5HY4A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
377
structure length
361
Chain Sequence
b'RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVSMCWSNDASALGVAVALGEVKRDLVADDRIRSDWDLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNGGNPVAAVVRRLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
total genus 112
structure length 361
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A01
4BVQA 5HY1A 4BVSA 5HXZA 4NQ3A 5HY0A 4BVRA 4BVTA 5HY4A 5HY2A 5HWEA 5HXUA
chains in the Genus database with same CATH superfamily
5IJ9B 3RYHB 5LYJB 3FD5A 2W8BC 5EB0A 3J81M 3Q8HA 2ZVZA 4O4HB 3P10A 5BMVB 1XRGA 3K14A 4PWTA 4X3LA 1Q81H 5LA6A 2H8EA 1QD9A 3F0FA 3IKEA 4ZK7A 2FGYA 4O2BA 3KIZA 4FFBA 5LA6B 3N2KA 5JCOA 3ZP4A 3CCJF 4LNUA 4ZHVA 4C8IA 4RHAA 1YJNF 4RQOA 3CCVF 3N2KB 2Z1TA 3HKCA 5CA0B 4EI9A 2LCAA 2OTLF 1W41A 2LBWA 3JAWA 3ZO8A 4U39A 2IQQA 2UYJA 4TV9A 4X1YA 3HKCB 1JY8A 2RB9A 1M1KH 5KX5A 4R40B 2QA4F 1K8AH 2UYPA 3CB2A 4X1YB 5HY0A 1GX1A 1XV2A 3K0TA 5EZYB 2MQEA 5EB1B 1JD1A 3DDNA 2BTOA 2BTUA 4BW0B 3VI6A 5J2TB 1PXWA 5AVMA 1IV1A 3QTYA 5JH7A 2QEXF 1OFUA 1RA4A 1KD1H 1VQ4F 5DCVA 3WPWA 4DXDA 4ZOLA 5JH7B 2IAFA 3KJKA 4E6EA 3G71F 2I6RA 4O4LA 5GANK 3F0EA 5HY1A 4B46A 3KE1A 4X20A 1IPAA 4ZOLB 5EIBD 3TD3A 3V7QA 3ELCA 3I7TA 1QAHA 2HS3A 1U43A 3S02A 1FNJA 4X20B 3WJPA 3J7AR 3HKDA 2UYKA 3FBAA 5MN6A 1YHQF 3E20B 3HKDB 3VOAA 2AMTA 4HNAA 5CA1A 3NVKE 1OAPA 3K2XA 2ZODA 2AIZP 1ONIA 3MQWA 2G9IA 5CA1B 3S06A 4C81A 3JASA 4BVTA 3CCUF 4ZI7B 3B6NA 3CPQA 2WALA 3CCQF 5FJ4C 3OBYA 5G4UC 3JALA 1TVKB 4F6RA 3CC4F 1W581 4TV8A 4BT7A 3JALB 4IIJA 4F6RB 1YIJF 1K9MH 3CXCF 3CPWF 4NWOB 4IIJB 3CCRF 2OTMA 4I4TA 3CD6F 2P6YA 1RLUA 5EO3A 3OBWA 4G4VA 3GTZA 3D00A 2RHJA 3CCMF 3CC2F 1KNKA 3RA6A 4G4WA 1IV4A 3HKEA 3LWVC 3CCSF 3S0HA 3VO8A 5HXUA 4BT5A 1U3PA 1PF5A 3CMAF 3LDTA 3JAKA 3UT5A 4BT4A 3WXMB 3IEWA 1K73H 2Q1YA 1JN1A 4YJ3A 4DRXB 1N8RH 5IYZA 1FSZA 3LFOA 1CK2A 4YJ3B 1ODEA 5IYZB 4EI7A 3N2GA 2FC3A 3NK7A 1SA0A 3ESJA 2AIFA 2GLZA 4XCQA 5JQGA 2B33A 3N2GB 4LCKA 5JQGB 4O2AA 1X7PA 2L26A 