1VQPF

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqpF00
3GYQA 5EO3A 1QVFF 2KTUA 3OW2F 3NK7A 1N8RH 3RA6A 4C4WC 3V7QA 1PXWA 3CCQF 3NVKE 3E20B 3NK6A 2KTVA 3I56F 3G6EF 1K8AH 1W41A 3MCAB 3AGKA 3N4YA 1YHQF 1Q86H 1K9MH 3WXMB 1VQ8F 1CN7A 1VQNF 5GIOC 2VGNA 1Q7YH 2QEXF 1QVGF 1YJNF 1S72F 3PLAC 1KD1H 5GAPK 2I6DA 3O85A 1YJWF 3CCMF 1W40A 1Q81H 1NJIH 1YITF 3LWRC 1VQ4F 5IT9M 1VQ7F 3OBWA 1T0KB 3CPWF 3N4ZA 1K73H 1VQ9F 3SIUA 1GO0A 1KQSF 4X3MA 1M90H 1YJ9F 3CPQA 1YIJF 2LBXA 3CC7F 2AIFA 5FJ4C 3LWQC 3J81M 1VQOF 3IR9A 1IPAA 1VQPF 2OTJF 3LFOA 3CCRF 5GANK 1GZ0A 3I55F 1KC8H 3JCMM 1VQMF 5G4UC 1VQ6F 3CCVF 1GO1A 2ALEA 3LWOC 1JJ2F 1ZWZA 4BW0B 5EWRA 3CC4F 3CMEF 4LCKA 3FFMA 3SIVA 3OBYA 5GINC 2FC3A 3CMAF 3CCUF 3NMUC 3HJWC 1E7KA 3LWPC 3CG6A 3HAXD 2WALA 1W3EX 3G71F 3CCJF 3CC2F 3CD6F 3ON1A 2KG4A 1H7MA 2QI2A 4X3LA 3VMFB 1NMUB 1YI2F 4TZZA 2CZWA 1X52A 3G4SF 2OZBA 1CK2A 3J80M 1VQ5F 4BY9D 2HVYD 2BO1A 1RLGA 2OHWA 3CCEF 1XBIA 1W2BF 5DCVA 1VQLF 2QA4F 1DT9A 4NUTA 1VQKF 1X7PA 2JNBA 3CXCF 2LBWA 3J7AR 3E1YA 1Q82H 3CCSF 3LWVC 3JAMM 5A2QM 1X7OA 3CCLF 2OTLF 1SDSA 1M1KH 1W42A 5G4VC 5GIPC 2VGMA 3RA5A 3PAFA 1RA4A 3V7EA 3VI6A 5FLXM 3NVIB
chains in the Genus database with same CATH superfamily
3L7QA 1YQNA 4ERHA 3JALA 4ZI7B 4XCQA 2RHLA 3E22B 3OW2F 2RB9A 2CSLA 3NK7A 2NMUA 4TV9A 1GX1A 3S02A 3C9UA 4IIJA 2AIZP 3FPIA 4F6RA 5LOVA 3CCQF 3NVKE 3E20B 2LBTA 5KX5B 2PHNA 3S0WA 4BT6A 4O4LB 4BVQA 3G6EF 1W41A 3MCAB 1YHQF 2ZAUA 3P0ZA 3N2GA 1W59A 2G9IA 3QUWA 3WXMB 2BTUA 2CW4A 1VQNF 4C8GA 3D54A 5ITZA 2VGNA 4YJ3B 1Q7YH 1FFXB 3DDNA 1S72F 2AMTA 4NWOB 3N2KA 1KD1H 4I55A 3PLAC 1W40A 5FNVB 3LWRC 1T0KB 2Z1TA 3M4SA 4R40B 5IJ9A 4B62A 1VQ9F 2ZODA 4U3JB 3D00A 2RHJA 1M90H 2YYEA 3CPQA 2HS3A 1Z5VA 3S03A 3HKDB 1J7HA 2AIFA 4BT5A 4O2AA 4U39A 5IYZA 1RQ2A 2HX0A 3F0EA 4ZHWA 3JASA 4G4WA 5J2UA 5GANK 3EORA 1TUBA 3BYQA 3MCQA 1W57A 3CB2A 5G4UC 2MQEA 4DXDA 3CCVF 1JJ2F 3QHDA 3SIVA 3OBYA 4DRXB 3V4DA 2BTOA 1TVKB 5MN6A 3NMUC 4BVSA 1XRGA 3HJWC 3G71F 3VCZA 3VOBA 2BTQB 1U3LA 2KG4A 3KE1A 4X3LA 3VMFB 4O4IA 4EI7A 4EB6A 1XHOA 