5HY4A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
377
structure length
361
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVSMCWSNDASALGVAVALGEVKRDLVADDRIRSDWDLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
total genus 112
structure length 361
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A01
5HXUA 4BVQA 5HY4A 5HY0A 5HXZA 4BVTA 5HWEA 4BVRA 5HY1A 5HY2A 4BVSA 4NQ3A
chains in the Genus database with same CATH superfamily
2RB9A 5JVDA 1W3EX 3FBAA 4O4LA 2VXYA 4C8EA 3P4EA 3I55F 3IMPA 4O4HA 4BT3A 5C8YA 3CYQA 4O4HB 2VAMA 3C9RA 3ERNA 5B8FA 5FNVB 3F6MA 5EIBC 4G4ZA 2OZBA 1VQNF 4BT7A 4U3JB 4I4TA 1XRGA 3IEQA 1Q8RA 3JASA 5JQGA 3C9SA 3TD4A 1YHQF 3LWRC 3CCLF 3N4YA 4IIJA 1KC8H 1M1KH 3WJQA 1W40A 4RHAA 5IJ9A 3VIUA 1QAHA 1CN7A 2N48A 2YXZA 5EZYA 3O85A 4X1KB 3MQWA 5LP6A 1VH8A 3VI6A 3CCUF 5KX5B 3L7QA 3LDTA 3JAWB 3SIUA 3M1XA 3QUWA 3JATB 2R6R1 3FD5A 1VHAA 3JAKB 3CCSF 4G4XA 3UT5A 3KHNA 4I50A 4BW0B 5J2TB 3PLAC 2GLZA 4KWEA 5LXTB 1VK3A 3JARA 5G4UC 3RA5A 1YJWF 1QVGF 1VQ9F 4ZOLA 1W5AA 1TVKB 3NVKE 5LA6B 3N2GB 1KNKA 1K8AH 2HP3A 4X1IA 3RYHA 4WBNA 4X1IB 1U43A 5CA0A 2LBWA 5IT9M 5FLXM 2UYNB 4BT6A 4DRXB 3C8LA 3RYFA 1R1MA 3TD3A 5GONA 3MCQA 3RYFB 5MN6A 4YJ3B 1U40A 3HKCB 1XV2A 1RLGA 1VQ6F 5HWEA 3NMUC 1X52A 4O4JB 3OBWA 3HKBB 5JCOA 3OW2F 1IPAA 3CC4F 1H47A 2V9YA 2HP0A 1COMA 3JAMM 4TV9A 3D54A 5CB4A 1SZQA 3K14A 1GX1A 1YGYA 3LWVC 1QU9A 1DBFA 1ZWZA 5GIOC 1W42A 3VTIC 1VQLF 2IAFA 3VOAA 5IYZA 3JALA 2DYYA 3E22A 4EI9A 4BY9D 3E22B 4IHJA 4BVSA 5GAPK 1VQVA 2CHTA 1FNJA 3CXCF 2W8BC 5EIBD 1PXWA 4TV8A 2MQEA 3C9UA 2Q1XA 2UZHA 3ON1A 4E6EA 5LYJA 3S02A 2HS4A 2Z1UA 1X25A 2HVYD 2F9ZC 2IG8A 1S72F 2HRYA 4ZHQB 2VAWA 5EWRA 2CW4A 1SDSA 4FFBB 2EWCA 2GZLA 1Q82H 3VYSC 4X20B 2UYJA 1JFFB 2I6DA 3V4DA 2JNBA 5FNVA 2CVLA 4O2BB 4G4WA 1GO1A 4BVRA 2AIFA 3V7EA 1W5FA 3WJRA 4NUTA 2Z1FA 1OFUA 4U3JA 3CC2F 2OTJF 4EI8A 5JH7A 4BVQA 5LOVB 5JH7B 3G71F 3CMEF 3CCJF 3DDNA 1Q81H 5MN4A 3KIZA 3LWPC 2RHLA 1U3PA 2YYEA 3S06A 4B45A 1W581 2Z01A 2KGWA 2CHSA 4NWOB 4X1KA 2B33A 