3F6MA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase ispf from yersinia pestis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
b'NAMRIGHGFDVHKFGENGSGPLIIGGVRIPYEKGLLAHSDGDVALHAATDALLGAAALGDIGKLFPDTDPAFKGADSRGLLREAYRRILAKGYKLGNLDITIIAQAPKMAPHIPQMRVNLAEDLQCHMDDINVKATTTEQLGFTGRGEGIACEAVVLLVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f6mA00
3IKEA 3F0EA 3Q8HA 1W55A 2GZLA 3ERNA 3P0ZA 1T0AA 3F0DA 1U3PA 3FBAA 3ELCA 4C8IA 1JY8A 3IEWA 3GHZA 4C8EA 2UZHA 4C82A 2AMTA 3KE1A 1VHAA 1GX1A 1KNJA 1KNKA 3F0FA 1IV3A 3IEQA 3K2XA 3F0GA 3FPIA 3JVHA 3T80A 1U3LA 3K14A 3B6NA 5B8FA 1U43A 3ESJA 3IKFA 1JN1A 4C8GA 2PMPA 3MBMA 3P10A 1W57A 1IV2A 1H48A 1YQNA 1VH8A 1IV4A 3F6MA 3RE3A 1IV1A 1H47A 4C81A 3EORA 3QHDA 1U40A
chains in the Genus database with same CATH superfamily
3Q8HA 2Q1XA 3WGLA 3CCLF 1YITF 3ERNA 3FBAA 1W40A 3UT5B 3CC4F 2P6YA 2VAMA 3CYPB 4C82A 5MN6A 2DT4A 3J81M 4FFBB 4TUYB 3V3TA 1OFUA 3OBWA 1X25A 1IV3A 3RYHB 3G71F 2QEXF 5JCOC 3C9SA 3B6NA 2LBTA 4ERHA 2Z1EA 1X52A 5GIPC 3S02A 4KWEA 1VH8A 1K9MH 3PLAC 1J7HA 3OW2F 4X1KA 5CA0A 3O85A 2CW4A 3WJPA 5LOVB 4B62A 2MQEA 3VOBA 2HP0B 3HKBA 3L7QA 3JAKB 3V7EA 2H8EA 4X3MA 1Q82H 5J2UA 2NMUA 5GONA 3VYSC 3KE1A 4DRXA 4BVRA 5JQGA 2ZODA 4XCQA 1KNKA 1SDSA 4X3LA 4I4TA 1U3LA 1XHOA 2CVLA 2LBWA 3ESJA 2UYJA 4C8GA 2HQSC 5HY4A 4BVQA 3C9TA 4X1IB 3S03A 3I3FA 3NMUC 5LXTA 1FFXA 5HY1A 3LMEA 3N2KA 3DDNA 5J2TA 3F0EA 3JCMM 2RHJA 5CB4B 4O4LA 2GVIA 5CA1A 2VXYA 2OTMA 2L26A 1QD9A 4G88A 3RYIA 5GAPK 3ZOPA 3HKDA 1M90H 3K12A 3ZO8A 3F0GA 5LP6A 3E22A 1YHQF 2JNBA 3S0YA 1VQ7F 4YJ2B 3IKFA 1YJWF 5KX5A 2ALEA 3J80M 2ZOVA 5JVDA 4M8IA 1N8RH 1VQ8F 4YJ3B 4O2BB 1TVKB 4G4VA 5IJ9B 4TV9A 5IYZB 1GO0A 2KTUA 2BTQB 4NWOB 4G4ZA 1SA0B 2IG8A 4LNUA 3C8LA 5HP8A 3JALB 3CB2A 3HKEB 2OZBA 4I55B 1FNJA 4ZHYB 2PMPA 1YQNA 1IV2A 1H48A 3WJQA 2CSLA 4BVSA 3HTNA 4B45A 1U40A 4ZOLA 3VTIC 4IIJA 3JAWB 1T0AA 1IPAA 2BTUA 3LWQC 4EI8A 3CC2F 3JATA 2QI2A 2CZWA 5DCVA 3RYFB 4BT7A 2RHHA 5A2QM 2HX0A 3TD3A 3CCSF 1JJ2F 4TZZA 2YYEA 4PWTA 4X1YA 5EIBD 4ZI7A 4O4JA 4TV8A 4X1YB 2VAWA 1W41A 3LFOA 3G4SF 2Z1FA 3E1YA 4BT6A 3CG6A 3OBYA 2I6RA 3D01A 4IHJA 4RHAA 1M1KH 