5HY4A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
377
structure length
361
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVSMCWSNDASALGVAVALGEVKRDLVADDRIRSDWDLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
total genus 112
structure length 361
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A01
5HXZA 5HY1A 4BVTA 5HWEA 4BVQA 5HY2A 4BVRA 5HY0A 4NQ3A 5HY4A 5HXUA 4BVSA
chains in the Genus database with same CATH superfamily
2Q1YA 2HQSC 3M1XA 4BT7A 3RA5A 5G4UC 4HNAA 3OW2F 3FBAA 5JQGA 3UT5A 3CC4F 2Z1UA 4C81A 2CHTA 3IEWA 5LP6C 2B33A 3TD5A 5FNVB 5MN6A 1QVFF 5HP7A 2PHNA 1U3PA 5FJ4C 3T80A 4X3MA 1CLIA 4C82A 1H47A 4LNUB 1M90H 1PF5A 1NQ3A 3CMAF 4EB6B 3PLAC 2N48A 3RE3A 2KTUA 4EB6A 1YJNF 1FNJA 1OFUA 1VQNF 2HS4A 2JNBA 4TV9B 3JATA 5HY2A 3HKDB 3IKFA 1VK3A 3J80M 3MBMA 1RLGA 3CCRF 2YYEA 4G4VA 4F6RA 2HP0A 3HKDA 5MN5A 1VQOF 1KC8H 1VHAA 2BTOA 3WJPA 1Q82H 4O2BA 2OHWA 4O4LB 3S0WA 5EIBC 1CN7A 3RYFB 3RYIB 3I55F 4X1IB 5EYPB 5LA6B 5C8YB 1CK2A 3JAKB 3RYIA 1TUBB 4X1IA 5EYPA 5C8YA 5J2UA 4RQOA 1VQ8F 4O2AB 3IR9A 1W42A 2Z01A 2HRYA 3C9UA 1COMA 1YJ9F 3JASB 1K73H 2UYJA 3F6MA 4IIJB 5GANK 3JASA 1W5EA 2OTJF 3HTNA 1FFXB 4ERHA 4IIJA 1E7KA 3VMFB 1J7HA 1UI9A 3CCMF 1FFXA 3S0YA 3MDOA 4ZHVA 3PAFA 3VOBA 1YIJF 3LWPC 2RHOA 5MN4A 2UZHA 5CA0B 4YJ2B 2VGNA 3D54A 4O4JB 3LFOA 4G88A 5CA0A 4YJ2A 2GZLA 1NMUB 3G4SF 3JALB 4O4JA 3NK7A 2Q1XA 3HKBA 5EB1B 1IV2A 1T0AA 5G4VC 3VYUC 3O85A 4BVRA 5ITZB 2QA4F 3E20B 4C8GA 2VAMA 1YI2F 3G6EF 1XBIA 5ITZA 4TZZA 3I56F 2QEXF 2CWJA 2FC3A 3P4EA 4G4ZA 2CZWA 3V4DA 4TUYB 4DRXB 5EWRA 4X20B 1TVKA 4TUYA 3JAWB 3NVIB 2EWCA 4DRXA 4RHAA 2ALEA 3L7QA 5J2TA 4ZI7B 2R6R1 3HWUA 5JCOA 4E6EA 2Z1EA 3ESJA 4BT6A 2FGYA 5IJ9B 4PWTA 3FD6A 4C8IA 3HKEB 3U0OA 3ZP7A 4NUTA 3S02A 2HP3A 1H48A 3J7AR 1SZQA 5EB0A 1GO0A 1JFFB 1RA4A 4BW0B 3C9SA 1M1KH 4YJ3B 1JFFA 5KX5B 3KE1A 2YXZA 5BMVB 3OBWA 3FFMA 3RYHB 2Z1TA 4YJ3A 5KX5A 3JARB 4U3JB 3D01A 1X7PA 3G71F 3RYHA 3DDNA 3I3FA 4I4TB 3CCLF 5FNVA 1U40A 3C9RA 3J81M 5EO3A 1T0KB 1JJ2F 5HY4A 4B46A 4I4TA 