2HS0A 3OBYA 3RYIB 3WPXA 1YI2F 3IR9A 3ZP7A 3M4SA 2LCAA 2UYKA 3CCQF 3VYTC 5KX5A 5HP7A 3FD6A 3N2KA 3JAWA 1M90H 2DT4A 3N2KB 3KJJA 1CLIA 3JATA 2H8EA 1W55A 2AIZP 3CB2A 3JAKA 5ITZB 4O2AB 1KQSF 1VQOF 2CSLA 3P10A 1JD1A 1SA0A 5HY4A 5HY0A 2QEXF 5J2TA 4X1YA 4F6RA 1SA0B 2BTOA 3D00A 5LXTA 1RA4A 4X1YB 3LMEA 4F6RB 2VGMA 1Z5VA 4EI7A 2BTQB 2IQQA 2BTUA 1TVKA 5LA6A 2LBTA 3N2GA 4B46A 1YQNA 1CK2A 4B62A 3E20B 2WALA 1W2BF 5EB0A 5GIPC 4M8IA 3SIVA 2UYNA 5IJ0B 3HKEB 3RE3A 4DRXA 2P6YA 3BYQA 3PAFA 3IKEA 5MN5A 3G4SF 4EB6B 4YJ3A 3J81M 3HKCA 2PHNA 3ELCA 2FC3A 3S03A 5BMVB 2ALEA 4O4JA 2ZVZA 3HKBA 5EYPB 1NQ3A 5HXUA 3CCRF 2HX0A 4DXDA 4BT4A 1FNKA 2RHHA 1KNJA 3TD5A 1IV1A 5GINC 4HNAA 4HNAB 3MCAB 3FFMA 1IV2A 3CCMF 2FGYA 1JN1A 1GZ0A 1W5BA 1YIJF 1K73H 3K12A 1TUBA 5EO3A 3WJPA 3I7TA 1JY8A 3P0ZA 3VO8A 4ZHYB 1TUBB 3CC7F 4LNUB 3F0DA 1UI9A 3VMFB 3LWQC 3IEWA 1VQMF 3S0WA 3IKFA 3ZP4A 1ONIA 1RQ2A 2I6RA 2OHWA 3LYBA 4ZHQA 3HKDA 3HWUA 2CWJA 3ZOPA 3GYQA 3EORA 4C8IA 4NQ3A 4XCQA 3HKDB 5KMGB 2QI2A 4FFBA 1VQ8F 4C81A 3I3FA 2H6LA 3Q8HA 1H48A 4X20A 2HS3A 1KD1H 2ZAUA 1JFFA 5EB1B 2Q1YA 3CYPB 1DT9A 3RYCB 3F0EA 3LFOA 4I55B 3VOBA 5HY2A 3K0TA 1ODEA 1UFYA 3FPIA 4TUYA 4O2BA 4B5CA 4BVTA 4TUYB 4YJ2B 5CA1A 1PF5A 1NJIH 4ZI7B 5CA1B 1FFXB 5LOVA 1FSZA 3J7AR 5G4VC 5J2UA 3J80M 3WPWA 3KE1A 1RQ7A 4O4IB 2RHJA 1U3LA 2Z1TA 3GTZA 5J2UB 4BT2A 5GANK 5A2QM 3WGLA 3HJWC 3MDOA 1J7HA 2ZODA 5JVDB 1Z5WA 4X3LA 3T80A 1JJ2F 3RYIA 4ERHA 4U39A 4O4LB 3CPQA 2VGNA 2UYPA 5C8YB 1IV4A 3CD6F 3MBMA 3C9TA 5HXZA 3I56F 3HAXD 3WGJA 3WGNA 4I4TB 3CMAF 5ITZA 4O2AA 2ZOVA 3ZO8A 3JASB 5JQGB 1XBIA 3NVIB 2KTVA 3JCMM 5FJ4C 4IIJB 5DCVA 1W41A 3N4ZA 1Q86H 4TZZA 5IJ9B 3R0PA 2NMUA 4PWTA 3CCEF 5EZYB 2AMTA 2KTUA 2HRUA 5LP6B 1T0AA 4C82A 1Q7YH 1W59A 3U0OA 1XHOA 1NMUB 1VQ4F 5IJ0A 3HKEA 3VCZA 1E7KA 2CZWA 2VAPA 4EB6A 3AGKA 1T0KB 3JVHA 1N8RH 3WGKA 5LP6C 1H7MA 3UT5B 3S0HA 5BMVA 5EYPA 3QTYA 5HY1A 4I50B 1RLUA 2LBXA 1VQ7F 2Z1EA 3JARB 3D01A 2ZVYA 4C4WC 1IV3A 4ZOLB 3WXMB 4G4VA 3NK6A 3OONA 2H8CA 1YITF 3RYHB 2L26A 5HP8A 3DC2A 4WBNB 