5HY4A

Structure-function analysis of functionally diverse members of the cyclic amide hydrolase family of toblerone fold enzymes
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
377
structure length
361
Chain Sequence
RYPKASMHVVPMLAPNDTAAFRALFASGAVDPASVVALIAKSEGSGLHNDHARVFADVSLRTALAEARGCPVEDLADSVTVAVSGGSPGVISPHVTVVTQEWVADLPAGLPGVGLVVGRGHTEPILPEDIGRTAQVDKVADAVAAAMLDAGVTDPDDVHLVMVKGPALSSRAVADALSRGKTVVSMCWSNDASALGVAVALGEVKRDLVADDRIRSDWDLFSAVAATSSGGEKRGGEVLLLANSAQSASELRIGHGITRDMADTEGIKTAIRTAGVDFDCCLSPAQQAQVVQVFGKFVLPGSDVLRGQHITALDDHEAHHVAKAVGGALVVSITGQPMSFISGGERNGGNPVAAVVRRLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring-opening amidohydrolase
publication title High-Resolution X-Ray Structures of Two Functionally Distinct Members of the Cyclic Amide Hydrolase Family of Toblerone Fold Enzymes.
pubmed doi rcsb
source organism Frankia sp. eul1b
molecule tags Hydrolase
total genus 112
structure length 361
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.15: Cyanuric acid amidohydrolase.
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09663 Amido_AtzD_TrzD Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.160 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A03
3.30.1330.170 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5hy4A01
4BVSA 4BVQA 4BVRA 5HY0A 5HXZA 5HXUA 5HY1A 4NQ3A 5HY4A 5HY2A 5HWEA 4BVTA
chains in the Genus database with same CATH superfamily
1IV4A 1W581 3CCSF 1FFXA 2UYNA 4X1YB 4U3JB 3HWUA 3MBMA 5LA6A 3S03A 3IKEA 2HVYD 4TV9A 3N2GB 4O2AB 3ELCA 1W40A 3WGNA 2AIFA 2IQQA 2CHSA 3CMAF 2G9IA 4IHJA 3R0PA 5JCOC 5FNVA 5LP6B 5AVMA 3ZOPA 3CC2F 3HAXD 3CCJF 1W3EX 1M90H 1E7KA 5FLXM 4IIJB 2CWJA 3K2XA 1OAPA 2UYJA 1NJIH 3LWVC 2HRUA 5KMGA 3LWQC 3F0GA 4R40B 3I3FA 4G4VA 5IT9M 2HRYA 4X20B 3OONA 4I55B 3VOAA 2F9ZC 2FGYA 4XCQA 3CCMF 3JAKA 4X1IB 1DBFA 3FFMA 2BTOA 3ZO8A 5JQGA 3HKDB 1Q7YH 2LBWA 3JAMM 1QAHA 1Q8RA 4EB6B 3V7QA 1VQKF 4TUYA 3LWRC 1S72F 1X52A 3FPIA 4O4LB 3IR9A 1GO1A 1YHQF 4FFBB 3IMPA 3RYCB 5CA1B 2QEXF 3RYIB 3FD5A 1YJNF 3WGKA 3N2KA 5LXTA 4WBNB 1RLGA 3BYQA 2I6DA 3CB2A 1VHAA 1JJ2F 4C4WC 1K8AH 5HY4A 5GINC 2ZOVA 