1VQPF

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqpF00
3CPQA 1H7MA 3MCAB 3G4SF 1YJWF 3LFOA 2WALA 1VQ7F 3OBWA 5DCVA 3E20B 3CMEF 1K73H 1ZWZA 2VGMA 3PAFA 3IR9A 3JAMM 4X3MA 1YJNF 3NVKE 2AIFA 3HJWC 3NK6A 3J7AR 1VQLF 1RA4A 1KD1H 3WXMB 3CCUF 1Q82H 3V7EA 1M90H 3N4YA 1GZ0A 2VGNA 1VQNF 3VI6A 3CCLF 3G6EF 1W41A 1Q86H 4C4WC 2CZWA 1X7PA 1GO0A 3GYQA 3JCMM 3CC4F 5GIOC 2QA4F 5GANK 5IT9M 1VQPF 3LWRC 2OTLF 2JNBA 3ON1A 1VQ4F 3CC7F 5FLXM 3LWPC 1XBIA 2QI2A 1VQKF 5GAPK 1GO1A 3CCQF 1X7OA 3HAXD 3NVIB 3FFMA 1E7KA 3CCJF 1CN7A 3LWQC 2I6DA 3J80M 3LWVC 3CD6F 3VMFB 3LWOC 1Q7YH 2KTUA 1VQ5F 1T0KB 1IPAA 3N4ZA 1VQ9F 1VQ6F 3NK7A 1VQMF 2ALEA 3G71F 2HVYD 2OTJF 1M1KH 1KQSF 1Q81H 5GIPC 2OZBA 3SIUA 5EWRA 2QEXF 4X3LA 3CXCF 1YIJF 1X52A 3RA6A 1VQ8F 1NJIH 3CMAF 3SIVA 5G4VC 1W3EX 3AGKA 3CCMF 3PLAC 1VQOF 4BW0B 1YHQF 5FJ4C 1W2BF 3I56F 5GINC 1RLGA 1KC8H 3J81M 2BO1A 5G4UC 4TZZA 1S72F 5EO3A 1PXWA 4LCKA 2LBWA 1QVGF 3V7QA 1NMUB 3O85A 3CC2F 2OHWA 2FC3A 3CCSF 3CPWF 1DT9A 3CCRF 1QVFF 1N8RH 5A2QM 3CG6A 3CCEF 3CCVF 4NUTA 1SDSA 3NMUC 1CK2A 1W42A 1YITF 1JJ2F 1YI2F 4BY9D 2KTVA 3I55F 1YJ9F 3OW2F 3OBYA 3E1YA 2KG4A 2LBXA 3RA5A 1W40A 1K8AH 1K9MH
chains in the Genus database with same CATH superfamily
3K14A 5HY1A 4NQ3A 1YJWF 3LFOA 2WALA 4XCQA 1VQ7F 3OBWA 1QD9A 2HS0A 5KX5B 3HKDA 2P6YA 4X1KA 1K73H 2GVIA 4C8IA 1JFFB 3RYIA 4X3MA 1X25A 2DYYA 5LYJB 3JASA 4RQOA 1RA4A 2HX0A 2HQSC 3WPWA 1KD1H 2RHJA 4TUYA 2I6RA 1FNJA 2AMTA 3N4YA 5BMVA 2VGNA 3TD3A 3CCLF 1JN1A 5FNVA 3C9RA 2PHNA 3UT5B 3S02A 5GIOC 2UYJA 4YJ2B 5GANK 4KWEA 4O4IB 3Q8HA 2Z1UA 5JH7A 2OTLF 3JAKB 4WBNB 4BVSA 2OTMA 3WJPA 3D00A 3P0ZA 4O4HA 5FLXM 2Z1FA 4G4WA 1K9MH 2QI2A 3R0PA 5LP6A 3N2KA 3CCQF 3NVIB 2BTUA 5J2UA 3FFMA 1CN7A 4IIJA 3RE3A 3K12A 5IJ0A 2ALEA 4ZHWA 3CB2A 2IQQA 5IJ9B 2ZF8A 2V9YA 1XV2A 5EWRA 5EB0A 1X52A 1Z5WA 3RA6A 2GLZA 4C81A 5G4VC 3AGKA 3WGLA 3CCMF 4ZOLA 3IMPA 1YHQF 5FJ4C 3VOAA 1RQ2A 3RYFB 1YQNA 1QAHA 1UI9A 3F0EA 3J81M 3S0HA 3KE1A 3I7TA 5MN6A 4G4YA 3N2GB 4O2AB 4O2BB 3VYSC 1NQ3A 1COMA 5HXUA 4LCKA 1KNJA 1NMUB 4O4JA 3M84A 2OHWA 