4ZK7A 4ZHWA 3S0YA 5CA0B 2K1SA 3G6EF 3V7QA 2HQSC 5GONB 2ZF8A 3B6NA 3F0GA 4C8GA 2PMPA 3NK7A 3LWOC 1YJNF 1VQKF 2R751 2BO1A 4LNUA 2RHOA 2HP0B 4R40B 1W5EA 4TV9B 1GO0A 4X3MA 4LCKA 2GVIA 2OTMA 5CB4B 5EAZA 2QTPA 3GHZA 3VYUC 1X7PA 2G9IA 1K9MH 3KJKA 2QA4F 5JCOC 3K2XA 4G88A 4ZHVA 5KMGA 3QHDA 3CPWF 3CG6A 5IYZB 3JALB 3WGMA 4BT5A 1QD9A 1VQ5F 3F0FA 4IHJB 3RYCA 2KG4A 3E1YA 3M84A 4I55A 3HTNA 1VQPF 1W57A 5AVMA 1X7OA 4G4YA 1YJ9F 4TV8B 4YJ2A 1OAPA 4ZI7A 1FFXA 5LYJB 3ESJA 2OTLF 4RQOA 3RA6A 4O4IA 3V3TA 1QVFF 3CCVF
chains in the Genus database with same CATH topology
2FC3A 3NVIB 2KTVA 4EI9A 2ALEA 3JCMM 1W3EX 4BY9D 5FJ4C 4BVSA 5DCVA 1W41A 5HXUA 3N4ZA 5GAPK 4TZZA 3CCRF 1Q86H 3I55F 3CCEF 3CXCF 2KTUA 1Q7YH 1PXWA 1NMUB 3ON1A 5GINC 1VQ4F 2OZBA 2HVYD 1VQNF 2F9ZC 3MCAB 1E7KA 3FFMA 2CZWA 1S72F 3CCMF 2FGYA 3AGKA 1T0KB 1N8RH 1GZ0A 5EWRA 1YHQF 3LWRC 1H7MA 1YIJF 3CCLF 1K73H 1SDSA 3N4YA 1M1KH 1KC8H 5HY1A 1Q82H 2LBXA 1W40A 5EO3A 1VQ7F 1CN7A 3CC7F 2I6DA 3O85A 3VMFB 4C4WC 2JNBA 3LWQC 3WXMB 3NK6A 1VQMF 3VI6A 3CCUF 1YITF 1GO1A 4BVRA 2AIFA 3V7EA 4NUTA 3SIUA 3CC2F 2OTJF 4EI8A 4BVQA 2OHWA 3G6EF 3V7QA 3GYQA 3G71F 4NQ3A 4XCQA 3CCSF 3CMEF 3CCJF 2QI2A 1Q81H 1VQ8F 3LWPC 4BW0B 3PLAC 2GLZA 3NK7A 3LWOC 1YJNF 1KD1H 1VQKF 1DT9A 5G4UC 2BO1A 3OBYA 3LFOA 3RA5A 1YI2F 3IR9A 1YJWF 1QVGF 1VQ9F 5HY2A 3CCQF 3NVKE 1GO0A 1K8AH 4X3MA 4BVTA 4LCKA 2LBWA 1M90H 1NJIH 5IT9M 5FLXM 1X7PA 3J7AR 5G4VC 1K9MH 3J80M 2QA4F 5GANK 1KQSF 5A2QM 3CPWF 3HJWC 1VQOF 3CG6A 5HY4A 5HY0A 2QEXF 1RLGA 1VQ6F 5HWEA 3NMUC 4X3LA 1VQ5F 1X52A 3D00A 1RA4A 3OBWA 1JJ2F 2KG4A 3OW2F 3E1YA 1IPAA 2VGMA 4EI7A 3CPQA 2VGNA 3CC4F 1VQPF 3JAMM 1CK2A 1X7OA 3CD6F 1YJ9F 3E20B 5HXZA 2WALA 1W2BF 3I56F 5GIPC 3HAXD 3LWVC 3SIVA 5GIOC 1ZWZA 2OTLF 1W42A 3RA6A 3PAFA 1VQLF 3CMAF 3G4SF 3V3TA 1QVFF 3J81M 1XBIA 3CCVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXU A;  4BVQ A;  5HY4 A;  5HY0 A;  5HXZ A;  4BVT A;  5HWE A;  4BVR A;  5HY1 A;  5HY2 A;  4BVS A;  4NQ3 A; 
#chains in the Genus database with same CATH topology
