3F6MA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase ispf from yersinia pestis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
161
structure length
161
Chain Sequence
NAMRIGHGFDVHKFGENGSGPLIIGGVRIPYEKGLLAHSDGDVALHAATDALLGAAALGDIGKLFPDTDPAFKGADSRGLLREAYRRILAKGYKLGNLDITIIAQAPKMAPHIPQMRVNLAEDLQCHMDDINVKATTTEQLGFTGRGEGIACEAVVLLVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Lyase
total genus 45
structure length 161
sequence length 161
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3f6mA00
1W55A 2GZLA 3K2XA 3QHDA 1IV3A 3K14A 3B6NA 3IKFA 1GX1A 2PMPA 1KNJA 3T80A 1H48A 3FPIA 3EORA 3ESJA 3F0EA 3F6MA 1IV4A 1JN1A 3Q8HA 1U43A 3IKEA 3KE1A 1VH8A 1VHAA 1YQNA 1H47A 1W57A 2UZHA 3IEWA 4C81A 3F0GA 3ELCA 3GHZA 1U40A 4C8GA 3JVHA 1IV1A 4C8EA 3RE3A 3IEQA 3MBMA 1KNKA 3FBAA 1U3PA 1T0AA 5B8FA 3F0DA 1JY8A 2AMTA 3P0ZA 1U3LA 3P10A 4C82A 3ERNA 3F0FA 1IV2A 4C8IA
chains in the Genus database with same CATH superfamily
1W55A 3RYFB 1VQ6F 5LYJB 4RHAA 2OHWA 3D00A 2WALA 3M84A 3WJQA 3CC2F 1KQSF 3U0OA 5LOVA 2UYNB 1QVGF 4BVSA 4EI9A 5JVDB 5LA6B 4U39A 2CZWA 4C81A 5HXZA 3ELCA 3RA6A 3PAFA 3HKDB 2KTUA 2H8EA 1X52A 5JCOA 5AVMA 3MBMA 4FFBB 3LMEA 3UT5A 1U3PA 4X1IB 2AMTA 4O4HA 5MN4A 1YJWF 2GZLA 3RYCA 3N4ZA 3LFOA 3NK7A 3T80A 1H48A 3HAXD 1YHQF 3CC7F 2HQSC 1W2BF 2BTUA 1JN1A 4B46A 4G4WA 3E22B 2HP0B 2HP3A 5J2TA 1UI9A 3F0GA 1VQLF 1SA0A 1NJIH 4B5CA 3OW2F 3P0ZA 3JAKA 5JH7B 3S0HA 3JATB 2UYKA 3LDTA 5CB4A 1VQ4F 4G4VA 4LNUA 3JCMM 1Z5WA 3QHDA 4I50B 3N2KB 1GZ0A 2PHNA 1NMUB 5CA1B 5EO3A 3CCMF 4O2BA 1FFXB 2Z1FA 4ZHQA 3F6MA 5GANK 3Q8HA 3S06A 1TUBA 2H8CA 3KJKA 3JARA 3KE1A 3IMPA 3JALB 3CCLF 3N2GB 3RYHB 1RQ2A 5LXTA 1Q86H 5CA0A 2JNBA 4ZI7A 3C9UA 4RQOA 1IPAA 4WBNB 3WGJA 4DRXB 5EYPB 3S03A 3WGMA 3PLAC 1ZWZA 4C82A 4EI8A 5KMGB 1W3EX 2IAFA 3VMFB 3MQWA 4X1KA 2ZVYA 3CCQF 3HTNA 4EB6B 4X1YB 4B62A 3CPQA 3F0EA 4O4LA 1J7HA 3D01A 5BMVB 3LWQC 1U43A 4DXDA 4IIJB 3CCSF 3IEWA 4I4TB 5HY0A 3FD6A 2RHLA 5GONB 1VQ5F 3JAMM 3CCJF 3HKEA 5EIBC 5HWEA 4ZK7A 4NUTA 2F9ZC 1UFYA 3V7QA 1JJ2F 3K2XA 5GIOC 4X20A 2KTVA 3B6NA 2QI2A 5GAPK 1RLGA 3JAWB 5G4UC 2H6LA 4R40B 4IHJB 4ZHWA 2AIFA 2KG4A 1JFFA 3R0PA 4TV9B 