4O4JA 4TZZA 2CZWA 2ZVZA 3J80M 3F0DA 1VQ5F 2Z1EA 3ELCA 1W5FA 5HP8A 2BO1A 2HS0A 2UYNA 3WGKA 2CHSA 1XBIA 1VQLF 3TD4A 1VQKF 2VAWA 5EYPB 4WBNB 4YJ2B 2IQQA 5JVDA 3E1YA 2GLZA 3CCSF 4LNUB 3JATB 5JQGA 1W42A 3V3TA 4FFBA 2KGWA 2UYKA 3RYCB 5GONA 4BT4A 4I50A 3T80A 5FLXM 1GO0A 3GHZA 1JD1A 3M1XA 5KMGB 3JAKA 3JVHA 3D01A 2RHOA 4ZI7A 5LXTB 5BMVB 2K1SA 2ZF8A 3E22A 4X20B 1Q8RA 5CA0B 1IV1A 3NK6A 3I56F 3VYSC 2PMPA 2VAMA 3AGKA 2W8BC 3N4YA 4X1KB 4C81A 2Z1FA 5KX5A 4O4LA 3CYQA 2QEXF 1R1MA 4C82A 5GAPK 3JARB 4KWEA 3WJRA 2I6DA 1H48A 3CCMF 4B5CA 3F6MA 4YJ3A 1Q81H 1FFXA 1YITF 2HP3A 3RYIB 3TD5A 3ESJA 5EB1B 3SIUA 5FNVA 3RE3A 1KQSF 5HWEA 2DT4A 2FGYA 1YIJF 3ERNA 5MN4A 4U3JA 1KNJA 2ZVYA 1W55A 1XV2A 2CHTA 3CYPB 1VQOF 5HXZA 3IR9A 1IPAA 3HKDA 2OTJF 3CCRF 5LP6C 5HY2A 1KC8H 1UFYA 4BT3A 4ZHYB 4C8EA 5LP6B 3C9RA 4O2BB 4EI9A 3S0YA 2Q1YA 4BW0B 3HKCB 5GINC 3I3FA 3QTYA 3CMAF 3CCUF 5HY0A 1E7KA 3HAXD 4TV8B 2GVIA 4M8IA 3CCJF 4DRXA 3CC2F 3CD6F 4BT2A 3IKFA 3S0HA 1TVKA 3HKBB 3KIZA 3S06A 1NMUB 1YI2F 3MBMA 3ZP7A 2HVYD 5CA1B 4BY9D 1FNKA 2OHWA 3M84A 2EWCA 2QA4F 3KJKA 2YXZA 4X1YB 3LDTA 2LBWA 5EYPA 2P6YA 4TUYA 4WBNA 5LA6B 5A2QM 3F0FA 2GZLA 1SDSA 1M1KH 3B6NA 3P10A 5G4VC 1JN1A 3KHNA 4LNUA 4E6EA 3JATA 1UI9A 3C8LA 3IKEA 1NQ3A 3GYQA 3RYFB 3ZO8A 4BVTA 3RYCA 5EO3A 3ZP4A 1QVFF 2R6R1 1SA0B 2HRYA 5J2TB 4IHJB 2H8EA 3TD3A 5CB4B 5KMGA 2HP0B 3RA6A 3WGJA 4G4YA 3VO8A 2OTMA 1JFFB 4ZHVA 4G4ZA 5LXTA 5BMVA 3WJPA 2B33A 1K8AH 4X20A 3FBAA 2L26A 5JCOA 1K9MH 3FD6A 1CN7A 5EIBC 5CA0A 5GIOC 1X25A 4X1KA 1YJNF 4HNAB 2HS4A 4NQ3A 3O85A 1YJWF 2H8CA 3LYBA 5IT9M 3JARA 1VQ7F 3MQWA 4B46A 4X3MA 3UT5B 1VHAA 1OFUA 4EI8A 3RYIA 3HKEB 1IV4A 1QAHA 1ODEA 3J81M 1ONIA 5HY4A 2R751 1VQPF 3LFOA 4ZK7A 1PF5A 1T0AA 3JAWB 4O4HB 4G4XA 1VQMF 2HQSC 3WPWA 2Z1UA 5IJ0B 5LYJB 3ZOPA 1GO1A 1YGYA 3LMEA 1ZWZA 3CC4F 3VYUC 3FFMA 3K14A 1RQ7A 2FC3A 3RYHB 5LP6A 5C8YB 1W5EA 5EZYB 4O2BA 1Z5WA 2Q1XA 3LWPC 3GTZA 5JH7B 1W3EX 3HKCA 3ON1A 2QI2A 3K2XA 2UYJA 4TV8A 1CLIA 4ZOLB 3G4SF 2Z01A 4RQOA 2OZBA 1CK2A 3K12A 5EIBD 3HKBA 2VXYA 1RLGA 4PWTA 1JY8A 5EAZA 3CCEF 3HWUA 