5HY4A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
377
structure length
361
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVSMCWSNDASALGVAVALGEVKRDLVADDRIRSDWDLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
molecule keywords Ring-opening amidohydrolase
total genus 112
structure length 361
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A01
4BVRA 4BVTA 4NQ3A 5HXUA 5HY1A 5HXZA 5HY4A 4BVSA 5HY0A 5HWEA 4BVQA 5HY2A
chains in the Genus database with same CATH superfamily
5MN4A 1QD9A 1ONIA 3CYQA 5LOVB 3M1XA 3N2GA 3CPWF 3OW2F 1E7KA 3WPXA 3I55F 2CHSA 2NMUA 2VAPA 3N4YA 3WXMB 2I6DA 1VQLF 3MCQA 1J7HA 3B6NA 3ZO8A 1CLIA 5EB0A 4WBNB 1JN1A 5LYJA 3CXCF 2Z1TA 1X7OA 1W581 3LWRC 3OBWA 4F6RB 3CCSF 4O4IB 1Q7YH 5HY4A 4I55B 3CCUF 4O2BA 5LA6A 4DRXA 3J7AR 2UYKA 4X1IB 3VOBA 2UYNB 1SA0B 4X3MA 1JFFB 3VYSC 3JALB 3JVHA 3NMUC 4ZI7A 1W5EA 1TUBB 2KGWA 2RHOA 3WGLA 5HY0A 1RQ7A 1X7PA 4O4JB 4TUYA 3WJPA 1IV4A 3CYPB 3KJKA 1YIJF 3CCEF 2HP0A 4G4VA 1XV2A 4C8EA 4ERHA 5GIOC 1TVKB 2ZVZA 2HQSC 5MN6A 5JQGB 5LP6C 4I4TA 3QTYA 5LP6B 3RYHA 4BVQA 5IJ9B 2W8BC 4C82A 5CB4A 3KHNA 1VK3A 5EYPB 5EAZA 4FFBA 2BTOA 2CW4A 3K0TA 2KG4A 3E22A 3F0EA 2FC3A 1PF5A 2OHWA 4TZZA 1TVKA 3UT5B 5CA1A 1M1KH 2ZOVA 4C81A 5FNVB 3CC7F 5IJ9A 3CPQA 3C9UA 4HNAB 1VQ9F 5JVDA 3JASA 1W2BF 1W40A 5CA0A 3HJWC 1JD1A 3KIZA 2YXZA 5BMVB 1VQ7F 2Q1YA 5J2TA 3U0OA 1R1MA 1W59A 1UI9A 2RHHA 4C8GA 3S03A 2H8EA 1OAPA 2F9ZC 1JJ2F 5DCVA 3HKDB 1QU9A 2V9YA 4G4XA 2IQQA 2AMTA 5JCOA 1GO1A 5KMGB 3MQWA 3OBYA 3I3FA 1SZQA 3RYFA 2B33A 2CSLA 3IEWA 5HXZA 1DBFA 4BT3A 4ZHYB 3CCRF 3JASB 1W42A 3CCJF 2LBWA 1IV3A 3JAKB 5LOVA 2R6R1 1VQNF 1QVFF 2HX0A 4X1YB 3VYUC 2UYJA 2EWCA 3S0HA 3V4DA 3V7QA 5LYJB 3HKCB 3CMAF 3FD6A 2PMPA 3C9SA 1KC8H 4ZOLA 5G4UC 3WJRA 2GLZA 3IEQA 3EORA 4BVSA 5FLXM 1SA0A 1FFXB 1UFYA 3JARA 4ZHQB 1U43A 4B45A 4X20B 5HP7A 1VQOF 1YGYA 2CVLA 4LNUA 1ODEA 5LXTA 3ON1A 1Z5WA 4IHJB 2DYYA 2QEXF 3L7QA 3CCQF 1VQ6F 4M8IA 1XRGA 1W3EX 3HKBB 1H7MA 5GIPC 2MQEA 1FFXA 2H6LA 3JATB 2H8CA 1W57A 5EZYA 4TV9A 1H48A 