1VQPF

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqpF00
3LWRC 1YI2F 1K73H 2OHWA 3JAMM 3G71F 2WALA 2QA4F 1M90H 3CG6A 3CCLF 3O85A 4LCKA 1YITF 1KQSF 1VQ6F 2I6DA 3J80M 1VQOF 1VQMF 1W2BF 3LFOA 1QVFF 3LWOC 3SIUA 1YJNF 1DT9A 4X3LA 3CXCF 1YJ9F 1W42A 3HJWC 1W41A 2AIFA 1KD1H 3CPWF 3AGKA 3CC2F 3CPQA 3JCMM 2LBXA 3CCQF 5GIPC 1RLGA 1VQPF 3PLAC 3N4YA 2QI2A 3V7EA 2OTJF 3J81M 3N4ZA 1GO0A 1W40A 2VGNA 4BY9D 1SDSA 5FJ4C 3CCUF 3NMUC 2BO1A 1PXWA 1VQ7F 5G4VC 3CCVF 3CC4F 1NMUB 3OBYA 1E7KA 3SIVA 4X3MA 1RA4A 3OW2F 1JJ2F 1K9MH 3E20B 3WXMB 5GAPK 5IT9M 1M1KH 3CC7F 1W3EX 1Q81H 1Q86H 2ALEA 2VGMA 5GIOC 2FC3A 1Q7YH 1K8AH 3NVKE 3IR9A 4BW0B 3VMFB 5GINC 2HVYD 3MCAB 1YIJF 1VQLF 1X7OA 3I56F 3CD6F 3E1YA 1X7PA 3J7AR 1N8RH 3G4SF 3LWQC 1YJWF 3CCEF 1VQ8F 4TZZA 1VQNF 1VQ4F 1GO1A 3I55F 3CCRF 5FLXM 1CK2A 1VQ5F 3FFMA 4C4WC 2KTVA 3G6EF 3RA6A 1YHQF 3HAXD 2JNBA 3VI6A 2QEXF 4NUTA 5EWRA 1XBIA 5A2QM 3CCJF 1KC8H 3CMEF 2KG4A 2CZWA 2LBWA 3NK6A 1H7MA 3V7QA 5GANK 3LWPC 1Q82H 1QVGF 1NJIH 3RA5A 1T0KB 3PAFA 1GZ0A 3CCMF 5DCVA 1S72F 1CN7A 3NK7A 1X52A 3NVIB 1IPAA 5EO3A 2OTLF 3LWVC 3CCSF 3ON1A 1VQ9F 2KTUA 3CMAF 3OBWA 5G4UC 1ZWZA 3GYQA 1VQKF 2OZBA
chains in the Genus database with same CATH superfamily
3KJJA 2OHWA 4ZI7B 4O4LB 5CA0A 3JATB 4ERHA 2WALA 2QA4F 3CCLF 3VYTC 2I6DA 1W2BF 1VQOF 2ZODA 3LFOA 2OTMA 4YJ3B 4BVTA 3RYFB 1YJNF 3FD5A 1TVKA 2ZVZA 2QTPA 3CXCF 3OONA 2V9YA 3HJWC 1FNKA 5LOVB 3CC2F 5EZYA 2DT4A 1JFFB 4R40B 1W581 4U3JB 5C8YB 5HY1A 1RLGA 1VQPF 3N4YA 3V7EA 3J81M 5HP8A 4O4JB 1GO0A 3V4DA 2UYKA 2LCAA 2HQSC 3RYIA 5KX5A 2H6LA 3SIVA 5G4VC 3RYCB 3CCVF 1NMUB 4BT2A 3IMPA 4O4HA 3WGMA 2GZLA 3OW2F 5J2UB 1W5BA 1K9MH 2I6RA 1VQVA 4LNUB 3E20B 1CLIA 4IIJA 3UT5A 5J2TA 5MN5A 5LP6B 4BT5A 1XRGA 3U0OA 2AMTA 1Q86H 3KJKA 3JALA 5GIOC 5CA0B 2CHSA 5GINC 2R6R1 2HVYD 5CA1B 3LYBA 3N2KA 5FNVA 4TUYA 2H8EA 4B5CA 1X7OA 1PF5A 3CD6F 4U39A 1N8RH 5EAZA 4NQ3A 2UYPA 3S03A 1GO1A 3HKEA 3ZP7A 5MN4A 4YJ2A 2KTVA 2HP0A 4TV8A 3RA6A 2JNBA 3L7QA 2QEXF 3CCJF 1KNJA 1FFXB 2KG4A 3QHDA 1IV3A 2CZWA 4IHJA 5JCOA 5GANK 4O4IA 4TV9B 