3F6MA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase ispf from yersinia pestis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
NAMRIGHGFDVHKFGENGSGPLIIGGVRIPYEKGLLAHSDGDVALHAATDALLGAAALGDIGKLFPDTDPAFKGADSRGLLREAYRRILAKGYKLGNLDITIIAQAPKMAPHIPQMRVNLAEDLQCHMDDINVKATTTEQLGFTGRGEGIACEAVVLLVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f6mA00
1IV3A 1W57A 3K14A 4C8EA 1KNKA 3IKFA 1W55A 3T80A 1T0AA 3IEQA 3FPIA 1IV4A 1VH8A 3ELCA 3F0GA 3B6NA 4C81A 1YQNA 3FBAA 1IV2A 1U3PA 3GHZA 4C8GA 1JN1A 3KE1A 1H48A 3EORA 3JVHA 3P10A 3IKEA 3RE3A 1U40A 3ESJA 1KNJA 2UZHA 1IV1A 3QHDA 3IEWA 2GZLA 3F0EA 3Q8HA 3MBMA 3ERNA 4C8IA 1H47A 1VHAA 1GX1A 1U43A 4C82A 3K2XA 3P0ZA 1U3LA 5B8FA 2PMPA 2AMTA 3F0DA 3F6MA 3F0FA 1JY8A
chains in the Genus database with same CATH superfamily
5JH7A 2ZF8A 2CHTA 1JD1A 2HP0A 4R40B 2VAMA 3E22B 2UYNA 2UYKA 3RA5A 3ZOPA 1IV4A 5CB4B 3FBAA 5J2TB 1TUBA 1RQ7A 5CA0B 3VI6A 3TD3A 5GANK 1Z5WA 4NWOB 5JVDB 3RE3A 4G4XA 3RA6A 1YJNF 4WBNA 4M8IA 3RYIB 1OFUA 1ONIA 2IAFA 3LWRC 2RHJA 2YXZA 1GX1A 5LP6B 2Z01A 5HP8A 3VCZA 3P0ZA 4ZHQB 5EO3A 2OTLF 3CB2A 2AMTA 3F0DA 5FNVB 3F0FA 3KHNA 1IV3A 3K12A 1VQ5F 3N2KA 3LWVC 2UYNB 5KMGA 3CPQA 3WGLA 5JQGB 4X1KB 3P10A 5LXTA 3JAKA 1KNJA 4ZOLB 5HY1A 5GONB 3CCMF 1KD1H 1T0KB 5EZYB 3LFOA 4PWTA 3LWQC 2ZVYA 3KIZA 4ZHYB 3CC2F 1QU9A 3HKDA 5HY4A 1PXWA 5IYZA 1YGYA 5EB0A 4F6RB 4WBNB 1VQNF 3CYPB 2PMPA 4O4JA 3WJRA 2QA4F 1W5EA 3LWOC 3VYUC 1YIJF 5HXUA 1VQOF 3RYIA 4BT2A 3ZO8A 5LYJA 2GLZA 4TV8A 3IKEA 2R751 2BTUA 4EB6A 4X1KA 4X1YA 3ESJA 3N2KB 1VQMF 4BVSA 2CW4A 4O4LA 5GONA 4BT6A 5LXTB 2RHOA 5LOVA 1VQVA 1OAPA 1U3LA 2NMUA 3HKBA 4O2AB 4ZHVA 5EZYA 2VGNA 2P6YA 2CHSA 3JASA 1W581 5LP6C 3S0HA 3WPWA 3I7TA 4F6RA 3PAFA 3B6NA 1RA4A 3DDNA 3WXMB 5BMVA 2L26A 3G4SF 1JN1A 4G4ZA 3EORA 1FNJA 4YJ3A 4DRXA 5FLXM 2HRYA 3O85A 3FFMA 1VHAA 4O4LB 5IJ9A 5HY0A 3RYFA 2B33A 3JAWA 1VQPF 5LOVB 4BT3A 3HAXD 3CCRF 5LYJB 4O2AA 3OONA 5EB1B 3CCSF 4EB6B 3S06A 3VYTC 3RYHA 1XBIA 3HKEA 2G9IA 4ZI7A 1ODEA 3CYQA 2Z1FA 1W5BA 2KG4A 1U3PA 1W3EX 2KTVA 5C8YB 5LA6A 1VQ4F 4O4HB 2LBXA 4O4IA 1QVGF 5IJ0A 4NQ3A 1VQ8F 2V9YA 2I6DA 3I55F 1FNKA 4DRXB 1DT9A 