5HY4A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
377
structure length
361
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVSMCWSNDASALGVAVALGEVKRDLVADDRIRSDWDLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
molecule keywords Ring-opening amidohydrolase
total genus 112
structure length 361
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A01
5HY0A 5HXZA 5HWEA 4BVQA 5HY4A 4BVTA 5HXUA 5HY1A 5HY2A 4BVRA 4NQ3A 4BVSA
chains in the Genus database with same CATH superfamily
1JD1A 4I50B 5LP6A 5EZYB 4YJ2A 1VQMF 4ZI7B 3S0WA 4B5CA 1IV2A 1YJ9F 2LBWA 1VQ5F 2HVYD 2QI2A 5JVDA 4B46A 1GZ0A 3CCUF 2OTMA 4XCQA 3S02A 2QEXF 2UYPA 3HTNA 1TUBA 2FGYA 2CW4A 3QTYA 4G4YA 3RYFA 3WGMA 2OZBA 4C8GA 3WGLA 5EYPA 1T0KB 1SA0A 1CLIA 1IV4A 2GLZA 1NQ3A 1VQOF 5FJ4C 1K8AH 3JVHA 3VOAA 2CHSA 2AIZP 3CCSF 1W5AA 5EIBC 4TUYA 1GO1A 2Z1TA 1W5BA 4O4HA 3M1XA 2VAWA 3VOBA 3S03A 1PF5A 3CC2F 3JAWB 2Q1XA 2VAPA 3TD5A 5JVDB 2FC3A 3V7EA 1FSZA 1VQKF 3RYHA 3BYQA 2OTJF 2UYNB 3CYQA 4O4JA 4G4WA 1RLGA 1VQPF 3MDOA 3RYFB 4IHJA 1E7KA 3LMEA 4O2BB 3OBWA 3N2KA 1W5FA 4I4TA 4KWEA 3ZO8A 5MN5A 2VXYA 4RQOA 1H48A 3LFOA 3K14A 3E22A 1IV1A 3P10A 4BT7A 1DT9A 4ZOLA 1VHAA 3TD4A 3LWRC 3FBAA 5J2UB 2QTPA 3HKEA 1OFUA 5GONB 3N2GA 4IIJA 1Q7YH 3CD6F 4O4IA 4X1KA 3CCVF 4TV8A 3JAWA 2ZF8A 5J2TA 3N4YA 3ELCA 3ON1A 3VIUA 1Z5WA 2CZWA 3NK7A 4O4JB 4BY9D 1Q86H 2VGNA 3IKEA 5FNVB 2HS3A 3KHNA 3MBMA 3GYQA 3T80A 1VQ8F 2R6R1 4G88A 3P4EA 4G4VA 1W3EX 2YXZA 3MCAB 4NWOB 3F0DA 5J2UA 1VK3A 1GX1A 4I55A 1U40A 5JQGB 3CCJF 4C8IA 1QAHA 4NQ3A 3E1YA 3J7AR 3C9RA 3LWVC 3S0HA 4RHAA 1X52A 3F0EA 2ZOVA 2BTQB 1JY8A 4G4XA 3K2XA 2Z1FA 5IJ0B 4BVQA 2B33A 2KGWA 3GHZA 1H7MA 2R751 5HY1A 2H8CA 4FFBA 3WPXA 4X20B 4B45A 1Q8RA 2RHLA 3F0GA 1XV2A 3N4ZA 4ZHVA 3OW2F 1UI9A 4O2BA 4ZHWA 2GZLA 3WGKA 1Q82H 1VQ7F 1VH8A 3SIUA 3IKFA 4B62A 5DCVA 5ITZB 4LCKA 5EZYA 1RQ7A 4E6EA 3HKEB 4X3MA 3ESJA 4YJ2B 3WJQA 5LYJB 4F6RB 2L26A 3B6NA 3UT5B 1W5EA 2UYJA 4BT4A 1K9MH 2I6DA 4X20A 4LNUA 3CCEF 3PLAC 1ONIA 4X1YB 3L7QA 3HWUA 3TD3A 1QVFF 4DRXA 