 2RB9 A;  5JVD A;  1W3E X;  3FBA A;  4O4L A;  2VXY A;  4C8E A;  3P4E A;  3I55 F;  3IMP A;  4O4H A;  4BT3 A;  5C8Y A;  3CYQ A;  4O4H B;  2VAM A;  3C9R A;  3ERN A;  5B8F A;  5FNV B;  3F6M A;  5EIB C;  4G4Z A;  2OZB A;  1VQN F;  4BT7 A;  4U3J B;  4I4T A;  1XRG A;  3IEQ A;  1Q8R A;  3JAS A;  5JQG A;  3C9S A;  3TD4 A;  1YHQ F;  3LWR C;  3CCL F;  3N4Y A;  4IIJ A;  1KC8 H;  1M1K H;  3WJQ A;  1W40 A;  4RHA A;  5IJ9 A;  3VIU A;  1QAH A;  1CN7 A;  2N48 A;  2YXZ A;  5EZY A;  3O85 A;  4X1K B;  3MQW A;  5LP6 A;  1VH8 A;  3VI6 A;  3CCU F;  5KX5 B;  3L7Q A;  3LDT A;  3JAW B;  3SIU A;  3M1X A;  3QUW A;  3JAT B;  2R6R 1;  3FD5 A;  1VHA A;  3JAK B;  3CCS F;  4G4X A;  3UT5 A;  3KHN A;  4I50 A;  4BW0 B;  5J2T B;  3PLA C;  2GLZ A;  4KWE A;  5LXT B;  1VK3 A;  3JAR A;  5G4U C;  3RA5 A;  1YJW F;  1QVG F;  1VQ9 F;  4ZOL A;  1W5A A;  1TVK B;  3NVK E;  5LA6 B;  3N2G B;  1KNK A;  1K8A H;  2HP3 A;  4X1I A;  3RYH A;  4WBN A;  4X1I B;  1U43 A;  5CA0 A;  2LBW A;  5IT9 M;  5FLX M;  2UYN B;  4BT6 A;  4DRX B;  3C8L A;  3RYF A;  1R1M A;  3TD3 A;  5GON A;  3MCQ A;  3RYF B;  5MN6 A;  4YJ3 B;  1U40 A;  3HKC B;  1XV2 A;  1RLG A;  1VQ6 F;  5HWE A;  3NMU C;  1X52 A;  4O4J B;  3OBW A;  3HKB B;  5JCO A;  3OW2 F;  1IPA A;  3CC4 F;  1H47 A;  2V9Y A;  2HP0 A;  1COM A;  3JAM M;  4TV9 A;  3D54 A;  5CB4 A;  1SZQ A;  3K14 A;  1GX1 A;  1YGY A;  3LWV C;  1QU9 A;  1DBF A;  1ZWZ A;  5GIO C;  1W42 A;  3VTI C;  1VQL F;  2IAF A;  3VOA A;  5IYZ A;  3JAL A;  2DYY A;  3E22 A;  4EI9 A;  4BY9 D;  3E22 B;  4IHJ A;  4BVS A;  5GAP K;  1VQV A;  2CHT A;  1FNJ A;  3CXC F;  2W8B C;  5EIB D;  1PXW A;  4TV8 A;  2MQE A;  3C9U A;  2Q1X A;  2UZH A;  3ON1 A;  4E6E A;  5LYJ A;  3S02 A;  2HS4 A;  2Z1U A;  1X25 A;  2HVY D;  2F9Z C;  2IG8 A;  1S72 F;  2HRY A;  4ZHQ B;  2VAW A;  5EWR A;  2CW4 A;  1SDS A;  4FFB B;  2EWC A;  2GZL A;  1Q82 H;  3VYS C;  4X20 B;  2UYJ A;  1JFF B;  2I6D A;  3V4D A;  2JNB A;  5FNV A;  2CVL A;  4O2B B;  4G4W A;  1GO1 A;  4BVR A;  2AIF A;  3V7E A;  1W5F