4YJ2B 1SA0B 2W8BC 3HJWC 1W42A 4IIJB 5MN4A 5HXZA 1RLGA 3CMAF 1YI2F 1H7MA 1W40A 1VH8A 3ELCA 3VMFB 4FFBA 3HKEB 1YQNA 4ZI7B 4G4YA 3VIUA 5IJ9B 2IG8A 5ITZA 2AIZP 1IPAA 3JALB 3JAKB 2DT4A 3OBWA 4B45A 2VAPA 5FJ4C 5EIBC 2WALA 5C8YA 3V3TA 2VXYA 3JAMM 3MDOA 3CMEF 1W59A 4I55A 3WGKA 1J7HA 5IJ0B 5A2QM 5J2UB 4HNAA 1UFYA 4TUYB 4ERHA 3HWUA 2LBTA 4BVQA 3RYCB 3E1YA 4B5CA 3KE1A 2HX0A 3G6EF 3HTNA 1U40A 5HY2A 2QI2A 3D00A 5G4VC 4X1YB 2BO1A 4FFBB 3CXCF 3F0EA 4IIJA 3Q8HA 3CD6F 4C82A 3NVIB 2I6RA 1GZ0A 3WJPA 1SZQA 3FD5A 3TD5A 2OHWA 4C8EA 3VTIC 5ITZB 5J2UA 1X7PA 1M90H 5MN6A 3FPIA 4TZZA 4XCQA 3S0YA 1RLUA 3FD6A 4ZHWA 1VQKF 1X25A 3NK6A 4DXDA 2BTOA 1GO1A 2JNBA 3JVHA 2IQQA 4I50B 1QAHA 4X3LA 3R0PA 3I56F 3S03A 4BVTA 3VYSC 4ZK7A 2VAWA 3K2XA 3PLAC 3MCQA 1NJIH 3JCMM 2KGWA 5J2TA 5GINC 3K14A 3N2GA 2H6LA 3N4YA 5CA1B 3WPXA 1W5FA 1ZWZA 2K1SA 3K0TA 1QVFF 5G4UC 1RQ2A 3SIVA 5EYPB 2ZOVA 3M1XA 3M84A 5KMGB 5LP6A 3BYQA 3JAWB 4E6EA 1Q81H 4RHAA 2UZHA 3MCAB 3CCJF 1Q82H 3IEWA 3WGMA 1COMA 1YITF 3DC2A 1JFFA 1YHQF 2Z1EA 4O2BB 5IYZB 1JY8A 4EI8A 3JATB 2HVYD 1TVKA 1KNKA 3J81M 2CZWA 4BVRA 3L7QA 1GO0A 3UT5B 3HKCA 3F0GA 1FFXB 5CA0A 3G71F 1XRGA 1H48A 5CA1A 4BT7A 2HS0A 4BT4A 4NUTA 3J80M 3CC7F 5EWRA 2CSLA 3MBMA 2Z1TA 3N4ZA 5EYPA 3VOBA 4ZHQA 4I4TA 5AVMA 1CN7A 1CLIA 3GYQA 4TV9A 3C9TA 1Q8RA 3JARA 1S72F 4KWEA 1W57A 4HNAB 2ALEA 5JCOA 1SDSA 4O4JB 1KQSF 1X52A 1VQ6F 2Q1XA 5BMVB 3V7QA 1Z5VA 1R1MA 3S02A 3UT5A 5DCVA 3NK7A 1JJ2F 1IV1A 2Q1YA 2EWCA 3CPWF 5MN5A 4B62A 2HP3A 2YYEA 4LNUB 3JATA 3JASB 5HP7A 5GAPK 4TV8B 1FSZA 4EI9A 2ZAUA 3WGNA 2VGMA 1E7KA 1FFXA 1W5AA 3LMEA 3C8LA 2HS3A 3JARB 1N8RH 3T80A 5EIBD 2UYPA 4U39A 3QTYA 3NVKE 1YJ9F 4I4TB 4IHJA 2MQEA 2Z1UA 3VOAA 3QHDA 5CB4A 2N48A 1XV2A 3ERNA 3AGKA 2DYYA 1U43A 4LNUA 4X3MA 3LWPC 2CVLA 3M4SA 1VQ9F 5JH7B 4X1IA 2F9ZC 5GIPC 4G88A 1M1KH 5KX5B 4C4WC 1UI9A 3NMUC 2UYJA 1VQ7F 2LCAA 3N2GB 3IEQA 2GVIA 2HRUA 4LCKA 2HQSC 3CCQF 4G4WA 5JVDA 3WJQA 5GIOC 1DBFA 1CK2A 3V4DA 3KJJA 3VO8A 1K9MH 3C9UA 5LA6B 3CCVF 1K8AH 1JFFB 3F6MA 3HKBB 3CG6A 3WGJA 2R6R1 2OZBA 2FC3A 2QEXF 5KX5A 3IKFA 4IHJB 4X20A 3HKDB 1Q7YH 4YJ2A 2RHLA 3P4EA 4X1IB 2CWJA 2LBWA 4I50A 3HKCB 