5DCVA 5CA1A 4NUTA 1QU9A 1X7PA 2JNBA 3CXCF 1IV3A 2CVLA 1VQVA 1VH8A 1RLUA 2UYPA 4X1YA 4X1IB 4I4TB 1DBFA 4ZHQB 3JAMM 3CCLF 5B8FA 2OTLF 4BT7A 5GIPC 1OAPA 3JALB 5LA6A 3RA5A 1U43A 2ZOVA 3K0TA 3IEWA 4TV9B 2UZHA 5HP7A 4RHAA 4IIJB 2KTUA 3RYFA 4F6RB 5LOVB 5MN5A 3WGMA 1N8RH 4B45A 1SA0A 3KJJA 3OONA 5J2TA 3C9TA 4IHJA 2LCAA 4C4WC 2IAFA 3N2GB 1PXWA 3V7QA 3F0GA 5CB4A 2HP0A 5ITZB 2KTVA 1U3PA 4YJ2A 2IG8A 1W581 3WPXA 1Q86H 1JFFA 3N2KB 2DYYA 4I55B 1VQ8F 5HY1A 3WJQA 1QVGF 3R0PA 4G88A 1SZQA 2CWJA 2N48A 5IJ9B 1NJIH 3VOAA 1VQ4F 4HNAA 3OBWA 2HRUA 3P4EA 3CPWF 3N4ZA 1K73H 3Q8HA 4O2AB 5IYZB 1YJ9F 1FSZA 3U0OA 2LBXA 3CC7F 3JASB 5J2UB 5FJ4C 3UT5A 1KNKA 3LWQC 1TUBB 5EB0A 2V9YA 3VTIC 3HKEA 3WGNA 2F9ZC 1GZ0A 3I55F 3JCMM 3VYTC 1VQ6F 4TUYB 2ALEA 3LWOC 3JAWA 4O4HA 5EWRA 3CMEF 4LCKA 5LYJA 5IJ0A 2I6RA 3FD5A 3DC2A 4O4IB 4BVRA 4EB6B 3MDOA 3CG6A 2WALA 4O4JB 3RYHA 2RHHA 1H7MA 5C8YA 3I7TA 2VAPA 4G4VA 5EZYA 2UYNB 5JH7A 5HXUA 1X52A 1U40A 1IV2A 1VK3A 3HTNA 3IEQA 5JCOC 4ZOLA 5JVDB 1W5BA 3IMPA 1W2BF 1DT9A 3VIUA 5JQGB 4C8IA 3J7AR 2H6LA 1QD9A 4FFBB 1Q82H 5GONB 5AVMA 3LWVC 4I50B 1X7OA 1H47A 1FNJA 1W5AA 3WGLA 2VGMA 1COMA 2QTPA 4X1IA 4I4TA 4ZHQA 3PAFA 1RA4A 3V7EA 3C9SA 3VI6A 3NVIB 3JAKB
chains in the Genus database with same CATH topology
4BVTA 3GYQA 5EO3A 1QVFF 2KTUA 4XCQA 3OW2F 3NK7A 1N8RH 3RA6A 4C4WC 3V7QA 1PXWA 3CCQF 3NVKE 3E20B 3NK6A 2KTVA 3I56F 4BVQA 3G6EF 1K8AH 1W41A 3MCAB 3AGKA 3N4YA 1YHQF 1Q86H 1K9MH 3WXMB 1VQ8F 1CN7A 1VQNF 5HY1A 5GIOC 2VGNA 1Q7YH 2QEXF 1QVGF 1YJNF 1S72F 3PLAC 1KD1H 5GAPK 2I6DA 4NQ3A 3O85A 1YJWF 3CCMF 1W40A 1Q81H 1NJIH 1YITF 3LWRC 1VQ4F 5IT9M 1VQ7F 3OBWA 1T0KB 3CPWF 3N4ZA 1K73H 1VQ9F 3SIUA 1GO0A 1KQSF 4X3MA 5HWEA 3D00A 1M90H 1YJ9F 3CPQA 2FGYA 1YIJF 4EI8A 2LBXA 3CC7F 2AIFA 5FJ4C 3LWQC 3J81M 1VQOF 5HXZA 5HY4A 3IR9A 1IPAA 1VQPF 2OTJF 3LFOA 3CCRF 5GANK 5HY2A 2F9ZC 1GZ0A 3I55F 1KC8H 3JCMM 1VQMF 5G4UC 1VQ6F 3CCVF 1GO1A 2ALEA 4EI9A 3LWOC 1JJ2F 1ZWZA 4BW0B 5EWRA 3CC4F 3CMEF 4LCKA 3FFMA 3SIVA 3OBYA 5GINC 2FC3A 4BVRA 3CMAF 3CCUF 5HY0A 4BVSA 1E7KA 3LWPC 3CG6A 3HAXD 