2HS4A 2OZBA 2UZHA 1W57A 2Z1TA 1SZQA 3RE3A 3TD3A 1KD1H 2G9IA 3G4SF 4G4YA 4O4JA 2LBTA 3F0FA 1K73H 4B45A 3K12A 1K9MH 2I6DA 2L26A 3C9SA 2QTPA 1E7KA 5C8YB 3RYIB 3ZP4A 4BT2A 5IJ9A 3AGKA 3JASB 3J80M 2PMPA 3CXCF 3V7EA 5EZYB 5KX5A 1W5FA 2RB9A 1VH8A 5FNVB 4O2AA 1H47A 2BO1A 3GHZA 1Q8RA 2NMUA 2CW4A 1GO0A 2OTMA 3LWPC 1JY8A 4BT4A 4G88A 4HNAA 1VQPF 3VOBA 3ZO8A 4YJ2A 1U3LA 3RYFA 1N8RH 3M1XA 5LYJA 1FNKA 2R751 4NQ3A 3ZP7A 1K8AH 4F6RB 5HP7A 3DDNA 4BVRA 3TD4A 3NVKE 2GLZA 2RHJA 1Q81H 4YJ3B 2UYNA 2HVYD 5HY4A 1OFUA 2QEXF 4G4ZA 3ESJA 5JVDA 1ODEA 5LA6A 5HY2A 3J7AR 2BTQB 3LWOC 3KJJA 1TVKB 3HKDA 1OAPA 2CWJA 2CSLA 2HS0A 5MN6A 3E1YA 5IYZB 5ITZB 4FFBA 4X1IA 5IT9M 2CHSA 1W41A 3NMUC 2I6RA 2IQQA 2Q1XA 4TUYB 3VYSC 3LWVC 2ZF8A 5B8FA 1T0KB 1JD1A 2W8BC 3S02A 4BT3A 3CD6F 3HKCB 2UYPA 3VIUA 2CHTA 4LNUB 3FD5A 3WJPA 3VCZA 3VOAA 1W59A 3S0YA 1CK2A 2ZODA 3EORA 2K1SA 2HP0A 3E22A 1PXWA 1IV4A 3D54A 3FFMA 2HX0A 4U3JB 1SDSA 1YJNF 5LXTB 4C8EA 1QVFF 3MDOA 4BT5A 3JATA 1XHOA 1T0AA 4BW0B 1X25A 4ZI7B 2QA4F 1X7OA 4I50A 3N2KA 3VO8A 1CN7A 2VAPA 5EB1B 5JQGB 3TD5A 5CA1A 5GIPC 2OTLF 1FFXA 1H7MA 3HKBB 3O85A 1DT9A 1NQ3A 2AIZP 3OBWA 3JALA 5DCVA 3M4SA 5HP8A 3N2GA 3RYHA 4O4IB 4ERHA 5IJ0B 1W581 4C8GA 3JVHA 5EIBD 4WBNA 2FGYA 4DRXA 5EYPA 2RHOA 4ZOLB 3CCEF 2YXZA 5FJ4C 5LP6B 4E6EA 3E20B 4EB6A 4X1YA 4X20B 1W5EA 2IG8A 4I55B 3J81M 3LYBA 3I55F 2LBXA 5BMVA 5G4VC 4IIJA 5J2UB 3CG6A 1FNJA 4I4TA 3C9TA 2ZOVA 5GONA 1COMA 3ZOPA 5EAZA 2RHHA 2ZVZA 3FBAA 1VK3A 4TV8B 3SIVA 3OONA 3IR9A 3ERNA 3MCAB 2Z1UA 3VYTC 1M1KH 2ZAUA 1GO1A 3V4DA 3NVIB 2CVLA 3VYUC 3JAWA 5EB0A 2YYEA 2P6YA 1GX1A 4IHJA 4TV9A 1CLIA 2BTOA 1YJ9F 3I3FA 5LOVB 1VQ7F 2LBWA 4LCKA 3CYPB 4O2AB 3CPWF 1RQ7A 3KHNA 1RLUA 2R6R1 3WGKA 1DBFA 1Q7YH 4BY9D 1VQMF 1W5AA 3UT5B 4ZHVA 2VXYA 5A2QM 3GYQA 5C8YA 3RYIA 3WGLA 3CMAF 3JASA 4O4HB 4ZHYB 2KGWA 3IKFA 5EZYA 4BVTA 3RYCB 4BT6A 1KNJA 3VTIC 5FNVA 3C8LA 3CCUF 5EWRA 3CYQA 3I7TA 4G4XA 3CCVF 1YITF 1Q82H 2N48A 1VQ9F 2OTJF 5J2TB 2V9YA 1SA0B 2DYYA 3G71F 1W40A 2ALEA 3GTZA 3V3TA 4F6RA 3P10A 3JAKB 2GVIA 4C8IA 3I56F 3CCRF 5CB4B 5LP6C 3K14A 4YJ3A 2UYJA 2VAMA 4BT7A 4TZZA 3WXMB 3P4EA 1FSZA 1TVKA 2EWCA 4O2BB 1VQOF 1QU9A 5IYZA 4ZHQB 5ITZA 