3R0P A;  3HKB A;  3I56 F;  4XCQ A;  1U3P A;  2HP0 A;  2N48 A;  5EYP B;  4EI7 A;  5LOV B;  3DDN A;  4ZK7 A;  1YJW F;  3WPX A;  3ZOP A;  3CYP B;  2H8E A;  1SDS A;  1Q81 H;  5LA6 A;  3HKE A;  3JAW B;  3N2G A;  3G6E F;  3VYS C;  5B8F A;  3HKE B;  3C9S A;  5LOV A;  2BTU A;  2RHJ A;  3JAK B;  4X1I B;  1RLU A;  3NMU C;  1ODE A;  4IHJ A;  4B45 A;  3CD6 F;  2HX0 A;  4YJ3 A;  2ZOD A;  4G4V A;  5JVD A;  1DBF A;  2UZH A;  2Z01 A;  3CB2 A;  5CA1 B;  3C9R A;  5FNV B;  4ZOL B;  5EIB D;  1VQ8 F;  2R75 1;  3V7E A;  4G4Y A;  3PLA C;  3ZP4 A;  1W5E A;  1DT9 A;  1XBI A;  5HP8 A;  3QUW A;  1UFY A;  4ERH A;  1W5A A;  1Z5V A;  1W55 A;  2GVI A;  1FNK A;  2LBT A;  3HKD A;  3K14 A;  5LXT B;  1FFX A;  4G88 A;  1COM A;  5LA6 B;  1IV2 A;  3N2K A;  1W40 A;  3VI6 A;  4WBN B;  2HP0 B;  5EYP A;  2QTP A;  5HP7 A;  1YI2 F;  3TD3 A;  1RLG A;  1W42 A;  3E1Y A;  2KTU A;  5HWE A;  3SIU A;  3M84 A;  5J2U B;  5GAP K;  5ITZ A;  4TV9 A;  3CCV F;  2Z1T A;  2Z1U A;  5ITZ B;  3WPW A;  1GX1 A;  3CG6 A;  3VO8 A;  4B46 A;  2OTM A;  2L26 A;  3CCQ F;  2PMP A;  3JAL B;  3D01 A;  5C8Y A;  5G4U C;  2I6D A;  5JCO C;  5EZY B;  5LP6 C;  1GO1 A;  3CME F;  3VTI C;  2P6Y A;  2BO1 A;  3FFM A;  3IKE A;  5EB1 B;  3K0T A;  4C81 A;  4NWO B;  3GHZ A;  3MDO A;  1JY8 A;  5CB4 A;  4BW0 B;  1TVK A;  1JN1 A;  3JAM M;  5LYJ B;  1TUB A;  2QI2 A;  5JH7 B;  5CA0 B;  4DRX A;  3S02 A;  2QA4 F;  3KE1 A;  3RA6 A;  3WGL A;  4R40 B;  4BVR A;  3MBM A;  1H47 A;  2CHS A;  4BT3 A;  1VQP F;  4C4W C;  2GZL A;  4IIJ B;  2VAP A;  3NVK E;  4B5C A;  4YJ2 A;  1VQ9 F;  2F9Z C;  2VXY A;  3HTN A;  1Q82 H;  2LBX A;  1M1K H;  5IJ0 A;  2W8B C;  4TUY B;  4X3L A;  1S72 F;  2ZOV A;  1SA0 B;  2K1S A;  2HS0 A;  3HKC B;  4X1Y B;  1NJI H;  5A2Q M;  3RYH A;  5AVM A;  3QTY A;  5JVD B;  1OAP A;  4TUY A;  4C8G A;  1KQS F;  4LCK A;  1VK3 A;  4RHA A;  1OFU A;  4EB6 B;  5C8Y B;  2HRY A;  2GLZ A;  2Q1Y A;  3RYI A;  5LP6 B;  5GIO C;  3NK7 A;  3OBY A;  3N4Y A;  1X7O A;  3AGK A;  2UYJ A;  1IV4 A;  