3PLAC 3RYFA 3JAWB 1CK2A 3JVHA 5JVDA 2MQEA 4ZHQA 3HKEA 1XRGA 3NK7A 4ERHA 4F6RA 3T80A 3LMEA 1W57A 2DYYA 1N8RH 1VQVA 3QUWA 5KX5A 3J81M 5LOVA 3HKCB 4X1KA 3RA6A 3CCEF 1SA0A 3FBAA 2Z1FA 3VI6A 4KWEA 1W5FA 3VMFB 4C81A 1QVFF 2ZODA 3O85A 3VIUA 1IPAA 3UT5B 5HP8A 2KTVA 5EZYB 4EI8A 1W42A 1Q82H 4O4JB 3RA5A 5JH7B 1VQ5F 4O4HB 4O4IB 2ZVZA 3P10A 4U39A 3I7TA 5EIBC 1VQ4F 3E22B 1YIJF 3CCLF 2ZF8A 2PMPA 3D01A 1JD1A 1U3PA 4E6EA 1OFUA 3HJWC 3KHNA 4NUTA 1Z5WA 4BVQA 5EAZA 4HNAB 4PWTA 3TD3A 2H6LA 3JARB 3JALB 1JY8A 1RLUA 3MDOA 1W2BF 2GVIA 1YI2F 1TUBA 4BT4A 5EIBD 5CB4A 4B46A 3V3TA 2VAPA 5EO3A 2Q1YA 5MN6A 4I4TB 5IJ0A 1H48A 1ODEA 1U40A 2RHJA 2VAWA 4YJ3B 5EB1B 2RHHA 1J7HA 4ZI7B 1FNKA 4X3LA 4C8EA 3I56F 3M1XA 4DRXA 3SIVA 3ERNA 1GZ0A 2WALA 3LWPC 2Q1XA 4RHAA 5J2UB 2CHTA 2IG8A 4LNUB 3FD6A 5C8YB 4ZHVA 4X1YA 2EWCA 2VAMA 3WPWA 1KNJA 3N2GA 3K14A 2L26A 4O2AA 4BT3A 2UYPA 3N4YA 3HTNA 4BW0B 2VGMA 3JATB 4YJ2B 5GIOC 3D54A 4BT6A 2NMUA 5CA0B 4O2BB 3ESJA 4BT5A 5LP6A 4BVRA 1FSZA 3WJPA 2Z1TA 3LDTA 1KNKA 1VQ7F 3WPXA 2HQSC 4IIJA 3U0OA 4ZHYB 3KJJA 1UI9A 5EYPB 3CG6A 1XHOA 3WJRA 2JNBA 5GONB 3MCQA 3RYHB 3E20B 3M84A 1DT9A 3IKFA 2OTLF 2VGNA 2HS4A 4X20A 4I55A 3S0WA 1K9MH 2KGWA 3JASB 5FJ4C 1IV2A 3DC2A 3ZP7A 2LBXA 3V7EA 5HP7A 2VXYA 3HKDA 2OZBA 3KE1A 2V9YA 3TD5A 3VCZA 5IJ9B 3WGLA 4EB6A 1CLIA 2ZVYA 1YITF 3LYBA 4O4LA 4BT2A 4EI7A 3KIZA 2RHOA 2HP3A 1T0AA 5IYZB 4FFBA 1W55A 3RYCA 3WXMB 5CA1A 2ZAUA 1R1MA 3RYIA 3E1YA 1VQMF 1JN1A 4WBNA 5EWRA 1VQ8F 3WGJA 2N48A 5JVDB 1TVKB 5DCVA 1GX1A 3TD4A 2KTUA 1RQ2A 2R751 4TV8B 3LFOA 2FC3A 4ZOLB 3S0HA 2HP0A 2CW4A 1Q86H 5ITZB 4EI9A 2OHWA 1U3LA 3HKCA 3L7QA 3S0YA 1YQNA 1KQSF 3C9TA 3KJKA 1VQ6F 3UT5A 3CPWF 3F0DA 1ZWZA 2CSLA 1JFFB 1W59A 3OW2F 1QVGF 5EZYA 5G4UC 3I55F 4BVTA 3RE3A 4I50B 4O4JA 4X3MA 5JH7A 5BMVB 5HXUA 4O4HA 1IV1A 3CCRF 5JCOA 1QU9A 3MCAB 2QTPA 3E22A 4B62A 2RB9A 5HY1A 5J2TB 3MQWA 3K0TA 1RA4A 3NVKE 2QI2A 1NMUB 1H7MA 3ZP4A 3PAFA 2H8CA 4HNAA 4ZHWA 5MN4A 3JARA 3JALA 3HKBB 1KC8H 5LYJB 2Z01A 1FFXB 2UYNB 3GTZA 3P0ZA 5HXZA 2GZLA 1X25A 2IAFA 1H47A 3OBYA 4I4TA 5LA6B 2W8BC 4LCKA 3EORA 2I6RA 4TV9B 2PHNA 4U3JA 4YJ3A 4ZI7A 3S06A 3C8LA 3CCQF 4G4XA 4IHJB 2AIZP 2LBTA 4TZZA 5GANK 