3V3TA 5C8YB 5GANK 1K9MH 3CC4F 1M90H 4TV8B 4NQ3A 4U3JB 5IJ0B 3G4SF 3D00A 2KTUA 5HY1A 1NMUB 4G4WA 3RYCB 5JCOC 2Z1FA 1W5FA 2FGYA 4C8IA 3O85A 3HKEB 3VO8A 1NJIH 3AGKA 2G9IA 4BT2A 1ZWZA 3ESJA 2R751 3RE3A 4IIJA 1RLGA 2UYPA 3IR9A 2Q1XA 3VCZA 2UYNA 1PXWA 3N2KB 2HS4A 1XBIA 5HY2A 1XHOA 4I50A 4RHAA 3ZOPA 3E1YA 3MBMA 1YQNA 5GONB 3BYQA 4X1KB 5LA6B 3SIVA 3S06A 1DT9A 2N48A 3I56F 3F0DA 1FNJA 1VQ8F 3MCAB 3QUWA 3CCMF 3FPIA 3N2KA 1W5AA 3CB2A 5KX5A 3HAXD 3HKCA 4O4LA 2HS0A 3NK6A 1JY8A 4NWOB 3TD5A 2AIFA 5EO3A 3E20B 3V7EA 1T0AA 2HP0B 2KTVA 3FBAA 2HRUA 5AVMA 5HP8A 1W55A 1N8RH 1FSZA 4G4YA 2ZAUA 3HWUA 2VAWA 5IT9M 2LBTA 4ZHVA 4R40B 2QI2A 3DDNA 3RYFB 5G4VC 1KQSF 4BT4A 1U3PA 1GX1A 1KD1H 1VH8A 2IG8A 4X1IA 5A2QM 2BO1A 3PAFA 3WPWA 1U3LA 1VQ4F 4YJ2B 3WJQA 3JCMM 4EI7A 1Z5VA 4I4TB 2RB9A 2OTLF 4WBNA 4ZI7B 5LP6A 3LFOA 2CZWA 4EB6A 1X25A 2AIZP 3C8LA 5HXUA 1KNJA 4O2BB 4O2AA 2P6YA 2ZODA 1H47A 3C9TA 5J2UB 3G6EF 2Z1UA 4RQOA 3CC2F 3ZP7A 2OTMA 3D54A 1IV2A 2VXYA 3LWPC 3K2XA 3VMFB 3MDOA 2WALA 3RYHB 3M4SA 2RHLA 3F0FA 4EI9A 1YI2F 4B46A 4O4JA 4TUYB 3WGKA 5ITZB 5MN5A 1VQPF 1CN7A 1VQ5F 2LCAA 3J80M 3HTNA 1IV1A 4BVRA 5GINC 2K1SA 3N2GB 2ZF8A 2CHTA 2VAMA 3LMEA 3VTIC 1VQKF 3FD5A 5JQGA 1NQ3A 3LWVC 1GZ0A 3S0WA 4G4ZA 3PLAC 2PHNA 2HVYD 3NVIB 5CA1B 1RLUA 2HRYA 4BT7A 5KX5B 3T80A 4ZOLB 3CCLF 4F6RA 1TUBA 2HP3A 5ITZA 5EIBC 3ZP4A 3HKEA 2L26A 4XCQA 4O4HA 1S72F 1JFFA 3NK7A 3Q8HA 3JALA 5B8FA 3S0YA 2QTPA 1Q82H 2OTJF 4IHJA 5C8YA 3ELCA 2VGMA 5GAPK 4NUTA 4DXDA 4YJ3A 3RYIB 3WGMA 3JAKA 4KWEA 1T0KB 3OONA 5CA0B 4BVTA 5EB1B 1GO0A 3RA6A 5FJ4C 3QHDA 2YYEA 4ZHWA 2BTQB 2QA4F 3E22B 3LWQC 2GVIA 3UT5A 2HS3A 5LXTB 1Q8RA 3TD3A 1X52A 2GZLA 4YJ3B 1RQ2A 1VQVA 3GHZA 3RYIA 1K8AH 3CD6F 3F6MA 3JARB 3M84A 4HNAA 5JVDB 4ZK7A 4IIJB 2ALEA 3KE1A 3IMPA 3NVKE 3J81M 1W41A 3VIUA 2RHJA 3LYBA 3CMEF 4X20A 4G88A 1CK2A 4LNUB 4U3JA 5GONA 3JAMM 3IKEA 5IYZA 2BTUA 5BMVA 4O4LB 4BT5A 5CB4B 2OZBA 4I55A 3VOAA 2Z01A 3I7TA 3TD4A 1Q86H 5EYPA 2VGNA 3S02A 3HKBA 1YJNF 4U39A 4EI8A 4TV8A 3G71F 3K12A 4B5CA 4LCKA 3K14A 3LWOC 2I6RA 