5LXTA 5MN6A 3I7TA 1VQ6F 1H47A 1YJWF 3LWOC 4HNAB 2VAMA 4EI9A 4ZK7A 5ITZA 1W2BF 1GO0A 2Z1UA 3Q8HA 2KTVA 3OONA 4O2AB 3HAXD 2ALEA 2AMTA 2Q1YA 1OAPA 1KC8H 3CMAF 4ZHYB 3CCQF 2BTUA 3KJJA 3N2KB 2Z1EA 4U3JA 3NMUC 5AVMA 5IJ9B 1XRGA 3RYIB 3ERNA 3JARB 5KMGB 1NJIH 4ZOLB 1U3LA 3WPWA 5GIOC 4HNAA 3MCQA 5A2QM 1JN1A 5HWEA 1YJNF 1IPAA 2QA4F 4TV8B 3CPWF 5JH7A 4O4LB 2HS0A 1XBIA 5J2TB 1FNKA 5EB1B 5LA6A 5CA1B 3JATA 1COMA 5LYJA 5FNVA 4C82A 5C8YA 2OTLF 1YGYA 3S06A 3V7QA 3J80M 5EIBD 2DT4A 1X7PA 1RA4A 4BT2A 3D00A 1ZWZA 2VGMA 2HQSC 4C81A 5JQGA 2LCAA 3F6MA 4I4TB 5HY0A 1YQNA 4YJ3B 2HX0A 5G4UC 5HY2A 2CWJA 3D01A 2I6RA 4EI7A 5BMVA 1R1MA 5EWRA 1FFXA 5HXUA 4ZHQA 5JCOC 3IEWA 5LOVA 3VI6A 3CYPB 4X1KB 1UFYA 3HJWC 2LBTA 2BTOA 3NVIB 1X25A 3G6EF 3HKBB 2NMUA 5KX5A 4BVRA 2MQEA 3LYBA 3M84A 4U3JB 3MQWA 5CB4B 5CA0B 5JCOA 2HP0A 1J7HA 3JARA 3VTIC 5GIPC 1JJ2F 2H8EA 1FNJA 3DDNA 3HKCA 3CG6A 2HRYA 2KG4A 2YYEA 1U43A 5BMVB 1CK2A 4ZHQB 3JCMM 3WJPA 4TV9A 1W41A 3LDTA 1KD1H 3UT5A 4ERHA 4BT3A 3VYTC 3I56F 4O4LA 1RLUA 1KQSF 4I50A 3ZP4A 3IMPA 3KE1A 3C8LA 5LA6B 2V9YA 1KNJA 2ZODA 5KX5B 1NMUB 4PWTA 3CC4F 4DXDA 4DRXB 3F0FA 1SDSA 5HXZA 5HY4A 1T0AA 3QUWA 1PXWA 3IR9A 1TUBB 3VYUC 3CXCF 3HKDA 4BW0B 2ZVYA 3JALB 3O85A 3QHDA 1W57A 4YJ3A 1S72F 1VQ9F 3JAKB 1YIJF 4O2AA 2AIFA 2PMPA 2UZHA 3RA5A 2IG8A 3S0YA 3FD6A 4X1IA 3WJRA 1FFXB 3FPIA 5MN4A 5LOVB 3CPQA 4U39A 4O4HB 3RE3A 4F6RA 1TVKA 3FFMA 1VQNF 5EAZA 3JASB 5IJ9A 4LNUB 2LBXA 1VQLF 3WXMB 4X1YA 3K0TA 2UYNA 3HKBA 2KTUA 1Q81H 2IAFA 3HKDB 3P0ZA 2F9ZC 5GANK 5LP6C 4WBNB 3KIZA 3CCRF 5EB0A 4BT6A 2RHJA 1KNKA 3DC2A 2HRUA 2RHHA 1W42A 2WALA 1W581 3D54A 3LWQC 3JATB 3JAMM 1SA0B 2P6YA 2ZAUA 2HS4A 1U3PA 4O4IB 1ODEA 3VMFB 1YI2F 5C8YB 1M1KH 3JASA 1QU9A 3GTZA 1QVGF 3NK6A 2CVLA 5GINC 3WGNA 2RHOA 2Z01A 5IYZA 3J81M 5FLXM 3NVKE 2EWCA 3RYIA 5IT9M 5KMGA 2W8BC 3PAFA 3VYSC 3C9UA 2H6LA 3RYCA 1QD9A 3FD5A 3ZP7A 3JALA 2DYYA 3JAKA 4TZZA 5JH7B 2CHTA 1VQ4F 2IQQA 4EI8A 3OBYA 5LP6B 5CA1A 1RQ2A 1X7OA 4ZI7A 2GVIA 3VO8A 2RB9A 1TVKB 4BT5A 4BVSA 5IYZB 4R40B 2CSLA 1YHQF 3CCMF 