5J2UA 4BVSA 5FNVB 2KG4A 4LNUA 2HS3A 5C8YA 3NK6A 3QHDA 3IEWA 4RQOA 3M4SA 3CXCF 2K1SA 1KD1H 4NQ3A 1FNJA 1T0KB 3C9RA 1SZQA 2HS0A 2UYKA 5KMGB 1ONIA 2CZWA 3G71F 3JATA 4YJ2A 2YYEA 1VQLF 1IV3A 4C8IA 1CN7A 5CA0A 4O2BA 1VQNF 2BTQB 1QD9A 3JAKB 5A2QM 3JCMM 1VQOF 5MN5A 1W41A 5JQGB 3K12A 1NQ3A 2QA4F 4C8GA 4X1IA 3WJQA 5EYPA 1VQPF 4B45A 3AGKA 2BO1A 1VH8A 5GONA 3RYHA 4NWOB 1PF5A 4TUYB 1W5EA 3OBWA 5GAPK 2Z1UA 2DT4A 3JASA 2LCAA 3N2KB 5LXTB 3CC7F 1GO0A 5HY0A 3WGMA 1W5BA 1K73H 3F0FA 4ZK7A 5EB0A 3J80M 3LWOC 3J7AR 3NMUC 1YJWF 3NVIB 2YXZA 3SIUA 2HX0A 5IJ9A 3RYFB 3IEQA 3GYQA 3VYUC 1YJ9F 4ZHQB 3HKEB 3QTYA 2OTJF 5IYZA 4F6RB 3JAWA 5LP6C 3F6MA 3GHZA 5KX5B 4M8IA 3B6NA 3CCVF 5LOVB 3VYSC 3CMEF 1UFYA 4X1KB 1COMA 3C9UA 4G4WA 1SA0B 5HWEA 3V4DA 3P4EA 1VQ9F 2ALEA 2UZHA 2AMTA 1TVKA 3CC4F 1YGYA 3S02A 4G4ZA 2HP0B 3G6EF 2CVLA 4C82A 4TV8A 1X7OA 1W5AA 4ZOLA 3D00A 1U43A 5ITZA 2H8EA 1X7PA 3CD6F 4B5CA 1M1KH 3VO8A 3VYTC 4DXDA 5B8FA 3ON1A 4BY9D 1PXWA 4O4IA 1RQ7A 3Q8HA 1JFFA 5GIPC 3G4SF 4I50A 2GLZA 1Z5VA 3CCUF 5BMVA 2R6R1 1XBIA 1TUBB 5G4VC 5CB4B 3N4ZA 1VK3A 5HY2A 2RHLA 3C9SA 3CYPB 2P6YA 1Q81H 4G4YA 5J2TA 3VTIC 5IJ0B 2Z1EA 3F0EA 2OTMA 3VOBA 3DDNA 3CPQA 2B33A 3CYQA 2BTUA 1SDSA 4DRXB 4BT7A 3HKBA 4G88A 1XV2A 5LYJA
chains in the Genus database with same CATH topology
1VQ5F 3WXMB 3CCSF 1VQNF 5A2QM 3E1YA 3JCMM 1VQMF 1VQ4F 1VQOF 3CCLF 1YIJF 5EWRA 1VQ8F 1W41A 2QA4F 3HJWC 2HVYD 5DCVA 1VQPF 4NUTA 3AGKA 2BO1A 4BVQA 2KTUA 1W40A 2AIFA 3OBWA 5GAPK 3CMAF 3LFOA 2FC3A 1W2BF 1YI2F 1Q86H 4EI9A 3CC2F 3V3TA 2OHWA 3CCJF 3HAXD 3CC7F 1W3EX 1M90H 5HY0A 1K73H 5FLXM 5EO3A 1KQSF 1E7KA 1GO0A 3J80M 3LWOC 3J7AR 3NMUC 1VQ6F 1YJWF 3CPWF 1NJIH 3NVIB 1ZWZA 3SIUA 3OW2F 3LWVC 3LWQC 1QVGF 5G4UC 3I55F 4X3LA 4BVTA 3I56F 5IT9M 3GYQA 3SIVA 1YJ9F 1GZ0A 2OTJF 2WALA 4X3MA 3LWPC 5HXUA 2F9ZC 2FGYA 4XCQA 3CCRF 3CCMF 3CCVF 3MCAB 3CMEF 3FFMA 5HY1A 5HWEA 1VQ9F 2ALEA 1Q7YH 2LBWA 3CC4F 1RA4A 3JAMM 3NVKE 2QI2A 1NMUB 1H7MA 3N4YA 3PAFA 3G6EF 4BW0B 3V7QA 2VGMA 1S72F 3LWRC 1VQKF 1X52A 5GIOC 3IR9A 1KC8H 1X7OA 1GO1A 1YHQF 3D00A 2QEXF 1X7PA 3CD6F 4BVRA 5HXZA 1YJNF 1M1KH 1RLGA 1VQ7F 3ON1A 2I6DA 4BY9D 1PXWA 1JJ2F 3OBYA 4C4WC 4LCKA 1K8AH 3CG6A 