3WJP A;  4BVQ A;  4B62 A;  3HKD B;  1W5F A;  1ZWZ A;  2PHN A;  3TD5 A;  3B6N A;  5JQG B;  3U0O A;  1TUB B;  5JH7 A;  3S0Y A;  1J7H A;  4ZHY B;  1NQ3 A;  4X20 B;  2OTJ F;  3M4S A;  4I50 A;  5CB4 B;  2UYP A;  1FFX B;  1Z5W A;  3CPW F;  3E22 B;  1UI9 A;  4YJ2 B;  3VYU C;  1N8R H;  1VQL F;  3HJW C;  4C82 A;  3FPI A;  3V4D A;  2B33 A;  1YJN F;  1QU9 A;  4U3J B;  5J2U A;  3VIU A;  3F6M A;  1VHA A;  3F0G A;  3LFO A;  3CXC F;  3KHN A;  2OHW A;  4G4X A;  2ALE A;  1Q86 H;  2WAL A;  3WGK A;  1GZ0 A;  3HWU A;  1YGY A;  2KG4 A;  4I55 A;  4O4I B;  2IG8 A;  3HKC A;  4X1Y A;  3LDT A;  3TD4 A;  2RHL A;  1VQ6 F;  3S06 A;  3WJQ A;  3V7Q A;  3ZP7 A;  3S03 A;  3LWP C;  2LBW A;  2DYY A;  2EWC A;  1VQV A;  1KC8 H;  1R1M A;  5GAN K;  3VYT C;  3VOB A;  2H6L A;  1VQK F;  4O4I A;  1KNJ A;  3G4S F;  4DXD A;  1X25 A;  1YHQ F;  5JQG A;  3IMP A;  5MN6 A;  5DCV A;  4O4J B;  5HY1 A;  1RQ7 A;  4NQ3 A;  4I50 B;  4BT4 A;  1JJ2 F;  5IYZ A;  4KWE A;  2I6R A;  2DT4 A;  4G4Z A;  1IV1 A;  3QHD A;  2HRU A;  2JNB A;  3ERN A;  3LME A;  4O2B B;  4EI8 A;  1W57 A;  2KTV A;  4IHJ B;  2UYN A;  1VQN F;  4I4T A;  3WGM A;  3CCL F;  2UYN B;  4TZZ A;  2LCA A;  3S0H A;  1CLI A;  3D54 A;  3MQW A;  5BMV B;  2FGY A;  3UT5 A;  3K12 A;  2BTO A;  4ZI7 B;  3MCA B;  1K9M H;  1H48 A;  3MCQ A;  2CZW A;  3P10 A;  5FJ4 C;  2RHO A;  4U3J A;  5MN5 A;  1W41 A;  1RA4 A;  1IPA A;  2BTQ B;  3JAS B;  2OZB A;  3UT5 B;  4I55 B;  1X7P A;  1XV2 A;  3KIZ A;  5EZY A;  3C8L A;  1Q7Y H;  1W5B A;  4O4L B;  1E7K A;  3RYI B;  5EB0 A;  3N4Z A;  1VQM F;  3CCJ F;  5HY0 A;  5IJ9 A;  3CPQ A;  2HQS C;  3KJK A;  4O2A B;  3CYQ A;  2RHH A;  5EAZ A;  4TV8 A;  2FC3 A;  5LP6 A;  4ZHW A;  5J2T A;  3VMF B;  2HP3 A;  4O4L A;  4PWT A;  1PXW A;  2CHT A;  3N2K B;  2Z1F A;  3WGJ A;  2V9Y A;  2NMU A;  4O4H A;  3WGN A;  1K8A H;  3IEQ A;  3PAF A;  3RA5 A;  4HNA A;  3F0D A;  3WXM B;  2RB9 A;  2QEX F;  4BVT A;  1XHO A;  2Q1X A;  3OBW A;  1CK2 A;  1U3L A;  4LNU B;  3V3T A;  4ZHV A;  5BMV