5KMGB 3S02A 3MCQA 3IKFA 4X1YA 3NVIB 4O4HB 2OTLF 3HWUA 1QD9A 2PMPA 2HS3A 5J2TB 4X1KA 2UYJA 4PWTA 2VAWA 3CMAF 4X1IB 2GVIA 3ZP4A 4DXDA 1SA0B 3OBWA 5HXUA 3R0PA 5LP6C 3K0TA 4FFBB 3CYPB 3HKDB 3N2KB 3P10A 3V3TA 1QU9A 4TUYB 5HP7A 2ZOVA 2L26A 4I50B 5LYJA 5B8FA 5HY2A 1YITF 1VQMF 3LWOC 3SIUA 3C9SA 1OAPA 2HP0B 2H8CA 1W5EA 1YJ9F 5GONA 3CPWF 3CPQA 3RYHB 2HX0A 4O4IB 4X20A 3PLAC 3ERNA 3N2GA 3I3FA 4X1YB 4BY9D 1JD1A 1SDSA 1UFYA 3CCUF 3VTIC 3JASA 3NMUC 2BO1A 2UZHA 1PXWA 2CW4A 1KNKA 3OBYA 3C9RA 4X1KB 4X3MA 4E6EA 4C8GA 3ESJA 3JAWA 2HS0A 4I55B 2N48A 1DBFA 4KWEA 4I4TA 2Z1UA 1U3PA 4ZHVA 1M1KH 3JAKA 2ALEA 2Q1XA 2VGMA 3WGNA 1Q7YH 5ITZB 1K8AH 3NVKE 4BW0B 3D54A 3VMFB 5IYZB 1W55A 2UYNA 1YIJF 4HNAB 1SZQA 3F0EA 3TD5A 3I56F 3G4SF 3LWQC 4C82A 4TZZA 4RHAA 5JVDA 1VQNF 5GONB 4BT6A 5JQGB 3IEWA 3CCRF 4G4XA 4G4VA 4C4WC 5JH7B 3FD6A 5BMVB 4EB6A 5LXTA 3S0YA 4X20B 3WPXA 5CB4A 5EWRA 1TUBA 1XBIA 3K12A 2Z1FA 1KC8H 1RLUA 5JCOC 1ODEA 2HRUA 3N2GB 3V7QA 3LWPC 1QVGF 3C8LA 1NJIH 2ZF8A 1FNJA 1T0KB 3PAFA 1U40A 3E22A 4ZOLA 3JASB 3NK7A 3F6MA 2Z1TA 3HKCA 5HY0A 2GLZA 5EO3A 3VYSC 3CCSF 1TVKB 3KIZA 3MBMA 3MDOA 3ON1A 1NQ3A 1VQ9F 3LDTA 1X25A 4G4ZA 5EZYB 3KHNA 3I7TA 5IJ9A 2VAMA 2OZBA 2YXZA 4M8IA 3LWRC 1K73H 1XV2A 4EI7A 4BVSA 2RHHA 1M90H 3RYIB 3S0WA 2BTUA 2RHJA 3ZO8A 5KX5B 4LCKA 1VHAA 1KQSF 3S06A 3VIUA 3FPIA 3GTZA 3F0GA 4BT7A 3IEQA 1R1MA 3BYQA 3K14A 1W42A 3DDNA 4IIJB 2AIFA 3UT5B 3T80A 5EB1B 5EB0A 1W5FA 4WBNA 2F9ZC 2HRYA 2LBXA 3HKBA 3JALB 2QI2A 5LA6A 2OTJF 2RHLA 3KE1A 3S0HA 2ZAUA 3E22B 4BVQA 4ZOLB 3EORA 2BTQB 5FNVB 3N4ZA 4ZI7A 4O4LA 1W40A 1XHOA 2VGNA 4C8IA 3HKCB 3JATA 3C9TA 5HWEA 1W5AA 3CC4F 1E7KA 1Z5WA 2DYYA 3DC2A 3Q8HA 4O2AA 4YJ3A 3VCZA 4BT3A 3HKEB 3QTYA 1RA4A 1JN1A 1QAHA 4YJ2B 4TV8B 5IJ9B 2G9IA 5GAPK 5LOVA 5IT9M 1H47A 1RQ2A 3HTNA 3WGKA 5HXZA 4BT4A 1Q81H 4IHJB 4U3JA 4EI9A 5C8YA 2CVLA 3QUWA 2VXYA 1W57A 2IQQA 5MN6A 3M4SA 3E1YA 1VQ8F 1IV1A 3LMEA 3RYCA 4B46A 2FGYA 4ZHQA 2EWCA 2KGWA 1VQ4F 3I55F 3TD3A 5FLXM 1YGYA 3B6NA 4C8EA 4NWOB 3HAXD 3VI6A 1H48A 5A2QM 5LP6A 3CMEF 4F6RA 1H7MA 3JARA 1Q82H 1ONIA 