5HY4A 5GINC 2JNBA 3PLAC 5GIPC 1CK2A 3E20B 3G4SF 1DT9A 2OTLF 2VGNA 3CCQF 2GLZA 3CCUF 3NK7A 4TZZA 5GANK 1K9MH 4BVSA 1XBIA 2KG4A 1N8RH 5G4VC 5FJ4C 3N4ZA 3J81M 3NK6A 5HY2A 3RA6A 1Q81H 3CCEF 2LBXA 3VI6A 3CXCF 3V7EA 1QVFF 3VMFB 3O85A 1IPAA 1KD1H 4NQ3A 2OZBA 1T0KB 2KTVA 3CPQA 4EI8A 2CZWA 3G71F 1W42A 1SDSA 1YITF 1Q82H 1VQLF 3RA5A 4EI7A 1CN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVS A;  4BVQ A;  4BVR A;  5HY0 A;  5HXZ A;  5HXU A;  5HY1 A;  4NQ3 A;  5HY4 A;  5HY2 A;  5HWE A;  4BVT A; 
#chains in the Genus database with same CATH topology
 1IV4 A;  1W58 1;  3CCS F;  1FFX A;  2UYN A;  4X1Y B;  4U3J B;  3HWU A;  3MBM A;  5LA6 A;  3S03 A;  3IKE A;  2HVY D;  4TV9 A;  3N2G B;  4O2A B;  3ELC A;  1W40 A;  3WGN A;  2AIF A;  2IQQ A;  2CHS A;  3CMA F;  2G9I A;  4IHJ A;  3R0P A;  5JCO C;  5FNV A;  5LP6 B;  5AVM A;  3ZOP A;  3CC2 F;  3HAX D;  3CCJ F;  1W3E X;  1M90 H;  1E7K A;  5FLX M;  4IIJ B;  2CWJ A;  3K2X A;  1OAP A;  2UYJ A;  1NJI H;  3LWV C;  2HRU A;  5KMG A;  3LWQ C;  3F0G A;  4R40 B;  3I3F A;  4G4V A;  5IT9 M;  2HRY A;  4X20 B;  3OON A;  4I55 B;  3VOA A;  2F9Z C;  2FGY A;  4XCQ A;  3CCM F;  3JAK A;  4X1I B;  1DBF A;  3FFM A;  2BTO A;  3ZO8 A;  5JQG A;  3HKD B;  1Q7Y H;  2LBW A;  3JAM M;  1QAH A;  1Q8R A;  4EB6 B;  3V7Q A;  1VQK F;  4TUY A;  3LWR C;  1S72 F;  1X52 A;  3FPI A;  4O4L B;  3IR9 A;  1GO1 A;  1YHQ F;  4FFB B;  3IMP A;  3RYC B;  5CA1 B;  2QEX F;  3RYI B;  3FD5 A;  1YJN F;  3WGK A;  3N2K A;  5LXT A;  4WBN B;  1RLG A;  3BYQ A;  2I6D A;  3CB2 A;  1VHA A;  1JJ2 F;  4C4W C;  1K8A H;  5HY4 A;  5GIN C;  2ZOV A;  3PLA C;  3RYF A;  3JAW B;  1CK2 A;  3JVH A;  5JVD A;  2MQE A;  4ZHQ A;  3HKE A;  1XRG A;  3NK7 A;  4ERH A;  4F6R A;  3T80 A;  3LME A;  1W57 A;  2DYY A;  1N8R H;  1VQV A;  3QUW A;  5KX5 A;  3J81 M;  5LOV A;  3HKC B;  4X1K A;  3RA6 A;  3CCE F;  1SA0 A;  3FBA A;  2Z1F A;  3VI6 A;  4KWE A;  1W5F A;  3VMF B;  4C81 A;  1QVF F;  2ZOD A;  3O85 A;  3VIU A;  1IPA A;  3UT5 B;  5HP8 A;  2KTV A;  5EZY B;  4EI8 A;  1W42 A;  1Q82 H;  4O4J B;  3RA5 A;  5JH7 B;  1VQ5 F;  4O4H B;  4O4I B;  2ZVZ A;  3P10 A;  4U39 A;  3I7T A;  5EIB C;  1VQ4 F;  