3HJWC 2WALA 3NMUC 1W3EX 3G71F 3CCJF 3CC2F 3CD6F 3ON1A 2KG4A 1H7MA 2QI2A 4X3LA 3VMFB 4EI7A 1NMUB 1YI2F 5HXUA 4TZZA 2CZWA 1X52A 3G4SF 2OZBA 1CK2A 3J80M 1VQ5F 4BY9D 2HVYD 2BO1A 1RLGA 2OHWA 3CCEF 1XBIA 1W2BF 5DCVA 1VQLF 2QA4F 1DT9A 4NUTA 1VQKF 1X7PA 2JNBA 3CXCF 2LBWA 3J7AR 3E1YA 1Q82H 2GLZA 3CCSF 3LWVC 3JAMM 5A2QM 1X7OA 3CCLF 2OTLF 1SDSA 1M1KH 1W42A 3V3TA 5G4VC 5GIPC 2VGMA 3RA5A 3PAFA 1RA4A 3V7EA 3VI6A 5FLXM 3NVIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYQ A;  5EO3 A;  1QVF F;  2KTU A;  3OW2 F;  3NK7 A;  1N8R H;  3RA6 A;  4C4W C;  3V7Q A;  1PXW A;  3CCQ F;  3NVK E;  3E20 B;  3NK6 A;  2KTV A;  3I56 F;  3G6E F;  1K8A H;  1W41 A;  3MCA B;  3AGK A;  3N4Y A;  1YHQ F;  1Q86 H;  1K9M H;  3WXM B;  1VQ8 F;  1CN7 A;  1VQN F;  5GIO C;  2VGN A;  1Q7Y H;  2QEX F;  1QVG F;  1YJN F;  1S72 F;  3PLA C;  1KD1 H;  5GAP K;  2I6D A;  3O85 A;  1YJW F;  3CCM F;  1W40 A;  1Q81 H;  1NJI H;  1YIT F;  3LWR C;  1VQ4 F;  5IT9 M;  1VQ7 F;  3OBW A;  1T0K B;  3CPW F;  3N4Z A;  1K73 H;  1VQ9 F;  3SIU A;  1GO0 A;  1KQS F;  4X3M A;  1M90 H;  1YJ9 F;  3CPQ A;  1YIJ F;  2LBX A;  3CC7 F;  2AIF A;  5FJ4 C;  3LWQ C;  3J81 M;  1VQO F;  3IR9 A;  1IPA A;  1VQP F;  2OTJ F;  3LFO A;  3CCR F;  5GAN K;  1GZ0 A;  3I55 F;  1KC8 H;  3JCM M;  1VQM F;  5G4U C;  1VQ6 F;  3CCV F;  1GO1 A;  2ALE A;  3LWO C;  1JJ2 F;  1ZWZ A;  4BW0 B;  5EWR A;  3CC4 F;  3CME F;  4LCK A;  3FFM A;  3SIV A;  3OBY A;  5GIN C;  2FC3 A;  3CMA F;  3CCU F;  3NMU C;  3HJW C;  1E7K A;  3LWP C;  3CG6 A;  3HAX D;  2WAL A;  1W3E X;  3G71 F;  3CCJ F;  3CC2 F;  3CD6 F;  3ON1 A;  2KG4 A;  1H7M A;  2QI2 A;  4X3L A;  3VMF B;  1NMU B;  1YI2 F;  4TZZ A;  2CZW A;  1X52 A;  3G4S F;  2OZB A;  1CK2 A;  3J80 M;  1VQ5 F;  4BY9 D;  2HVY D;  2BO1 A;  1RLG A;  2OHW A;  3CCE F;  1XBI A;  1W2B F;  5DCV A;  1VQL F;  2QA4 F;  1DT9 A;  4NUT A;  1VQK F;  1X7P A;  2JNB A;  3CXC F;  2LBW A;  3J7A R;  3E1Y A;  1Q82 H;  3CCS F;  3LWV C;  3JAM M;  5A2Q M;  1X7O A;  3CCL F;  2OTL F;  1SDS A;  1M1K H;  1W42 A;  5G4V C;  5GIP C;  2VGM A;  3RA5 A;  3PAF A;  1RA4 A;  3V7E A;  3VI6 A;  5FLX M;  3NVI B; 