3LWOC 4EI8A 4O2BB 1X52A 4FFBB 3J80M 5LOVA 4LNUB 3HJWC 1KNJA 3M4SA 4O4JA 4U3JA 2NMUA 5LOVB 1KQSF 3HAXD 3RYFA 3SIUA 5B8FA 4G88A 3JAWB 2KTUA 2HS0A 4U3JB 2YXZA 4TV9B 1YJ9F 3RYFB 3WGLA 5KX5B 4IHJA 1XHOA 2LBXA 3FPIA 1VQOF 3RE3A 4EB6A 4BT6A 1JFFA 4ZHYB 1VHAA 2R6R1 2RHHA 3G6EF 1W5EA 4EB6B 3QHDA 1JFFB 3F0GA 3CCEF 1Z5VA 1RQ2A 3JVHA 3JATA 2HRUA 2RHOA 3WGJA 3ZOPA 5FLXM 3JATB 4KWEA 3G4SF 4O4LB 5HY4A 5HWEA 5GINC 3M1XA 5GAPK 1FNKA 4B5CA 1VQ9F 1W2BF 1IV2A 4G4XA 5EYPA 3MBMA 4X1KA 5JCOC 3S0YA 3S0WA 3KHNA 3ON1A 3RYCA 5LP6A 1GO1A 2VGMA 3C9RA 2KGWA 3VCZA 1NMUB 1FFXA 3QUWA 4HNAB 3DC2A 3RYCB 5LP6B 3V7EA 3RYIA 1VQ5F 1FFXB 2VGNA 3JASB 5G4VC 3I3FA 3U0OA 4BY9D 3CCLF 3VYSC 1S72F 3CYPB 5C8YA 1SDSA 1H48A 2ZVYA 3EORA 3RA5A 1VQPF 2OTJF 4TV8B 1QU9A 2CWJA 3VYTC 2VAMA 5C8YB 2F9ZC 3WJQA 3E1YA 3WJRA 2YYEA 2Q1XA 1H7MA 4I4TB 3VTIC 4I55A 2HQSC 3E22A 1W5FA 3T80A 3OONA 3I56F 4BT3A 4I55B 5EIBC 3E22B 1NQ3A 3VMFB 1VQNF 3FFMA 1Q82H 2H6LA 3P4EA 5JVDA 2H8CA 2Z1EA 1UFYA 4C8GA 3LYBA 4NQ3A 2CVLA 3VOBA 5LXTA 1KC8H 1W42A 3HKEB 3P0ZA 4ZHQA 1VQ8F 4C4WC 1W5AA 2OHWA 2ZOVA 3TD5A 2UZHA 2DT4A 1UI9A 5LXTB 4ZHQB 1T0AA 1YQNA 2ZAUA 3JAKB 3UT5B 2LBTA 5GIPC 2VAPA 3GHZA 2CZWA 5HY2A 1W40A 3C8LA 5CB4A 3LWPC 1ZWZA 2HVYD 1TUBA 5J2UA 5KMGA 3IMPA 1GO0A 1SA0B 1TUBB 3NK6A 1YJWF 3MCQA 3PAFA 1XBIA 1SZQA 5J2UB 3C9SA 5BMVA 5KMGB 5GIOC 4BVSA 1GZ0A 2CW4A 4O2AB 3CG6A 3LWRC 1YI2F 2HS4A 1NJIH 3SIVA 4TUYA 2IG8A 3BYQA 5HXZA 3IEQA 3R0PA 4O4JB 5EAZA 4G4ZA 3LMEA 4TUYB 5ITZA 5CA0A 2BTQB 2Z01A 4IHJB 5ITZB 1VK3A 1W55A 5IT9M 3N4YA 4C8EA 2Z1UA 3CC7F 4BT2A 3ERNA 3NMUC 1RLGA 2VAWA 5EZYA 2CHTA 1VQMF 5J2TA 2ZF8A 3MCAB 2OZBA 5FNVA 5IJ0A 3KJJA 3D01A 1W3EX 1VQ6F 2K1SA 5FNVB 5IJ0B 2Z1FA 5MN4A 2QTPA 1YITF 3C9UA 2BO1A 1CLIA 5EWRA 1U3LA 3LWQC 1QVFF 1J7HA 5EYPB 2KG4A 3D54A 3PLAC 2GVIA 4ERHA 2QI2A 1W59A 2R751 4X1KB 3O85A 1VQVA 2GZLA 1M90H 3VYUC 1COMA 2V9YA 3JAMM 4BVRA 4I50A 4C82A 3HTNA 3OW2F 2EWCA 5GONA 2ALEA 2KTVA 2I6DA 3RYIB 3F0DA 3MDOA 4I50B 1X7OA 5HP8A 4ZHWA 3ZP7A 1DBFA 1Q8RA 3WPXA 2PHNA 5GONB 3IKFA 1JJ2F 