3HJWC 5HY1A 4XCQA 2VAWA 3LWRC 1VHAA 1TUBB 2VGMA 2MQEA 3JARB 4EI7A 1M90H 4TUYA 1R1MA 3C9RA 5JH7A 3CMEF 5CA0B 3F0DA 3HKCA 1QAHA 3CB2A 1YIJF 2Z1EA 3BYQA 2HRYA 2HRUA 2Z01A 3G6EF 3MCQA 1X7PA 3RA5A 3NK6A 1YI2F 4X1KB 3FPIA 4U3JA 3CC4F 4KWEA 4O4LB 3L7QA 1YQNA 3ON1A 1IV1A 3IEQA 5JCOC 5JQGA 3OBYA 3HKEB 3QUWA 4X3MA 5KMGA 1VQNF 4C4WC 4PWTA 1IV3A 3HKBA 2HS3A 3WGNA 1XRGA 4O4IA 3VI6A 5IJ0A 2FC3A 1S72F 3IKEA 3WPWA 3WPXA 1JFFB 1PF5A 1KNKA 1KC8H 1ONIA 4ZOLA 2LCAA 2Q1YA 5MN5A 5LP6A 1VQKF 1QD9A 1W5BA 1IV2A 1W42A 4O4JB 3SIUA 1XV2A 4I55A 2DT4A 2B33A 3N4YA 1Z5VA 1VQVA 5J2UA 5IJ9B 5GINC 3KIZA 1YGYA 3QTYA 5HXUA 4M8IA 5FLXM 5KX5B 1XBIA 1U40A 1RA4A 4TV8A 3WJRA 2VGNA 4X3LA 3S0WA 4NWOB 3HWUA 3DC2A 4BVQA 3K0TA 1VQ8F 4HNAB 4YJ2B
chains in the Genus database with same CATH topology
1W55A 2GZLA 3K2XA 3QHDA 1IV3A 3K14A 3B6NA 3IKFA 1GX1A 2PMPA 1KNJA 3T80A 1H48A 3FPIA 3EORA 3ESJA 3F0EA 3F6MA 1IV4A 1JN1A 3Q8HA 1U43A 3IKEA 3KE1A 1VH8A 1VHAA 1YQNA 1H47A 1W57A 2UZHA 3IEWA 4C81A 3F0GA 3ELCA 3GHZA 1U40A 4C8GA 3JVHA 1IV1A 4C8EA 3RE3A 3IEQA 3MBMA 1KNKA 3FBAA 1U3PA 1T0AA 5B8FA 3F0DA 1JY8A 2AMTA 3P0ZA 1U3LA 3P10A 4C82A 3ERNA 3F0FA 1IV2A 4C8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W55 A;  2GZL A;  3K2X A;  3QHD A;  1IV3 A;  3K14 A;  3B6N A;  3IKF A;  1GX1 A;  2PMP A;  1KNJ A;  3T80 A;  1H48 A;  3FPI A;  3EOR A;  3ESJ A;  3F0E A;  3F6M A;  1IV4 A;  1JN1 A;  3Q8H A;  1U43 A;  3IKE A;  3KE1 A;  1VH8 A;  1VHA A;  1YQN A;  1H47 A;  1W57 A;  2UZH A;  3IEW A;  4C81 A;  3F0G A;  3ELC A;  3GHZ A;  1U40 A;  4C8G A;  3JVH A;  1IV1 A;  4C8E A;  3RE3 A;  3IEQ A;  3MBM A;  1KNK A;  3FBA A;  1U3P A;  1T0A A;  5B8F A;  3F0D A;  1JY8 A;  2AMT A;  3P0Z A;  1U3L A;  3P10 A;  4C82 A;  3ERN A;  3F0F A;  1IV2 A;  4C8I A; 
#chains in the Genus database with same CATH topology
 1W55 A;  3RYF B;  1VQ6 F;  5LYJ B;  4RHA A;  2OHW A;  3D00 A;  2WAL A;  3M84 A;  3WJQ A;  3CC2 F;  1KQS F;  3U0O A;  5LOV A;  2UYN B;  1QVG F;  4BVS A;  4EI9 A;  5JVD B;  5LA6 B;  4U39 A;  2CZW A;  4C81 A;  5HXZ A;  3ELC A;  3RA6 A;  3PAF A;  3HKD B;  2KTU A;  2H8E A;  1X52 A;  5JCO A;  5AVM A;  3MBM A;  4FFB