1VQPF

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqpF00
3V7QA 1Q81H 1YJNF 3CCEF 4LCKA 3FFMA 1Q7YH 3J81M 1KQSF 2LBXA 2FC3A 1ZWZA 3JCMM 5G4VC 1SDSA 3NK6A 5GIOC 3CCVF 3O85A 1VQNF 4X3MA 2KTVA 2OHWA 2KTUA 3LWOC 3PLAC 2QEXF 3E20B 1RA4A 4X3LA 1XBIA 2QI2A 3LFOA 3G6EF 3LWQC 1CN7A 1JJ2F 5FLXM 1NJIH 1VQ5F 2OTLF 3G4SF 3V7EA 3VMFB 1T0KB 3OBWA 3SIUA 3CCMF 5A2QM 1KD1H 3VI6A 1X52A 1VQ8F 2VGNA 3RA5A 1GZ0A 1QVFF 3LWPC 3PAFA 1Q86H 3CD6F 5GAPK 2AIFA 2VGMA 2QA4F 1E7KA 3CMEF 4BW0B 5GANK 3CCQF 1YJ9F 1K8AH 3LWVC 1CK2A 1W42A 5IT9M 1M90H 3CCUF 1W2BF 3N4YA 3WXMB 1NMUB 1YJWF 1VQ9F 2BO1A 3I55F 2OZBA 1M1KH 3JAMM 3NK7A 1Q82H 1W3EX 1VQMF 3J80M 3G71F 1YI2F 3N4ZA 5EO3A 3CMAF 4BY9D 3J7AR 1K9MH 3CC2F 2JNBA 1YITF 1S72F 3OBYA 5EWRA 3NVIB 3SIVA 5GIPC 1KC8H 3CXCF 2CZWA 1H7MA 1X7OA 1N8RH 4NUTA 3CC7F 3CPWF 1YIJF 1W41A 2KG4A 1VQKF 4C4WC 2ALEA 3CG6A 5FJ4C 3LWRC 1IPAA 3MCAB 3RA6A 2OTJF 3IR9A 3CPQA 1PXWA 1VQOF 3CCRF 1K73H 3AGKA 3NMUC 3HAXD 2I6DA 1DT9A 1VQPF 1VQ7F 3CCSF 1W40A 3I56F 3CCJF 1VQ6F 5DCVA 3OW2F 1RLGA 3ON1A 3E1YA 3NVKE 2WALA 4TZZA 1GO1A 2LBWA 5GINC 1VQ4F 1X7PA 1GO0A 3CCLF 1YHQF 1QVGF 3CC4F 1VQLF 5G4UC 3HJWC 3GYQA 2HVYD
chains in the Genus database with same CATH superfamily
4O4LA 1Q8RA 3V7QA 3UT5A 3CCEF 4O4IA 4ZHQB 2UZHA 3FD6A 5CA0A 1IV4A 3CYQA 3IEQA 5KX5B 1KQSF 5G4VC 4BT3A 4U3JA 4DXDA 4ZK7A 5LOVB 5HP7A 3CCVF 3JAWB 3K0TA 4TV9A 5HY2A 1X25A 5LP6C 3HKCB 2IG8A 2R6R1 3WJQA 3FPIA 2K1SA 5IJ9B 2QI2A 3WJRA 3Q8HA 1W59A 3WGMA 1U3PA 4ZOLB 3HKEA 1U3LA 3HKBB 5JH7A 3MQWA 5BMVA 4FFBB 1IV2A 2YYEA 4X20A 2DT4A 3F0GA 4WBNB 4ZI7B 4C81A 3OBWA 5JVDA 3VI6A 1X52A 1GZ0A 1W55A 4XCQA 5GAPK 3RYHA 4IIJA 1J7HA 1XHOA 2UYNB 4IHJA 3JAKA 5IYZA 2QA4F 2IAFA 4G4WA 1IV3A 1YJ9F 3BYQA 3K12A 2B33A 3WPXA 3KE1A 2CHTA 1Z5WA 2V9YA 4X1IB 3CCUF 3L7QA 3N4YA 3WXMB 2ZVZA 1YJWF 2CSLA 1VQ9F 5MN4A 3P10A 