4FFBB 3CCLF 2HP0B 2ZVZA 3M4SA 2HP3A 1N8RH 3E20B 5G4VC 3VCZA 3CB2A 3RYCB 5HP7A 3ZOPA 2OHWA 1CN7A 4EB6A 4TV9B 5EO3A 3C9TA 4WBNA 1M90H 3CC7F 3V4DA 4BVTA 2G9IA 4I55B 4NUTA 4G4ZA 1DBFA 1K73H 4TUYB 3WGJA 3I55F 3G71F 1W55A 1SZQA 1W59A 1JFFA 3V3TA 2PHNA 3RYHB 2N48A 5IJ0A 2JNBA 4IHJB 1YITF 3KJKA 3G4SF 3EORA 4EB6B 5LXTB 5B8FA 5CB4A 3K12A 1W40A 5CA0A 3IEQA 2K1SA 3E22B 4C8EA 2UYKA 5GAPK 3LWPC 3U0OA 3RA6A 4M8IA 2BO1A 3C9SA 3HKCB 1VQVA 5HP8A 4X1IB 3CMEF 5GONA 5EYPB 1XHOA 1IV3A 4IIJB 3N2GB 4X3LA 4C4WC 3I3FA 3SIVA 3R0PA 1Z5VA 1JFFB 3AGKA
chains in the Genus database with same CATH topology
1W42A 2WALA 5HY0A 3LWQC 3JAMM 3N4ZA 1VQMF 5G4UC 5HY2A 3VMFB 1YI2F 3OW2F 1M1KH 4EI7A 1YJ9F 2LBWA 1VQ5F 2HVYD 2QI2A 5EWRA 5HXUA 1QVGF 1GZ0A 3NK6A 1Q82H 1VQ7F 3CCUF 4XCQA 5GINC 3SIUA 2QEXF 2FGYA 3VI6A 2OZBA 5DCVA 3J81M 5FLXM 4LCKA 3NVKE 3HJWC 1T0KB 5IT9M 4X3MA 3NVIB 2GLZA 3G6EF 3PAFA 1VQOF 5FJ4C 4BVRA 1K8AH 1K9MH 2I6DA 3CCEF 3CCSF 3PLAC 5GIPC 1JJ2F 4TZZA 1GO1A 3CG6A 3CC2F 1QVFF 2KG4A 1VQ4F 2FC3A 4EI8A 1CK2A 3OBYA 3V7EA 3JCMM 1W41A 1VQKF 1X7OA 2OTJF 1KD1H 1VQ6F 1RLGA 1VQPF 1YJWF 3LWOC 4BVSA 3I56F 1E7KA 4EI9A 3CCMF 3OBWA 1YHQF 3CCLF 1W2BF 1KQSF 1GO0A 3LFOA 2KTVA 1N8RH 3E20B 5G4VC 1DT9A 1NMUB 3HAXD 3CC4F 3LWRC 2OHWA 1CN7A 2ALEA 1SDSA 5EO3A 5HXZA 1KC8H 3CMAF 1Q7YH 5HY4A 1PXWA 3IR9A 3CD6F 1M90H 3CC7F 3CXCF 3CCQF 3CCVF 4BVTA 4BW0B 3N4YA 3NMUC 3ON1A 4NUTA 3O85A 2CZWA 3NK7A 1S72F 1K73H 1NJIH 1VQ9F 1YIJF 1Q86H 4BY9D 2AIFA 5GIOC 3I55F 2VGNA 3G71F 3RA5A 5A2QM 3GYQA 3V3TA 1VQ8F 5HWEA 1YJNF 1IPAA 3CPQA 2QA4F 2JNBA 3CPWF 1YITF 1W3EX 3FFMA 3MCAB 1XBIA 3G4SF 1VQNF 2LBXA 1VQLF 1W40A 3WXMB 3CCJF 5GAPK 3LWPC 4NQ3A 3E1YA 2KTUA 3RA6A 3J7AR 3LWVC 2BO1A 1Q81H 1X52A 2OTLF 3CMEF 3V7QA 3J80M 2F9ZC 4C4WC 5GANK 4X3LA 1X7PA 3CCRF 1RA4A 4BVQA 3SIVA 3D00A 1ZWZA 2VGMA 1H7MA 5HY1A 3AGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HY0 A;  5HXZ A;  5HWE A;  4BVQ A;  5HY4 A;  4BVT A;  5HXU A;  5HY1 A;  5HY2 A;  4BVR A;  4NQ3 A;  4BVS A; 
#chains in the Genus database with same CATH topology