3ZP7A 2VAWA 4FFBB 1FFXB 3D01A 5MN4A 2H8EA 1W581 5J2UB 3ERNA 4EB6B 1W57A 4NUTA 3ZOPA 5B8FA 4X1KB 1JD1A 5CA1A 1TVKA 1CK2A 1YITF 3WGKA 1W5EA 4NWOB 5EIBD 3OBYA 1U3LA 4X20B 3N2KB 3JAWB 2IG8A 3FD5A 3NMUC 4ZI7A 1H7MA 3MCAB 4EI7A 3G4SF 2RHLA 3E22A 2Z01A 1VH8A 3FBAA 1TUBA 1U40A 3FPIA 2VGMA 3PAFA 3U0OA 3WJRA 3KJKA 4O4IA 3JAMM 1YJNF 3TD5A 2AIFA 2ZVZA 5JQGA 3WXMB 1Q82H 3V7EA 4BVRA 3HKCB 5LA6B 1GZ0A 3VCZA 1XRGA 2CW4A 2IAFA 1W59A 3E22B 5HY0A 3HKBA 5KX5A 2FGYA 3JVHA 2CZWA 4ZHQB 3GYQA 1JFFA 4I55B 3JCMM 3CC4F 4G4VA 4X1IA 2HRUA 5AVMA 1VK3A 1XHOA 3ON1A 3HKCA 4TV9B 2HP0B 1VQKF 3VYTC 4ZK7A 5GAPK 1GO1A 3HAXD 4HNAB 2HRYA 1E7KA 3CCJF 2QTPA 4TV8A 4ZI7B 2I6DA 3JARA 3J80M 2G9IA 3LWQC 2K1SA 3LYBA 2KTUA 1T0KB 4O4LB 1IPAA 3N4ZA 4I4TB 4ZHYB 2B33A 2UYNB 3NK7A 5EZYB 5HY4A 1VQMF 2H6LA 2HVYD 2OTJF 4TV9A 4G4XA 5GIPC 3WPXA 2HS4A 3C9UA 5LP6B 1YIJF 5LOVA 5LA6A 1RLUA 4R40B 1RQ7A 5EYPB 4B62A 3F0FA 3IKFA 1JY8A 4C8GA 1OAPA 3PLAC 1H48A 1QU9A 2W8BC 4G4ZA 2Z1EA 4U39A 5C8YB 4EI8A 1FSZA 1RLGA 5IJ9A 1KC8H 2LCAA 5G4UC 2KGWA 1S72F 1PXWA 1QVGF 1H47A 3JAWA 3O85A 3IKEA 2HP0A 3CPWF 3M4SA 2HS3A 4IHJB 3P4EA 3MQWA 4M8IA 4X1YA 3RYHB 3HKEA 5HXZA 1W42A 1JJ2F 3ELCA 3L7QA 4LNUA 3KIZA 3OONA 2LBTA 3OW2F 3E1YA 4DXDA 4YJ3A 4F6RB 2PMPA 3K2XA 4IIJB 3JARB 5FNVB 1U43A 3RYCA 5DCVA 4O4LA 3E20B 2CHSA 5IJ0B 1R1MA 3FD6A 3IR9A 2EWCA 2CSLA 5KMGB 3C9SA 3NVKE 5GONB 3NK6A 1VQLF 1M90H 2MQEA 2L26A 3V3TA 5LXTA 3G6EF 3JALA 4U3JA 1GO0A 2YXZA 4IHJA 2QA4F 5IT9M 4RHAA 1VQPF 4I4TA 3GTZA 3LWRC 5GONA 5CA1B 4I50B 2RHOA 5HWEA 2VAMA 3HWUA 3KJJA 3LWPC 1XBIA 3IEWA 3S0YA 5JVDA 3TD4A 3ZO8A 4YJ3B 3V4DA 3WGNA 3LWVC 3C9TA 4BVTA 3LWOC 1Q7YH 3HKEB 1VQ5F 4G88A 1VQ9F 1VQ6F 2DT4A 3HKDB 4LNUB 2ZVYA 5J2TB 3RYFA 2AIZP 3QTYA 5KMGA 1Q81H 4X20A 2OZBA 2QEXF 1ONIA 4X3LA 5JCOA 3RYCB 1NJIH 2ZOVA 5EB1B 4BT4A 2UYNA 5EZYA 4ERHA 1VQOF 3F0GA 4C8EA 2CVLA 5GINC 3CYPB 2Z1TA 3HTNA 3IEQA 2N48A 2UYPA 1ODEA 4C82A 3VO8A 4TZZA 1IV1A 5EO3A 4B5CA 2CHTA 3T80A 2LBWA 4EI9A 3V7QA 3WJQA 3ESJA 5ITZA 3CC2F 2FC3A 3S0WA 4ZHQA 3CCSF 2UZHA 2GZLA 2BTOA 3CCRF 3QUWA 4X1IB 