2IAFA 5LYJB 3CXCF 4LCKA 4LNUA 1K8AH 5GIOC 4BT3A 2OTLF 1JD1A 4FFBB 1U43A 5LOVB 5GINC 1N8RH 3N4YA 2F9ZC 2KTVA 4FFBA 5LOVA 3CCJF 4NQ3A 2BO1A 3DC2A 4TV9A 2L26A 3VIUA 2UYNB 1X25A 2P6YA 1UFYA 1IV1A 4BT2A 2UYPA 4O4LA 5JH7B 5AVMA 2WALA 4C8EA 3RYFA 3VO8A 3CCSF 3CCEF 2CHSA 5LA6A 3VYSC 5EAZA 5JH7A 1W57A 3VI6A 3GYQA 4BT4A 4X1KB 3JAKA 5GIPC 1TUBA 2LCAA 3BYQA 4BVQA 1FNKA 5JCOC 2IQQA 3K12A 3JAMM 4O2AA 1VQVA 5FLXM 3M84A 4I50B 4BVSA 2ZVZA 2OTMA 2DYYA 2VGMA 3LWQC 1SDSA 4B45A 3N2GB 5CB4B 3V3TA 1RLUA 3Q8HA 3R0PA 5A2QM 1IV4A 3N2GA 1VQ9F 4WBNB 5CB4A 3WGMA 1DT9A 4WBNA 2PMPA 1X7OA 4BT5A 2H8CA 1SA0B 3VYTC 5B8FA 3LWOC 3NVKE 3CG6A 3WPXA 1W40A 4XCQA 4B5CA 2HS3A 4I55B 2ZOVA 2ZF8A 3GTZA 1IV3A 3CCQF 3N2KB 3E1YA 2V9YA 1ONIA 1JN1A 4M8IA 1VQLF 2GLZA 3F0FA 1U3LA 2HRUA 3JALA 3CD6F 3F0DA 1VH8A 3CYPB 3MQWA 2DT4A 3CB2A 1W5AA 5HWEA 3P0ZA 2BTQB 3LWRC 3C8LA 3LMEA 3FPIA 2CW4A 1NJIH 1VQ6F 2NMUA 3ERNA 4G4YA 3S06A 3SIUA 4X20A 4ZHWA 3JAWA 3WGKA 1W5BA 4NWOB 5DCVA 3F0GA 1GZ0A 4ZOLB 2ZVYA 3HJWC 4ZI7A 3CMEF 1YITF 4ZK7A 1Z5WA 5IJ9A 1W55A 3HKEA 3HKCB 1VQPF 1JY8A 4X3LA 4BVTA 3IKEA 3TD3A 1YJWF 3OONA 5BMVA 3CPQA 3ON1A 5JVDB 3JARA 5GAPK 4U3JA 3JVHA 2OZBA 1YGYA 2K1SA 3CC2F 5JVDA 3SIVA 1XV2A 4HNAB 2I6DA 4G4WA 4X1YB 1H7MA 3C9TA 5JQGB 1Q7YH 3IEQA 5EIBD 3UT5B 4X1YA 5LYJA 4EI7A 3MCQA 3WJQA 1RQ7A 2W8BC 2QI2A 2R751 2RHLA 3CCVF 2LBWA 3WGJA 1GO1A 5HY0A 3WPWA 2AIZP 3ZO8A 3NK6A 1PXWA 2LBTA 5IJ0B 1W2BF 1W3EX 5IYZB 1ZWZA 2UYNA 2VAPA 3RYCB 5EZYB 5IJ0A 5HXUA 3B6NA 5IYZA 4ZHYB 3WJRA 2BTUA 2HVYD 4KWEA 1Q86H 3CC7F 3RYCA 3JATB 5EZYA 3QUWA 4F6RB 5HY1A 2HP0B 3K0TA 1OAPA 1Z5VA 3EORA 4DXDA 5IT9M 2KG4A 2G9IA 1FSZA 4X1KA 3VCZA 2AIFA 4O2BB 2RHJA 2ZAUA 2LBXA 2RHHA 1QU9A 4I50A 2Z1FA 2MQEA 3D00A 3M4SA 5J2UB 1W5FA 1W581 1DBFA 5KMGB 2HX0A 3ZP4A 5HXZA 3TD4A 3K2XA 1Q8RA 5KMGA 3NMUC 4O4HB 5GONB 3HAXD 4B62A 1VQ7F 1ODEA 1SA0A 1VQ5F 2CVLA 1W41A 2VAWA 4O4HA 5GONA 1QD9A 2UYKA 1XHOA 3QTYA 3MCAB 3N4ZA 4BY9D 3AGKA 3K14A 3LDTA 4I55A 1K9MH 3GHZA 3QHDA 3F0EA 1S72F 1GX1A 4ZHQB 1QAHA 3WXMB 3N2KA 