B;  3LME A;  3UT5 A;  1U3P A;  4X1I B;  2AMT A;  4O4H A;  5MN4 A;  1YJW F;  2GZL A;  3RYC A;  3N4Z A;  3LFO A;  3NK7 A;  3T80 A;  1H48 A;  3HAX D;  1YHQ F;  3CC7 F;  2HQS C;  1W2B F;  2BTU A;  1JN1 A;  4B46 A;  4G4W A;  3E22 B;  2HP0 B;  2HP3 A;  5J2T A;  1UI9 A;  3F0G A;  1VQL F;  1SA0 A;  1NJI H;  4B5C A;  3OW2 F;  3P0Z A;  3JAK A;  5JH7 B;  3S0H A;  3JAT B;  2UYK A;  3LDT A;  5CB4 A;  1VQ4 F;  4G4V A;  4LNU A;  3JCM M;  1Z5W A;  3QHD A;  4I50 B;  3N2K B;  1GZ0 A;  2PHN A;  1NMU B;  5CA1 B;  5EO3 A;  3CCM F;  4O2B A;  1FFX B;  2Z1F A;  4ZHQ A;  3F6M A;  5GAN K;  3Q8H A;  3S06 A;  1TUB A;  2H8C A;  3KJK A;  3JAR A;  3KE1 A;  3IMP A;  3JAL B;  3CCL F;  3N2G B;  3RYH B;  1RQ2 A;  5LXT A;  1Q86 H;  5CA0 A;  2JNB A;  4ZI7 A;  3C9U A;  4RQO A;  1IPA A;  4WBN B;  3WGJ A;  4DRX B;  5EYP B;  3S03 A;  3WGM A;  3PLA C;  1ZWZ A;  4C82 A;  4EI8 A;  5KMG B;  1W3E X;  2IAF A;  3VMF B;  3MQW A;  4X1K A;  2ZVY A;  3CCQ F;  3HTN A;  4EB6 B;  4X1Y B;  4B62 A;  3CPQ A;  3F0E A;  4O4L A;  1J7H A;  3D01 A;  5BMV B;  3LWQ C;  1U43 A;  4DXD A;  4IIJ B;  3CCS F;  3IEW A;  4I4T B;  5HY0 A;  3FD6 A;  2RHL A;  5GON B;  1VQ5 F;  3JAM M;  3CCJ F;  3HKE A;  5EIB C;  5HWE A;  4ZK7 A;  4NUT A;  2F9Z C;  1UFY A;  3V7Q A;  1JJ2 F;  3K2X A;  5GIO C;  4X20 A;  2KTV A;  3B6N A;  2QI2 A;  5GAP K;  1RLG A;  3JAW B;  5G4U C;  2H6L A;  4R40 B;  4IHJ B;  4ZHW A;  2AIF A;  2KG4 A;  1JFF A;  3R0P A;  4TV9 B;  2HS4 A;  2OZB A;  2UZH A;  1W57 A;  2Z1T A;  1SZQ A;  3RE3 A;  3TD3 A;  1KD1 H;  2G9I A;  3G4S F;  4G4Y A;  4O4J A;  2LBT A;  3F0F A;  1K73 H;  4B45 A;  3K12 A;  1K9M H;  2I6D A;  2L26 A;  3C9S A;  2QTP A;  1E7K A;  5C8Y B;  3RYI B;  3ZP4 A;  4BT2 A;  5IJ9 A;  3AGK A;  3JAS B;  3J80 M;  2PMP A;  3CXC F;  3V7E A;  5EZY B;  5KX5 A;  1W5F A;  2RB9 A;  1VH8 A;  5FNV B;  4O2A A;  1H47 A;  2BO1 A;  3GHZ A;  1Q8R A;  2NMU A;  2CW4 A;  1GO0 A;  2OTM A;  3LWP C;  1JY8 A;  4BT4 A;  4G88 A;  4HNA A;  1VQP F;  3VOB A;  3ZO8 A;  4YJ2 A;  1U3L A;  3RYF A;  1N8R H;  3M1X A;  5LYJ A;  1FNK A;  2R75 1;  4NQ3 A;  3ZP7 A;  1K8A H;  4F6R B;  5HP7 A;  3DDN A;  4BVR A;  3TD4 A;  3NVK