3RA5A 5EYPA 1GZ0A 5DCVA 5CA1A 1S72F 3GHZA 5LYJB 1W59A 1CN7A 1X52A 3WJPA 3M84A 4O2AB 3C9UA 3VYUC 3LWVC 3P4EA 3D01A 4B62A 2PHNA 3FBAA 2R751 1JY8A 2HP3A 1T0AA 3VOAA 3IKEA 2KTUA 4BVRA 2RHOA 2Z1EA 4DRXA 1Q8RA 4ZHYB 4XCQA 3GYQA 1VQKF 1YQNA 1FFXA 1YI2F 2IAFA 3VOBA 4TV9A 2MQEA 3JAMM 3G71F 5HY4A 1COMA 5KMGA 3CG6A 3O85A 2B33A 1VQ6F 4O2BA 3J80M 3WGLA 1VK3A 4ZHQB 5EIBC 1QVFF 3JAWB 1DT9A 4X3LA 3TD4A 2ZVYA 1W41A 4I4TB 1KD1H 3AGKA 4X1IA 2IG8A 3JCMM 3JAKB 3WJQA 1SA0A 3CCQF 4F6RB 3JARB 5GIPC 1IV4A 1OFUA 5EYPB 2NMUA 3F0DA 1FSZA 3RE3A 4EI8A 2BTOA 4FFBA 2UYNB 1Z5VA 3HKDA 3CYQA 3MQWA 2CHTA 5FJ4C 1UI9A 4I50A 1VQ7F 5JVDB 3M1XA 1JJ2F 3VO8A 3F0FA 4EB6B 5LXTB 3WXMB 4C81A 4DRXB 2RB9A 5CB4B 1TUBB 1GX1A 5IJ0A 3RYHA 2CWJA 3CC7F 4RQOA 1W3EX 2Q1YA 2FC3A 3IR9A 3MCAB 3WGJA 1VQLF 4O2BB 2W8BC 1X7PA 3P0ZA 3J7AR 1YJWF 3CCEF 3RYFA 2VAPA 3CB2A 1CK2A 4I55A 3FFMA 3WJRA 1VQ5F 4G4WA 2Z01A 3ELCA 3G6EF 4G88A 1YHQF 4NUTA 3ZOPA 1JFFA 3NK6A 2LBWA 3JVHA 5ITZA 2CSLA 4G4YA 4B45A 2P6YA 3K2XA 5IYZA 3CCMF 1RQ7A 4HNAA 4O4JA 1U43A 4ZHWA 1IPAA 4ZK7A 3D00A 2HS4A 1IV2A 5AVMA 5JQGA 1J7HA 4WBNB 5IJ0B 5J2UA 1VH8A 1U3LA 3HKBB 2LBTA 4LNUA 5BMVA 5JH7A 3WPWA 2YYEA 2AIZP 2K1SA 5LA6B 5G4UC 1ZWZA 5EIBD
chains in the Genus database with same CATH topology
3LWRC 1YI2F 3V3TA 1K73H 4EI7A 2OHWA 4BVSA 3JAMM 3G71F 2WALA 5HY4A 2QA4F 1M90H 3CG6A 3CCLF 3O85A 4LCKA 5HY2A 1YITF 1KQSF 2I6DA 3J80M 1VQOF 1VQMF 1W2BF 1VQ6F 3LFOA 1QVFF 4BVTA 3LWOC 3SIUA 1YJNF 1DT9A 4X3LA 3CXCF 1YJ9F 1W42A 3HJWC 1W41A 2AIFA 1KD1H 3CPWF 3AGKA 3CC2F 3CPQA 3JCMM 2F9ZC 2LBXA 3CCQF 5GIPC 5HY1A 1RLGA 1VQPF 3PLAC 3N4YA 2QI2A 3V7EA 2OTJF 4EI8A 3J81M 4BVQA 3N4ZA 1GO0A 1W40A 2VGNA 4BY9D 1SDSA 5FJ4C 3CCUF 5HWEA 3NMUC 2BO1A 1PXWA 1VQ7F 5G4VC 3CCVF 3CC4F 1NMUB 3OBYA 1E7KA 3SIVA 4X3MA 1RA4A 3OW2F 1JJ2F 1K9MH 3E20B 3WXMB 5GAPK 5IT9M 5HXZA 1M1KH 3CC7F 1W3EX 1Q81H 1Q86H 4EI9A 2ALEA 2VGMA 5GIOC 2FC3A 1Q7YH 1K8AH 3NVKE 3IR9A 4BW0B 3VMFB 5GINC 2HVYD 3MCAB 1YIJF 1VQLF 1X7OA 3I56F 3CD6F 3E1YA 1X7PA 3J7AR 1N8RH 3G4SF 3LWQC 1YJWF 3CCEF 1VQ8F 4TZZA 4NQ3A 