4O4IB 1YQNA 3JCMM 5LP6B 3CYQA 4ZHQA 3P10A 1W59A 4O4IA 3V7QA 5LP6A 3FD5A 1KD1H 3S0HA 1VQMF 3ZOPA 1X52A 1KQSF 4EI9A 4C4WC 3KHNA 3WGLA 1YHQF 3HKBB 1KNKA 2GVIA 5CA1B 2RB9A 3CCUF 3E22B 1RQ2A 2ZODA 1IPAA 2AMTA 2VXYA 3I7TA 1Q81H 3KJJA 5CA1A 3E22A 5LXTB 2KGWA 3LYBA 2CSLA 1QVGF 3S03A 4TV8B 5LXTA 4ZOLA 2I6RA 1R1MA 4TV8A 4R40B 3WGNA 1VQKF 1XRGA 1TVKB 2HS0A 3KJKA 2H6LA 3VTIC 4EI8A 2H8EA 3OBYA 5J2TB 3V7EA 3IMPA 3HKCA 1VQ4F 1KNJA 5HP8A 2QTPA 4G4XA 2IG8A 4U39A 3RA6A 3CPWF 3LWVC 3ELCA 4IHJB 3VOAA 4IHJA 3KIZA
chains in the Genus database with same CATH topology
3G6EF 1XBIA 2HVYD 4TZZA 1Q86H 3CC7F 3LWOC 3I56F 2QEXF 3NVKE 3CG6A 2FC3A 3RA5A 1W40A 4XCQA 5G4UC 2CZWA 5HY1A 3OW2F 5EWRA 5IT9M 2KG4A 2AIFA 3CC4F 3NVIB 3CCQF 3E1YA 2ALEA 2LBXA 1QVFF 1VQLF 2GLZA 3CD6F 5FJ4C 4X3MA 3D00A 2FGYA 1M90H 5HXZA 4NUTA 5HWEA 3CMAF 3PLAC 3NMUC 3J7AR 3HAXD 3LWRC 2KTUA 1YJNF 1VQ7F 1VQNF 1GO0A 2JNBA 1RA4A 1VQ5F 1W41A 4BW0B 5HY2A 1NJIH 1VQ6F 3J80M 1M1KH 1RLGA 3CCRF 3MCAB 3N4ZA 1VQOF 4BY9D 3AGKA 1KC8H 3OBWA 3FFMA 3SIUA 1K9MH 1S72F 1Q82H 1X7PA 2OHWA 3WXMB 3G71F 5DCVA 3JCMM 1GZ0A 3CCLF 1CN7A 3I55F 3HJWC 3J81M 3CMEF 5EO3A 1T0KB 1JJ2F 5HY4A 1CK2A 3V7QA 1YITF 3CXCF 1KD1H 4LCKA 1VQMF 1K8AH 1X52A 1VQ8F 5GIOC 2OTLF 1KQSF 3IR9A 4EI9A 1W42A 5GINC 1N8RH 3N4YA 4C4WC 1VQPF 2F9ZC 2KTVA 1YHQF 3CCJF 1YJ9F 4NQ3A 2BO1A 4X3LA 4BVTA 1K73H 5GANK 3CCUF 1IPAA 1Q81H 2OTJF 1YJWF 1E7KA 3VMFB 3CPQA 3ON1A 5GAPK 3CCMF 1QVGF 2OZBA 3CC2F 3PAFA 3SIVA 1YIJF 2WALA 3LWPC 3CCSF 2I6DA 3CCEF 1VQKF 3VI6A 1H7MA 1Q7YH 3GYQA 5GIPC 4BVQA 2VGNA 4EI7A 4EI8A 3JAMM 3LFOA 3OBYA 5FLXM 3V7EA 2QI2A 1NMUB 4BVSA 2VGMA 3G4SF 2LBWA 3CCVF 1VQ4F 3LWQC 3NK7A 1SDSA 1GO1A 5HY0A 3RA6A 3CPWF 3V3TA 3LWVC 3NK6A 5A2QM 5G4VC 1PXWA 1VQ9F 3O85A 1W2BF 1W3EX 4BVRA 2QA4F 1ZWZA 3E20B 1DT9A 1YI2F 5HXUA 1X7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXZ A;  5HY1 A;  4BVT A;  5HWE A;  4BVQ A;  5HY2 A;  4BVR A;  5HY0 A;  4NQ3 A;  5HY4 A;  5HXU A;  4BVS A; 
#chains in the Genus database with same CATH topology