3JCMM 1QVGF 3HWUA 4ZI7A 3CMEF 1X25A 3K12A 4B62A 3IR9A 2HRYA 3JARA 2UYNA 1VQKF 1W5BA 3HKBA 4TZZA 1TVKA 2PMPA 1VQ7F 1Q86H 3JARB 2UYNB 1VQLF 2CSLA 3HKBB 3GYQA 1T0KB 4WBNA 3WGNA 1W57A 4B45A 2CHSA 4X1IA 3S03A 4M8IA 4G4YA 3V4DA 4WBNB 4NUTA 1DT9A 4X1IB 2JNBA 3F6MA 4O4IA 3TD4A 3CYQA 1H47A 2HX0A 3WGKA 5JVDB 3V3TA 4BVQA 1CN7A 2VXYA 4YJ2A 3NVIB 4O4IB 3VIUA 1E7KA 1IV3A 5LP6C 1RQ7A 2HP3A 4YJ2B 2HP0A 4X3MA 3WGMA 5HP7A 5MN5A 1U40A 3FD6A 3M84A 1Z5WA 2HP0B 1R1MA 5A2QM 3I55F 3C9TA 2N48A 4DRXA 5CB4B 5LYJA 3L7QA 3RYHA 5IJ9A 2RHLA 2DYYA 3N4ZA 1VH8A 4O4HA 3AGKA 1YGYA 1Q7YH
chains in the Genus database with same CATH topology
1GO1A 2VGMA 1RLGA 3NMUC 3CD6F 1NMUB 3J81M 1VQMF 3MCAB 2OZBA 5EO3A 3OBWA 3V7EA 4X3LA 3D00A 1VQ5F 1W3EX 1Q81H 2VGNA 1VQ6F 3CCMF 3CC2F 3RA6A 5G4VC 2FGYA 3LWVC 1YITF 3CCSF 3CCJF 4BY9D 5HXUA 3CCLF 2BO1A 1YJNF 1S72F 3CCVF 1SDSA 5EWRA 3CMAF 3RA5A 1VQPF 2OTJF 3LWQC 1QVFF 4EI9A 3WXMB 2OTLF 2LBWA 1W41A 2KG4A 1K73H 3PLAC 2QI2A 2F9ZC 1N8RH 1M1KH 3E1YA 3O85A 3LFOA 1CK2A 2QA4F 1M90H 1K8AH 1H7MA 5HY0A 3JAMM 4BVRA 4EI7A 4BW0B 2FC3A 3NK7A 3VI6A 3OW2F 3I56F 2AIFA 2GLZA 4XCQA 2ALEA 1JJ2F 2KTVA 2I6DA 1PXWA 1VQNF 3VMFB 1X7OA 3FFMA 1Q82H 4LCKA 1X7PA 4NQ3A 2QEXF 3JCMM 1QVGF 3LWOC 1W42A 4EI8A 1RA4A 1X52A 1KC8H 1KD1H 3J80M 1VQ4F 1VQ8F 4C4WC 2OHWA 5DCVA 3CMEF 3HJWC 3IR9A 1VQKF 3G71F 3SIUA 1KQSF 5GANK 3HAXD 4TZZA 5HY1A 5GIPC 1VQ7F 1IPAA 1Q86H 3V7QA 2KTUA 1VQLF 1YJ9F 2CZWA 3GYQA 2LBXA 5HY2A 1W40A 3LWPC 1VQOF 1T0KB 3J7AR 1ZWZA 2HVYD 3G6EF 1YHQF 3E20B 1GO0A 4NUTA 1DT9A 3NK6A 1YJWF 2JNBA 3PAFA 3NVKE 3CCEF 1XBIA 5GIOC 3V3TA 4BVQA 4BVSA 1GZ0A 1CN7A 3NVIB 3CG6A 3LWRC 1YI2F 1E7KA 1NJIH 3CCUF 4BVTA 5FLXM 3SIVA 5HXZA 3CPQA 2WALA 3CCQF 4X3MA 5FJ4C 3OBYA 3G4SF 5HY4A 5G4UC 5HWEA 5GINC 3CC4F 5GAPK 1VQ9F 1W2BF 5A2QM 3I55F 1YIJF 1K9MH 3CXCF 5IT9M 3N4YA 3N4ZA 3CPWF 3CC7F 3AGKA 3CCRF 3ON1A 1Q7YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVQ A;  5HY1 A;  4BVS A;  5HXZ A;  4NQ3 A;  5HY0 A;  4BVR A;  4BVT A;  5HY4 A;  5HY2 A;  5HWE A;  5HXU A; 