3IKFA 1QVGF 1COMA 5IJ0A 5IYZB 3P10A 1VQMF 4EB6B 1RA4A 1Q81H 3KJJA 2JNBA 4O2AB 4BY9D 1U40A 3CG6A 5EZYB 3F0GA 4PWTA 4X1YA 3WGJA 5J2TB 4TV9B 2CWJA 3JAWB 3VI6A 4ZHQA 2DT4A 3P4EA 3R0PA 3HKDA 3WGNA 5JH7B 1YJWF 1KNKA 3C9RA 2ZVYA 1W5BA 4X1KA 5EIBD 4BW0B 2UZHA 3FFMA 4E6EA 5EWRA 4I50B 4O4HB 1K73H 3SIUA 4FFBB 3D01A 3DC2A 4YJ2A 3VYTC 4B62A 3JATA 3GTZA 2Z1EA 3JAWA 1FNKA 2LBXA 3RA5A 3N4ZA 1YITF 3LDTA 5FNVA 4BT6A 5JH7A 1VHAA 3CCVF 1SDSA 1IPAA 5KMGA 1QAHA 5HWEA 4C4WC 5J2UA 3RYCA 1YJ9F 3GYQA 4O4IA 2IAFA 3ERNA 4DRXB 4X3LA 1OFUA 1YHQF 3P0ZA
chains in the Genus database with same CATH topology
1QVFF 3CPWF 3OW2F 1E7KA 5IT9M 2QA4F 3LWQC 3I55F 3N4YA 3V7QA 2QI2A 3WXMB 2I6DA 1VQLF 3CMAF 5G4VC 1X52A 1KQSF 3CD6F 3CXCF 1K8AH 1KC8H 1KD1H 1X7OA 5G4UC 2GLZA 3LWRC 3OBWA 3CCSF 1Q7YH 5A2QM 5HY4A 2BO1A 4BVSA 5FLXM 3CCUF 3PAFA 3J7AR 1VQ4F 2ALEA 3NVKE 4X3MA 3J81M 1VQOF 1W41A 3JCMM 4EI7A 3NMUC 3CMEF 1CK2A 3ON1A 3JAMM 2OTLF 5HY0A 2QEXF 3LFOA 1X7PA 2CZWA 3CCQF 5HXUA 1VQ6F 2OZBA 1W3EX 1H7MA 5GIPC 3G6EF 1YIJF 3CCEF 1Q86H 3CC2F 2VGNA 1YJNF 4EI8A 5GIOC 3G71F 3V3TA 3LWPC 5GANK 3VMFB 1K9MH 3CC4F 2WALA 1M90H 4NQ3A 4LCKA 3G4SF 3LWOC 3D00A 2KTUA 5HY1A 1QVGF 1NMUB 4EI9A 4BVQA 1YI2F 1VQMF 2FGYA 1VQPF 3O85A 1CN7A 1VQ5F 1RA4A 3J80M 1Q81H 1NJIH 2JNBA 4BVRA 5GINC 4BY9D 3AGKA 3CG6A 1ZWZA 2KG4A 1RLGA 1VQKF 2FC3A 3IR9A 2OHWA 3VI6A 4TZZA 3LWVC 1GZ0A 1PXWA 1M1KH 1YJWF 3PLAC 1XBIA 2HVYD 3NVIB 5HY2A 3CC7F 3CPQA 3CCLF 3E1YA 4BW0B 3FFMA 5EWRA 1VQ9F 3SIVA 1W2BF 1W40A 1K73H 3SIUA 3HJWC 4XCQA 1DT9A 1VQ7F 3I56F 1S72F 3NK7A 1VQ8F 3MCAB 2F9ZC 2LBXA 3CCMF 3RA5A 3N4ZA 1YITF 1Q82H 1JJ2F 2OTJF 5DCVA 2VGMA 1GO1A 3OBYA 3HAXD 3CCVF 1SDSA 5GAPK 1IPAA 4NUTA 5HXZA 3NK6A 5HWEA 4C4WC 2AIFA 1T0KB 5EO3A 3E20B 5FJ4C 1YJ9F 3CCRF 3GYQA 3V7EA 4BVTA 2KTVA 1W42A 3CCJF 2LBWA 1VQNF 4X3LA 1N8RH 1GO0A 3RA6A 1YHQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVR A;  4BVT A;  4NQ3 A;  5HXU A;  5HY1 A;  5HXZ A;  5HY4 A;  4BVS A;  5HY0 A;  5HWE A;  4BVQ A;  5HY2 A; 
#chains in the Genus database with same CATH topology