1VQNF 2FGYA 1VQ4F 1GO1A 3I55F 3CCRF 5FLXM 1CK2A 1VQ5F 3FFMA 4C4WC 2KTVA 3G6EF 3RA6A 1YHQF 3HAXD 2JNBA 3VI6A 2QEXF 4NUTA 5EWRA 1XBIA 5A2QM 3CCJF 1KC8H 3CMEF 2KG4A 2CZWA 2LBWA 3NK6A 1H7MA 3V7QA 5GANK 3LWPC 1Q82H 1QVGF 1NJIH 3RA5A 1T0KB 3PAFA 1GZ0A 3CCMF 5DCVA 1S72F 1CN7A 3NK7A 1X52A 3NVIB 5HY0A 2GLZA 1IPAA 5EO3A 2OTLF 3LWVC 3D00A 3CCSF 3ON1A 1VQ9F 2KTUA 4BVRA 3CMAF 3OBWA 5HXUA 5G4UC 4XCQA 1ZWZA 3GYQA 1VQKF 2OZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWR C;  1YI2 F;  1K73 H;  2OHW A;  3JAM M;  3G71 F;  2WAL A;  2QA4 F;  1M90 H;  3CG6 A;  3CCL F;  3O85 A;  4LCK A;  1YIT F;  1KQS F;  1VQ6 F;  2I6D A;  3J80 M;  1VQO F;  1VQM F;  1W2B F;  3LFO A;  1QVF F;  3LWO C;  3SIU A;  1YJN F;  1DT9 A;  4X3L A;  3CXC F;  1YJ9 F;  1W42 A;  3HJW C;  1W41 A;  2AIF A;  1KD1 H;  3CPW F;  3AGK A;  3CC2 F;  3CPQ A;  3JCM M;  2LBX A;  3CCQ F;  5GIP C;  1RLG A;  1VQP F;  3PLA C;  3N4Y A;  2QI2 A;  3V7E A;  2OTJ F;  3J81 M;  3N4Z A;  1GO0 A;  1W40 A;  2VGN A;  4BY9 D;  1SDS A;  5FJ4 C;  3CCU F;  3NMU C;  2BO1 A;  1PXW A;  1VQ7 F;  5G4V C;  3CCV F;  3CC4 F;  1NMU B;  3OBY A;  1E7K A;  3SIV A;  4X3M A;  1RA4 A;  3OW2 F;  1JJ2 F;  1K9M H;  3E20 B;  3WXM B;  5GAP K;  5IT9 M;  1M1K H;  3CC7 F;  1W3E X;  1Q81 H;  1Q86 H;  2ALE A;  2VGM A;  5GIO C;  2FC3 A;  1Q7Y H;  1K8A H;  3NVK E;  3IR9 A;  4BW0 B;  3VMF B;  5GIN C;  2HVY D;  3MCA B;  1YIJ F;  1VQL F;  1X7O A;  3I56 F;  3CD6 F;  3E1Y A;  1X7P A;  3J7A R;  1N8R H;  3G4S F;  3LWQ C;  1YJW F;  3CCE F;  1VQ8 F;  4TZZ A;  1VQN F;  1VQ4 F;  1GO1 A;  3I55 F;  3CCR F;  5FLX M;  1CK2 A;  1VQ5 F;  3FFM A;  4C4W C;  2KTV A;  3G6E F;  3RA6 A;  1YHQ F;  3HAX D;  2JNB A;  3VI6 A;  2QEX F;  4NUT A;  5EWR A;  1XBI A;  5A2Q M;  3CCJ F;  1KC8 H;  3CME F;  2KG4 A;  2CZW A;  2LBW A;  3NK6 A;  1H7M A;  3V7Q A;  5GAN K;  3LWP C;  1Q82 H;  1QVG F;  1NJI H;  3RA5 A;  1T0K B;  3PAF A;  1GZ0 A;  3CCM F;  5DCV A;  1S72 F;  1CN7 A;  3NK7 A;  1X52 A;  3NVI B;  1IPA A;  5EO3 A;  2OTL F;  3LWV C;  3CCS F;  3ON1 A;  1VQ9 F;  2KTU A;  3CMA F;  3OBW A;  5G4U C;  1ZWZ A;  3GYQ A;  1VQK F;  2OZB A; 