1N8RH 3F6MA 3S06A 3CCEF 1T0AA 3VOBA 3BYQA 3CCVF 2VXYA 3GHZA 3S03A 4I50A 3MDOA 4BY9D 2KTVA 1J7HA 3I55F 1IV2A 5CA0A 4BT7A 4O2AA 2KG4A 2LBXA 4TUYB 3RA5A 3MBMA 3JATB 4DRXB 1YGYA 1FFXA 2BTQB 3CPQA 4FFBA 1SA0B 4BT6A 3B6NA 5JCOC 1IV3A 1FNKA 3CMEF 5EYPA 2RHHA 1ZWZA 1UFYA 2ZAUA 2HP3A 3HJWC 2Q1XA 3P10A 3J7AR 3F0DA 3CCUF 1Q8RA 2ZODA 3DC2A 5IYZA 4O4HB 1VQNF 5CB4A 3VI6A 5JVDB 1OFUA 1W41A 1Q86H 2VAPA 1KNKA 4C4WC 1X7PA 4TV8B 2R6R1 3LMEA 2R751 3D54A 3WGMA 4EB6A 1SZQA 4BVQA 2RB9A 2JNBA 3RYHA 3N2GA 1VQ4F 4E6EA 3CC7F 3KHNA 5MN5A 5CB4B 1W5AA 1X7OA 3JALB 5LOVB 3I3FA 4I55A 2F9ZC 3CD6F 4X1YB 4YJ2A 4ZHVA 3VMFB 3M1XA 3LDTA 1TVKB 1U3PA 4B45A 4ZOLB 2H8CA 3G71F 5HP7A 4WBNA 5CA0B 1M1KH 1W5BA 1KQSF 3SIUA 3CYQA 3VIUA 4F6RA 3JATA 4DRXA 5JQGB 3CXCF 3VYUC 1SA0A 4O2BA 4HNAA 1VQ8F 5BMVB 4O4JB 3CMAF 1TUBB 2CWJA 3SIVA 1GX1A 1Z5VA 1PF5A 1W3EX 3RYIB 4BW0B 4U3JB 5J2TA 3I56F 1W2BF 5IYZB 1DBFA 2BO1A 1CLIA 5JH7B 3C8LA 3JAKA 3WGJA 2NMUA 4BT2A 5LXTB 5HY2A 3HKBB 3UT5A 2YYEA 1VQVA 1DT9A 3DDNA 1W55A 1QVFF 4B46A 5A2QM 2UYKA 3CG6A 5EIBC 1IV4A 5C8YA 1W5FA 2Q1YA 4BT3A 1SDSA 3K0TA 3VTIC 1YI2F 5HP8A 5LYJA 3JASB 4BT5A 1VHAA 1YJ9F 5EAZA 5LP6C 5ITZB 3MCQA 3QHDA 3EORA 3ZP4A 1W40A 1K8AH 4PWTA
chains in the Genus database with same CATH topology
3CPQA 1H7MA 3MCAB 4NQ3A 4EI7A 5HY1A 3LFOA 2WALA 4XCQA 3G4SF 1YJWF 3OBWA 1VQ7F 5DCVA 3E20B 3CMEF 1K73H 1ZWZA 2VGMA 3PAFA 3IR9A 3JAMM 4X3MA 1YJNF 3NVKE 2AIFA 3HJWC 3NK6A 3J7AR 1VQLF 1RA4A 1KD1H 3WXMB 3CCUF 1Q82H 3V7EA 4BVRA 1M90H 3N4YA 1GZ0A 3V3TA 2VGNA 1VQNF 3VI6A 3CCLF 3G6EF 1W41A 1Q86H 5HY0A 2FGYA 4C4WC 2CZWA 1X7PA 1GO0A 3GYQA 3JCMM 3CC4F 5GIOC 2QA4F 5GANK 5IT9M 4BVQA 1VQPF 3LWRC 2OTLF 2JNBA 5HWEA 4BVSA 3ON1A 1VQ4F 3CC7F 3D00A 5FLXM 3LWPC 1XBIA 2QI2A 1VQKF 5GAPK 1GO1A 3CCQF 1X7OA 3HAXD 3NVIB 3FFMA 1E7KA 3CCJF 1CN7A 2F9ZC 3LWQC 2I6DA 3J80M 3LWVC 3CD6F 3VMFB 4BVTA 3LWOC 1Q7YH 2KTUA 1VQ5F 1T0KB 1IPAA 3N4ZA 1VQ9F 1VQ6F 3NK7A 5HY4A 1VQMF 2ALEA 3G71F 2HVYD 2OTJF 1M1KH 1KQSF 1Q81H 5GIPC 2OZBA 3SIUA 5EWRA 2QEXF 4X3LA 3CXCF 1YIJF 1X52A 3RA6A 1VQ8F 1NJIH 