 5MN4 A;  1QD9 A;  1ONI A;  3CYQ A;  5LOV B;  3M1X A;  3N2G A;  3CPW F;  3OW2 F;  1E7K A;  3WPX A;  3I55 F;  2CHS A;  2NMU A;  2VAP A;  3N4Y A;  3WXM B;  2I6D A;  1VQL F;  3MCQ A;  1J7H A;  3B6N A;  3ZO8 A;  1CLI A;  5EB0 A;  4WBN B;  1JN1 A;  5LYJ A;  3CXC F;  2Z1T A;  1X7O A;  1W58 1;  3LWR C;  3OBW A;  4F6R B;  3CCS F;  4O4I B;  1Q7Y H;  5HY4 A;  4I55 B;  3CCU F;  4O2B A;  5LA6 A;  4DRX A;  3J7A R;  2UYK A;  4X1I B;  3VOB A;  2UYN B;  1SA0 B;  4X3M A;  1JFF B;  3VYS C;  3JAL B;  3JVH A;  3NMU C;  4ZI7 A;  1W5E A;  1TUB B;  2KGW A;  2RHO A;  3WGL A;  5HY0 A;  1RQ7 A;  1X7P A;  4O4J B;  4TUY A;  3WJP A;  1IV4 A;  3CYP B;  3KJK A;  1YIJ F;  3CCE F;  2HP0 A;  4G4V A;  1XV2 A;  4C8E A;  4ERH A;  5GIO C;  1TVK B;  2ZVZ A;  2HQS C;  5MN6 A;  5JQG B;  5LP6 C;  4I4T A;  3QTY A;  5LP6 B;  3RYH A;  4BVQ A;  5IJ9 B;  2W8B C;  4C82 A;  5CB4 A;  3KHN A;  1VK3 A;  5EYP B;  5EAZ A;  4FFB A;  2BTO A;  2CW4 A;  3K0T A;  2KG4 A;  3E22 A;  3F0E A;  2FC3 A;  1PF5 A;  2OHW A;  4TZZ A;  1TVK A;  3UT5 B;  5CA1 A;  1M1K H;  2ZOV A;  4C81 A;  5FNV B;  3CC7 F;  5IJ9 A;  3CPQ A;  3C9U A;  4HNA B;  1VQ9 F;  5JVD A;  3JAS A;  1W2B F;  1W40 A;  5CA0 A;  3HJW C;  1JD1 A;  3KIZ A;  2YXZ A;  5BMV B;  1VQ7 F;  2Q1Y A;  5J2T A;  3U0O A;  1R1M A;  1W59 A;  1UI9 A;  2RHH A;  4C8G A;  3S03 A;  2H8E A;  1OAP A;  2F9Z C;  1JJ2 F;  5DCV A;  3HKD B;  1QU9 A;  2V9Y A;  4G4X A;  2IQQ A;  2AMT A;  5JCO A;  1GO1 A;  5KMG B;  3MQW A;  3OBY A;  3I3F A;  1SZQ A;  3RYF A;  2B33 A;  2CSL A;  3IEW A;  5HXZ A;  1DBF A;  4BT3 A;  4ZHY B;  3CCR F;  3JAS B;  1W42 A;  3CCJ F;  2LBW A;  1IV3 A;  3JAK B;  5LOV A;  2R6R 1;  1VQN F;  1QVF F;  2HX0 A;  4X1Y B;  3VYU C;  2UYJ A;  2EWC A;  3S0H A;  3V4D A;  3V7Q A;  5LYJ B;  3HKC B;  3CMA F;  3FD6 A;  2PMP A;  3C9S A;  1KC8 H;  4ZOL A;  5G4U C;  3WJR A;  2GLZ A;  3IEQ A;  3EOR A;  4BVS A;  5FLX M;  1SA0 A;  1FFX B;  1UFY A;  3JAR A;  4ZHQ B;  1U43 A;  4B45 A;  4X20 B;  5HP7 A;  1VQO F;  