A;  3JAW A;  3N2G B;  5GON A;  4X3M A;  1K73 H;  2CSL A;  3LYB A;  5IJ0 B;  3LWV C;  5GON B;  1SZQ A;  5EWR A;  3I7T A;  1KNK A;  3JAT B;  5IT9 M;  4X1K B;  3RYF B;  2G9I A;  4NUT A;  3FD6 A;  4E6E A;  2HS3 A;  3Q8H A;  3CC4 F;  3KJJ A;  1VQ5 F;  3JAR A;  5FNV A;  4M8I A;  2VGN A;  3CC2 F;  5KX5 A;  1VQ7 F;  1W3E X;  1QVF F;  3K2X A;  2CW4 A;  5HXZ A;  1VQO F;  1JFF A;  1U43 A;  3EOR A;  4C8I A;  3CCS F;  2KGW A;  4ZOL A;  4O4J A;  4O2A A;  1X52 A;  3P4E A;  4EB6 A;  3J7A R;  5KX5 B;  3ON1 A;  5LYJ A;  1PF5 A;  3OON A;  5GIN C;  2YYE A;  2AIZ P;  1YIJ F;  1QD9 A;  5EO3 A;  2H8C A;  3FBA A;  3E22 A;  2ZAU A;  4U39 A;  1W59 A;  3OW2 F;  2UYK A;  1SA0 A;  4TV9 B;  5G4V C;  4BY9 D;  3IR9 A;  3CCE F;  1RQ2 A;  3C9U A;  2ZVZ A;  4YJ3 B;  5JCO A;  5KMG A;  3RYC A;  4RQO A;  2R6R 1;  1VH8 A;  3JVH A;  3JAL A;  3JAK A;  5GIP C;  1YJ9 F;  3ELC A;  4X1K A;  3CCM F;  2CVL A;  3JAT A;  3M1X A;  3RYH B;  3CCU F;  3RE3 A;  3G71 F;  1Q8R A;  3DC2 A;  2AIF A;  2VGM A;  5MN4 A;  3IEW A;  3O85 A;  3SIV A;  4FFB B;  5HY2 A;  1QAH A;  3VCZ A;  3RYF A;  1T0K B;  3JCM M;  4G4W A;  4BT7 A;  3F0F A;  4X1I A;  3CC7 F;  2Z1E A;  3LWQ C;  1YIT F;  4ZI7 A;  3CCR F;  3GYQ A;  1FSZ A;  1QVG F;  3S0W A;  4FFB A;  2VAM A;  3FD5 A;  2CWJ A;  4BT2 A;  3J81 M;  3D00 A;  4X20 A;  3BYQ A;  3IKF A; 
#chains in the Genus database with same CATH homology
 3P10 A;  3K14 A;  3Q8H A;  3RE3 A;  2PMP A;  4C8E A;  3IEW A;  2UZH A;  3KE1 A;  1U3P A;  3IEQ A;  1IV2 A;  3FBA A;  1IV1 A;  3QHD A;  4C8G A;  3K2X A;  3ERN A;  3MBM A;  1H47 A;  1U40 A;  3F0D A;  1W57 A;  1IV3 A;  1U43 A;  3F0F A;  2GZL A;  3EOR A;  4C8I A;  4C82 A;  3ESJ A;  3FPI A;  3IKE A;  3T80 A;  1U3L A;  3F0E A;  1VH8 A;  3JVH A;  5B8F A;  3P0Z A;  1IV4 A;  1W55 A;  4C81 A;  1T0A A;  1YQN A;  3F6M A;  3GHZ A;  1JY8 A;  1KNJ A;  1VHA A;  1GX1 A;  3ELC A;  2AMT A;  1KNK A;  1JN1 A;  3F0G A;  3B6N A;  1H48 A;  3IKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...