 1JD1 A;  4I50 B;  5LP6 A;  5EZY B;  4YJ2 A;  1VQM F;  4ZI7 B;  3S0W A;  4B5C A;  1IV2 A;  1YJ9 F;  2LBW A;  1VQ5 F;  2HVY D;  2QI2 A;  5JVD A;  4B46 A;  1GZ0 A;  3CCU F;  2OTM A;  4XCQ A;  3S02 A;  2QEX F;  2UYP A;  3HTN A;  1TUB A;  2FGY A;  2CW4 A;  3QTY A;  4G4Y A;  3RYF A;  3WGM A;  2OZB A;  4C8G A;  3WGL A;  5EYP A;  1T0K B;  1SA0 A;  1CLI A;  1IV4 A;  2GLZ A;  1NQ3 A;  1VQO F;  5FJ4 C;  1K8A H;  3JVH A;  3VOA A;  2CHS A;  2AIZ P;  3CCS F;  1W5A A;  5EIB C;  4TUY A;  1GO1 A;  2Z1T A;  1W5B A;  4O4H A;  3M1X A;  2VAW A;  3VOB A;  3S03 A;  1PF5 A;  3CC2 F;  3JAW B;  2Q1X A;  2VAP A;  3TD5 A;  5JVD B;  2FC3 A;  3V7E A;  1FSZ A;  1VQK F;  3RYH A;  3BYQ A;  2OTJ F;  2UYN B;  3CYQ A;  4O4J A;  4G4W A;  1RLG A;  1VQP F;  3MDO A;  3RYF B;  4IHJ A;  1E7K A;  3LME A;  4O2B B;  3OBW A;  3N2K A;  1W5F A;  4I4T A;  4KWE A;  3ZO8 A;  5MN5 A;  2VXY A;  4RQO A;  1H48 A;  3LFO A;  3K14 A;  3E22 A;  1IV1 A;  3P10 A;  4BT7 A;  1DT9 A;  4ZOL A;  1VHA A;  3TD4 A;  3LWR C;  3FBA A;  5J2U B;  2QTP A;  3HKE A;  1OFU A;  5GON B;  3N2G A;  4IIJ A;  1Q7Y H;  3CD6 F;  4O4I A;  4X1K A;  3CCV F;  4TV8 A;  3JAW A;  2ZF8 A;  5J2T A;  3N4Y A;  3ELC A;  3ON1 A;  3VIU A;  1Z5W A;  2CZW A;  3NK7 A;  4O4J B;  4BY9 D;  1Q86 H;  2VGN A;  3IKE A;  5FNV B;  2HS3 A;  3KHN A;  3MBM A;  3GYQ A;  3T80 A;  1VQ8 F;  2R6R 1;  4G88 A;  3P4E A;  4G4V A;  1W3E X;  2YXZ A;  3MCA B;  4NWO B;  3F0D A;  5J2U A;  1VK3 A;  1GX1 A;  4I55 A;  1U40 A;  5JQG B;  3CCJ F;  4C8I A;  1QAH A;  4NQ3 A;  3E1Y A;  3J7A R;  3C9R A;  3LWV C;  3S0H A;  4RHA A;  1X52 A;  3F0E A;  2ZOV A;  2BTQ B;  1JY8 A;  4G4X A;  3K2X A;  2Z1F A;  5IJ0 B;  4BVQ A;  2B33 A;  2KGW A;  3GHZ A;  1H7M A;  2R75 1;  5HY1 A;  2H8C A;  4FFB A;  3WPX A;  4X20 B;  4B45 A;  1Q8R A;  2RHL A;  3F0G A;  1XV2 A;  3N4Z A;  4ZHV A;  3OW2 F;  1UI9 A;  4O2B A;  4ZHW A;  2GZL A;  3WGK A;  1Q82 H;  1VQ7 F;  1VH8 A;  3SIU A;  3IKF A;  4B62 A;  5DCV A;  5ITZ B;  4LCK A;  5EZY A;  