#chains in the Genus database with same CATH topology
 5IJ9 B;  3RYH B;  5LYJ B;  3FD5 A;  2W8B C;  5EB0 A;  3J81 M;  3Q8H A;  2ZVZ A;  4O4H B;  3P10 A;  5BMV B;  1XRG A;  3K14 A;  4PWT A;  4X3L A;  1Q81 H;  5LA6 A;  2H8E A;  1QD9 A;  3F0F A;  3IKE A;  4ZK7 A;  2FGY A;  4O2B A;  3KIZ A;  4FFB A;  5LA6 B;  3N2K A;  5JCO A;  3ZP4 A;  3CCJ F;  4LNU A;  4ZHV A;  4C8I A;  4RHA A;  1YJN F;  4RQO A;  3CCV F;  3N2K B;  2Z1T A;  3HKC A;  5CA0 B;  4EI9 A;  2LCA A;  2OTL F;  1W41 A;  2LBW A;  3JAW A;  3ZO8 A;  4U39 A;  2IQQ A;  2UYJ A;  4TV9 A;  4X1Y A;  3HKC B;  1JY8 A;  2RB9 A;  1M1K H;  5KX5 A;  4R40 B;  2QA4 F;  1K8A H;  2UYP A;  3CB2 A;  4X1Y B;  5HY0 A;  1GX1 A;  1XV2 A;  3K0T A;  5EZY B;  2MQE A;  5EB1 B;  1JD1 A;  3DDN A;  2BTO A;  2BTU A;  4BW0 B;  3VI6 A;  5J2T B;  1PXW A;  5AVM A;  1IV1 A;  3QTY A;  5JH7 A;  2QEX F;  1OFU A;  1RA4 A;  1KD1 H;  1VQ4 F;  5DCV A;  3WPW A;  4DXD A;  4ZOL A;  5JH7 B;  2IAF A;  3KJK A;  4E6E A;  3G71 F;  2I6R A;  4O4L A;  5GAN K;  3F0E A;  5HY1 A;  4B46 A;  3KE1 A;  4X20 A;  1IPA A;  4ZOL B;  5EIB D;  3TD3 A;  3V7Q A;  3ELC A;  3I7T A;  1QAH A;  2HS3 A;  1U43 A;  3S02 A;  1FNJ A;  4X20 B;  3WJP A;  3J7A R;  3HKD A;  2UYK A;  3FBA A;  5MN6 A;  1YHQ F;  3E20 B;  3HKD B;  3VOA A;  2AMT A;  4HNA A;  5CA1 A;  3NVK E;  1OAP A;  3K2X A;  2ZOD A;  2AIZ P;  1ONI A;  3MQW A;  2G9I A;  5CA1 B;  3S06 A;  4C81 A;  3JAS A;  4BVT A;  3CCU F;  4ZI7 B;  3B6N A;  3CPQ A;  2WAL A;  3CCQ F;  5FJ4 C;  3OBY A;  5G4U C;  3JAL A;  1TVK B;  4F6R A;  3CC4 F;  1W58 1;  4TV8 A;  4BT7 A;  3JAL B;  4IIJ A;  4F6R B;  1YIJ F;  1K9M H;  3CXC F;  3CPW F;  4NWO B;  4IIJ B;  3CCR F;  2OTM A;  4I4T A;  3CD6 F;  2P6Y A;  1RLU A;  5EO3 A;  3OBW A;  4G4V A;  3GTZ A;  3D00 A;  2RHJ A;  3CCM F;  3CC2 F;  1KNK A;  3RA6 A;  4G4W A;  1IV4 A;  3HKE A;  3LWV C;  3CCS F;  3S0H A;  3VO8 A;  5HXU A;  4BT5 A;  1U3P A;  1PF5 A;  3CMA F;  3LDT A;  3JAK A;  3UT5 A;  4BT4 A;  3WXM B;  3IEW A;  1K73 H;  2Q1Y A;  1JN1 A;  4YJ3 A;  4DRX B;  1N8R