5LOVA 4TUYA 1VQVA 4X1KA 5FNVB 4C82A 3DDNA 5EZYB 2Z01A 4B62A 1SA0B 3RYCA 1YI2F 1UFYA 1FSZA 5EO3A 3CMAF 1H48A 3OONA 4NWOB 3CC2F 1S72F 2RHJA 3NVIB 3SIVA 4BT5A 2Z1FA 3C9RA 3IEWA 2EWCA 3VOBA 3S0HA 5EIBC 3S06A 1N8RH 3HKDB 3CC7F 5HY4A 1YIJF 5FNVA 1W41A 2KG4A 4ZHQA 4U39A 3CG6A 3JALB 5KMGB 1PF5A 2NMUA 3CPQA 1PXWA 4O2AA 4BT6A 3CCRF 1VQOF 1K73H 5EZYA 1IV1A 3M1XA 3P4EA 3JASB 1VQPF 1VQ7F 1OAPA 3M84A 3HKDA 2HP3A 5HY0A 4G4ZA 4TV8A 3ZOPA 1W5BA 4BVQA 2VXYA 2WALA 5GINC 3CCLF 5JVDB 4ZI7A 1QVGF 5LP6A 4YJ3A 2ZOVA 3RE3A 2HVYD 3LMEA 2CWJA 4BVSA 2ZODA 1JN1A 1R1MA 1YGYA 3FFMA 1Q7YH 3J81M 4I4TA 4PWTA 5LYJB 3C9UA 4BVRA 4DRXB 2VAWA 2HX0A 3FBAA 1Z5VA 5J2TA 2QEXF 3E20B 1QU9A 2RB9A 5CB4A 4X3LA 2P6YA 4G4VA 2AMTA 4I50B 3QUWA 3MBMA 4O4IB 4O4JA 1CN7A 3CYPB 3JATA 5FLXM 1NJIH 4B45A 1KNKA 1VQ5F 2OTLF 1T0KB 2GVIA 4EI8A 2RHOA 5A2QM 3ZP4A 4BVTA 3RA5A 4TUYB 4X1KB 4C8EA 3C9SA 2HRYA 1QVFF 1Q86H 2PHNA 2CHSA 4F6RB 1COMA 2VGMA 3CMEF 3JARB 3WGKA 3N2GA 3U0OA 1FFXA 2AIZP 2BTQB 1M90H 1XV2A 2G9IA 3JAKB 2L26A 4O2BB 2KGWA 2CVLA 4G4YA 3I3FA 1ONIA 3NK7A 1VQMF 2HS4A 1YQNA 5J2UB 3JALA 3LDTA 3J7AR 5EYPB 3RYFB 3F0DA 1YITF 3KJKA 1VHAA 3OBYA 5EWRA 1H47A 1TUBA 1VH8A 3HKEB 4YJ2B 5C8YA 2DYYA 2ZAUA 4ZHWA 3HTNA 2Z1TA 4TV8B 1W5EA 4ZHVA 1OFUA 5LA6A 3K14A 4HNAA 3RYIA 1T0AA 3WGJA 3F0EA 4O4HA 2OTJF 4ZOLA 5EYPA 5LP6B 3UT5B 4I55A 3ZO8A 5HY1A 3T80A 2I6DA 3K2XA 1DT9A 4C8GA 5LXTA 3CCJF 2HS0A 2PMPA 1W5AA 1TUBB 4YJ2A 4B5CA 3ON1A 3E1YA 3NVKE 3WJPA 2LBWA 1VQ4F 5B8FA 4LNUB 3S0YA 3VYTC 3CC4F 1VQLF 5G4UC 1JFFA 3HJWC 3VYUC 2F9ZC 2R751 4RHAA 4LCKA 2MQEA 3C8LA 4WBNA 2LBXA 3F6MA 3KJJA 1ZWZA 3EORA 4YJ3B 3JCMM 1DBFA 1SZQA 5JCOC 3VOAA 3NK6A 5GIOC 3FD5A 1FNKA 2H8CA 1VQNF 2KTVA 4BT2A 4C8IA 2OHWA 2KTUA 4G88A 3PLAC 4BT4A 5LXTB 5HWEA 3WPWA 1XBIA 3VO8A 3LWQC 3C9TA 1JJ2F 3M4SA 4EI7A 3VCZA 1SA0A 2GLZA 5KX5A 3G4SF 2H8EA 