1RQ7 A;  4E6E A;  3HKE B;  4X3M A;  3ESJ A;  4YJ2 B;  3WJQ A;  5LYJ B;  4F6R B;  2L26 A;  3B6N A;  3UT5 B;  1W5E A;  2UYJ A;  4BT4 A;  1K9M H;  2I6D A;  4X20 A;  4LNU A;  3CCE F;  3PLA C;  1ONI A;  4X1Y B;  3L7Q A;  3HWU A;  3TD3 A;  1QVF F;  4DRX A;  5LXT A;  5MN6 A;  3I7T A;  1VQ6 F;  1H47 A;  1YJW F;  3LWO C;  4HNA B;  2VAM A;  4EI9 A;  4ZK7 A;  5ITZ A;  1W2B F;  1GO0 A;  2Z1U A;  3Q8H A;  2KTV A;  3OON A;  4O2A B;  3HAX D;  2ALE A;  2AMT A;  2Q1Y A;  1OAP A;  1KC8 H;  3CMA F;  4ZHY B;  3CCQ F;  2BTU A;  3KJJ A;  3N2K B;  2Z1E A;  4U3J A;  3NMU C;  5AVM A;  5IJ9 B;  1XRG A;  3RYI B;  3ERN A;  3JAR B;  5KMG B;  1NJI H;  4ZOL B;  1U3L A;  3WPW A;  5GIO C;  4HNA A;  3MCQ A;  5A2Q M;  1JN1 A;  5HWE A;  1YJN F;  1IPA A;  2QA4 F;  4TV8 B;  3CPW F;  5JH7 A;  4O4L B;  2HS0 A;  1XBI A;  5J2T B;  1FNK A;  5EB1 B;  5LA6 A;  5CA1 B;  3JAT A;  1COM A;  5LYJ A;  5FNV A;  4C82 A;  5C8Y A;  2OTL F;  1YGY A;  3S06 A;  3V7Q A;  3J80 M;  5EIB D;  2DT4 A;  1X7P A;  1RA4 A;  4BT2 A;  3D00 A;  1ZWZ A;  2VGM A;  2HQS C;  4C81 A;  5JQG A;  2LCA A;  3F6M A;  4I4T B;  5HY0 A;  1YQN A;  4YJ3 B;  2HX0 A;  5G4U C;  5HY2 A;  2CWJ A;  3D01 A;  2I6R A;  4EI7 A;  5BMV A;  1R1M A;  5EWR A;  1FFX A;  5HXU A;  4ZHQ A;  5JCO C;  3IEW A;  5LOV A;  3VI6 A;  3CYP B;  4X1K B;  1UFY A;  3HJW C;  2LBT A;  2BTO A;  3NVI B;  1X25 A;  3G6E F;  3HKB B;  2NMU A;  5KX5 A;  4BVR A;  2MQE A;  3LYB A;  3M84 A;  4U3J B;  3MQW A;  5CB4 B;  5CA0 B;  5JCO A;  2HP0 A;  1J7H A;  3JAR A;  3VTI C;  5GIP C;  1JJ2 F;  2H8E A;  1FNJ A;  3DDN A;  3HKC A;  3CG6 A;  2HRY A;  2KG4 A;  2YYE A;  1U43 A;  5BMV B;  1CK2 A;  4ZHQ B;  3JCM M;  3WJP A;  4TV9 A;  1W41 A;  3LDT A;  1KD1 H;  3UT5 A;  4ERH A;  4BT3 A;  3VYT C;  3I56 F;  4O4L A;  1RLU A;  1KQS F;  4I50 A;  3ZP4 A;  3IMP A;  3KE1 A;  3C8L A;  5LA6 B;  2V9Y A;  1KNJ A;  2ZOD A;  5KX5 B;  1NMU B;  4PWT A;  3CC4 F;  4DXD A;  4DRX B;  3F0F A;  1SDS A;  5HXZ A;  5HY4 A;  1T0A A;  3QUW A;  1PXW A;  3IR9 A;  1TUB B;  3VYU