H;  5IYZ A;  1FSZ A;  3LFO A;  1CK2 A;  4YJ3 B;  1ODE A;  5IYZ B;  4EI7 A;  3N2G A;  2FC3 A;  3NK7 A;  1SA0 A;  3ESJ A;  2AIF A;  2GLZ A;  4XCQ A;  5JQG A;  2B33 A;  3N2G B;  4LCK A;  5JQG B;  4O2A A;  1X7P A;  2L26 A;  3LWO C;  4EI8 A;  4O2B B;  1X52 A;  4FFB B;  3J80 M;  5LOV A;  4LNU B;  3HJW C;  1KNJ A;  3M4S A;  4O4J A;  4U3J A;  2NMU A;  5LOV B;  1KQS F;  3HAX D;  3RYF A;  3SIU A;  5B8F A;  4G88 A;  3JAW B;  2KTU A;  2HS0 A;  4U3J B;  2YXZ A;  4TV9 B;  1YJ9 F;  3RYF B;  3WGL A;  5KX5 B;  4IHJ A;  1XHO A;  2LBX A;  3FPI A;  1VQO F;  3RE3 A;  4EB6 A;  4BT6 A;  1JFF A;  4ZHY B;  1VHA A;  2R6R 1;  2RHH A;  3G6E F;  1W5E A;  4EB6 B;  3QHD A;  1JFF B;  3F0G A;  3CCE F;  1Z5V A;  1RQ2 A;  3JVH A;  3JAT A;  2HRU A;  2RHO A;  3WGJ A;  3ZOP A;  5FLX M;  3JAT B;  4KWE A;  3G4S F;  4O4L B;  5HY4 A;  5HWE A;  5GIN C;  3M1X A;  5GAP K;  1FNK A;  4B5C A;  1VQ9 F;  1W2B F;  1IV2 A;  4G4X A;  5EYP A;  3MBM A;  4X1K A;  5JCO C;  3S0Y A;  3S0W A;  3KHN A;  3ON1 A;  3RYC A;  5LP6 A;  1GO1 A;  2VGM A;  3C9R A;  2KGW A;  3VCZ A;  1NMU B;  1FFX A;  3QUW A;  4HNA B;  3DC2 A;  3RYC B;  5LP6 B;  3V7E A;  3RYI A;  1VQ5 F;  1FFX B;  2VGN A;  3JAS B;  5G4V C;  3I3F A;  3U0O A;  4BY9 D;  3CCL F;  3VYS C;  1S72 F;  3CYP B;  5C8Y A;  1SDS A;  1H48 A;  2ZVY A;  3EOR A;  3RA5 A;  1VQP F;  2OTJ F;  4TV8 B;  1QU9 A;  2CWJ A;  3VYT C;  2VAM A;  5C8Y B;  2F9Z C;  3WJQ A;  3E1Y A;  3WJR A;  2YYE A;  2Q1X A;  1H7M A;  4I4T B;  3VTI C;  4I55 A;  2HQS C;  3E22 A;  1W5F A;  3T80 A;  3OON A;  3I56 F;  4BT3 A;  4I55 B;  5EIB C;  3E22 B;  1NQ3 A;  3VMF B;  1VQN F;  3FFM A;  1Q82 H;  2H6L A;  3P4E A;  5JVD A;  2H8C A;  2Z1E A;  1UFY A;  4C8G A;  3LYB A;  4NQ3 A;  2CVL A;  3VOB A;  5LXT A;  1KC8 H;  1W42 A;  3HKE B;  3P0Z A;  4ZHQ A;  1VQ8 F;  4C4W C;  1W5A A;  2OHW A;  2ZOV A;  3TD5 A;  2UZH A;  2DT4 A;  1UI9 A;  5LXT B;  4ZHQ B;  1T0A A;  1YQN A;  2ZAU A;  3JAK B;  3UT5 B;  2LBT A;  5GIP C;  2VAP A;  3GHZ A;  2CZW A;  5HY2 A;  1W40 A;  3C8L A;  