#chains in the Genus database with same CATH topology
 3KJJ A;  2OHW A;  4ZI7 B;  4O4L B;  5CA0 A;  3JAT B;  4ERH A;  2WAL A;  2QA4 F;  3CCL F;  3VYT C;  2I6D A;  1W2B F;  1VQO F;  2ZOD A;  3LFO A;  2OTM A;  4YJ3 B;  4BVT A;  3RYF B;  1YJN F;  3FD5 A;  1TVK A;  2ZVZ A;  2QTP A;  3CXC F;  3OON A;  2V9Y A;  3HJW C;  1FNK A;  5LOV B;  3CC2 F;  5EZY A;  2DT4 A;  1JFF B;  4R40 B;  1W58 1;  4U3J B;  5C8Y B;  5HY1 A;  1RLG A;  1VQP F;  3N4Y A;  3V7E A;  3J81 M;  5HP8 A;  4O4J B;  1GO0 A;  3V4D A;  2UYK A;  2LCA A;  2HQS C;  3RYI A;  5KX5 A;  2H6L A;  3SIV A;  5G4V C;  3RYC B;  3CCV F;  1NMU B;  4BT2 A;  3IMP A;  4O4H A;  3WGM A;  2GZL A;  3OW2 F;  5J2U B;  1W5B A;  1K9M H;  2I6R A;  1VQV A;  4LNU B;  3E20 B;  1CLI A;  4IIJ A;  3UT5 A;  5J2T A;  5MN5 A;  5LP6 B;  4BT5 A;  1XRG A;  3U0O A;  2AMT A;  1Q86 H;  3KJK A;  3JAL A;  5GIO C;  5CA0 B;  2CHS A;  5GIN C;  2R6R 1;  2HVY D;  5CA1 B;  3LYB A;  3N2K A;  5FNV A;  4TUY A;  2H8E A;  4B5C A;  1X7O A;  1PF5 A;  3CD6 F;  4U39 A;  1N8R H;  5EAZ A;  4NQ3 A;  2UYP A;  3S03 A;  1GO1 A;  3HKE A;  3ZP7 A;  5MN4 A;  4YJ2 A;  2KTV A;  2HP0 A;  4TV8 A;  3RA6 A;  2JNB A;  3L7Q A;  2QEX F;  3CCJ F;  1KNJ A;  1FFX B;  2KG4 A;  3QHD A;  1IV3 A;  2CZW A;  4IHJ A;  5JCO A;  5GAN K;  4O4I A;  4TV9 B;  5KMG B;  3S02 A;  3MCQ A;  3IKF A;  4X1Y A;  3NVI B;  4O4H B;  2OTL F;  3HWU A;  1QD9 A;  2PMP A;  2HS3 A;  5J2T B;  4X1K A;  2UYJ A;  4PWT A;  2VAW A;  3CMA F;  4X1I B;  2GVI A;  3ZP4 A;  4DXD A;  1SA0 B;  3OBW A;  5HXU A;  3R0P A;  5LP6 C;  3K0T A;  4FFB B;  3CYP B;  3HKD B;  3N2K B;  3P10 A;  3V3T A;  1QU9 A;  4TUY B;  5HP7 A;  2ZOV A;  2L26 A;  4I50 B;  5LYJ A;  5B8F A;  5HY2 A;  1YIT F;  1VQM F;  3LWO C;  3SIU A;  3C9S A;  1OAP A;  2HP0 B;  2H8C A;  1W5E A;  1YJ9 F;  5GON A;  3CPW F;  3CPQ A;  3RYH B;  2HX0 A;  4O4I B;  4X20 A;  3PLA C;  3ERN A;  3N2G A;  3I3F A;  4X1Y B;  4BY9 D;  1JD1 A;  1SDS A;  1UFY A;  3CCU F;  3VTI C;  3JAS A;  