1YGY A;  2CVL A;  4LNU A;  1ODE A;  5LXT A;  3ON1 A;  1Z5W A;  4IHJ B;  2DYY A;  2QEX F;  3L7Q A;  3CCQ F;  1VQ6 F;  4M8I A;  1XRG A;  1W3E X;  3HKB B;  1H7M A;  5GIP C;  2MQE A;  1FFX A;  2H6L A;  3JAT B;  2H8C A;  1W57 A;  5EZY A;  4TV9 A;  1H48 A;  3V3T A;  5C8Y B;  5GAN K;  1K9M H;  3CC4 F;  1M90 H;  4TV8 B;  4NQ3 A;  4U3J B;  5IJ0 B;  3G4S F;  3D00 A;  2KTU A;  5HY1 A;  1NMU B;  4G4W A;  3RYC B;  5JCO C;  2Z1F A;  1W5F A;  2FGY A;  4C8I A;  3O85 A;  3HKE B;  3VO8 A;  1NJI H;  3AGK A;  2G9I A;  4BT2 A;  1ZWZ A;  3ESJ A;  2R75 1;  3RE3 A;  4IIJ A;  1RLG A;  2UYP A;  3IR9 A;  2Q1X A;  3VCZ A;  2UYN A;  1PXW A;  3N2K B;  2HS4 A;  1XBI A;  5HY2 A;  1XHO A;  4I50 A;  4RHA A;  3ZOP A;  3E1Y A;  3MBM A;  1YQN A;  5GON B;  3BYQ A;  4X1K B;  5LA6 B;  3SIV A;  3S06 A;  1DT9 A;  2N48 A;  3I56 F;  3F0D A;  1FNJ A;  1VQ8 F;  3MCA B;  3QUW A;  3CCM F;  3FPI A;  3N2K A;  1W5A A;  3CB2 A;  5KX5 A;  3HAX D;  3HKC A;  4O4L A;  2HS0 A;  3NK6 A;  1JY8 A;  4NWO B;  3TD5 A;  2AIF A;  5EO3 A;  3E20 B;  3V7E A;  1T0A A;  2HP0 B;  2KTV A;  3FBA A;  2HRU A;  5AVM A;  5HP8 A;  1W55 A;  1N8R H;  1FSZ A;  4G4Y A;  2ZAU A;  3HWU A;  2VAW A;  5IT9 M;  2LBT A;  4ZHV A;  4R40 B;  2QI2 A;  3DDN A;  3RYF B;  5G4V C;  1KQS F;  4BT4 A;  1U3P A;  1GX1 A;  1KD1 H;  1VH8 A;  2IG8 A;  4X1I A;  5A2Q M;  2BO1 A;  3PAF A;  3WPW A;  1U3L A;  1VQ4 F;  4YJ2 B;  3WJQ A;  3JCM M;  4EI7 A;  1Z5V A;  4I4T B;  2RB9 A;  2OTL F;  4WBN A;  4ZI7 B;  5LP6 A;  3LFO A;  2CZW A;  4EB6 A;  1X25 A;  2AIZ P;  3C8L A;  5HXU A;  1KNJ A;  4O2B B;  4O2A A;  2P6Y A;  2ZOD A;  1H47 A;  3C9T A;  5J2U B;  3G6E F;  2Z1U A;  4RQO A;  3CC2 F;  3ZP7 A;  2OTM A;  3D54 A;  1IV2 A;  2VXY A;  3LWP C;  3K2X A;  3VMF B;  3MDO A;  2WAL A;  3RYH B;  3M4S A;  2RHL A;  3F0F A;  4EI9 A;  1YI2 F;  4B46 A;  4O4J A;  4TUY B;  3WGK A;  5ITZ B;  5MN5 A;  1VQP F;  1CN7 A;  1VQ5 F;  2LCA A;  3J80 M;  3HTN A;  1IV1 A;  4BVR A;  5GIN C;  2K1S A;  3N2G B;  2ZF8 A;  2CHT A;  2VAM A;  3LME A;  3VTI