3D01A 4C8GA 4ZOLA 4BW0B 4O4HA 3D54A 4O2BA 4EI7A 3LDTA 3GTZA 3MQWA 3LYBA 5HWEA 1TVKB 1VQLF 3TD4A 3IR9A 3RYFB 3RYCA 4C8IA 1NQ3A 4U3JB 2FGYA 2OTJF 3V7EA 2RB9A 3I3FA 1W55A 1XHOA 1T0AA 3E20B 3CCEF 1PF5A 1QD9A 2KTUA 2ZVZA 2H8CA 4I55B 3CC4F 3U0OA 5EAZA 2AIFA 4X20B 3OW2F 1YJWF 3C9SA 1TUBB 3ZP4A 3C9RA 4B46A 1H47A 4RQOA 3E22A 1W2BF 1NMUB 1X7OA 2HP0B 4BY9D 5B8FA 1SA0A 4G4VA 4TUYA 3OBYA 3IMPA 3QUWA 4U3JA 3KJKA 3J7AR 2OTMA 2RHHA 5IT9M 4BT5A 4C81A 5FNVA 1IV2A 4YJ3B 3GHZA 2QTPA 1KC8H 5JCOC 3RYHB 1VK3A 3ZP7A 1W41A 3SIUA 3JALA 3S0WA 2GZLA 1K73H 5JQGA 2PHNA 2BTQB 4TV9B 3CCUF 2HS4A 2H8EA 2ZODA 3ON1A 1Q86H 4O4IB 3CCLF
chains in the Genus database with same CATH topology
1IV3A 1W57A 3K14A 4C8EA 1KNKA 3IKFA 1W55A 3T80A 1T0AA 3IEQA 3FPIA 1IV4A 1VH8A 3ELCA 3F0GA 3B6NA 4C81A 1YQNA 3FBAA 1IV2A 1U3PA 3GHZA 4C8GA 1JN1A 3KE1A 1H48A 3EORA 3JVHA 3P10A 3IKEA 3RE3A 1U40A 3ESJA 1KNJA 2UZHA 1IV1A 3QHDA 3IEWA 2GZLA 3F0EA 3Q8HA 3MBMA 3ERNA 4C8IA 1H47A 1VHAA 1GX1A 1U43A 4C82A 3K2XA 3P0ZA 1U3LA 5B8FA 2PMPA 2AMTA 3F0DA 3F6MA 3F0FA 1JY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV3 A;  1W57 A;  3K14 A;  4C8E A;  1KNK A;  3IKF A;  1W55 A;  3T80 A;  1T0A A;  3IEQ A;  3FPI A;  1IV4 A;  1VH8 A;  3ELC A;  3F0G A;  3B6N A;  4C81 A;  1YQN A;  3FBA A;  1IV2 A;  1U3P A;  3GHZ A;  4C8G A;  1JN1 A;  3KE1 A;  1H48 A;  3EOR A;  3JVH A;  3P10 A;  3IKE A;  3RE3 A;  1U40 A;  3ESJ A;  1KNJ A;  2UZH A;  1IV1 A;  3QHD A;  3IEW A;  2GZL A;  3F0E A;  3Q8H A;  3MBM A;  3ERN A;  4C8I A;  1H47 A;  1VHA A;  1GX1 A;  1U43 A;  4C82 A;  3K2X A;  3P0Z A;  1U3L A;  5B8F A;  2PMP A;  2AMT A;  3F0D A;  3F6M A;  3F0F A;  1JY8 A; 
#chains in the Genus database with same CATH topology
 5JH7 A;  2ZF8 A;  2CHT A;  1JD1 A;  2HP0 A;  4R40 B;  2VAM A;  3E22 B;  2UYN A;  2UYK A;  3RA5 A;  3ZOP A;  1IV4 A;  5CB4 B;  3FBA A;  5J2T B;  1TUB A;  1RQ7 A;  5CA0 B;  3VI6 A;  3TD3 A;  5GAN K;  1Z5W A;  4NWO B;  5JVD B;  3RE3 A;  4G4X A;  3RA6 A;  1YJN F;  4WBN A;  4M8I A;  3RYI B;  1OFU A;  1ONI A;  2IAF A;  3LWR C;  2RHJ A;  2YXZ A;  1GX1 A;  5LP6 B;  2Z01 A;  5HP8 A;  3VCZ A;  