 2Q1Y A;  2HQS C;  3M1X A;  4BT7 A;  3RA5 A;  5G4U C;  4HNA A;  3OW2 F;  3FBA A;  5JQG A;  3UT5 A;  3CC4 F;  2Z1U A;  4C81 A;  2CHT A;  3IEW A;  5LP6 C;  2B33 A;  3TD5 A;  5FNV B;  5MN6 A;  1QVF F;  5HP7 A;  2PHN A;  1U3P A;  5FJ4 C;  3T80 A;  4X3M A;  1CLI A;  4C82 A;  1H47 A;  4LNU B;  1M90 H;  1PF5 A;  1NQ3 A;  3CMA F;  4EB6 B;  3PLA C;  2N48 A;  3RE3 A;  2KTU A;  4EB6 A;  1YJN F;  1FNJ A;  1OFU A;  1VQN F;  2HS4 A;  2JNB A;  4TV9 B;  3JAT A;  5HY2 A;  3HKD B;  3IKF A;  1VK3 A;  3J80 M;  3MBM A;  1RLG A;  3CCR F;  2YYE A;  4G4V A;  4F6R A;  2HP0 A;  3HKD A;  5MN5 A;  1VQO F;  1KC8 H;  1VHA A;  2BTO A;  3WJP A;  1Q82 H;  4O2B A;  2OHW A;  4O4L B;  3S0W A;  5EIB C;  1CN7 A;  3RYF B;  3RYI B;  3I55 F;  4X1I B;  5EYP B;  5LA6 B;  5C8Y B;  1CK2 A;  3JAK B;  3RYI A;  1TUB B;  4X1I A;  5EYP A;  5C8Y A;  5J2U A;  4RQO A;  1VQ8 F;  4O2A B;  3IR9 A;  1W42 A;  2Z01 A;  2HRY A;  3C9U A;  1COM A;  1YJ9 F;  3JAS B;  1K73 H;  2UYJ A;  3F6M A;  4IIJ B;  5GAN K;  3JAS A;  1W5E A;  2OTJ F;  3HTN A;  1FFX B;  4ERH A;  4IIJ A;  1E7K A;  3VMF B;  1J7H A;  1UI9 A;  3CCM F;  1FFX A;  3S0Y A;  3MDO A;  4ZHV A;  3PAF A;  3VOB A;  1YIJ F;  3LWP C;  2RHO A;  5MN4 A;  2UZH A;  5CA0 B;  4YJ2 B;  2VGN A;  3D54 A;  4O4J B;  3LFO A;  4G88 A;  5CA0 A;  4YJ2 A;  2GZL A;  1NMU B;  3G4S F;  3JAL B;  4O4J A;  3NK7 A;  2Q1X A;  3HKB A;  5EB1 B;  1IV2 A;  1T0A A;  5G4V C;  3VYU C;  3O85 A;  4BVR A;  5ITZ B;  2QA4 F;  3E20 B;  4C8G A;  2VAM A;  1YI2 F;  3G6E F;  1XBI A;  5ITZ A;  4TZZ A;  3I56 F;  2QEX F;  2CWJ A;  2FC3 A;  3P4E A;  4G4Z A;  2CZW A;  3V4D A;  4TUY B;  4DRX B;  5EWR A;  4X20 B;  1TVK A;  4TUY A;  3JAW B;  3NVI B;  2EWC A;  4DRX A;  4RHA A;  2ALE A;  3L7Q A;  5J2T A;  4ZI7 B;  2R6R 1;  3HWU A;  5JCO A;  4E6E A;  2Z1E A;  3ESJ A;  4BT6 A;  2FGY A;  5IJ9 B;  4PWT A;  3FD6 A;  4C8I A;  3HKE B;  3U0O A;  3ZP7 A;  4NUT A;  3S02 A;  2HP3 A;  1H48 A;  3J7A R;  1SZQ A;  5EB0 A;  1GO0 A;  1JFF B;  1RA4 A;  4BW0 B;  3C9S A;  1M1K