#chains in the Genus database with same CATH topology
 3L7Q A;  1YQN A;  4ERH A;  3JAL A;  4ZI7 B;  4XCQ A;  2RHL A;  3E22 B;  3OW2 F;  2RB9 A;  2CSL A;  3NK7 A;  2NMU A;  4TV9 A;  1GX1 A;  3S02 A;  3C9U A;  4IIJ A;  2AIZ P;  3FPI A;  4F6R A;  5LOV A;  3CCQ F;  3NVK E;  3E20 B;  2LBT A;  5KX5 B;  2PHN A;  3S0W A;  4BT6 A;  4O4L B;  4BVQ A;  3G6E F;  1W41 A;  3MCA B;  1YHQ F;  2ZAU A;  3P0Z A;  3N2G A;  1W59 A;  2G9I A;  3QUW A;  3WXM B;  2BTU A;  2CW4 A;  1VQN F;  4C8G A;  3D54 A;  5ITZ A;  2VGN A;  4YJ3 B;  1Q7Y H;  1FFX B;  3DDN A;  1S72 F;  2AMT A;  4NWO B;  3N2K A;  1KD1 H;  4I55 A;  3PLA C;  1W40 A;  5FNV B;  3LWR C;  1T0K B;  2Z1T A;  3M4S A;  4R40 B;  5IJ9 A;  4B62 A;  1VQ9 F;  2ZOD A;  4U3J B;  3D00 A;  2RHJ A;  1M90 H;  2YYE A;  3CPQ A;  2HS3 A;  1Z5V A;  3S03 A;  3HKD B;  1J7H A;  2AIF A;  4BT5 A;  4O2A A;  4U39 A;  5IYZ A;  1RQ2 A;  2HX0 A;  3F0E A;  4ZHW A;  3JAS A;  4G4W A;  5J2U A;  5GAN K;  3EOR A;  1TUB A;  3BYQ A;  3MCQ A;  1W57 A;  3CB2 A;  5G4U C;  2MQE A;  4DXD A;  3CCV F;  1JJ2 F;  3QHD A;  3SIV A;  3OBY A;  4DRX B;  3V4D A;  2BTO A;  1TVK B;  5MN6 A;  3NMU C;  4BVS A;  1XRG A;  3HJW C;  3G71 F;  3VCZ A;  3VOB A;  2BTQ B;  1U3L A;  2KG4 A;  3KE1 A;  4X3L A;  3VMF B;  4O4I A;  4EI7 A;  4EB6 A;  1XHO A;  4O4J A;  4TZZ A;  2CZW A;  2ZVZ A;  3J80 M;  3F0D A;  1VQ5 F;  2Z1E A;  3ELC A;  1W5F A;  5HP8 A;  2BO1 A;  2HS0 A;  2UYN A;  3WGK A;  2CHS A;  1XBI A;  1VQL F;  3TD4 A;  1VQK F;  2VAW A;  5EYP B;  4WBN B;  4YJ2 B;  2IQQ A;  5JVD A;  3E1Y A;  2GLZ A;  3CCS F;  4LNU B;  3JAT B;  5JQG A;  1W42 A;  3V3T A;  4FFB A;  2KGW A;  2UYK A;  3RYC B;  5GON A;  4BT4 A;  4I50 A;  3T80 A;  5FLX M;  1GO0 A;  3GHZ A;  1JD1 A;  3M1X A;  5KMG B;  3JAK A;  3JVH A;  3D01 A;  2RHO A;  4ZI7 A;  5LXT B;  5BMV B;  2K1S A;  2ZF8 A;  3E22 A;  4X20 B;  1Q8R A;  5CA0 B;  1IV1 A;  3NK6 A;  3I56 F;  3VYS C;  2PMP A;  2VAM A;  3AGK A;  2W8B C;  3N4Y A;  4X1K B;  4C81 A;  