3P0Z A;  4ZHQ B;  5EO3 A;  2OTL F;  3CB2 A;  2AMT A;  3F0D A;  5FNV B;  3F0F A;  3KHN A;  1IV3 A;  3K12 A;  1VQ5 F;  3N2K A;  3LWV C;  2UYN B;  5KMG A;  3CPQ A;  3WGL A;  5JQG B;  4X1K B;  3P10 A;  5LXT A;  3JAK A;  1KNJ A;  4ZOL B;  5HY1 A;  5GON B;  3CCM F;  1KD1 H;  1T0K B;  5EZY B;  3LFO A;  4PWT A;  3LWQ C;  2ZVY A;  3KIZ A;  4ZHY B;  3CC2 F;  1QU9 A;  3HKD A;  5HY4 A;  1PXW A;  5IYZ A;  1YGY A;  5EB0 A;  4F6R B;  4WBN B;  1VQN F;  3CYP B;  2PMP A;  4O4J A;  3WJR A;  2QA4 F;  1W5E A;  3LWO C;  3VYU C;  1YIJ F;  5HXU A;  1VQO F;  3RYI A;  4BT2 A;  3ZO8 A;  5LYJ A;  2GLZ A;  4TV8 A;  3IKE A;  2R75 1;  2BTU A;  4EB6 A;  4X1K A;  4X1Y A;  3ESJ A;  3N2K B;  1VQM F;  4BVS A;  2CW4 A;  4O4L A;  5GON A;  4BT6 A;  5LXT B;  2RHO A;  5LOV A;  1VQV A;  1OAP A;  1U3L A;  2NMU A;  3HKB A;  4O2A B;  4ZHV A;  5EZY A;  2VGN A;  2P6Y A;  2CHS A;  3JAS A;  1W58 1;  5LP6 C;  3S0H A;  3WPW A;  3I7T A;  4F6R A;  3PAF A;  3B6N A;  1RA4 A;  3DDN A;  3WXM B;  5BMV A;  2L26 A;  3G4S F;  1JN1 A;  4G4Z A;  3EOR A;  1FNJ A;  4YJ3 A;  4DRX A;  5FLX M;  2HRY A;  3O85 A;  3FFM A;  1VHA A;  4O4L B;  5IJ9 A;  5HY0 A;  3RYF A;  2B33 A;  3JAW A;  1VQP F;  5LOV B;  4BT3 A;  3HAX D;  3CCR F;  5LYJ B;  4O2A A;  3OON A;  5EB1 B;  3CCS F;  4EB6 B;  3S06 A;  3VYT C;  3RYH A;  1XBI A;  3HKE A;  2G9I A;  4ZI7 A;  1ODE A;  3CYQ A;  2Z1F A;  1W5B A;  2KG4 A;  1U3P A;  1W3E X;  2KTV A;  5C8Y B;  5LA6 A;  1VQ4 F;  4O4H B;  2LBX A;  4O4I A;  1QVG F;  5IJ0 A;  4NQ3 A;  1VQ8 F;  2V9Y A;  2I6D A;  3I55 F;  1FNK A;  4DRX B;  1DT9 A;  4YJ2 B;  1SA0 B;  2W8B C;  3HJW C;  1W42 A;  4IIJ B;  5MN4 A;  5HXZ A;  1RLG A;  3CMA F;  1YI2 F;  1H7M A;  1W40 A;  1VH8 A;  3ELC A;  3VMF B;  4FFB A;  3HKE B;  1YQN A;  4ZI7 B;  4G4Y A;  3VIU A;  5IJ9 B;  2IG8 A;  5ITZ A;  2AIZ P;  1IPA A;  3JAL B;  3JAK B;  2DT4 A;  3OBW A;  4B45 A;  2VAP A;  5FJ4 C;  5EIB C;  2WAL A;  5C8Y A;  3V3T A;  2VXY A;  3JAM M;  3MDO A;  3CME F;  1W59 A;  4I55 A;  3WGK A;  1J7H A;  5IJ0 B;  5A2Q M;  5J2U B;  4HNA A;  1UFY A;  4TUY B;  4ERH A;  3HWU A;  2LBT A;  4BVQ A;  3RYC B;  3E1Y A;  4B5C