1XRGA 5BMVB 1RQ2A 3LDTA 4I50B 4X20A 2UYPA 3NK7A 5EO3A 1VK3A 3WXMB 3IEWA 1W5FA 2N48A 1OAPA 4ZHWA 1VQ5F 2R751 4ZK7A 3HKCA 4BW0B 3I56F 3HKCB 3SIVA 4ZHVA 5HXZA 1YI2F 4G4YA 2IAFA 1YIJF 3C9RA 3IKEA 1QU9A 1W55A 4X1KB 5CA0B 3CCQF 1FNKA 1K8AH 3C9UA 3V4DA 3HKBB 1KC8H 1RLGA 1COMA 3CCUF 1GO1A 3J7AR 1Q81H 1W5AA 5J2UB 2UZHA 2ZF8A 3NVKE 5GONB 2LBXA 2HS4A 4DRXB 5JQGB 3SIUA 3K2XA 1H7MA 3K0TA 3FPIA 5LYJA 1W5BA 4I4TB 3FD5A 1ZWZA 5FNVA 1XBIA 4BT3A 1T0KB 2I6DA 3ON1A 3RE3A 5EZYA 4O2AA 5LXTB 1FFXB 1JFFA 4NUTA 1JFFB 3JASA 3N2KB 1W2BF 5J2TB 1KD1H 5IJ0A 1W5EA 3M84A 3ELCA 4O4HA 4O4LB 3VI6A 1JY8A 5CA1B 3RYIB 1VHAA 3KIZA 3ZP7A 2HP3A 3HKDB 2RB9A 2H6LA 5EYPA 5EB1B 3CCVF 2UYKA 4EB6A 3N2GA 5LP6B 1RA4A 1XV2A 3E22B 1YGYA 2OHWA 2HS0A 5HY2A 2UYNA 2KG4A 5LA6A 5KX5B 1QAHA 5HY0A 5JVDB 5JH7A 5HP7A 4O4IA 4G4WA 3VOAA 5GINC 4TV9B 4C8IA 3RYCA 2B33A 1GX1A 3F0FA 3N4ZA 3WPWA 4C8EA 3RA6A 3T80A 4LNUB 3G6EF 2FC3A 1VQKF 4U39A 1VQMF 4NQ3A 2ZVYA 3CMEF 1QVFF 1RQ7A 1JN1A 1Q86H 1X7PA 3WPXA 2Q1YA 1VQLF 4ZOLB 3VIUA 1VQNF 3CMAF 3AGKA 4IIJB 3VCZA 2KTVA 4ZHQA 3GHZA 3JATB 4B5CA 1NJIH 1KQSF 1YJNF 1DBFA 5JCOA 3FD6A 4C4WC 3TD4A 1ONIA 5C8YA 1SZQA 2CHTA 2YXZA 4ZI7B 4O4JB 4TV8B 2QA4F 2WALA 1IV4A 3CCJF 3MCAB 2LCAA 4C81A 3M1XA 3KJJA 2ZAUA 2H8CA 1QVGF 4IHJB 2GZLA 4U3JA 4X20B 5G4VC 1TUBA 2HRUA 3JARA 4LCKA 1NMUB 1PF5A 4HNAA 2RHOA 2CWJA 2F9ZC 2HS3A 1JD1A 1UFYA 5EB0A 5HWEA 3K14A 4BT5A 5GANK 3VYTC 2K1SA 1W3EX 5KMGA 1YJ9F 3MBMA 3WGKA 5FJ4C 4EI7A 4RQOA 1H47A 3EORA 3CCMF 3MDOA 2EWCA 2GLZA 1X7OA 3BYQA 3R0PA 3UT5A 3VMFB 3CC7F 1U3PA 3MCQA 2Z1UA 3VO8A 3WGMA 1CLIA 4FFBA 4TUYA 4R40B 1VQPF 3RYHA 1KNJA 3LWPC 1E7KA 2OTJF 3WGNA 5LYJB 3LWRC 3HWUA 3QTYA 2G9IA 5FNVB 5IT9M 3LWVC 3CPWF 5FLXM 4BVTA 2AIFA 3QHDA 2HRYA 5LOVA 3I55F 5EZYB 4O2AB 3WJRA 2HP0A 2DYYA 2OTLF 2FGYA 2QTPA 3JAKA 2W8BC 3M4SA 5EWRA 1GZ0A 3JASB 3IMPA 5IJ0B 3FFMA 3HAXD 4O4HB 1CK2A 2AIZP 1Z5WA 4B46A 3DC2A 1W59A 4F6RA 4F6RB 5EYPB 3GYQA 1NQ3A 3QUWA 2ZVZA 3OONA 3E20B 4X1IA 4EB6B 3PAFA 3N2GB 3NK6A 2IQQA 1Q7YH 3LYBA 1VQ4F 3U0OA 2BTOA 2RHLA 2UYNB 5LA6B 3S06A 5CB4A 2CHSA 4E6EA 5JH7B 3I7TA 1R1MA 3F0DA 3KJKA 4O4IB 5MN4A 4WBNA 4WBNB 1W42A 