2GLZA 3CMAF 3SIVA 5G4VC 1W3EX 3AGKA 3CCMF 3PLAC 1VQOF 4BW0B 1YHQF 5FJ4C 1W2BF 3I56F 4EI8A 5GINC 1RLGA 1KC8H 3J81M 2BO1A 5G4UC 4TZZA 1S72F 5EO3A 1PXWA 4EI9A 5HXUA 2LBWA 1QVGF 4LCKA 5HY2A 3V7QA 1NMUB 3O85A 3CC2F 2OHWA 2FC3A 3CCSF 3CPWF 1DT9A 3CCRF 1QVFF 1N8RH 5A2QM 3CG6A 3CCEF 3CCVF 4NUTA 1SDSA 3NMUC 5HXZA 1CK2A 1W42A 1YITF 1JJ2F 1YI2F 4BY9D 2KTVA 3I55F 1YJ9F 3OW2F 3OBYA 3E1YA 2KG4A 2LBXA 3RA5A 1W40A 1K8AH 1K9MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPQ A;  1H7M A;  3MCA B;  3G4S F;  1YJW F;  3LFO A;  2WAL A;  1VQ7 F;  3OBW A;  5DCV A;  3E20 B;  3CME F;  1K73 H;  1ZWZ A;  2VGM A;  3PAF A;  3IR9 A;  3JAM M;  4X3M A;  1YJN F;  3NVK E;  2AIF A;  3HJW C;  3NK6 A;  3J7A R;  1VQL F;  1RA4 A;  1KD1 H;  3WXM B;  3CCU F;  1Q82 H;  3V7E A;  1M90 H;  3N4Y A;  1GZ0 A;  2VGN A;  1VQN F;  3VI6 A;  3CCL F;  3G6E F;  1W41 A;  1Q86 H;  4C4W C;  2CZW A;  1X7P A;  1GO0 A;  3GYQ A;  3JCM M;  3CC4 F;  5GIO C;  2QA4 F;  5GAN K;  5IT9 M;  1VQP F;  3LWR C;  2OTL F;  2JNB A;  3ON1 A;  1VQ4 F;  3CC7 F;  5FLX M;  3LWP C;  1XBI A;  2QI2 A;  1VQK F;  5GAP K;  1GO1 A;  3CCQ F;  1X7O A;  3HAX D;  3NVI B;  3FFM A;  1E7K A;  3CCJ F;  1CN7 A;  3LWQ C;  2I6D A;  3J80 M;  3LWV C;  3CD6 F;  3VMF B;  3LWO C;  1Q7Y H;  2KTU A;  1VQ5 F;  1T0K B;  1IPA A;  3N4Z A;  1VQ9 F;  1VQ6 F;  3NK7 A;  1VQM F;  2ALE A;  3G71 F;  2HVY D;  2OTJ F;  1M1K H;  1KQS F;  1Q81 H;  5GIP C;  2OZB A;  3SIU A;  5EWR A;  2QEX F;  4X3L A;  3CXC F;  1YIJ F;  1X52 A;  3RA6 A;  1VQ8 F;  1NJI H;  3CMA F;  3SIV A;  5G4V C;  1W3E X;  3AGK A;  3CCM F;  3PLA C;  1VQO F;  4BW0 B;  1YHQ F;  5FJ4 C;  1W2B F;  3I56 F;  5GIN C;  1RLG A;  1KC8 H;  3J81 M;  2BO1 A;  5G4U C;  4TZZ A;  1S72 F;  5EO3 A;  1PXW A;  4LCK A;  2LBW A;  1QVG F;  3V7Q A;  1NMU B;  3O85 A;  3CC2 F;  2OHW A;  2FC3 A;  3CCS F;  3CPW F;  1DT9 A;  3CCR F;  1QVF F;  1N8R H;  5A2Q M;  3CG6 A;  3CCE F;  3CCV F;  4NUT A;  1SDS A;  3NMU C;  1CK2 A;  1W42 A;  1YIT F;  1JJ2 F;  1YI2 F;  4BY9 D;  2KTV A;  3I55 F;  1YJ9 F;  3OW2 F;  3OBY A;  3E1Y A;  2KG4 A;  2LBX A;  3RA5 A;  1W40 A;  1K8A H;  1K9M H; 