3VMFB 4EB6A 2Z1EA 3CCMF 4X1YA 1VQ8F 4O4LB 2RHHA 2VAMA 2VAPA 3N2KB 3S03A 3B6NA 1TVKB 3CD6F 2AIFA 3D01A 5JQGB 2YXZA 5CA1A 5GANK 3F0FA 3CCQF 1K8AH 1RLUA 3VTIC 5LA6B 2Q1XA 3MCQA 3QTYA 1TVKA 5IT9M 2IQQA 5HP8A 5MN6A 5J2UA 4X1YB 1W2BF 1W581 3V4DA 3I55F 2UYPA 4U3JB 2OZBA 3JAMM 1QAHA 1Q82H 2GZLA 3J80M 4X20B 5EAZA 3N4ZA 1JY8A 3JATB 1U43A 2JNBA 1FFXB 2UYJA 2H6LA 3ERNA 3KHNA 1KC8H 4F6RA 2LBTA 2CZWA 1H7MA 5IYZB 5GONB 4IHJB 3LYBA 3CPWF 3TD4A 5LYJA 5CA0B 1IPAA 5HXUA 3RA6A 2I6RA 1JFFB 3IR9A 4LNUA 3NMUC 4FFBA 1FNJA 3RYCB 3S02A 1RQ2A 1W40A 3D54A 2Q1YA 5GONA 3E22B 1RQ7A 3JVHA 4O4JB 5DCVA 4DRXA 3OW2F 1RLGA 1GO1A 1X7PA 4EB6B 4G4XA 4I4TB 1NQ3A 5CA1B 4R40B 3VIUA 1YHQF 2ZF8A 5HXZA 3GYQA 4O2AB 1CLIA 1Q81H 1YJNF 3N2KA 5KMGA 2BTOA 1JD1A 2FC3A 3IKEA 4B46A 1UI9A 1SDSA 2Z1UA 3WGNA 3KIZA 3O85A 4X3MA 3P0ZA 5BMVB 3LWOC 1RA4A 2UYNA 1W5FA 2QTPA 3LFOA 3HWUA 5JQGA 3N2GB 3G6EF 4KWEA 4ERHA 3IMPA 3JARA 3S0WA 3R0PA 4EI9A 5EIBD 3DC2A 5AVMA 3V7EA 3SIUA 5IJ0B 1KD1H 2VGNA 2HRUA 3QHDA 3LWPC 3PAFA 3ZP7A 3GHZA 2LCAA 5IJ9A 1E7KA 4BW0B 3WGLA 4I50A 3LWVC 2OTMA 1CK2A 3HKCA 3I7TA 1W42A 3JAWA 4RQOA 5EB0A 4IIJB 5J2TB 1GX1A 1NMUB 5EB1B 1U40A 2BO1A 1KNJA 5IJ0A 1M1KH 4ZHYB 1W3EX 4I55B 3TD3A 3G71F 4X1IA 2HP0A 4BY9D 1K9MH 4O4HB 3ELCA 5CB4B 2ZVYA 5GIPC 4BT7A 3VYSC 3RYHB 3CXCF 5ITZB 4NQ3A 1X7OA 3E22A 2N48A 1VK3A 4NUTA 5C8YB 1QD9A 1VQKF 3D00A 4C4WC 2ALEA 2HQSC 5FJ4C 3LWRC 3JASA 3MCAB 3RYFA 4O2BA 5MN5A 1ODEA 5JCOA 2HS3A 4M8IA 3AGKA 3HAXD 4HNAB 3RYIB 2W8BC 3CCSF 5ITZA 3I56F 1W57A 3MDOA 4TV9B 1VQ6F 3HKBA 5JH7B 4E6EA 4TZZA 2CW4A 3TD5A 1GO0A 2RHLA 2BTUA 1XRGA 2HP0B 3CB2A 2UYKA 3ESJA 3GTZA 3V3TA 3IKFA 2FGYA
chains in the Genus database with same CATH topology