3LWOC 3RYCB 3VYUC 3CXCF 3JVHA 3KHNA 4YJ2A 2VGMA 3CCEF 1U43A 4EI9A 1Z5VA 3NVIB 3P10A 3ZP4A 3P4EA 3CPQA 1VQ9F 3S0WA 5EAZA 4YJ3A 4O2BA 1TVKA 5IJ9A 5IYZA 3D00A 1UI9A 1VQOF 1FSZA 4BY9D 1SA0A 1W581 1RLUA 3TD5A 4DXDA 2AMTA 4ZHQB 1CN7A 3GTZA 3JALA 3S0HA 1ODEA 3HKEA 3IEQA 2V9YA 5B8FA 4G4XA 4I55A 5LP6C 5GIOC 2Z1TA 5C8YB 1W57A 1Q8RA 1VQVA 4BT2A 1S72F 1IV1A 1PXWA 4BT4A 2KGWA 3CCRF 2VAPA 3JAWA 5G4UC 3P0ZA 3V7QA 3RYFA 1VQ6F 4U3JB 3HJWC 1TUBB 3JARB 3D54A 3JAMM 3IR9A 4HNAB 3MQWA 2BO1A 3WGJA 5ITZA 3RA5A 5ITZB 2Z01A 5HXUA 2HVYD 3N4YA 2PHNA 5EIBC 5AVMA 5KMGB 5MN5A 1DT9A 3F6MA 2VGNA 3CD6F 5BMVA 2R6R1 3CYQA 4I50A 1K73H
chains in the Genus database with same CATH topology
3IKEA 3F0EA 3Q8HA 1W55A 2GZLA 3ERNA 3P0ZA 1T0AA 3F0DA 1U3PA 3FBAA 3ELCA 4C8IA 1JY8A 3IEWA 3GHZA 4C8EA 2UZHA 4C82A 2AMTA 3KE1A 1VHAA 1GX1A 1KNJA 1KNKA 3F0FA 1IV3A 3IEQA 3K2XA 3F0GA 3FPIA 3JVHA 3T80A 1U3LA 3K14A 3B6NA 5B8FA 1U43A 3ESJA 3IKFA 1JN1A 4C8GA 2PMPA 3MBMA 3P10A 1W57A 1IV2A 1H48A 1YQNA 1VH8A 1IV4A 3F6MA 3RE3A 1IV1A 1H47A 4C81A 3EORA 3QHDA 1U40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKE A;  3F0E A;  3Q8H A;  1W55 A;  2GZL A;  3ERN A;  3P0Z A;  1T0A A;  3F0D A;  1U3P A;  3FBA A;  3ELC A;  4C8I A;  1JY8 A;  3IEW A;  3GHZ A;  4C8E A;  2UZH A;  4C82 A;  2AMT A;  3KE1 A;  1VHA A;  1GX1 A;  1KNJ A;  1KNK A;  3F0F A;  1IV3 A;  3IEQ A;  3K2X A;  3F0G A;  3FPI A;  3JVH A;  3T80 A;  1U3L A;  3K14 A;  3B6N A;  5B8F A;  1U43 A;  3ESJ A;  3IKF A;  1JN1 A;  4C8G A;  2PMP A;  3MBM A;  3P10 A;  1W57 A;  1IV2 A;  1H48 A;  1YQN A;  1VH8 A;  1IV4 A;  3F6M A;  3RE3 A;  1IV1 A;  1H47 A;  4C81 A;  3EOR A;  3QHD A;  1U40 A; 
#chains in the Genus database with same CATH topology
 3Q8H A;  2Q1X A;  3WGL A;  3CCL F;  1YIT F;  3ERN A;  3FBA A;  1W40 A;  3UT5 B;  3CC4 F;  2P6Y A;  2VAM A;  3CYP B;  4C82 A;  5MN6 A;  2DT4 A;  3J81 M;  4FFB B;  4TUY B;  3V3T A;  1OFU A;  3OBW A;  1X25 A;  1IV3 A;  3RYH B;  3G71 F;  2QEX F;  5JCO C;  3C9S A;  3B6N A;  2LBT A;  4ERH A;  2Z1E A;  1X52 A;  5GIP C;  3S02 A;  4KWE A;  1VH8 A;  1K9M H;  3PLA C;  1J7H A;  3OW2 F;  4X1K A;  