A;  3WJR A;  4NUT A;  2Z1F A;  1OFU A;  4U3J A;  3CC2 F;  2OTJ F;  4EI8 A;  5JH7 A;  4BVQ A;  5LOV B;  5JH7 B;  3G71 F;  3CME F;  3CCJ F;  3DDN A;  1Q81 H;  5MN4 A;  3KIZ A;  3LWP C;  2RHL A;  1U3P A;  2YYE A;  3S06 A;  4B45 A;  1W58 1;  2Z01 A;  2KGW A;  2CHS A;  4NWO B;  4X1K A;  2B33 A;  2HS0 A;  3OBY A;  3RYI B;  3WPX A;  1YI2 F;  3IR9 A;  3ZP7 A;  3M4S A;  2LCA A;  2UYK A;  3CCQ F;  3VYT C;  5KX5 A;  5HP7 A;  3FD6 A;  3N2K A;  3JAW A;  1M90 H;  2DT4 A;  3N2K B;  3KJJ A;  1CLI A;  3JAT A;  2H8E A;  1W55 A;  2AIZ P;  3CB2 A;  3JAK A;  5ITZ B;  4O2A B;  1KQS F;  1VQO F;  2CSL A;  3P10 A;  1JD1 A;  1SA0 A;  5HY4 A;  5HY0 A;  2QEX F;  5J2T A;  4X1Y A;  4F6R A;  1SA0 B;  2BTO A;  3D00 A;  5LXT A;  1RA4 A;  4X1Y B;  3LME A;  4F6R B;  2VGM A;  1Z5V A;  4EI7 A;  2BTQ B;  2IQQ A;  2BTU A;  1TVK A;  5LA6 A;  2LBT A;  3N2G A;  4B46 A;  1YQN A;  1CK2 A;  4B62 A;  3E20 B;  2WAL A;  1W2B F;  5EB0 A;  5GIP C;  4M8I A;  3SIV A;  2UYN A;  5IJ0 B;  3HKE B;  3RE3 A;  4DRX A;  2P6Y A;  3BYQ A;  3PAF A;  3IKE A;  5MN5 A;  3G4S F;  4EB6 B;  4YJ3 A;  3J81 M;  3HKC A;  2PHN A;  3ELC A;  2FC3 A;  3S03 A;  5BMV B;  2ALE A;  4O4J A;  2ZVZ A;  3HKB A;  5EYP B;  1NQ3 A;  5HXU A;  3CCR F;  2HX0 A;  4DXD A;  4BT4 A;  1FNK A;  2RHH A;  1KNJ A;  3TD5 A;  1IV1 A;  5GIN C;  4HNA A;  4HNA B;  3MCA B;  3FFM A;  1IV2 A;  3CCM F;  2FGY A;  1JN1 A;  1GZ0 A;  1W5B A;  1YIJ F;  1K73 H;  3K12 A;  1TUB A;  5EO3 A;  3WJP A;  3I7T A;  1JY8 A;  3P0Z A;  3VO8 A;  4ZHY B;  1TUB B;  3CC7 F;  4LNU B;  3F0D A;  1UI9 A;  3VMF B;  3LWQ C;  3IEW A;  1VQM F;  3S0W A;  3IKF A;  3ZP4 A;  1ONI A;  1RQ2 A;  2I6R A;  2OHW A;  3LYB A;  4ZHQ A;  3HKD A;  3HWU A;  2CWJ A;  3ZOP A;  3GYQ A;  3EOR A;  4C8I A;  4NQ3 A;  4XCQ A;  3HKD B;  5KMG B;  2QI2 A;  4FFB A;  1VQ8 F;  4C81 A;  3I3F A;  2H6L A;  3Q8H A;  1H48 A;  4X20 A;  2HS3 A;  1KD1 H;  2ZAU A;  1JFF A;  5EB1 B;  2Q1Y A;  3CYP B;  1DT9 A;  3RYC B;  3F0E A;  3LFO A;  4I55 B;  3VOB A;  5HY2 A;  3K0T A;  