H;  4YJ3 B;  1JFF A;  5KX5 B;  3KE1 A;  2YXZ A;  5BMV B;  3OBW A;  3FFM A;  3RYH B;  2Z1T A;  4YJ3 A;  5KX5 A;  3JAR B;  4U3J B;  3D01 A;  1X7P A;  3G71 F;  3RYH A;  3DDN A;  3I3F A;  4I4T B;  3CCL F;  5FNV A;  1U40 A;  3C9R A;  3J81 M;  5EO3 A;  1T0K B;  1JJ2 F;  5HY4 A;  4B46 A;  4I4T A;  2IAF A;  5LYJ B;  3CXC F;  4LCK A;  4LNU A;  1K8A H;  5GIO C;  4BT3 A;  2OTL F;  1JD1 A;  4FFB B;  1U43 A;  5LOV B;  5GIN C;  1N8R H;  3N4Y A;  2F9Z C;  2KTV A;  4FFB A;  5LOV A;  3CCJ F;  4NQ3 A;  2BO1 A;  3DC2 A;  4TV9 A;  2L26 A;  3VIU A;  2UYN B;  1X25 A;  2P6Y A;  1UFY A;  1IV1 A;  4BT2 A;  2UYP A;  4O4L A;  5JH7 B;  5AVM A;  2WAL A;  4C8E A;  3RYF A;  3VO8 A;  3CCS F;  3CCE F;  2CHS A;  5LA6 A;  3VYS C;  5EAZ A;  5JH7 A;  1W57 A;  3VI6 A;  3GYQ A;  4BT4 A;  4X1K B;  3JAK A;  5GIP C;  1TUB A;  2LCA A;  3BYQ A;  4BVQ A;  1FNK A;  5JCO C;  2IQQ A;  3K12 A;  3JAM M;  4O2A A;  1VQV A;  5FLX M;  3M84 A;  4I50 B;  4BVS A;  2ZVZ A;  2OTM A;  2DYY A;  2VGM A;  3LWQ C;  1SDS A;  4B45 A;  3N2G B;  5CB4 B;  3V3T A;  1RLU A;  3Q8H A;  3R0P A;  5A2Q M;  1IV4 A;  3N2G A;  1VQ9 F;  4WBN B;  5CB4 A;  3WGM A;  1DT9 A;  4WBN A;  2PMP A;  1X7O A;  4BT5 A;  2H8C A;  1SA0 B;  3VYT C;  5B8F A;  3LWO C;  3NVK E;  3CG6 A;  3WPX A;  1W40 A;  4XCQ A;  4B5C A;  2HS3 A;  4I55 B;  2ZOV A;  2ZF8 A;  3GTZ A;  1IV3 A;  3CCQ F;  3N2K B;  3E1Y A;  2V9Y A;  1ONI A;  1JN1 A;  4M8I A;  1VQL F;  2GLZ A;  3F0F A;  1U3L A;  2HRU A;  3JAL A;  3CD6 F;  3F0D A;  1VH8 A;  3CYP B;  3MQW A;  2DT4 A;  3CB2 A;  1W5A A;  5HWE A;  3P0Z A;  2BTQ B;  3LWR C;  3C8L A;  3LME A;  3FPI A;  2CW4 A;  1NJI H;  1VQ6 F;  2NMU A;  3ERN A;  4G4Y A;  3S06 A;  3SIU A;  4X20 A;  4ZHW A;  3JAW A;  3WGK A;  1W5B A;  4NWO B;  5DCV A;  3F0G A;  1GZ0 A;  4ZOL B;  2ZVY A;  3HJW C;  4ZI7 A;  3CME F;  1YIT F;  4ZK7 A;  1Z5W A;  5IJ9 A;  1W55 A;  3HKE A;  3HKC B;  1VQP F;  1JY8 A;  4X3L A;  4BVT A;  3IKE A;  3TD3 A;  1YJW F;  3OON A;  5BMV A;  3CPQ A;  3ON1 A;  5JVD B;  3JAR A;  