5CA0 A;  3O85 A;  2CW4 A;  3WJP A;  5LOV B;  4B62 A;  2MQE A;  3VOB A;  2HP0 B;  3HKB A;  3L7Q A;  3JAK B;  3V7E A;  2H8E A;  4X3M A;  1Q82 H;  5J2U A;  2NMU A;  5GON A;  3VYS C;  3KE1 A;  4DRX A;  4BVR A;  5JQG A;  2ZOD A;  4XCQ A;  1KNK A;  1SDS A;  4X3L A;  4I4T A;  1U3L A;  1XHO A;  2CVL A;  2LBW A;  3ESJ A;  2UYJ A;  4C8G A;  2HQS C;  5HY4 A;  4BVQ A;  3C9T A;  4X1I B;  3S03 A;  3I3F A;  3NMU C;  5LXT A;  1FFX A;  5HY1 A;  3LME A;  3N2K A;  3DDN A;  5J2T A;  3F0E A;  3JCM M;  2RHJ A;  5CB4 B;  4O4L A;  2GVI A;  5CA1 A;  2VXY A;  2OTM A;  2L26 A;  1QD9 A;  4G88 A;  3RYI A;  5GAP K;  3ZOP A;  3HKD A;  1M90 H;  3K12 A;  3ZO8 A;  3F0G A;  5LP6 A;  3E22 A;  1YHQ F;  2JNB A;  3S0Y A;  1VQ7 F;  4YJ2 B;  3IKF A;  1YJW F;  5KX5 A;  2ALE A;  3J80 M;  2ZOV A;  5JVD A;  4M8I A;  1N8R H;  1VQ8 F;  4YJ3 B;  4O2B B;  1TVK B;  4G4V A;  5IJ9 B;  4TV9 A;  5IYZ B;  1GO0 A;  2KTU A;  2BTQ B;  4NWO B;  4G4Z A;  1SA0 B;  2IG8 A;  4LNU A;  3C8L A;  5HP8 A;  3JAL B;  3CB2 A;  3HKE B;  2OZB A;  4I55 B;  1FNJ A;  4ZHY B;  2PMP A;  1YQN A;  1IV2 A;  1H48 A;  3WJQ A;  2CSL A;  4BVS A;  3HTN A;  4B45 A;  1U40 A;  4ZOL A;  3VTI C;  4IIJ A;  3JAW B;  1T0A A;  1IPA A;  2BTU A;  3LWQ C;  4EI8 A;  3CC2 F;  3JAT A;  2QI2 A;  2CZW A;  5DCV A;  3RYF B;  4BT7 A;  2RHH A;  5A2Q M;  2HX0 A;  3TD3 A;  3CCS F;  1JJ2 F;  4TZZ A;  2YYE A;  4PWT A;  4X1Y A;  5EIB D;  4ZI7 A;  4O4J A;  4TV8 A;  4X1Y B;  2VAW A;  1W41 A;  3LFO A;  3G4S F;  2Z1F A;  3E1Y A;  4BT6 A;  3CG6 A;  3OBY A;  2I6R A;  3D01 A;  4IHJ A;  4RHA A;  1M1K H;  1XRG A;  5BMV B;  1RQ2 A;  3LDT A;  4I50 B;  4X20 A;  2UYP A;  3NK7 A;  5EO3 A;  1VK3 A;  3WXM B;  3IEW A;  1W5F A;  2N48 A;  1OAP A;  4ZHW A;  1VQ5 F;  2R75 1;  4ZK7 A;  3HKC A;  4BW0 B;  3I56 F;  3HKC B;  3SIV A;  4ZHV A;  5HXZ A;  1YI2 F;  4G4Y A;  2IAF A;  1YIJ F;  3C9R A;  3IKE A;  1QU9 A;  1W55 A;  4X1K B;  5CA0 B;  3CCQ F;  1FNK A;  1K8A H;  3C9U A;  3V4D A;  3HKB B;  1KC8 H;  1RLG A;  1COM A;  3CCU F;  1GO1 A;  3J7A R;  1Q81 H;  1W5A A;  5J2U B;  2UZH A;  2ZF8 A;  3NVK E;  5GON B;  2LBX A;  2HS4 A;  4DRX B;  5JQG