3NMU C;  2BO1 A;  2UZH A;  1PXW A;  2CW4 A;  1KNK A;  3OBY A;  3C9R A;  4X1K B;  4X3M A;  4E6E A;  4C8G A;  3ESJ A;  3JAW A;  2HS0 A;  4I55 B;  2N48 A;  1DBF A;  4KWE A;  4I4T A;  2Z1U A;  1U3P A;  4ZHV A;  1M1K H;  3JAK A;  2ALE A;  2Q1X A;  2VGM A;  3WGN A;  1Q7Y H;  5ITZ B;  1K8A H;  3NVK E;  4BW0 B;  3D54 A;  3VMF B;  5IYZ B;  1W55 A;  2UYN A;  1YIJ F;  4HNA B;  1SZQ A;  3F0E A;  3TD5 A;  3I56 F;  3G4S F;  3LWQ C;  4C82 A;  4TZZ A;  4RHA A;  5JVD A;  1VQN F;  5GON B;  4BT6 A;  5JQG B;  3IEW A;  3CCR F;  4G4X A;  4G4V A;  4C4W C;  5JH7 B;  3FD6 A;  5BMV B;  4EB6 A;  5LXT A;  3S0Y A;  4X20 B;  3WPX A;  5CB4 A;  5EWR A;  1TUB A;  1XBI A;  3K12 A;  2Z1F A;  1KC8 H;  1RLU A;  5JCO C;  1ODE A;  2HRU A;  3N2G B;  3V7Q A;  3LWP C;  1QVG F;  3C8L A;  1NJI H;  2ZF8 A;  1FNJ A;  1T0K B;  3PAF A;  1U40 A;  3E22 A;  4ZOL A;  3JAS B;  3NK7 A;  3F6M A;  2Z1T A;  3HKC A;  5HY0 A;  2GLZ A;  5EO3 A;  3VYS C;  3CCS F;  1TVK B;  3KIZ A;  3MBM A;  3MDO A;  3ON1 A;  1NQ3 A;  1VQ9 F;  3LDT A;  1X25 A;  4G4Z A;  5EZY B;  3KHN A;  3I7T A;  5IJ9 A;  2VAM A;  2OZB A;  2YXZ A;  4M8I A;  3LWR C;  1K73 H;  1XV2 A;  4EI7 A;  4BVS A;  2RHH A;  1M90 H;  3RYI B;  3S0W A;  2BTU A;  2RHJ A;  3ZO8 A;  5KX5 B;  4LCK A;  1VHA A;  1KQS F;  3S06 A;  3VIU A;  3FPI A;  3GTZ A;  3F0G A;  4BT7 A;  3IEQ A;  1R1M A;  3BYQ A;  3K14 A;  1W42 A;  3DDN A;  4IIJ B;  2AIF A;  3UT5 B;  3T80 A;  5EB1 B;  5EB0 A;  1W5F A;  4WBN A;  2F9Z C;  2HRY A;  2LBX A;  3HKB A;  3JAL B;  2QI2 A;  5LA6 A;  2OTJ F;  2RHL A;  3KE1 A;  3S0H A;  2ZAU A;  3E22 B;  4BVQ A;  4ZOL B;  3EOR A;  2BTQ B;  5FNV B;  3N4Z A;  4ZI7 A;  4O4L A;  1W40 A;  1XHO A;  2VGN A;  4C8I A;  3HKC B;  3JAT A;  3C9T A;  5HWE A;  1W5A A;  3CC4 F;  1E7K A;  1Z5W A;  2DYY A;  3DC2 A;  3Q8H A;  4O2A A;  4YJ3 A;  3VCZ A;  4BT3 A;  3HKE B;  3QTY A;  1RA4 A;  1JN1 A;  1QAH A;  4YJ2 B;  4TV8 B;  5IJ9 B;  2G9I A;  5GAP K;  5LOV A;  5IT9 M;  1H47 A;  1RQ2 A;  3HTN A;  3WGK A;  5HXZ A;  4BT4 A;  1Q81 H;  4IHJ B;  4U3J A;  4EI9 A;  