2Z1F A;  5KX5 A;  4O4L A;  3CYQ A;  2QEX F;  1R1M A;  4C82 A;  5GAP K;  3JAR B;  4KWE A;  3WJR A;  2I6D A;  1H48 A;  3CCM F;  4B5C A;  3F6M A;  4YJ3 A;  1Q81 H;  1FFX A;  1YIT F;  2HP3 A;  3RYI B;  3TD5 A;  3ESJ A;  5EB1 B;  3SIU A;  5FNV A;  3RE3 A;  1KQS F;  5HWE A;  2DT4 A;  2FGY A;  1YIJ F;  3ERN A;  5MN4 A;  4U3J A;  1KNJ A;  2ZVY A;  1W55 A;  1XV2 A;  2CHT A;  3CYP B;  1VQO F;  5HXZ A;  3IR9 A;  1IPA A;  3HKD A;  2OTJ F;  3CCR F;  5LP6 C;  5HY2 A;  1KC8 H;  1UFY A;  4BT3 A;  4ZHY B;  4C8E A;  5LP6 B;  3C9R A;  4O2B B;  4EI9 A;  3S0Y A;  2Q1Y A;  4BW0 B;  3HKC B;  5GIN C;  3I3F A;  3QTY A;  3CMA F;  3CCU F;  5HY0 A;  1E7K A;  3HAX D;  4TV8 B;  2GVI A;  4M8I A;  3CCJ F;  4DRX A;  3CC2 F;  3CD6 F;  4BT2 A;  3IKF A;  3S0H A;  1TVK A;  3HKB B;  3KIZ A;  3S06 A;  1NMU B;  1YI2 F;  3MBM A;  3ZP7 A;  2HVY D;  5CA1 B;  4BY9 D;  1FNK A;  2OHW A;  3M84 A;  2EWC A;  2QA4 F;  3KJK A;  2YXZ A;  4X1Y B;  3LDT A;  2LBW A;  5EYP A;  2P6Y A;  4TUY A;  4WBN A;  5LA6 B;  5A2Q M;  3F0F A;  2GZL A;  1SDS A;  1M1K H;  3B6N A;  3P10 A;  5G4V C;  1JN1 A;  3KHN A;  4LNU A;  4E6E A;  3JAT A;  1UI9 A;  3C8L A;  3IKE A;  1NQ3 A;  3GYQ A;  3RYF B;  3ZO8 A;  4BVT A;  3RYC A;  5EO3 A;  3ZP4 A;  1QVF F;  2R6R 1;  1SA0 B;  2HRY A;  5J2T B;  4IHJ B;  2H8E A;  3TD3 A;  5CB4 B;  5KMG A;  2HP0 B;  3RA6 A;  3WGJ A;  4G4Y A;  3VO8 A;  2OTM A;  1JFF B;  4ZHV A;  4G4Z A;  5LXT A;  5BMV A;  3WJP A;  2B33 A;  1K8A H;  4X20 A;  3FBA A;  2L26 A;  5JCO A;  1K9M H;  3FD6 A;  1CN7 A;  5EIB C;  5CA0 A;  5GIO C;  1X25 A;  4X1K A;  1YJN F;  4HNA B;  2HS4 A;  4NQ3 A;  3O85 A;  1YJW F;  2H8C A;  3LYB A;  5IT9 M;  3JAR A;  1VQ7 F;  3MQW A;  4B46 A;  4X3M A;  3UT5 B;  1VHA A;  1OFU A;  4EI8 A;  3RYI A;  3HKE B;  1IV4 A;  1QAH A;  1ODE A;  3J81 M;  1ONI A;  5HY4 A;  2R75 1;  1VQP F;  3LFO A;  4ZK7 A;  1PF5 A;  1T0A A;  3JAW B;  4O4H B;  4G4X A;  1VQM F;  2HQS C;  3WPW A;  2Z1U A;  5IJ0 B;  5LYJ B;  3ZOP A;  1GO1 A;  1YGY A;  3LME A;  1ZWZ A;  3CC4 F;  3VYU C;  3FFM A;  3K14 A;  