A;  3KE1 A;  2HX0 A;  3G6E F;  3HTN A;  1U40 A;  5HY2 A;  2QI2 A;  3D00 A;  5G4V C;  4X1Y B;  2BO1 A;  4FFB B;  3CXC F;  3F0E A;  4IIJ A;  3Q8H A;  3CD6 F;  4C82 A;  3NVI B;  2I6R A;  1GZ0 A;  3WJP A;  1SZQ A;  3FD5 A;  3TD5 A;  2OHW A;  4C8E A;  3VTI C;  5ITZ B;  5J2U A;  1X7P A;  1M90 H;  5MN6 A;  3FPI A;  4TZZ A;  4XCQ A;  3S0Y A;  1RLU A;  3FD6 A;  4ZHW A;  1VQK F;  1X25 A;  3NK6 A;  4DXD A;  2BTO A;  1GO1 A;  2JNB A;  3JVH A;  2IQQ A;  4I50 B;  1QAH A;  4X3L A;  3R0P A;  3I56 F;  3S03 A;  4BVT A;  3VYS C;  4ZK7 A;  2VAW A;  3K2X A;  3PLA C;  3MCQ A;  1NJI H;  3JCM M;  2KGW A;  5J2T A;  5GIN C;  3K14 A;  3N2G A;  2H6L A;  3N4Y A;  5CA1 B;  3WPX A;  1W5F A;  1ZWZ A;  2K1S A;  3K0T A;  1QVF F;  5G4U C;  1RQ2 A;  3SIV A;  5EYP B;  2ZOV A;  3M1X A;  3M84 A;  5KMG B;  5LP6 A;  3BYQ A;  3JAW B;  4E6E A;  1Q81 H;  4RHA A;  2UZH A;  3MCA B;  3CCJ F;  1Q82 H;  3IEW A;  3WGM A;  1COM A;  1YIT F;  3DC2 A;  1JFF A;  1YHQ F;  2Z1E A;  4O2B B;  5IYZ B;  1JY8 A;  4EI8 A;  3JAT B;  2HVY D;  1TVK A;  1KNK A;  3J81 M;  2CZW A;  4BVR A;  3L7Q A;  1GO0 A;  3UT5 B;  3HKC A;  3F0G A;  1FFX B;  5CA0 A;  3G71 F;  1XRG A;  1H48 A;  5CA1 A;  4BT7 A;  2HS0 A;  4BT4 A;  4NUT A;  3J80 M;  3CC7 F;  5EWR A;  2CSL A;  3MBM A;  2Z1T A;  3N4Z A;  5EYP A;  3VOB A;  4ZHQ A;  4I4T A;  5AVM A;  1CN7 A;  1CLI A;  3GYQ A;  4TV9 A;  3C9T A;  1Q8R A;  3JAR A;  1S72 F;  4KWE A;  1W57 A;  4HNA B;  2ALE A;  5JCO A;  1SDS A;  4O4J B;  1KQS F;  1X52 A;  1VQ6 F;  2Q1X A;  5BMV B;  3V7Q A;  1Z5V A;  1R1M A;  3S02 A;  3UT5 A;  5DCV A;  3NK7 A;  1JJ2 F;  1IV1 A;  2Q1Y A;  2EWC A;  3CPW F;  5MN5 A;  4B62 A;  2HP3 A;  2YYE A;  4LNU B;  3JAT A;  3JAS B;  5HP7 A;  5GAP K;  4TV8 B;  1FSZ A;  4EI9 A;  2ZAU A;  3WGN A;  2VGM A;  1E7K A;  1FFX A;  1W5A A;  3LME A;  3C8L A;  2HS3 A;  3JAR B;  1N8R H;  3T80 A;  5EIB D;  2UYP A;  4U39 A;  3QTY A;  3NVK E;  1YJ9 F;  4I4T B;  4IHJ A;  2MQE A;  2Z1U A;  3VOA A;  3QHD A;  5CB4 A;  2N48 A;  1XV2 A;  3ERN A;  3AGK A;  2DYY A;  1U43 A;  4LNU A;  4X3M A;  3LWP C;  2CVL A;  3M4S A;  1VQ9 F;  5JH7 B;  4X1I A;  2F9Z