1ODE A;  1UFY A;  3FPI A;  4TUY A;  4O2B A;  4B5C A;  4BVT A;  4TUY B;  4YJ2 B;  5CA1 A;  1PF5 A;  1NJI H;  4ZI7 B;  5CA1 B;  1FFX B;  5LOV A;  1FSZ A;  3J7A R;  5G4V C;  5J2U A;  3J80 M;  3WPW A;  3KE1 A;  1RQ7 A;  4O4I B;  2RHJ A;  1U3L A;  2Z1T A;  3GTZ A;  5J2U B;  4BT2 A;  5GAN K;  5A2Q M;  3WGL A;  3HJW C;  3MDO A;  1J7H A;  2ZOD A;  5JVD B;  1Z5W A;  4X3L A;  3T80 A;  1JJ2 F;  3RYI A;  4ERH A;  4U39 A;  4O4L B;  3CPQ A;  2VGN A;  2UYP A;  5C8Y B;  1IV4 A;  3CD6 F;  3MBM A;  3C9T A;  5HXZ A;  3I56 F;  3HAX D;  3WGJ A;  3WGN A;  4I4T B;  3CMA F;  5ITZ A;  4O2A A;  2ZOV A;  3ZO8 A;  3JAS B;  5JQG B;  1XBI A;  3NVI B;  2KTV A;  3JCM M;  5FJ4 C;  4IIJ B;  5DCV A;  1W41 A;  3N4Z A;  1Q86 H;  4TZZ A;  5IJ9 B;  3R0P A;  2NMU A;  4PWT A;  3CCE F;  5EZY B;  2AMT A;  2KTU A;  2HRU A;  5LP6 B;  1T0A A;  4C82 A;  1Q7Y H;  1W59 A;  3U0O A;  1XHO A;  1NMU B;  1VQ4 F;  5IJ0 A;  3HKE A;  3VCZ A;  1E7K A;  2CZW A;  2VAP A;  4EB6 A;  3AGK A;  1T0K B;  3JVH A;  1N8R H;  3WGK A;  5LP6 C;  1H7M A;  3UT5 B;  3S0H A;  5BMV A;  5EYP A;  3QTY A;  5HY1 A;  4I50 B;  1RLU A;  2LBX A;  1VQ7 F;  2Z1E A;  3JAR B;  3D01 A;  2ZVY A;  4C4W C;  1IV3 A;  4ZOL B;  3WXM B;  4G4V A;  3NK6 A;  3OON A;  2H8C A;  1YIT F;  3RYH B;  2L26 A;  5HP8 A;  3DC2 A;  4WBN B;  4ZK7 A;  4ZHW A;  3S0Y A;  5CA0 B;  2K1S A;  3G6E F;  3V7Q A;  2HQS C;  5GON B;  2ZF8 A;  3B6N A;  3F0G A;  4C8G A;  2PMP A;  3NK7 A;  3LWO C;  1YJN F;  1VQK F;  2R75 1;  2BO1 A;  4LNU A;  2RHO A;  2HP0 B;  4R40 B;  1W5E A;  4TV9 B;  1GO0 A;  4X3M A;  4LCK A;  2GVI A;  2OTM A;  5CB4 B;  5EAZ A;  2QTP A;  3GHZ A;  3VYU C;  1X7P A;  2G9I A;  1K9M H;  3KJK A;  2QA4 F;  5JCO C;  3K2X A;  4G88 A;  4ZHV A;  5KMG A;  3QHD A;  3CPW F;  3CG6 A;  5IYZ B;  3JAL B;  3WGM A;  4BT5 A;  1QD9 A;  1VQ5 F;  3F0F A;  4IHJ B;  3RYC A;  2KG4 A;  3E1Y A;  3M84 A;  4I55 A;  3HTN A;  1VQP F;  1W57 A;  5AVM A;  1X7O A;  4G4Y A;  1YJ9 F;  4TV8 B;  4YJ2 A;  1OAP A;  4ZI7 A;  1FFX A;  5LYJ B;  3ESJ A;  2OTL F;  4RQO A;  3RA6 A;  4O4I A;  3V3T A;  1QVF F;  3CCV F; 