5GAP K;  4U3J A;  3JVH A;  2OZB A;  1YGY A;  2K1S A;  3CC2 F;  5JVD A;  3SIV A;  1XV2 A;  4HNA B;  2I6D A;  4G4W A;  4X1Y B;  1H7M A;  3C9T A;  5JQG B;  1Q7Y H;  3IEQ A;  5EIB D;  3UT5 B;  4X1Y A;  5LYJ A;  4EI7 A;  3MCQ A;  3WJQ A;  1RQ7 A;  2W8B C;  2QI2 A;  2R75 1;  2RHL A;  3CCV F;  2LBW A;  3WGJ A;  1GO1 A;  5HY0 A;  3WPW A;  2AIZ P;  3ZO8 A;  3NK6 A;  1PXW A;  2LBT A;  5IJ0 B;  1W2B F;  1W3E X;  5IYZ B;  1ZWZ A;  2UYN A;  2VAP A;  3RYC B;  5EZY B;  5IJ0 A;  5HXU A;  3B6N A;  5IYZ A;  4ZHY B;  3WJR A;  2BTU A;  2HVY D;  4KWE A;  1Q86 H;  3CC7 F;  3RYC A;  3JAT B;  5EZY A;  3QUW A;  4F6R B;  5HY1 A;  2HP0 B;  3K0T A;  1OAP A;  1Z5V A;  3EOR A;  4DXD A;  5IT9 M;  2KG4 A;  2G9I A;  1FSZ A;  4X1K A;  3VCZ A;  2AIF A;  4O2B B;  2RHJ A;  2ZAU A;  2LBX A;  2RHH A;  1QU9 A;  4I50 A;  2Z1F A;  2MQE A;  3D00 A;  3M4S A;  5J2U B;  1W5F A;  1W58 1;  1DBF A;  5KMG B;  2HX0 A;  3ZP4 A;  5HXZ A;  3TD4 A;  3K2X A;  1Q8R A;  5KMG A;  3NMU C;  4O4H B;  5GON B;  3HAX D;  4B62 A;  1VQ7 F;  1ODE A;  1SA0 A;  1VQ5 F;  2CVL A;  1W41 A;  2VAW A;  4O4H A;  5GON A;  1QD9 A;  2UYK A;  1XHO A;  3QTY A;  3MCA B;  3N4Z A;  4BY9 D;  3AGK A;  3K14 A;  3LDT A;  4I55 A;  1K9M H;  3GHZ A;  3QHD A;  3F0E A;  1S72 F;  1GX1 A;  4ZHQ B;  1QAH A;  3WXM B;  3N2K A;  4O4I B;  1YQN A;  3JCM M;  5LP6 B;  3CYQ A;  4ZHQ A;  3P10 A;  1W59 A;  4O4I A;  3V7Q A;  5LP6 A;  3FD5 A;  1KD1 H;  3S0H A;  1VQM F;  3ZOP A;  1X52 A;  1KQS F;  4EI9 A;  4C4W C;  3KHN A;  3WGL A;  1YHQ F;  3HKB B;  1KNK A;  2GVI A;  5CA1 B;  2RB9 A;  3CCU F;  3E22 B;  1RQ2 A;  2ZOD A;  1IPA A;  2AMT A;  2VXY A;  3I7T A;  1Q81 H;  3KJJ A;  5CA1 A;  3E22 A;  5LXT B;  2KGW A;  3LYB A;  2CSL A;  1QVG F;  3S03 A;  4TV8 B;  5LXT A;  4ZOL A;  2I6R A;  1R1M A;  4TV8 A;  4R40 B;  3WGN A;  1VQK F;  1XRG A;  1TVK B;  2HS0 A;  3KJK A;  2H6L A;  3VTI C;  4EI8 A;  2H8E A;  3OBY A;  5J2T B;  3V7E A;  3IMP A;  3HKC A;  1VQ4 F;  1KNJ A;  5HP8 A;  2QTP A;  4G4X A;  2IG8 A;  4U39 A;  3RA6 A;  3CPW F;  3LWV C;  3ELC A;  4IHJ B;  3VOA A;  4IHJ A;  3KIZ A; 