3E22 B;  1YIJ F;  3CCL F;  2ZF8 A;  2PMP A;  3D01 A;  1JD1 A;  1U3P A;  4E6E A;  1OFU A;  3HJW C;  3KHN A;  4NUT A;  1Z5W A;  4BVQ A;  5EAZ A;  4HNA B;  4PWT A;  3TD3 A;  2H6L A;  3JAR B;  3JAL B;  1JY8 A;  1RLU A;  3MDO A;  1W2B F;  2GVI A;  1YI2 F;  1TUB A;  4BT4 A;  5EIB D;  5CB4 A;  4B46 A;  3V3T A;  2VAP A;  5EO3 A;  2Q1Y A;  5MN6 A;  4I4T B;  5IJ0 A;  1H48 A;  1ODE A;  1U40 A;  2RHJ A;  2VAW A;  4YJ3 B;  5EB1 B;  2RHH A;  1J7H A;  4ZI7 B;  1FNK A;  4X3L A;  4C8E A;  3I56 F;  3M1X A;  4DRX A;  3SIV A;  3ERN A;  1GZ0 A;  2WAL A;  3LWP C;  2Q1X A;  4RHA A;  5J2U B;  2CHT A;  2IG8 A;  4LNU B;  3FD6 A;  5C8Y B;  4ZHV A;  4X1Y A;  2EWC A;  2VAM A;  3WPW A;  1KNJ A;  3N2G A;  3K14 A;  2L26 A;  4O2A A;  4BT3 A;  2UYP A;  3N4Y A;  3HTN A;  4BW0 B;  2VGM A;  3JAT B;  4YJ2 B;  5GIO C;  3D54 A;  4BT6 A;  2NMU A;  5CA0 B;  4O2B B;  3ESJ A;  4BT5 A;  5LP6 A;  4BVR A;  1FSZ A;  3WJP A;  2Z1T A;  3LDT A;  1KNK A;  1VQ7 F;  3WPX A;  2HQS C;  4IIJ A;  3U0O A;  4ZHY B;  3KJJ A;  1UI9 A;  5EYP B;  3CG6 A;  1XHO A;  3WJR A;  2JNB A;  5GON B;  3MCQ A;  3RYH B;  3E20 B;  3M84 A;  1DT9 A;  3IKF A;  2OTL F;  2VGN A;  2HS4 A;  4X20 A;  4I55 A;  3S0W A;  1K9M H;  2KGW A;  3JAS B;  5FJ4 C;  1IV2 A;  3DC2 A;  3ZP7 A;  2LBX A;  3V7E A;  5HP7 A;  2VXY A;  3HKD A;  2OZB A;  3KE1 A;  2V9Y A;  3TD5 A;  3VCZ A;  5IJ9 B;  3WGL A;  4EB6 A;  1CLI A;  2ZVY A;  1YIT F;  3LYB A;  4O4L A;  4BT2 A;  4EI7 A;  3KIZ A;  2RHO A;  2HP3 A;  1T0A A;  5IYZ B;  4FFB A;  1W55 A;  3RYC A;  3WXM B;  5CA1 A;  2ZAU A;  1R1M A;  3RYI A;  3E1Y A;  1VQM F;  1JN1 A;  4WBN A;  5EWR A;  1VQ8 F;  3WGJ A;  2N48 A;  5JVD B;  1TVK B;  5DCV A;  1GX1 A;  3TD4 A;  2KTU A;  1RQ2 A;  2R75 1;  4TV8 B;  3LFO A;  2FC3 A;  4ZOL B;  3S0H A;  2HP0 A;  2CW4 A;  1Q86 H;  5ITZ B;  4EI9 A;  2OHW A;  1U3L A;  3HKC A;  3L7Q A;  3S0Y A;  1YQN A;  1KQS F;  3C9T A;  3KJK A;  1VQ6 F;  3UT5 A;  3CPW F;  3F0D A;  1ZWZ A;  2CSL A;  1JFF B;  1W59 A;  3OW2 F;  1QVG F;  5EZY A;  5G4U C;  3I55 F;  4BVT A;  3RE3 A;  4I50 B;  4O4J A;  4X3M A;  5JH7 A;  5BMV B;  5HXU A;  4O4H A;  1IV1 A;  3CCR F;  5JCO A;  1QU9 A;  3MCA