C;  5GIP C;  4G88 A;  1M1K H;  5KX5 B;  4C4W C;  1UI9 A;  3NMU C;  2UYJ A;  1VQ7 F;  2LCA A;  3N2G B;  3IEQ A;  2GVI A;  2HRU A;  4LCK A;  2HQS C;  3CCQ F;  4G4W A;  5JVD A;  3WJQ A;  5GIO C;  1DBF A;  1CK2 A;  3V4D A;  3KJJ A;  3VO8 A;  1K9M H;  3C9U A;  5LA6 B;  3CCV F;  1K8A H;  1JFF B;  3F6M A;  3HKB B;  3CG6 A;  3WGJ A;  2R6R 1;  2OZB A;  2FC3 A;  2QEX F;  5KX5 A;  3IKF A;  4IHJ B;  4X20 A;  3HKD B;  1Q7Y H;  4YJ2 A;  2RHL A;  3P4E A;  4X1I B;  2CWJ A;  2LBW A;  4I50 A;  3HKC B;  3D01 A;  4C8G A;  4ZOL A;  4BW0 B;  4O4H A;  3D54 A;  4O2B A;  4EI7 A;  3LDT A;  3GTZ A;  3MQW A;  3LYB A;  5HWE A;  1TVK B;  1VQL F;  3TD4 A;  3IR9 A;  3RYF B;  3RYC A;  4C8I A;  1NQ3 A;  4U3J B;  2FGY A;  2OTJ F;  3V7E A;  2RB9 A;  3I3F A;  1W55 A;  1XHO A;  1T0A A;  3E20 B;  3CCE F;  1PF5 A;  1QD9 A;  2KTU A;  2ZVZ A;  2H8C A;  4I55 B;  3CC4 F;  3U0O A;  5EAZ A;  2AIF A;  4X20 B;  3OW2 F;  1YJW F;  3C9S A;  1TUB B;  3ZP4 A;  3C9R A;  4B46 A;  1H47 A;  4RQO A;  3E22 A;  1W2B F;  1NMU B;  1X7O A;  2HP0 B;  4BY9 D;  5B8F A;  1SA0 A;  4G4V A;  4TUY A;  3OBY A;  3IMP A;  3QUW A;  4U3J A;  3KJK A;  3J7A R;  2OTM A;  2RHH A;  5IT9 M;  4BT5 A;  4C81 A;  5FNV A;  1IV2 A;  4YJ3 B;  3GHZ A;  2QTP A;  1KC8 H;  5JCO C;  3RYH B;  1VK3 A;  3ZP7 A;  1W41 A;  3SIU A;  3JAL A;  3S0W A;  2GZL A;  1K73 H;  5JQG A;  2PHN A;  2BTQ B;  4TV9 B;  3CCU F;  2HS4 A;  2H8E A;  2ZOD A;  3ON1 A;  1Q86 H;  4O4I B;  3CCL F; 
#chains in the Genus database with same CATH homology
 1IV3 A;  1W57 A;  3K14 A;  4C8E A;  1KNK A;  3IKF A;  1W55 A;  3T80 A;  1T0A A;  3IEQ A;  3FPI A;  1IV4 A;  1VH8 A;  3ELC A;  3F0G A;  3B6N A;  4C81 A;  1YQN A;  3FBA A;  1IV2 A;  1U3P A;  3GHZ A;  4C8G A;  1JN1 A;  3KE1 A;  1H48 A;  3EOR A;  3JVH A;  3P10 A;  3IKE A;  3RE3 A;  1U40 A;  3ESJ A;  1KNJ A;  2UZH A;  1IV1 A;  3QHD A;  3IEW A;  2GZL A;  3F0E A;  3Q8H A;  3MBM A;  3ERN A;  4C8I A;  1H47 A;  1VHA A;  1GX1 A;  1U43 A;  4C82 A;  3K2X A;  3P0Z A;  1U3L A;  5B8F A;  2PMP A;  2AMT A;  3F0D A;  3F6M A;  3F0F A;  1JY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...