E;  2GLZ A;  2RHJ A;  1Q81 H;  4YJ3 B;  2UYN A;  2HVY D;  5HY4 A;  1OFU A;  2QEX F;  4G4Z A;  3ESJ A;  5JVD A;  1ODE A;  5LA6 A;  5HY2 A;  3J7A R;  2BTQ B;  3LWO C;  3KJJ A;  1TVK B;  3HKD A;  1OAP A;  2CWJ A;  2CSL A;  2HS0 A;  5MN6 A;  3E1Y A;  5IYZ B;  5ITZ B;  4FFB A;  4X1I A;  5IT9 M;  2CHS A;  1W41 A;  3NMU C;  2I6R A;  2IQQ A;  2Q1X A;  4TUY B;  3VYS C;  3LWV C;  2ZF8 A;  5B8F A;  1T0K B;  1JD1 A;  2W8B C;  3S02 A;  4BT3 A;  3CD6 F;  3HKC B;  2UYP A;  3VIU A;  2CHT A;  4LNU B;  3FD5 A;  3WJP A;  3VCZ A;  3VOA A;  1W59 A;  3S0Y A;  1CK2 A;  2ZOD A;  3EOR A;  2K1S A;  2HP0 A;  3E22 A;  1PXW A;  1IV4 A;  3D54 A;  3FFM A;  2HX0 A;  4U3J B;  1SDS A;  1YJN F;  5LXT B;  4C8E A;  1QVF F;  3MDO A;  4BT5 A;  3JAT A;  1XHO A;  1T0A A;  4BW0 B;  1X25 A;  4ZI7 B;  2QA4 F;  1X7O A;  4I50 A;  3N2K A;  3VO8 A;  1CN7 A;  2VAP A;  5EB1 B;  5JQG B;  3TD5 A;  5CA1 A;  5GIP C;  2OTL F;  1FFX A;  1H7M A;  3HKB B;  3O85 A;  1DT9 A;  1NQ3 A;  2AIZ P;  3OBW A;  3JAL A;  5DCV A;  3M4S A;  5HP8 A;  3N2G A;  3RYH A;  4O4I B;  4ERH A;  5IJ0 B;  1W58 1;  4C8G A;  3JVH A;  5EIB D;  4WBN A;  2FGY A;  4DRX A;  5EYP A;  2RHO A;  4ZOL B;  3CCE F;  2YXZ A;  5FJ4 C;  5LP6 B;  4E6E A;  3E20 B;  4EB6 A;  4X1Y A;  4X20 B;  1W5E A;  2IG8 A;  4I55 B;  3J81 M;  3LYB A;  3I55 F;  2LBX A;  5BMV A;  5G4V C;  4IIJ A;  5J2U B;  3CG6 A;  1FNJ A;  4I4T A;  3C9T A;  2ZOV A;  5GON A;  1COM A;  3ZOP A;  5EAZ A;  2RHH A;  2ZVZ A;  3FBA A;  1VK3 A;  4TV8 B;  3SIV A;  3OON A;  3IR9 A;  3ERN A;  3MCA B;  2Z1U A;  3VYT C;  1M1K H;  2ZAU A;  1GO1 A;  3V4D A;  3NVI B;  2CVL A;  3VYU C;  3JAW A;  5EB0 A;  2YYE A;  2P6Y A;  1GX1 A;  4IHJ A;  4TV9 A;  1CLI A;  2BTO A;  1YJ9 F;  3I3F A;  5LOV B;  1VQ7 F;  2LBW A;  4LCK A;  3CYP B;  4O2A B;  3CPW F;  1RQ7 A;  3KHN A;  1RLU A;  2R6R 1;  3WGK A;  1DBF A;  1Q7Y H;  4BY9 D;  1VQM F;  1W5A A;  3UT5 B;  4ZHV A;  2VXY A;  5A2Q M;  3GYQ A;  5C8Y A;  3RYI A;  3WGL A;  3CMA F;  3JAS A;  4O4H B;  4ZHY B;  2KGW A;  3IKF A;  5EZY A;  4BVT A;  3RYC B;  4BT6 A;  1KNJ A;  3VTI C;  5FNV A;  3C8L A;  3CCU F;  5EWR A;  3CYQ A;  3I7T A;  4G4X A;  3CCV