B;  2QTP A;  3E22 A;  4B62 A;  2RB9 A;  5HY1 A;  5J2T B;  3MQW A;  3K0T A;  1RA4 A;  3NVK E;  2QI2 A;  1NMU B;  1H7M A;  3ZP4 A;  3PAF A;  2H8C A;  4HNA A;  4ZHW A;  5MN4 A;  3JAR A;  3JAL A;  3HKB B;  1KC8 H;  5LYJ B;  2Z01 A;  1FFX B;  2UYN B;  3GTZ A;  3P0Z A;  5HXZ A;  2GZL A;  1X25 A;  2IAF A;  1H47 A;  3OBY A;  4I4T A;  5LA6 B;  2W8B C;  4LCK A;  3EOR A;  2I6R A;  4TV9 B;  2PHN A;  4U3J A;  4YJ3 A;  4ZI7 A;  3S06 A;  3C8L A;  3CCQ F;  4G4X A;  4IHJ B;  2AIZ P;  2LBT A;  4TZZ A;  5GAN K;  5J2U A;  4BVS A;  5FNV B;  2KG4 A;  4LNU A;  2HS3 A;  5C8Y A;  3NK6 A;  3QHD A;  3IEW A;  4RQO A;  3M4S A;  3CXC F;  2K1S A;  1KD1 H;  4NQ3 A;  1FNJ A;  1T0K B;  3C9R A;  1SZQ A;  2HS0 A;  2UYK A;  5KMG B;  1ONI A;  2CZW A;  3G71 F;  3JAT A;  4YJ2 A;  2YYE A;  1VQL F;  1IV3 A;  4C8I A;  1CN7 A;  5CA0 A;  4O2B A;  1VQN F;  2BTQ B;  1QD9 A;  3JAK B;  5A2Q M;  3JCM M;  1VQO F;  5MN5 A;  1W41 A;  5JQG B;  3K12 A;  1NQ3 A;  2QA4 F;  4C8G A;  4X1I A;  3WJQ A;  5EYP A;  1VQP F;  4B45 A;  3AGK A;  2BO1 A;  1VH8 A;  5GON A;  3RYH A;  4NWO B;  1PF5 A;  4TUY B;  1W5E A;  3OBW A;  5GAP K;  2Z1U A;  2DT4 A;  3JAS A;  2LCA A;  3N2K B;  5LXT B;  3CC7 F;  1GO0 A;  5HY0 A;  3WGM A;  1W5B A;  1K73 H;  3F0F A;  4ZK7 A;  5EB0 A;  3J80 M;  3LWO C;  3J7A R;  3NMU C;  1YJW F;  3NVI B;  2YXZ A;  3SIU A;  2HX0 A;  5IJ9 A;  3RYF B;  3IEQ A;  3GYQ A;  3VYU C;  1YJ9 F;  4ZHQ B;  3HKE B;  3QTY A;  2OTJ F;  5IYZ A;  4F6R B;  3JAW A;  5LP6 C;  3F6M A;  3GHZ A;  5KX5 B;  4M8I A;  3B6N A;  3CCV F;  5LOV B;  3VYS C;  3CME F;  1UFY A;  4X1K B;  1COM A;  3C9U A;  4G4W A;  1SA0 B;  5HWE A;  3V4D A;  3P4E A;  1VQ9 F;  2ALE A;  2UZH A;  2AMT A;  1TVK A;  3CC4 F;  1YGY A;  3S02 A;  4G4Z A;  2HP0 B;  3G6E F;  2CVL A;  4C82 A;  4TV8 A;  1X7O A;  1W5A A;  4ZOL A;  3D00 A;  1U43 A;  5ITZ A;  2H8E A;  1X7P A;  3CD6 F;  4B5C A;  1M1K H;  3VO8 A;  3VYT C;  4DXD A;  5B8F A;  3ON1 A;  4BY9 D;  1PXW A;  4O4I A;  1RQ7 A;  3Q8H A;  1JFF A;  5GIP C;  3G4S F;  4I50 A;  2GLZ A;  1Z5V A;  3CCU F;  5BMV A;  2R6R 1;  1XBI A;  1TUB B;  5G4V C;  5CB4 B;  3N4Z A;  1VK3 A;  5HY2 A;  2RHL A;  3C9S A;  3CYP B;  2P6Y A;  1Q81 H;  4G4Y A;  5J2T A;  3VTI C;  5IJ0 B;  2Z1E A;  3F0E A;  2OTM A;  3VOB A;  3DDN A;  3CPQ A;  2B33 A;  3CYQ A;  2BTU A;  1SDS A;  4DRX B;  4BT7 A;  3HKB A;  4G88 A;  1XV2 A;  5LYJ A; 