#chains in the Genus database with same CATH homology
 2FC3 A;  3NVI B;  2KTV A;  4EI9 A;  2ALE A;  3JCM M;  1W3E X;  4BY9 D;  5FJ4 C;  4BVS A;  5DCV A;  1W41 A;  5HXU A;  3N4Z A;  5GAP K;  4TZZ A;  3CCR F;  1Q86 H;  3I55 F;  3CCE F;  3CXC F;  2KTU A;  1Q7Y H;  1PXW A;  1NMU B;  3ON1 A;  5GIN C;  1VQ4 F;  2OZB A;  2HVY D;  1VQN F;  2F9Z C;  3MCA B;  1E7K A;  3FFM A;  2CZW A;  1S72 F;  3CCM F;  2FGY A;  3AGK A;  1T0K B;  1N8R H;  1GZ0 A;  5EWR A;  1YHQ F;  3LWR C;  1H7M A;  1YIJ F;  3CCL F;  1K73 H;  1SDS A;  3N4Y A;  1M1K H;  1KC8 H;  5HY1 A;  1Q82 H;  2LBX A;  1W40 A;  5EO3 A;  1VQ7 F;  1CN7 A;  3CC7 F;  2I6D A;  3O85 A;  3VMF B;  4C4W C;  2JNB A;  3LWQ C;  3WXM B;  3NK6 A;  1VQM F;  3VI6 A;  3CCU F;  1YIT F;  1GO1 A;  4BVR A;  2AIF A;  3V7E A;  4NUT A;  3SIU A;  3CC2 F;  2OTJ F;  4EI8 A;  4BVQ A;  2OHW A;  3G6E F;  3V7Q A;  3GYQ A;  3G71 F;  4NQ3 A;  4XCQ A;  3CCS F;  3CME F;  3CCJ F;  2QI2 A;  1Q81 H;  1VQ8 F;  3LWP C;  4BW0 B;  3PLA C;  2GLZ A;  3NK7 A;  3LWO C;  1YJN F;  1KD1 H;  1VQK F;  1DT9 A;  5G4U C;  2BO1 A;  3OBY A;  3LFO A;  3RA5 A;  1YI2 F;  3IR9 A;  1YJW F;  1QVG F;  1VQ9 F;  5HY2 A;  3CCQ F;  3NVK E;  1GO0 A;  1K8A H;  4X3M A;  4BVT A;  4LCK A;  2LBW A;  1M90 H;  1NJI H;  5IT9 M;  5FLX M;  1X7P A;  3J7A R;  5G4V C;  1K9M H;  3J80 M;  2QA4 F;  5GAN K;  1KQS F;  5A2Q M;  3CPW F;  3HJW C;  1VQO F;  3CG6 A;  5HY4 A;  5HY0 A;  2QEX F;  1RLG A;  1VQ6 F;  5HWE A;  3NMU C;  4X3L A;  1VQ5 F;  1X52 A;  3D00 A;  1RA4 A;  3OBW A;  1JJ2 F;  2KG4 A;  3OW2 F;  3E1Y A;  1IPA A;  2VGM A;  4EI7 A;  3CPQ A;  2VGN A;  3CC4 F;  1VQP F;  3JAM M;  1CK2 A;  1X7O A;  3CD6 F;  1YJ9 F;  3E20 B;  5HXZ A;  2WAL A;  1W2B F;  3I56 F;  5GIP C;  3HAX D;  3LWV C;  3SIV A;  5GIO C;  1ZWZ A;  2OTL F;  1W42 A;  3RA6 A;  3PAF A;  1VQL F;  3CMA F;  3G4S F;  3V3T A;  1QVF F;  3J81 M;  1XBI A;  3CCV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...