F;  1YIT F;  1Q82 H;  2N48 A;  1VQ9 F;  2OTJ F;  5J2T B;  2V9Y A;  1SA0 B;  2DYY A;  3G71 F;  1W40 A;  2ALE A;  3GTZ A;  3V3T A;  4F6R A;  3P10 A;  3JAK B;  2GVI A;  4C8I A;  3I56 F;  3CCR F;  5CB4 B;  5LP6 C;  3K14 A;  4YJ3 A;  2UYJ A;  2VAM A;  4BT7 A;  4TZZ A;  3WXM B;  3P4E A;  1FSZ A;  1TVK A;  2EWC A;  4O2B B;  1VQO F;  1QU9 A;  5IYZ A;  4ZHQ B;  5ITZ A;  3HJW C;  5HY1 A;  4XCQ A;  2VAW A;  3LWR C;  1VHA A;  1TUB B;  2VGM A;  2MQE A;  3JAR B;  4EI7 A;  1M90 H;  4TUY A;  1R1M A;  3C9R A;  5JH7 A;  3CME F;  5CA0 B;  3F0D A;  3HKC A;  1QAH A;  3CB2 A;  1YIJ F;  2Z1E A;  3BYQ A;  2HRY A;  2HRU A;  2Z01 A;  3G6E F;  3MCQ A;  1X7P A;  3RA5 A;  3NK6 A;  1YI2 F;  4X1K B;  3FPI A;  4U3J A;  3CC4 F;  4KWE A;  4O4L B;  3L7Q A;  1YQN A;  3ON1 A;  1IV1 A;  3IEQ A;  5JCO C;  5JQG A;  3OBY A;  3HKE B;  3QUW A;  4X3M A;  5KMG A;  1VQN F;  4C4W C;  4PWT A;  1IV3 A;  3HKB A;  2HS3 A;  3WGN A;  1XRG A;  4O4I A;  3VI6 A;  5IJ0 A;  2FC3 A;  1S72 F;  3IKE A;  3WPW A;  3WPX A;  1JFF B;  1PF5 A;  1KNK A;  1KC8 H;  1ONI A;  4ZOL A;  2LCA A;  2Q1Y A;  5MN5 A;  5LP6 A;  1VQK F;  1QD9 A;  1W5B A;  1IV2 A;  1W42 A;  4O4J B;  3SIU A;  1XV2 A;  4I55 A;  2DT4 A;  2B33 A;  3N4Y A;  1Z5V A;  1VQV A;  5J2U A;  5IJ9 B;  5GIN C;  3KIZ A;  1YGY A;  3QTY A;  5HXU A;  4M8I A;  5FLX M;  5KX5 B;  1XBI A;  1U40 A;  1RA4 A;  4TV8 A;  3WJR A;  2VGN A;  4X3L A;  3S0W A;  4NWO B;  3HWU A;  3DC2 A;  4BVQ A;  3K0T A;  1VQ8 F;  4HNA B;  4YJ2 B; 
#chains in the Genus database with same CATH homology
 1W55 A;  2GZL A;  3K2X A;  3QHD A;  1IV3 A;  3K14 A;  3B6N A;  3IKF A;  1GX1 A;  2PMP A;  1KNJ A;  3T80 A;  1H48 A;  3FPI A;  3EOR A;  3ESJ A;  3F0E A;  3F6M A;  1IV4 A;  1JN1 A;  3Q8H A;  1U43 A;  3IKE A;  3KE1 A;  1VH8 A;  1VHA A;  1YQN A;  1H47 A;  1W57 A;  2UZH A;  3IEW A;  4C81 A;  3F0G A;  3ELC A;  3GHZ A;  1U40 A;  4C8G A;  3JVH A;  1IV1 A;  4C8E A;  3RE3 A;  3IEQ A;  3MBM A;  1KNK A;  3FBA A;  1U3P A;  1T0A A;  5B8F A;  3F0D A;  1JY8 A;  2AMT A;  3P0Z A;  1U3L A;  3P10 A;  4C82 A;  3ERN A;  3F0F A;  1IV2 A;  4C8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...