3V7QA 1Q81H 4BVSA 1YJNF 3CCEF 4LCKA 3FFMA 1Q7YH 3J81M 1KQSF 2LBXA 2FC3A 1ZWZA 4BVRA 3JCMM 5G4VC 1SDSA 3NK6A 5GIOC 3CCVF 5HY2A 3O85A 1VQNF 4X3MA 2KTVA 2OHWA 2KTUA 3LWOC 3PLAC 2QEXF 3E20B 5HWEA 1RA4A 4X3LA 1XBIA 2QI2A 3LFOA 3G6EF 3LWQC 1CN7A 4EI9A 1JJ2F 4EI7A 5FLXM 2GLZA 1NJIH 1VQ5F 2OTLF 3G4SF 3V7EA 3VMFB 1T0KB 3OBWA 3SIUA 4EI8A 3CCMF 5A2QM 1KD1H 3VI6A 1X52A 1VQ8F 2VGNA 4BVTA 3RA5A 1GZ0A 1QVFF 4XCQA 3LWPC 3PAFA 1Q86H 3CD6F 5GAPK 2AIFA 2VGMA 2QA4F 1E7KA 3CMEF 4BW0B 5GANK 3CCQF 1YJ9F 1K8AH 3LWVC 1CK2A 1W42A 5IT9M 1M90H 3CCUF 1W2BF 3N4YA 3WXMB 1NMUB 1YJWF 1VQ9F 2BO1A 3I55F 2OZBA 1M1KH 3JAMM 3NK7A 1Q82H 1W3EX 1VQMF 3J80M 3G71F 1YI2F 3N4ZA 5EO3A 3CMAF 4BY9D 3J7AR 1K9MH 3CC2F 2JNBA 1YITF 1S72F 3OBYA 5EWRA 3NVIB 3SIVA 5GIPC 1KC8H 3CXCF 2CZWA 1H7MA 4NQ3A 1X7OA 1N8RH 4NUTA 5HY4A 3CPWF 1YIJF 3CC7F 1W41A 2KG4A 1VQKF 3D00A 4C4WC 2ALEA 3CG6A 5FJ4C 3LWRC 1IPAA 3MCAB 5HXUA 3RA6A 2OTJF 3IR9A 3CPQA 1PXWA 1VQOF 3CCRF 1K73H 3AGKA 3NMUC 3HAXD 5HY1A 2I6DA 1DT9A 1VQPF 1VQ7F 3CCSF 1W40A 3I56F 3CCJF 5HY0A 1VQ6F 5DCVA 3OW2F 1RLGA 3ON1A 3E1YA 4BVQA 2WALA 4TZZA 3NVKE 1GO1A 2LBWA 5GINC 1VQ4F 1X7PA 1GO0A 3CCLF 1YHQF 1QVGF 5HXZA 3V3TA 1VQLF 3CC4F 3HJWC 5G4UC 3GYQA 2HVYD 2F9ZC 2FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7Q A;  1Q81 H;  1YJN F;  3CCE F;  4LCK A;  3FFM A;  1Q7Y H;  3J81 M;  1KQS F;  2LBX A;  2FC3 A;  1ZWZ A;  3JCM M;  5G4V C;  1SDS A;  3NK6 A;  5GIO C;  3CCV F;  3O85 A;  1VQN F;  4X3M A;  2KTV A;  2OHW A;  2KTU A;  3LWO C;  3PLA C;  2QEX F;  3E20 B;  1RA4 A;  4X3L A;  1XBI A;  2QI2 A;  3LFO A;  3G6E F;  3LWQ C;  1CN7 A;  1JJ2 F;  5FLX M;  1NJI H;  1VQ5 F;  2OTL F;  3G4S F;  3V7E A;  3VMF B;  1T0K B;  3OBW A;  3SIU A;  3CCM F;  5A2Q M;  1KD1 H;  3VI6 A;  1X52 A;  1VQ8 F;  2VGN A;  3RA5 A;  1GZ0 A;  1QVF F;  3LWP C;  3PAF A;  1Q86 H;  3CD6 F;  5GAP K;  2AIF A;  2VGM A;  2QA4 F;  1E7K A;  3CME F;  4BW0 B;  5GAN K;  3CCQ F;  1YJ9 F;  1K8A H;  3LWV C;  1CK2 A;  