1RQ7 A;  2FC3 A;  3RYH B;  5LP6 A;  5C8Y B;  1W5E A;  5EZY B;  4O2B A;  1Z5W A;  2Q1X A;  3LWP C;  3GTZ A;  5JH7 B;  1W3E X;  3HKC A;  3ON1 A;  2QI2 A;  3K2X A;  2UYJ A;  4TV8 A;  1CLI A;  4ZOL B;  3G4S F;  2Z01 A;  4RQO A;  2OZB A;  1CK2 A;  3K12 A;  5EIB D;  3HKB A;  2VXY A;  1RLG A;  4PWT A;  1JY8 A;  5EAZ A;  3CCE F;  3HWU A;  5DCV A;  5CA1 A;  4NUT A;  1QU9 A;  1X7P A;  2JNB A;  3CXC F;  1IV3 A;  2CVL A;  1VQV A;  1VH8 A;  1RLU A;  2UYP A;  4X1Y A;  4X1I B;  4I4T B;  1DBF A;  4ZHQ B;  3JAM M;  3CCL F;  5B8F A;  2OTL F;  4BT7 A;  5GIP C;  1OAP A;  3JAL B;  5LA6 A;  3RA5 A;  1U43 A;  2ZOV A;  3K0T A;  3IEW A;  4TV9 B;  2UZH A;  5HP7 A;  4RHA A;  4IIJ B;  2KTU A;  3RYF A;  4F6R B;  5LOV B;  5MN5 A;  3WGM A;  1N8R H;  4B45 A;  1SA0 A;  3KJJ A;  3OON A;  5J2T A;  3C9T A;  4IHJ A;  2LCA A;  4C4W C;  2IAF A;  3N2G B;  1PXW A;  3V7Q A;  3F0G A;  5CB4 A;  2HP0 A;  5ITZ B;  2KTV A;  1U3P A;  4YJ2 A;  2IG8 A;  1W58 1;  3WPX A;  1Q86 H;  1JFF A;  3N2K B;  2DYY A;  4I55 B;  1VQ8 F;  5HY1 A;  3WJQ A;  1QVG F;  3R0P A;  4G88 A;  1SZQ A;  2CWJ A;  2N48 A;  5IJ9 B;  1NJI H;  3VOA A;  1VQ4 F;  4HNA A;  3OBW A;  2HRU A;  3P4E A;  3CPW F;  3N4Z A;  1K73 H;  3Q8H A;  4O2A B;  5IYZ B;  1YJ9 F;  1FSZ A;  3U0O A;  2LBX A;  3CC7 F;  3JAS B;  5J2U B;  5FJ4 C;  3UT5 A;  1KNK A;  3LWQ C;  1TUB B;  5EB0 A;  2V9Y A;  3VTI C;  3HKE A;  3WGN A;  2F9Z C;  1GZ0 A;  3I55 F;  3JCM M;  3VYT C;  1VQ6 F;  4TUY B;  2ALE A;  3LWO C;  3JAW A;  4O4H A;  5EWR A;  3CME F;  4LCK A;  5LYJ A;  5IJ0 A;  2I6R A;  3FD5 A;  3DC2 A;  4O4I B;  4BVR A;  4EB6 B;  3MDO A;  3CG6 A;  2WAL A;  4O4J B;  3RYH A;  2RHH A;  1H7M A;  5C8Y A;  3I7T A;  2VAP A;  4G4V A;  5EZY A;  2UYN B;  5JH7 A;  5HXU A;  1X52 A;  1U40 A;  1IV2 A;  1VK3 A;  3HTN A;  3IEQ A;  5JCO C;  4ZOL A;  5JVD B;  1W5B A;  3IMP A;  1W2B F;  1DT9 A;  3VIU A;  5JQG B;  4C8I A;  3J7A R;  2H6L A;  1QD9 A;  4FFB B;  1Q82 H;  5GON B;  5AVM A;  3LWV C;  4I50 B;  1X7O A;  1H47 A;  1FNJ A;  1W5A A;  3WGL A;  2VGM A;  1COM A;  2QTP A;  4X1I A;  4I4T A;  4ZHQ A;  3PAF A;  1RA4 A;  3V7E A;  3C9S A;  3VI6 A;  3NVI B;  3JAK B; 