#chains in the Genus database with same CATH topology
 3K14 A;  5HY1 A;  4NQ3 A;  1YJW F;  3LFO A;  2WAL A;  4XCQ A;  1VQ7 F;  3OBW A;  1QD9 A;  2HS0 A;  5KX5 B;  3HKD A;  2P6Y A;  4X1K A;  1K73 H;  2GVI A;  4C8I A;  1JFF B;  3RYI A;  4X3M A;  1X25 A;  2DYY A;  5LYJ B;  3JAS A;  4RQO A;  1RA4 A;  2HX0 A;  2HQS C;  3WPW A;  1KD1 H;  2RHJ A;  4TUY A;  2I6R A;  1FNJ A;  2AMT A;  3N4Y A;  5BMV A;  2VGN A;  3TD3 A;  3CCL F;  1JN1 A;  5FNV A;  3C9R A;  2PHN A;  3UT5 B;  3S02 A;  5GIO C;  2UYJ A;  4YJ2 B;  5GAN K;  4KWE A;  4O4I B;  3Q8H A;  2Z1U A;  5JH7 A;  2OTL F;  3JAK B;  4WBN B;  4BVS A;  2OTM A;  3WJP A;  3D00 A;  3P0Z A;  4O4H A;  5FLX M;  2Z1F A;  4G4W A;  1K9M H;  2QI2 A;  3R0P A;  5LP6 A;  3N2K A;  3CCQ F;  3NVI B;  2BTU A;  5J2U A;  3FFM A;  1CN7 A;  4IIJ A;  3RE3 A;  3K12 A;  5IJ0 A;  2ALE A;  4ZHW A;  3CB2 A;  2IQQ A;  5IJ9 B;  2ZF8 A;  2V9Y A;  1XV2 A;  5EWR A;  5EB0 A;  1X52 A;  1Z5W A;  3RA6 A;  2GLZ A;  4C81 A;  5G4V C;  3AGK A;  3WGL A;  3CCM F;  4ZOL A;  3IMP A;  1YHQ F;  5FJ4 C;  3VOA A;  1RQ2 A;  3RYF B;  1YQN A;  1QAH A;  1UI9 A;  3F0E A;  3J81 M;  3S0H A;  3KE1 A;  3I7T A;  5MN6 A;  4G4Y A;  3N2G B;  4O2A B;  4O2B B;  3VYS C;  1NQ3 A;  1COM A;  5HXU A;  4LCK A;  1KNJ A;  1NMU B;  4O4J A;  3M84 A;  2OHW A;  3ZP7 A;  2VAW A;  4FFB B;  1FFX B;  3D01 A;  5MN4 A;  2H8E A;  1W58 1;  5J2U B;  3ERN A;  4EB6 B;  1W57 A;  4NUT A;  3ZOP A;  5B8F A;  4X1K B;  1JD1 A;  5CA1 A;  1TVK A;  1CK2 A;  1YIT F;  3WGK A;  1W5E A;  4NWO B;  5EIB D;  3OBY A;  1U3L A;  4X20 B;  3N2K B;  3JAW B;  2IG8 A;  3FD5 A;  3NMU C;  4ZI7 A;  1H7M A;  3MCA B;  4EI7 A;  3G4S F;  2RHL A;  3E22 A;  2Z01 A;  1VH8 A;  3FBA A;  1TUB A;  1U40 A;  3FPI A;  2VGM A;  3PAF A;  3U0O A;  3WJR A;  3KJK A;  4O4I A;  3JAM M;  1YJN F;  3TD5 A;  2AIF A;  2ZVZ A;  5JQG A;  3WXM B;  1Q82 H;  3V7E A;  4BVR A;  3HKC B;  5LA6 B;  1GZ0 A;  3VCZ A;  1XRG A;  2CW4 A;  2IAF A;  1W59 A;  3E22 B;  5HY0 A;  