5C8Y A;  2CVL A;  3QUW A;  2VXY A;  1W57 A;  2IQQ A;  5MN6 A;  3M4S A;  3E1Y A;  1VQ8 F;  1IV1 A;  3LME A;  3RYC A;  4B46 A;  2FGY A;  4ZHQ A;  2EWC A;  2KGW A;  1VQ4 F;  3I55 F;  3TD3 A;  5FLX M;  1YGY A;  3B6N A;  4C8E A;  4NWO B;  3HAX D;  3VI6 A;  1H48 A;  5A2Q M;  5LP6 A;  3CME F;  4F6R A;  1H7M A;  3JAR A;  1Q82 H;  1ONI A;  3RA5 A;  5EYP A;  1GZ0 A;  5DCV A;  5CA1 A;  1S72 F;  3GHZ A;  5LYJ B;  1W59 A;  1CN7 A;  1X52 A;  3WJP A;  3M84 A;  4O2A B;  3C9U A;  3VYU C;  3LWV C;  3P4E A;  3D01 A;  4B62 A;  2PHN A;  3FBA A;  2R75 1;  1JY8 A;  2HP3 A;  1T0A A;  3VOA A;  3IKE A;  2KTU A;  4BVR A;  2RHO A;  2Z1E A;  4DRX A;  1Q8R A;  4ZHY B;  4XCQ A;  3GYQ A;  1VQK F;  1YQN A;  1FFX A;  1YI2 F;  2IAF A;  3VOB A;  4TV9 A;  2MQE A;  3JAM M;  3G71 F;  5HY4 A;  1COM A;  5KMG A;  3CG6 A;  3O85 A;  2B33 A;  1VQ6 F;  4O2B A;  3J80 M;  3WGL A;  1VK3 A;  4ZHQ B;  5EIB C;  1QVF F;  3JAW B;  1DT9 A;  4X3L A;  3TD4 A;  2ZVY A;  1W41 A;  4I4T B;  1KD1 H;  3AGK A;  4X1I A;  2IG8 A;  3JCM M;  3JAK B;  3WJQ A;  1SA0 A;  3CCQ F;  4F6R B;  3JAR B;  5GIP C;  1IV4 A;  1OFU A;  5EYP B;  2NMU A;  3F0D A;  1FSZ A;  3RE3 A;  4EI8 A;  2BTO A;  4FFB A;  2UYN B;  1Z5V A;  3HKD A;  3CYQ A;  3MQW A;  2CHT A;  5FJ4 C;  1UI9 A;  4I50 A;  1VQ7 F;  5JVD B;  3M1X A;  1JJ2 F;  3VO8 A;  3F0F A;  4EB6 B;  5LXT B;  3WXM B;  4C81 A;  4DRX B;  2RB9 A;  5CB4 B;  1TUB B;  1GX1 A;  5IJ0 A;  3RYH A;  2CWJ A;  3CC7 F;  4RQO A;  1W3E X;  2Q1Y A;  2FC3 A;  3IR9 A;  3MCA B;  3WGJ A;  1VQL F;  4O2B B;  2W8B C;  1X7P A;  3P0Z A;  3J7A R;  1YJW F;  3CCE F;  3RYF A;  2VAP A;  3CB2 A;  1CK2 A;  4I55 A;  3FFM A;  3WJR A;  1VQ5 F;  4G4W A;  2Z01 A;  3ELC A;  3G6E F;  4G88 A;  1YHQ F;  4NUT A;  3ZOP A;  1JFF A;  3NK6 A;  2LBW A;  3JVH A;  5ITZ A;  2CSL A;  4G4Y A;  4B45 A;  2P6Y A;  3K2X A;  5IYZ A;  3CCM F;  1RQ7 A;  4HNA A;  4O4J A;  1U43 A;  4ZHW A;  1IPA A;  4ZK7 A;  3D00 A;  2HS4 A;  1IV2 A;  5AVM A;  5JQG A;  1J7H A;  4WBN B;  5IJ0 B;  5J2U A;  1VH8 A;  1U3L A;  3HKB B;  2LBT A;  4LNU A;  5BMV A;  5JH7 A;  3WPW A;  2YYE A;  2AIZ P;  2K1S A;  5LA6 B;  5G4U C;  1ZWZ A;  5EIB D; 