5CB4 A;  3LWP C;  1ZWZ A;  2HVY D;  1TUB A;  5J2U A;  5KMG A;  3IMP A;  1GO0 A;  1SA0 B;  1TUB B;  3NK6 A;  1YJW F;  3MCQ A;  3PAF A;  1XBI A;  1SZQ A;  5J2U B;  3C9S A;  5BMV A;  5KMG B;  5GIO C;  4BVS A;  1GZ0 A;  2CW4 A;  4O2A B;  3CG6 A;  3LWR C;  1YI2 F;  2HS4 A;  1NJI H;  3SIV A;  4TUY A;  2IG8 A;  3BYQ A;  5HXZ A;  3IEQ A;  3R0P A;  4O4J B;  5EAZ A;  4G4Z A;  3LME A;  4TUY B;  5ITZ A;  5CA0 A;  2BTQ B;  2Z01 A;  4IHJ B;  5ITZ B;  1VK3 A;  1W55 A;  5IT9 M;  3N4Y A;  4C8E A;  2Z1U A;  3CC7 F;  4BT2 A;  3ERN A;  3NMU C;  1RLG A;  2VAW A;  5EZY A;  2CHT A;  1VQM F;  5J2T A;  2ZF8 A;  3MCA B;  2OZB A;  5FNV A;  5IJ0 A;  3KJJ A;  3D01 A;  1W3E X;  1VQ6 F;  2K1S A;  5FNV B;  5IJ0 B;  2Z1F A;  5MN4 A;  2QTP A;  1YIT F;  3C9U A;  2BO1 A;  1CLI A;  5EWR A;  1U3L A;  3LWQ C;  1QVF F;  1J7H A;  5EYP B;  2KG4 A;  3D54 A;  3PLA C;  2GVI A;  4ERH A;  2QI2 A;  1W59 A;  2R75 1;  4X1K B;  3O85 A;  1VQV A;  2GZL A;  1M90 H;  3VYU C;  1COM A;  2V9Y A;  3JAM M;  4BVR A;  4I50 A;  4C82 A;  3HTN A;  3OW2 F;  2EWC A;  5GON A;  2ALE A;  2KTV A;  2I6D A;  3RYI B;  3F0D A;  3MDO A;  4I50 B;  1X7O A;  5HP8 A;  4ZHW A;  3ZP7 A;  1DBF A;  1Q8R A;  3WPX A;  2PHN A;  5GON B;  3IKF A;  1JJ2 F;  3JCM M;  1QVG F;  3HWU A;  4ZI7 A;  3CME F;  1X25 A;  3K12 A;  4B62 A;  3IR9 A;  2HRY A;  3JAR A;  2UYN A;  1VQK F;  1W5B A;  3HKB A;  4TZZ A;  1TVK A;  2PMP A;  1VQ7 F;  1Q86 H;  3JAR B;  2UYN B;  1VQL F;  2CSL A;  3HKB B;  3GYQ A;  1T0K B;  4WBN A;  3WGN A;  1W57 A;  4B45 A;  2CHS A;  4X1I A;  3S03 A;  4M8I A;  4G4Y A;  3V4D A;  4WBN B;  4NUT A;  1DT9 A;  4X1I B;  2JNB A;  3F6M A;  4O4I A;  3TD4 A;  3CYQ A;  1H47 A;  2HX0 A;  3WGK A;  5JVD B;  3V3T A;  4BVQ A;  1CN7 A;  2VXY A;  4YJ2 A;  3NVI B;  4O4I B;  3VIU A;  1E7K A;  1IV3 A;  5LP6 C;  1RQ7 A;  2HP3 A;  4YJ2 B;  2HP0 A;  4X3M A;  3WGM A;  5HP7 A;  5MN5 A;  1U40 A;  3FD6 A;  3M84 A;  1Z5W A;  2HP0 B;  1R1M A;  5A2Q M;  3I55 F;  3C9T A;  2N48 A;  4DRX A;  5CB4 B;  5LYJ A;  3L7Q A;  3RYH A;  5IJ9 A;  2RHL A;  2DYY A;  3N4Z A;  1VH8 A;  4O4H A;  3AGK A;  1YGY A;  1Q7Y H; 