3HKB A;  5KX5 A;  2FGY A;  3JVH A;  2CZW A;  4ZHQ B;  3GYQ A;  1JFF A;  4I55 B;  3JCM M;  3CC4 F;  4G4V A;  4X1I A;  2HRU A;  5AVM A;  1VK3 A;  1XHO A;  3ON1 A;  3HKC A;  4TV9 B;  2HP0 B;  1VQK F;  3VYT C;  4ZK7 A;  5GAP K;  1GO1 A;  3HAX D;  4HNA B;  2HRY A;  1E7K A;  3CCJ F;  2QTP A;  4TV8 A;  4ZI7 B;  2I6D A;  3JAR A;  3J80 M;  2G9I A;  3LWQ C;  2K1S A;  3LYB A;  2KTU A;  1T0K B;  4O4L B;  1IPA A;  3N4Z A;  4I4T B;  4ZHY B;  2B33 A;  2UYN B;  3NK7 A;  5EZY B;  5HY4 A;  1VQM F;  2H6L A;  2HVY D;  2OTJ F;  4TV9 A;  4G4X A;  5GIP C;  3WPX A;  2HS4 A;  3C9U A;  5LP6 B;  1YIJ F;  5LOV A;  5LA6 A;  1RLU A;  4R40 B;  1RQ7 A;  5EYP B;  4B62 A;  3F0F A;  3IKF A;  1JY8 A;  4C8G A;  1OAP A;  3PLA C;  1H48 A;  1QU9 A;  2W8B C;  4G4Z A;  2Z1E A;  4U39 A;  5C8Y B;  4EI8 A;  1FSZ A;  1RLG A;  5IJ9 A;  1KC8 H;  2LCA A;  5G4U C;  2KGW A;  1S72 F;  1PXW A;  1QVG F;  1H47 A;  3JAW A;  3O85 A;  3IKE A;  2HP0 A;  3CPW F;  3M4S A;  2HS3 A;  4IHJ B;  3P4E A;  3MQW A;  4M8I A;  4X1Y A;  3RYH B;  3HKE A;  5HXZ A;  1W42 A;  1JJ2 F;  3ELC A;  3L7Q A;  4LNU A;  3KIZ A;  3OON A;  2LBT A;  3OW2 F;  3E1Y A;  4DXD A;  4YJ3 A;  4F6R B;  2PMP A;  3K2X A;  4IIJ B;  3JAR B;  5FNV B;  1U43 A;  3RYC A;  5DCV A;  4O4L A;  3E20 B;  2CHS A;  5IJ0 B;  1R1M A;  3FD6 A;  3IR9 A;  2EWC A;  2CSL A;  5KMG B;  3C9S A;  3NVK E;  5GON B;  3NK6 A;  1VQL F;  1M90 H;  2MQE A;  2L26 A;  3V3T A;  5LXT A;  3G6E F;  3JAL A;  4U3J A;  1GO0 A;  2YXZ A;  4IHJ A;  2QA4 F;  5IT9 M;  4RHA A;  1VQP F;  4I4T A;  3GTZ A;  3LWR C;  5GON A;  5CA1 B;  4I50 B;  2RHO A;  5HWE A;  2VAM A;  3HWU A;  3KJJ A;  3LWP C;  1XBI A;  3IEW A;  3S0Y A;  5JVD A;  3TD4 A;  3ZO8 A;  4YJ3 B;  3V4D A;  3WGN A;  3LWV C;  3C9T A;  4BVT A;  3LWO C;  1Q7Y H;  3HKE B;  1VQ5 F;  4G88 A;  1VQ9 F;  1VQ6 F;  2DT4 A;  3HKD B;  4LNU B;  2ZVY A;  5J2T B;  3RYF A;  2AIZ P;  3QTY A;  5KMG A;  1Q81 H;  4X20 A;  2OZB A;  2QEX F;  1ONI A;  4X3L A;  5JCO A;  3RYC B;  1NJI H;  2ZOV A;  5EB1 B;  4BT4 A;  2UYN A;  5EZY A;  4ERH A;  