C;  3CXC F;  3HKD A;  4BW0 B;  2ZVY A;  3JAL B;  3O85 A;  3QHD A;  1W57 A;  4YJ3 A;  1S72 F;  1VQ9 F;  3JAK B;  1YIJ F;  4O2A A;  2AIF A;  2PMP A;  2UZH A;  3RA5 A;  2IG8 A;  3S0Y A;  3FD6 A;  4X1I A;  3WJR A;  1FFX B;  3FPI A;  5MN4 A;  5LOV B;  3CPQ A;  4U39 A;  4O4H B;  3RE3 A;  4F6R A;  1TVK A;  3FFM A;  1VQN F;  5EAZ A;  3JAS B;  5IJ9 A;  4LNU B;  2LBX A;  1VQL F;  3WXM B;  4X1Y A;  3K0T A;  2UYN A;  3HKB A;  2KTU A;  1Q81 H;  2IAF A;  3HKD B;  3P0Z A;  2F9Z C;  5GAN K;  5LP6 C;  4WBN B;  3KIZ A;  3CCR F;  5EB0 A;  4BT6 A;  2RHJ A;  1KNK A;  3DC2 A;  2HRU A;  2RHH A;  1W42 A;  2WAL A;  1W58 1;  3D54 A;  3LWQ C;  3JAT B;  3JAM M;  1SA0 B;  2P6Y A;  2ZAU A;  2HS4 A;  1U3P A;  4O4I B;  1ODE A;  3VMF B;  1YI2 F;  5C8Y B;  1M1K H;  3JAS A;  1QU9 A;  3GTZ A;  1QVG F;  3NK6 A;  2CVL A;  5GIN C;  3WGN A;  2RHO A;  2Z01 A;  5IYZ A;  3J81 M;  5FLX M;  3NVK E;  2EWC A;  3RYI A;  5IT9 M;  5KMG A;  2W8B C;  3PAF A;  3VYS C;  3C9U A;  2H6L A;  3RYC A;  1QD9 A;  3FD5 A;  3ZP7 A;  3JAL A;  2DYY A;  3JAK A;  4TZZ A;  5JH7 B;  2CHT A;  1VQ4 F;  2IQQ A;  4EI8 A;  3OBY A;  5LP6 B;  5CA1 A;  1RQ2 A;  1X7O A;  4ZI7 A;  2GVI A;  3VO8 A;  2RB9 A;  1TVK B;  4BT5 A;  4BVS A;  5IYZ B;  4R40 B;  2CSL A;  1YHQ F;  3CCM F;  4FFB B;  3CCL F;  2HP0 B;  2ZVZ A;  3M4S A;  2HP3 A;  1N8R H;  3E20 B;  5G4V C;  3VCZ A;  3CB2 A;  3RYC B;  5HP7 A;  3ZOP A;  2OHW A;  1CN7 A;  4EB6 A;  4TV9 B;  5EO3 A;  3C9T A;  4WBN A;  1M90 H;  3CC7 F;  3V4D A;  4BVT A;  2G9I A;  4I55 B;  4NUT A;  4G4Z A;  1DBF A;  1K73 H;  4TUY B;  3WGJ A;  3I55 F;  3G71 F;  1W55 A;  1SZQ A;  1W59 A;  1JFF A;  3V3T A;  2PHN A;  3RYH B;  2N48 A;  5IJ0 A;  2JNB A;  4IHJ B;  1YIT F;  3KJK A;  3G4S F;  3EOR A;  4EB6 B;  5LXT B;  5B8F A;  5CB4 A;  3K12 A;  1W40 A;  5CA0 A;  3IEQ A;  2K1S A;  3E22 B;  4C8E A;  2UYK A;  5GAP K;  3LWP C;  3U0O A;  3RA6 A;  4M8I A;  2BO1 A;  3C9S A;  3HKC B;  1VQV A;  5HP8 A;  4X1I B;  3CME F;  5GON A;  5EYP B;  1XHO A;  1IV3 A;  4IIJ B;  3N2G B;  4X3L A;  4C4W C;  3I3F A;  3SIV A;  3R0P A;  1Z5V A;  1JFF B;  3AGK A; 