C;  1VQK F;  3FD5 A;  5JQG A;  1NQ3 A;  3LWV C;  1GZ0 A;  3S0W A;  4G4Z A;  3PLA C;  2PHN A;  2HVY D;  3NVI B;  5CA1 B;  1RLU A;  2HRY A;  4BT7 A;  5KX5 B;  3T80 A;  4ZOL B;  3CCL F;  4F6R A;  1TUB A;  2HP3 A;  5ITZ A;  5EIB C;  3ZP4 A;  3HKE A;  2L26 A;  4XCQ A;  4O4H A;  1S72 F;  1JFF A;  3NK7 A;  3Q8H A;  3JAL A;  5B8F A;  3S0Y A;  2QTP A;  1Q82 H;  2OTJ F;  4IHJ A;  5C8Y A;  3ELC A;  2VGM A;  5GAP K;  4NUT A;  4DXD A;  4YJ3 A;  3RYI B;  3WGM A;  3JAK A;  4KWE A;  1T0K B;  3OON A;  5CA0 B;  4BVT A;  5EB1 B;  1GO0 A;  3RA6 A;  5FJ4 C;  3QHD A;  2YYE A;  4ZHW A;  2BTQ B;  2QA4 F;  3E22 B;  3LWQ C;  2GVI A;  3UT5 A;  2HS3 A;  5LXT B;  1Q8R A;  3TD3 A;  1X52 A;  2GZL A;  4YJ3 B;  1RQ2 A;  1VQV A;  3GHZ A;  3RYI A;  1K8A H;  3CD6 F;  3F6M A;  3JAR B;  3M84 A;  4HNA A;  5JVD B;  4ZK7 A;  4IIJ B;  2ALE A;  3KE1 A;  3IMP A;  3NVK E;  3J81 M;  1W41 A;  3VIU A;  2RHJ A;  3LYB A;  3CME F;  4X20 A;  4G88 A;  1CK2 A;  4LNU B;  4U3J A;  5GON A;  3JAM M;  3IKE A;  5IYZ A;  2BTU A;  5BMV A;  4O4L B;  4BT5 A;  5CB4 B;  2OZB A;  4I55 A;  3VOA A;  2Z01 A;  3I7T A;  3TD4 A;  1Q86 H;  5EYP A;  2VGN A;  3S02 A;  3HKB A;  1YJN F;  4U39 A;  4EI8 A;  4TV8 A;  3G71 F;  3K12 A;  4B5C A;  4LCK A;  3K14 A;  3LWO C;  2I6R A;  3IKF A;  1QVG F;  1COM A;  5IJ0 A;  5IYZ B;  3P10 A;  1VQM F;  4EB6 B;  1RA4 A;  1Q81 H;  3KJJ A;  2JNB A;  4O2A B;  4BY9 D;  1U40 A;  3CG6 A;  5EZY B;  3F0G A;  4PWT A;  4X1Y A;  3WGJ A;  5J2T B;  4TV9 B;  2CWJ A;  3JAW B;  3VI6 A;  4ZHQ A;  2DT4 A;  3P4E A;  3R0P A;  3HKD A;  3WGN A;  5JH7 B;  1YJW F;  1KNK A;  3C9R A;  2ZVY A;  1W5B A;  4X1K A;  5EIB D;  4BW0 B;  2UZH A;  3FFM A;  4E6E A;  5EWR A;  4I50 B;  4O4H B;  1K73 H;  3SIU A;  4FFB B;  3D01 A;  3DC2 A;  4YJ2 A;  3VYT C;  4B62 A;  3JAT A;  3GTZ A;  2Z1E A;  3JAW A;  1FNK A;  2LBX A;  3RA5 A;  3N4Z A;  1YIT F;  3LDT A;  5FNV A;  4BT6 A;  5JH7 A;  1VHA A;  3CCV F;  1SDS A;  1IPA A;  5KMG A;  1QAH A;  5HWE A;  4C4W C;  5J2U A;  3RYC A;  1YJ9 F;  3GYQ A;  4O4I A;  2IAF A;  3ERN A;  4DRX B;  4X3L A;  1OFU A;  1YHQ F;  3P0Z A; 