1VQO F;  3F0G A;  4C8E A;  2CVL A;  5GIN C;  3CYP B;  2Z1T A;  3HTN A;  3IEQ A;  2N48 A;  2UYP A;  1ODE A;  4C82 A;  3VO8 A;  4TZZ A;  1IV1 A;  5EO3 A;  4B5C A;  2CHT A;  3T80 A;  2LBW A;  4EI9 A;  3V7Q A;  3WJQ A;  3ESJ A;  5ITZ A;  3CC2 F;  2FC3 A;  3S0W A;  4ZHQ A;  3CCS F;  2UZH A;  2GZL A;  2BTO A;  3CCR F;  3QUW A;  4X1I B;  1N8R H;  3F6M A;  3S06 A;  3CCE F;  1T0A A;  3VOB A;  3BYQ A;  3CCV F;  2VXY A;  3GHZ A;  3S03 A;  4I50 A;  3MDO A;  4BY9 D;  2KTV A;  1J7H A;  3I55 F;  1IV2 A;  5CA0 A;  4BT7 A;  4O2A A;  2KG4 A;  2LBX A;  4TUY B;  3RA5 A;  3MBM A;  3JAT B;  4DRX B;  1YGY A;  1FFX A;  2BTQ B;  3CPQ A;  4FFB A;  1SA0 B;  4BT6 A;  3B6N A;  5JCO C;  1IV3 A;  1FNK A;  3CME F;  5EYP A;  2RHH A;  1ZWZ A;  1UFY A;  2ZAU A;  2HP3 A;  3HJW C;  2Q1X A;  3P10 A;  3J7A R;  3F0D A;  3CCU F;  1Q8R A;  2ZOD A;  3DC2 A;  5IYZ A;  4O4H B;  1VQN F;  5CB4 A;  3VI6 A;  5JVD B;  1OFU A;  1W41 A;  1Q86 H;  2VAP A;  1KNK A;  4C4W C;  1X7P A;  4TV8 B;  2R6R 1;  3LME A;  2R75 1;  3D54 A;  3WGM A;  4EB6 A;  1SZQ A;  4BVQ A;  2RB9 A;  2JNB A;  3RYH A;  3N2G A;  1VQ4 F;  4E6E A;  3CC7 F;  3KHN A;  5MN5 A;  5CB4 B;  1W5A A;  1X7O A;  3JAL B;  5LOV B;  3I3F A;  4I55 A;  2F9Z C;  3CD6 F;  4X1Y B;  4YJ2 A;  4ZHV A;  3VMF B;  3M1X A;  3LDT A;  1TVK B;  1U3P A;  4B45 A;  4ZOL B;  2H8C A;  3G71 F;  5HP7 A;  4WBN A;  5CA0 B;  1M1K H;  1W5B A;  1KQS F;  3SIU A;  3CYQ A;  3VIU A;  4F6R A;  3JAT A;  4DRX A;  5JQG B;  3CXC F;  3VYU C;  1SA0 A;  4O2B A;  4HNA A;  1VQ8 F;  5BMV B;  4O4J B;  3CMA F;  1TUB B;  2CWJ A;  3SIV A;  1GX1 A;  1Z5V A;  1PF5 A;  1W3E X;  3RYI B;  4BW0 B;  4U3J B;  5J2T A;  3I56 F;  1W2B F;  5IYZ B;  1DBF A;  2BO1 A;  1CLI A;  5JH7 B;  3C8L A;  3JAK A;  3WGJ A;  2NMU A;  4BT2 A;  5LXT B;  5HY2 A;  3HKB B;  3UT5 A;  2YYE A;  1VQV A;  1DT9 A;  3DDN A;  1W55 A;  1QVF F;  4B46 A;  5A2Q M;  2UYK A;  3CG6 A;  5EIB C;  1IV4 A;  5C8Y A;  1W5F A;  2Q1Y A;  4BT3 A;  1SDS A;  3K0T A;  3VTI C;  1YI2 F;  5HP8 A;  5LYJ A;  3JAS B;  4BT5 A;  1VHA A;  1YJ9 F;  5EAZ A;  5LP6 C;  5ITZ B;  3MCQ A;  3QHD A;  3EOR A;  3ZP4 A;  1W40 A;  1K8A H;  4PWT A; 