#chains in the Genus database with same CATH homology
 4BVT A;  3GYQ A;  5EO3 A;  1QVF F;  2KTU A;  4XCQ A;  3OW2 F;  3NK7 A;  1N8R H;  3RA6 A;  4C4W C;  3V7Q A;  1PXW A;  3CCQ F;  3NVK E;  3E20 B;  3NK6 A;  2KTV A;  3I56 F;  4BVQ A;  3G6E F;  1K8A H;  1W41 A;  3MCA B;  3AGK A;  3N4Y A;  1YHQ F;  1Q86 H;  1K9M H;  3WXM B;  1VQ8 F;  1CN7 A;  1VQN F;  5HY1 A;  5GIO C;  2VGN A;  1Q7Y H;  2QEX F;  1QVG F;  1YJN F;  1S72 F;  3PLA C;  1KD1 H;  5GAP K;  2I6D A;  4NQ3 A;  3O85 A;  1YJW F;  3CCM F;  1W40 A;  1Q81 H;  1NJI H;  1YIT F;  3LWR C;  1VQ4 F;  5IT9 M;  1VQ7 F;  3OBW A;  1T0K B;  3CPW F;  3N4Z A;  1K73 H;  1VQ9 F;  3SIU A;  1GO0 A;  1KQS F;  4X3M A;  5HWE A;  3D00 A;  1M90 H;  1YJ9 F;  3CPQ A;  2FGY A;  1YIJ F;  4EI8 A;  2LBX A;  3CC7 F;  2AIF A;  5FJ4 C;  3LWQ C;  3J81 M;  1VQO F;  5HXZ A;  5HY4 A;  3IR9 A;  1IPA A;  1VQP F;  2OTJ F;  3LFO A;  3CCR F;  5GAN K;  5HY2 A;  2F9Z C;  1GZ0 A;  3I55 F;  1KC8 H;  3JCM M;  1VQM F;  5G4U C;  1VQ6 F;  3CCV F;  1GO1 A;  2ALE A;  4EI9 A;  3LWO C;  1JJ2 F;  1ZWZ A;  4BW0 B;  5EWR A;  3CC4 F;  3CME F;  4LCK A;  3FFM A;  3SIV A;  3OBY A;  5GIN C;  2FC3 A;  4BVR A;  3CMA F;  3CCU F;  5HY0 A;  4BVS A;  1E7K A;  3LWP C;  3CG6 A;  3HAX D;  3HJW C;  2WAL A;  3NMU C;  1W3E X;  3G71 F;  3CCJ F;  3CC2 F;  3CD6 F;  3ON1 A;  2KG4 A;  1H7M A;  2QI2 A;  4X3L A;  3VMF B;  4EI7 A;  1NMU B;  1YI2 F;  5HXU A;  4TZZ A;  2CZW A;  1X52 A;  3G4S F;  2OZB A;  1CK2 A;  3J80 M;  1VQ5 F;  4BY9 D;  2HVY D;  2BO1 A;  1RLG A;  2OHW A;  3CCE F;  1XBI A;  1W2B F;  5DCV A;  1VQL F;  2QA4 F;  1DT9 A;  4NUT A;  1VQK F;  1X7P A;  2JNB A;  3CXC F;  2LBW A;  3J7A R;  3E1Y A;  1Q82 H;  2GLZ A;  3CCS F;  3LWV C;  3JAM M;  5A2Q M;  1X7O A;  3CCL F;  2OTL F;  1SDS A;  1M1K H;  1W42 A;  3V3T A;  5G4V C;  5GIP C;  2VGM A;  3RA5 A;  3PAF A;  1RA4 A;  3V7E A;  3VI6 A;  5FLX M;  3NVI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...