#chains in the Genus database with same CATH homology
 1QVF F;  3CPW F;  3OW2 F;  1E7K A;  5IT9 M;  2QA4 F;  3LWQ C;  3I55 F;  3N4Y A;  3V7Q A;  2QI2 A;  3WXM B;  2I6D A;  1VQL F;  3CMA F;  5G4V C;  1X52 A;  1KQS F;  3CD6 F;  3CXC F;  1K8A H;  1KC8 H;  1KD1 H;  1X7O A;  5G4U C;  2GLZ A;  3LWR C;  3OBW A;  3CCS F;  1Q7Y H;  5A2Q M;  5HY4 A;  2BO1 A;  4BVS A;  5FLX M;  3CCU F;  3PAF A;  3J7A R;  1VQ4 F;  2ALE A;  3NVK E;  4X3M A;  3J81 M;  1VQO F;  1W41 A;  3JCM M;  4EI7 A;  3NMU C;  3CME F;  1CK2 A;  3ON1 A;  3JAM M;  2OTL F;  5HY0 A;  2QEX F;  3LFO A;  1X7P A;  2CZW A;  3CCQ F;  5HXU A;  1VQ6 F;  2OZB A;  1W3E X;  1H7M A;  5GIP C;  3G6E F;  1YIJ F;  3CCE F;  1Q86 H;  3CC2 F;  2VGN A;  1YJN F;  4EI8 A;  5GIO C;  3G71 F;  3V3T A;  3LWP C;  5GAN K;  3VMF B;  1K9M H;  3CC4 F;  2WAL A;  1M90 H;  4NQ3 A;  4LCK A;  3G4S F;  3LWO C;  3D00 A;  2KTU A;  5HY1 A;  1QVG F;  1NMU B;  4EI9 A;  4BVQ A;  1YI2 F;  1VQM F;  2FGY A;  1VQP F;  3O85 A;  1CN7 A;  1VQ5 F;  1RA4 A;  3J80 M;  1Q81 H;  1NJI H;  2JNB A;  4BVR A;  5GIN C;  4BY9 D;  3AGK A;  3CG6 A;  1ZWZ A;  2KG4 A;  1RLG A;  1VQK F;  2FC3 A;  3IR9 A;  2OHW A;  3VI6 A;  4TZZ A;  3LWV C;  1GZ0 A;  1PXW A;  1M1K H;  1YJW F;  3PLA C;  1XBI A;  2HVY D;  3NVI B;  5HY2 A;  3CC7 F;  3CPQ A;  3CCL F;  3E1Y A;  4BW0 B;  3FFM A;  5EWR A;  1VQ9 F;  3SIV A;  1W2B F;  1W40 A;  1K73 H;  3SIU A;  3HJW C;  4XCQ A;  1DT9 A;  1VQ7 F;  3I56 F;  1S72 F;  3NK7 A;  1VQ8 F;  3MCA B;  2F9Z C;  2LBX A;  3CCM F;  3RA5 A;  3N4Z A;  1YIT F;  1Q82 H;  1JJ2 F;  2OTJ F;  5DCV A;  2VGM A;  1GO1 A;  3OBY A;  3HAX D;  3CCV F;  1SDS A;  5GAP K;  1IPA A;  4NUT A;  5HXZ A;  3NK6 A;  5HWE A;  4C4W C;  2AIF A;  1T0K B;  5EO3 A;  3E20 B;  5FJ4 C;  1YJ9 F;  3CCR F;  3GYQ A;  3V7E A;  4BVT A;  2KTV A;  1W42 A;  3CCJ F;  2LBW A;  1VQN F;  4X3L A;  1N8R H;  1GO0 A;  3RA6 A;  1YHQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...