B;  3SIU A;  3K2X A;  1H7M A;  3K0T A;  3FPI A;  5LYJ A;  1W5B A;  4I4T B;  3FD5 A;  1ZWZ A;  5FNV A;  1XBI A;  4BT3 A;  1T0K B;  2I6D A;  3ON1 A;  3RE3 A;  5EZY A;  4O2A A;  5LXT B;  1FFX B;  1JFF A;  4NUT A;  1JFF B;  3JAS A;  3N2K B;  1W2B F;  5J2T B;  1KD1 H;  5IJ0 A;  1W5E A;  3M84 A;  3ELC A;  4O4H A;  4O4L B;  3VI6 A;  1JY8 A;  5CA1 B;  3RYI B;  1VHA A;  3KIZ A;  3ZP7 A;  2HP3 A;  3HKD B;  2RB9 A;  2H6L A;  5EYP A;  5EB1 B;  3CCV F;  2UYK A;  4EB6 A;  3N2G A;  5LP6 B;  1RA4 A;  1XV2 A;  3E22 B;  1YGY A;  2OHW A;  2HS0 A;  5HY2 A;  2UYN A;  2KG4 A;  5LA6 A;  5KX5 B;  1QAH A;  5HY0 A;  5JVD B;  5JH7 A;  5HP7 A;  4O4I A;  4G4W A;  3VOA A;  5GIN C;  4TV9 B;  4C8I A;  3RYC A;  2B33 A;  1GX1 A;  3F0F A;  3N4Z A;  3WPW A;  4C8E A;  3RA6 A;  3T80 A;  4LNU B;  3G6E F;  2FC3 A;  1VQK F;  4U39 A;  1VQM F;  4NQ3 A;  2ZVY A;  3CME F;  1QVF F;  1RQ7 A;  1JN1 A;  1Q86 H;  1X7P A;  3WPX A;  2Q1Y A;  1VQL F;  4ZOL B;  3VIU A;  1VQN F;  3CMA F;  3AGK A;  4IIJ B;  3VCZ A;  2KTV A;  4ZHQ A;  3GHZ A;  3JAT B;  4B5C A;  1NJI H;  1KQS F;  1YJN F;  1DBF A;  5JCO A;  3FD6 A;  4C4W C;  3TD4 A;  1ONI A;  5C8Y A;  1SZQ A;  2CHT A;  2YXZ A;  4ZI7 B;  4O4J B;  4TV8 B;  2QA4 F;  2WAL A;  1IV4 A;  3CCJ F;  3MCA B;  2LCA A;  4C81 A;  3M1X A;  3KJJ A;  2ZAU A;  2H8C A;  1QVG F;  4IHJ B;  2GZL A;  4U3J A;  4X20 B;  5G4V C;  1TUB A;  2HRU A;  3JAR A;  4LCK A;  1NMU B;  1PF5 A;  4HNA A;  2RHO A;  2CWJ A;  2F9Z C;  2HS3 A;  1JD1 A;  1UFY A;  5EB0 A;  5HWE A;  3K14 A;  4BT5 A;  5GAN K;  3VYT C;  2K1S A;  1W3E X;  5KMG A;  1YJ9 F;  3MBM A;  3WGK A;  5FJ4 C;  4EI7 A;  4RQO A;  1H47 A;  3EOR A;  3CCM F;  3MDO A;  2EWC A;  2GLZ A;  1X7O A;  3BYQ A;  3R0P A;  3UT5 A;  3VMF B;  3CC7 F;  1U3P A;  3MCQ A;  2Z1U A;  3VO8 A;  3WGM A;  1CLI A;  4FFB A;  4TUY A;  4R40 B;  1VQP F;  3RYH A;  1KNJ A;  3LWP C;  1E7K A;  2OTJ F;  3WGN A;  5LYJ B;  3LWR C;  3HWU A;  3QTY A;  2G9I A;  5FNV B;  5IT9 M;  3LWV C;  3CPW F;  5FLX M;  4BVT A;  2AIF A;  3QHD A;  2HRY A;  5LOV A;  3I55 F;  5EZY B;  4O2A B;  3WJR A;  2HP0 A;  2DYY A;  2OTL F;  2FGY A;  2QTP