#chains in the Genus database with same CATH homology
 3CPQ A;  1H7M A;  3MCA B;  4NQ3 A;  4EI7 A;  5HY1 A;  3LFO A;  2WAL A;  4XCQ A;  3G4S F;  1YJW F;  3OBW A;  1VQ7 F;  5DCV A;  3E20 B;  3CME F;  1K73 H;  1ZWZ A;  2VGM A;  3PAF A;  3IR9 A;  3JAM M;  4X3M A;  1YJN F;  3NVK E;  2AIF A;  3HJW C;  3NK6 A;  3J7A R;  1VQL F;  1RA4 A;  1KD1 H;  3WXM B;  3CCU F;  1Q82 H;  3V7E A;  4BVR A;  1M90 H;  3N4Y A;  1GZ0 A;  3V3T A;  2VGN A;  1VQN F;  3VI6 A;  3CCL F;  3G6E F;  1W41 A;  1Q86 H;  5HY0 A;  2FGY A;  4C4W C;  2CZW A;  1X7P A;  1GO0 A;  3GYQ A;  3JCM M;  3CC4 F;  5GIO C;  2QA4 F;  5GAN K;  5IT9 M;  4BVQ A;  1VQP F;  3LWR C;  2OTL F;  2JNB A;  5HWE A;  4BVS A;  3ON1 A;  1VQ4 F;  3CC7 F;  3D00 A;  5FLX M;  3LWP C;  1XBI A;  2QI2 A;  1VQK F;  5GAP K;  1GO1 A;  3CCQ F;  1X7O A;  3HAX D;  3NVI B;  3FFM A;  1E7K A;  3CCJ F;  1CN7 A;  2F9Z C;  3LWQ C;  2I6D A;  3J80 M;  3LWV C;  3CD6 F;  3VMF B;  4BVT A;  3LWO C;  1Q7Y H;  2KTU A;  1VQ5 F;  1T0K B;  1IPA A;  3N4Z A;  1VQ9 F;  1VQ6 F;  3NK7 A;  5HY4 A;  1VQM F;  2ALE A;  3G71 F;  2HVY D;  2OTJ F;  1M1K H;  1KQS F;  1Q81 H;  5GIP C;  2OZB A;  3SIU A;  5EWR A;  2QEX F;  4X3L A;  3CXC F;  1YIJ F;  1X52 A;  3RA6 A;  1VQ8 F;  1NJI H;  2GLZ A;  3CMA F;  3SIV A;  5G4V C;  1W3E X;  3AGK A;  3CCM F;  3PLA C;  1VQO F;  4BW0 B;  1YHQ F;  5FJ4 C;  1W2B F;  3I56 F;  4EI8 A;  5GIN C;  1RLG A;  1KC8 H;  3J81 M;  2BO1 A;  5G4U C;  4TZZ A;  1S72 F;  5EO3 A;  1PXW A;  4EI9 A;  5HXU A;  2LBW A;  1QVG F;  4LCK A;  5HY2 A;  3V7Q A;  1NMU B;  3O85 A;  3CC2 F;  2OHW A;  2FC3 A;  3CCS F;  3CPW F;  1DT9 A;  3CCR F;  1QVF F;  1N8R H;  5A2Q M;  3CG6 A;  3CCE F;  3CCV F;  4NUT A;  1SDS A;  3NMU C;  5HXZ A;  1CK2 A;  1W42 A;  1YIT F;  1JJ2 F;  1YI2 F;  4BY9 D;  2KTV A;  3I55 F;  1YJ9 F;  3OW2 F;  3OBY A;  3E1Y A;  2KG4 A;  2LBX A;  3RA5 A;  1W40 A;  1K8A H;  1K9M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...