#chains in the Genus database with same CATH homology
 1VQ5 F;  3WXM B;  3CCS F;  1VQN F;  5A2Q M;  3E1Y A;  3JCM M;  1VQM F;  1VQ4 F;  1VQO F;  3CCL F;  1YIJ F;  5EWR A;  1VQ8 F;  1W41 A;  2QA4 F;  3HJW C;  2HVY D;  5DCV A;  1VQP F;  4NUT A;  3AGK A;  2BO1 A;  4BVQ A;  2KTU A;  1W40 A;  2AIF A;  3OBW A;  5GAP K;  3CMA F;  3LFO A;  2FC3 A;  1W2B F;  1YI2 F;  1Q86 H;  4EI9 A;  3CC2 F;  3V3T A;  2OHW A;  3CCJ F;  3HAX D;  3CC7 F;  1W3E X;  1M90 H;  5HY0 A;  1K73 H;  5FLX M;  5EO3 A;  1KQS F;  1E7K A;  1GO0 A;  3J80 M;  3LWO C;  3J7A R;  3NMU C;  1VQ6 F;  1YJW F;  3CPW F;  1NJI H;  3NVI B;  1ZWZ A;  3SIU A;  3OW2 F;  3LWV C;  3LWQ C;  1QVG F;  5G4U C;  3I55 F;  4X3L A;  4BVT A;  3I56 F;  5IT9 M;  3GYQ A;  3SIV A;  1YJ9 F;  1GZ0 A;  2OTJ F;  2WAL A;  4X3M A;  3LWP C;  5HXU A;  2F9Z C;  2FGY A;  4XCQ A;  3CCR F;  3CCM F;  3CCV F;  3MCA B;  3CME F;  3FFM A;  5HY1 A;  5HWE A;  1VQ9 F;  2ALE A;  1Q7Y H;  2LBW A;  3CC4 F;  1RA4 A;  3JAM M;  3NVK E;  2QI2 A;  1NMU B;  1H7M A;  3N4Y A;  3PAF A;  3G6E F;  4BW0 B;  3V7Q A;  2VGM A;  1S72 F;  3LWR C;  1VQK F;  1X52 A;  5GIO C;  3IR9 A;  1KC8 H;  1X7O A;  1GO1 A;  1YHQ F;  3D00 A;  2QEX F;  1X7P A;  3CD6 F;  4BVR A;  5HXZ A;  1YJN F;  1M1K H;  1RLG A;  1VQ7 F;  3ON1 A;  2I6D A;  4BY9 D;  1PXW A;  1JJ2 F;  3OBY A;  4C4W C;  4LCK A;  1K8A H;  3CG6 A;  5HY4 A;  5GIN C;  2JNB A;  3PLA C;  5GIP C;  1CK2 A;  3E20 B;  3G4S F;  1DT9 A;  2OTL F;  2VGN A;  3CCQ F;  2GLZ A;  3CCU F;  3NK7 A;  4TZZ A;  5GAN K;  1K9M H;  4BVS A;  1XBI A;  2KG4 A;  1N8R H;  5G4V C;  5FJ4 C;  3N4Z A;  3J81 M;  3NK6 A;  5HY2 A;  3RA6 A;  1Q81 H;  3CCE F;  2LBX A;  3VI6 A;  3CXC F;  3V7E A;  1QVF F;  3VMF B;  3O85 A;  1IPA A;  1KD1 H;  4NQ3 A;  2OZB A;  1T0K B;  2KTV A;  3CPQ A;  4EI8 A;  2CZW A;  3G71 F;  1W42 A;  1SDS A;  1YIT F;  1Q82 H;  1VQL F;  3RA5 A;  4EI7 A;  1CN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...