#chains in the Genus database with same CATH homology
 1GO1 A;  2VGM A;  1RLG A;  3NMU C;  3CD6 F;  1NMU B;  3J81 M;  1VQM F;  3MCA B;  2OZB A;  5EO3 A;  3OBW A;  3V7E A;  4X3L A;  3D00 A;  1VQ5 F;  1W3E X;  1Q81 H;  2VGN A;  1VQ6 F;  3CCM F;  3CC2 F;  3RA6 A;  5G4V C;  2FGY A;  3LWV C;  1YIT F;  3CCS F;  3CCJ F;  4BY9 D;  5HXU A;  3CCL F;  2BO1 A;  1YJN F;  1S72 F;  3CCV F;  1SDS A;  5EWR A;  3CMA F;  3RA5 A;  1VQP F;  2OTJ F;  3LWQ C;  1QVF F;  4EI9 A;  3WXM B;  2OTL F;  2LBW A;  1W41 A;  2KG4 A;  1K73 H;  3PLA C;  2QI2 A;  2F9Z C;  1N8R H;  1M1K H;  3E1Y A;  3O85 A;  3LFO A;  1CK2 A;  2QA4 F;  1M90 H;  1K8A H;  1H7M A;  5HY0 A;  3JAM M;  4BVR A;  4EI7 A;  4BW0 B;  2FC3 A;  3NK7 A;  3VI6 A;  3OW2 F;  3I56 F;  2AIF A;  2GLZ A;  4XCQ A;  2ALE A;  1JJ2 F;  2KTV A;  2I6D A;  1PXW A;  1VQN F;  3VMF B;  1X7O A;  3FFM A;  1Q82 H;  4LCK A;  1X7P A;  4NQ3 A;  2QEX F;  3JCM M;  1QVG F;  3LWO C;  1W42 A;  4EI8 A;  1RA4 A;  1X52 A;  1KC8 H;  1KD1 H;  3J80 M;  1VQ4 F;  1VQ8 F;  4C4W C;  2OHW A;  5DCV A;  3CME F;  3HJW C;  3IR9 A;  1VQK F;  3G71 F;  3SIU A;  1KQS F;  5GAN K;  3HAX D;  4TZZ A;  5HY1 A;  5GIP C;  1VQ7 F;  1IPA A;  1Q86 H;  3V7Q A;  2KTU A;  1VQL F;  1YJ9 F;  2CZW A;  3GYQ A;  2LBX A;  5HY2 A;  1W40 A;  3LWP C;  1VQO F;  1T0K B;  3J7A R;  1ZWZ A;  2HVY D;  3G6E F;  1YHQ F;  3E20 B;  1GO0 A;  4NUT A;  1DT9 A;  3NK6 A;  1YJW F;  2JNB A;  3PAF A;  3NVK E;  3CCE F;  1XBI A;  5GIO C;  3V3T A;  4BVQ A;  4BVS A;  1GZ0 A;  1CN7 A;  3NVI B;  3CG6 A;  3LWR C;  1YI2 F;  1E7K A;  1NJI H;  3CCU F;  4BVT A;  5FLX M;  3SIV A;  5HXZ A;  3CPQ A;  2WAL A;  3CCQ F;  4X3M A;  5FJ4 C;  3OBY A;  3G4S F;  5HY4 A;  5G4U C;  5HWE A;  5GIN C;  3CC4 F;  5GAP K;  1VQ9 F;  1W2B F;  5A2Q M;  3I55 F;  1YIJ F;  1K9M H;  3CXC F;  5IT9 M;  3N4Y A;  3N4Z A;  3CPW F;  3CC7 F;  3AGK A;  3CCR F;  3ON1 A;  1Q7Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...