A;  3JAK A;  2W8B C;  3M4S A;  5EWR A;  1GZ0 A;  3JAS B;  3IMP A;  5IJ0 B;  3FFM A;  3HAX D;  4O4H B;  1CK2 A;  2AIZ P;  1Z5W A;  4B46 A;  3DC2 A;  1W59 A;  4F6R A;  4F6R B;  5EYP B;  3GYQ A;  1NQ3 A;  3QUW A;  2ZVZ A;  3OON A;  3E20 B;  4X1I A;  4EB6 B;  3PAF A;  3N2G B;  3NK6 A;  2IQQ A;  1Q7Y H;  3LYB A;  1VQ4 F;  3U0O A;  2BTO A;  2RHL A;  2UYN B;  5LA6 B;  3S06 A;  5CB4 A;  2CHS A;  4E6E A;  5JH7 B;  3I7T A;  1R1M A;  3F0D A;  3KJK A;  4O4I B;  5MN4 A;  4WBN A;  4WBN B;  1W42 A;  3LWO C;  3RYC B;  3VYU C;  3CXC F;  3JVH A;  3KHN A;  4YJ2 A;  2VGM A;  3CCE F;  1U43 A;  4EI9 A;  1Z5V A;  3NVI B;  3P10 A;  3ZP4 A;  3P4E A;  3CPQ A;  1VQ9 F;  3S0W A;  5EAZ A;  4YJ3 A;  4O2B A;  1TVK A;  5IJ9 A;  5IYZ A;  3D00 A;  1UI9 A;  1VQO F;  1FSZ A;  4BY9 D;  1SA0 A;  1W58 1;  1RLU A;  3TD5 A;  4DXD A;  2AMT A;  4ZHQ B;  1CN7 A;  3GTZ A;  3JAL A;  3S0H A;  1ODE A;  3HKE A;  3IEQ A;  2V9Y A;  5B8F A;  4G4X A;  4I55 A;  5LP6 C;  5GIO C;  2Z1T A;  5C8Y B;  1W57 A;  1Q8R A;  1VQV A;  4BT2 A;  1S72 F;  1IV1 A;  1PXW A;  4BT4 A;  2KGW A;  3CCR F;  2VAP A;  3JAW A;  5G4U C;  3P0Z A;  3V7Q A;  3RYF A;  1VQ6 F;  4U3J B;  3HJW C;  1TUB B;  3JAR B;  3D54 A;  3JAM M;  3IR9 A;  4HNA B;  3MQW A;  2BO1 A;  3WGJ A;  5ITZ A;  3RA5 A;  5ITZ B;  2Z01 A;  5HXU A;  2HVY D;  3N4Y A;  2PHN A;  5EIB C;  5AVM A;  5KMG B;  5MN5 A;  1DT9 A;  3F6M A;  2VGN A;  3CD6 F;  5BMV A;  2R6R 1;  3CYQ A;  4I50 A;  1K73 H; 
#chains in the Genus database with same CATH homology
 3IKE A;  3F0E A;  3Q8H A;  1W55 A;  2GZL A;  3ERN A;  3P0Z A;  1T0A A;  3F0D A;  1U3P A;  3FBA A;  3ELC A;  4C8I A;  1JY8 A;  3IEW A;  3GHZ A;  4C8E A;  2UZH A;  4C82 A;  2AMT A;  3KE1 A;  1VHA A;  1GX1 A;  1KNJ A;  1KNK A;  3F0F A;  1IV3 A;  3IEQ A;  3K2X A;  3F0G A;  3FPI A;  3JVH A;  3T80 A;  1U3L A;  3K14 A;  3B6N A;  5B8F A;  1U43 A;  3ESJ A;  3IKF A;  1JN1 A;  4C8G A;  2PMP A;  3MBM A;  3P10 A;  1W57 A;  1IV2 A;  1H48 A;  1YQN A;  1VH8 A;  1IV4 A;  3F6M A;  3RE3 A;  1IV1 A;  1H47 A;  4C81 A;  3EOR A;  3QHD A;  1U40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...