#chains in the Genus database with same CATH homology
 3LWR C;  1YI2 F;  3V3T A;  1K73 H;  4EI7 A;  2OHW A;  4BVS A;  3JAM M;  3G71 F;  2WAL A;  5HY4 A;  2QA4 F;  1M90 H;  3CG6 A;  3CCL F;  3O85 A;  4LCK A;  5HY2 A;  1YIT F;  1KQS F;  2I6D A;  3J80 M;  1VQO F;  1VQM F;  1W2B F;  1VQ6 F;  3LFO A;  1QVF F;  4BVT A;  3LWO C;  3SIU A;  1YJN F;  1DT9 A;  4X3L A;  3CXC F;  1YJ9 F;  1W42 A;  3HJW C;  1W41 A;  2AIF A;  1KD1 H;  3CPW F;  3AGK A;  3CC2 F;  3CPQ A;  3JCM M;  2F9Z C;  2LBX A;  3CCQ F;  5GIP C;  5HY1 A;  1RLG A;  1VQP F;  3PLA C;  3N4Y A;  2QI2 A;  3V7E A;  2OTJ F;  4EI8 A;  3J81 M;  4BVQ A;  3N4Z A;  1GO0 A;  1W40 A;  2VGN A;  4BY9 D;  1SDS A;  5FJ4 C;  3CCU F;  5HWE A;  3NMU C;  2BO1 A;  1PXW A;  1VQ7 F;  5G4V C;  3CCV F;  3CC4 F;  1NMU B;  3OBY A;  1E7K A;  3SIV A;  4X3M A;  1RA4 A;  3OW2 F;  1JJ2 F;  1K9M H;  3E20 B;  3WXM B;  5GAP K;  5IT9 M;  5HXZ A;  1M1K H;  3CC7 F;  1W3E X;  1Q81 H;  1Q86 H;  4EI9 A;  2ALE A;  2VGM A;  5GIO C;  2FC3 A;  1Q7Y H;  1K8A H;  3NVK E;  3IR9 A;  4BW0 B;  3VMF B;  5GIN C;  2HVY D;  3MCA B;  1YIJ F;  1VQL F;  1X7O A;  3I56 F;  3CD6 F;  3E1Y A;  1X7P A;  3J7A R;  1N8R H;  3G4S F;  3LWQ C;  1YJW F;  3CCE F;  1VQ8 F;  4TZZ A;  4NQ3 A;  1VQN F;  2FGY A;  1VQ4 F;  1GO1 A;  3I55 F;  3CCR F;  5FLX M;  1CK2 A;  1VQ5 F;  3FFM A;  4C4W C;  2KTV A;  3G6E F;  3RA6 A;  1YHQ F;  3HAX D;  2JNB A;  3VI6 A;  2QEX F;  4NUT A;  5EWR A;  1XBI A;  5A2Q M;  3CCJ F;  1KC8 H;  3CME F;  2KG4 A;  2CZW A;  2LBW A;  3NK6 A;  1H7M A;  3V7Q A;  5GAN K;  3LWP C;  1Q82 H;  1QVG F;  1NJI H;  3RA5 A;  1T0K B;  3PAF A;  1GZ0 A;  3CCM F;  5DCV A;  1S72 F;  1CN7 A;  3NK7 A;  1X52 A;  3NVI B;  5HY0 A;  2GLZ A;  1IPA A;  5EO3 A;  2OTL F;  3LWV C;  3D00 A;  3CCS F;  3ON1 A;  1VQ9 F;  2KTU A;  4BVR A;  3CMA F;  3OBW A;  5HXU A;  5G4U C;  4XCQ A;  1ZWZ A;  3GYQ A;  1VQK F;  2OZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...