#chains in the Genus database with same CATH homology
 3G6E F;  1XBI A;  2HVY D;  4TZZ A;  1Q86 H;  3CC7 F;  3LWO C;  3I56 F;  2QEX F;  3NVK E;  3CG6 A;  2FC3 A;  3RA5 A;  1W40 A;  4XCQ A;  5G4U C;  2CZW A;  5HY1 A;  3OW2 F;  5EWR A;  5IT9 M;  2KG4 A;  2AIF A;  3CC4 F;  3NVI B;  3CCQ F;  3E1Y A;  2ALE A;  2LBX A;  1QVF F;  1VQL F;  2GLZ A;  3CD6 F;  5FJ4 C;  4X3M A;  3D00 A;  2FGY A;  1M90 H;  5HXZ A;  4NUT A;  5HWE A;  3CMA F;  3PLA C;  3NMU C;  3J7A R;  3HAX D;  3LWR C;  2KTU A;  1YJN F;  1VQ7 F;  1VQN F;  1GO0 A;  2JNB A;  1RA4 A;  1VQ5 F;  1W41 A;  4BW0 B;  5HY2 A;  1NJI H;  1VQ6 F;  3J80 M;  1M1K H;  1RLG A;  3CCR F;  3MCA B;  3N4Z A;  1VQO F;  4BY9 D;  3AGK A;  1KC8 H;  3OBW A;  3FFM A;  3SIU A;  1K9M H;  1S72 F;  1Q82 H;  1X7P A;  2OHW A;  3WXM B;  3G71 F;  5DCV A;  3JCM M;  1GZ0 A;  3CCL F;  1CN7 A;  3I55 F;  3HJW C;  3J81 M;  3CME F;  5EO3 A;  1T0K B;  1JJ2 F;  5HY4 A;  1CK2 A;  3V7Q A;  1YIT F;  3CXC F;  1KD1 H;  4LCK A;  1VQM F;  1K8A H;  1X52 A;  1VQ8 F;  5GIO C;  2OTL F;  1KQS F;  3IR9 A;  4EI9 A;  1W42 A;  5GIN C;  1N8R H;  3N4Y A;  4C4W C;  1VQP F;  2F9Z C;  2KTV A;  1YHQ F;  3CCJ F;  1YJ9 F;  4NQ3 A;  2BO1 A;  4X3L A;  4BVT A;  1K73 H;  5GAN K;  3CCU F;  1IPA A;  1Q81 H;  2OTJ F;  1YJW F;  1E7K A;  3VMF B;  3CPQ A;  3ON1 A;  5GAP K;  3CCM F;  1QVG F;  2OZB A;  3CC2 F;  3PAF A;  3SIV A;  1YIJ F;  2WAL A;  3LWP C;  3CCS F;  2I6D A;  3CCE F;  1VQK F;  3VI6 A;  1H7M A;  1Q7Y H;  3GYQ A;  5GIP C;  4BVQ A;  2VGN A;  4EI7 A;  4EI8 A;  3JAM M;  3LFO A;  3OBY A;  5FLX M;  3V7E A;  2QI2 A;  1NMU B;  4BVS A;  2VGM A;  3G4S F;  2LBW A;  3CCV F;  1VQ4 F;  3LWQ C;  3NK7 A;  1SDS A;  1GO1 A;  5HY0 A;  3RA6 A;  3CPW F;  3V3T A;  3LWV C;  3NK6 A;  5A2Q M;  5G4V C;  1PXW A;  1VQ9 F;  3O85 A;  1W2B F;  1W3E X;  4BVR A;  2QA4 F;  1ZWZ A;  3E20 B;  1DT9 A;  1YI2 F;  5HXU A;  1X7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...