#chains in the Genus database with same CATH homology
 1W42 A;  2WAL A;  5HY0 A;  3LWQ C;  3JAM M;  3N4Z A;  1VQM F;  5G4U C;  5HY2 A;  3VMF B;  1YI2 F;  3OW2 F;  1M1K H;  4EI7 A;  1YJ9 F;  2LBW A;  1VQ5 F;  2HVY D;  2QI2 A;  5EWR A;  5HXU A;  1QVG F;  1GZ0 A;  3NK6 A;  1Q82 H;  1VQ7 F;  3CCU F;  4XCQ A;  5GIN C;  3SIU A;  2QEX F;  2FGY A;  3VI6 A;  2OZB A;  5DCV A;  3J81 M;  5FLX M;  4LCK A;  3NVK E;  3HJW C;  1T0K B;  5IT9 M;  4X3M A;  3NVI B;  2GLZ A;  3G6E F;  3PAF A;  1VQO F;  5FJ4 C;  4BVR A;  1K8A H;  1K9M H;  2I6D A;  3CCE F;  3CCS F;  3PLA C;  5GIP C;  1JJ2 F;  4TZZ A;  1GO1 A;  3CG6 A;  3CC2 F;  1QVF F;  2KG4 A;  1VQ4 F;  2FC3 A;  4EI8 A;  1CK2 A;  3OBY A;  3V7E A;  3JCM M;  1W41 A;  1VQK F;  1X7O A;  2OTJ F;  1KD1 H;  1VQ6 F;  1RLG A;  1VQP F;  1YJW F;  3LWO C;  4BVS A;  3I56 F;  1E7K A;  4EI9 A;  3CCM F;  3OBW A;  1YHQ F;  3CCL F;  1W2B F;  1KQS F;  1GO0 A;  3LFO A;  2KTV A;  1N8R H;  3E20 B;  5G4V C;  1DT9 A;  1NMU B;  3HAX D;  3CC4 F;  3LWR C;  2OHW A;  1CN7 A;  2ALE A;  1SDS A;  5EO3 A;  5HXZ A;  1KC8 H;  3CMA F;  1Q7Y H;  5HY4 A;  1PXW A;  3IR9 A;  3CD6 F;  1M90 H;  3CC7 F;  3CXC F;  3CCQ F;  3CCV F;  4BVT A;  4BW0 B;  3N4Y A;  3NMU C;  3ON1 A;  4NUT A;  3O85 A;  2CZW A;  3NK7 A;  1S72 F;  1K73 H;  1NJI H;  1VQ9 F;  1YIJ F;  1Q86 H;  4BY9 D;  2AIF A;  5GIO C;  3I55 F;  2VGN A;  3G71 F;  3RA5 A;  5A2Q M;  3GYQ A;  3V3T A;  1VQ8 F;  5HWE A;  1YJN F;  1IPA A;  3CPQ A;  2QA4 F;  2JNB A;  3CPW F;  1YIT F;  1W3E X;  3FFM A;  3MCA B;  1XBI A;  3G4S F;  1VQN F;  2LBX A;  1VQL F;  1W40 A;  3WXM B;  3CCJ F;  5GAP K;  3LWP C;  4NQ3 A;  3E1Y A;  2KTU A;  3RA6 A;  3J7A R;  3LWV C;  2BO1 A;  1Q81 H;  1X52 A;  2OTL F;  3CME F;  3V7Q A;  3J80 M;  2F9Z C;  4C4W C;  5GAN K;  4X3L A;  1X7P A;  3CCR F;  1RA4 A;  4BVQ A;  3SIV A;  3D00 A;  1ZWZ A;  2VGM A;  1H7M A;  5HY1 A;  3AGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...