1W42 A;  5IT9 M;  1M90 H;  3CCU F;  1W2B F;  3N4Y A;  3WXM B;  1NMU B;  1YJW F;  1VQ9 F;  2BO1 A;  3I55 F;  2OZB A;  1M1K H;  3JAM M;  3NK7 A;  1Q82 H;  1W3E X;  1VQM F;  3J80 M;  3G71 F;  1YI2 F;  3N4Z A;  5EO3 A;  3CMA F;  4BY9 D;  3J7A R;  1K9M H;  3CC2 F;  2JNB A;  1YIT F;  1S72 F;  3OBY A;  5EWR A;  3NVI B;  3SIV A;  5GIP C;  1KC8 H;  3CXC F;  2CZW A;  1H7M A;  1X7O A;  1N8R H;  4NUT A;  3CC7 F;  3CPW F;  1YIJ F;  1W41 A;  2KG4 A;  1VQK F;  4C4W C;  2ALE A;  3CG6 A;  5FJ4 C;  3LWR C;  1IPA A;  3MCA B;  3RA6 A;  2OTJ F;  3IR9 A;  3CPQ A;  1PXW A;  1VQO F;  3CCR F;  1K73 H;  3AGK A;  3NMU C;  3HAX D;  2I6D A;  1DT9 A;  1VQP F;  1VQ7 F;  3CCS F;  1W40 A;  3I56 F;  3CCJ F;  1VQ6 F;  5DCV A;  3OW2 F;  1RLG A;  3ON1 A;  3E1Y A;  3NVK E;  2WAL A;  4TZZ A;  1GO1 A;  2LBW A;  5GIN C;  1VQ4 F;  1X7P A;  1GO0 A;  3CCL F;  1YHQ F;  1QVG F;  3CC4 F;  1VQL F;  5G4U C;  3HJW C;  3GYQ A;  2HVY D; 
#chains in the Genus database with same CATH topology
 4O4L A;  1Q8R A;  3V7Q A;  3UT5 A;  3CCE F;  4O4I A;  4ZHQ B;  2UZH A;  3FD6 A;  5CA0 A;  1IV4 A;  3CYQ A;  3IEQ A;  5KX5 B;  1KQS F;  5G4V C;  4BT3 A;  4U3J A;  4DXD A;  4ZK7 A;  5LOV B;  5HP7 A;  3CCV F;  3JAW B;  3K0T A;  4TV9 A;  5HY2 A;  1X25 A;  5LP6 C;  3HKC B;  2IG8 A;  2R6R 1;  3WJQ A;  3FPI A;  2K1S A;  5IJ9 B;  2QI2 A;  3WJR A;  3Q8H A;  1W59 A;  3WGM A;  1U3P A;  4ZOL B;  3HKE A;  1U3L A;  3HKB B;  5JH7 A;  3MQW A;  5BMV A;  4FFB B;  1IV2 A;  2YYE A;  4X20 A;  2DT4 A;  3F0G A;  4WBN B;  4ZI7 B;  4C81 A;  3OBW A;  5JVD A;  3VI6 A;  1X52 A;  1GZ0 A;  1W55 A;  4XCQ A;  5GAP K;  3RYH A;  4IIJ A;  1J7H A;  1XHO A;  2UYN B;  4IHJ A;  3JAK A;  5IYZ A;  2QA4 F;  2IAF A;  4G4W A;  1IV3 A;  1YJ9 F;  3BYQ A;  3K12 A;  2B33 A;  3WPX A;  3KE1 A;  2CHT A;  1Z5W A;  2V9Y A;  4X1I B;  3CCU F;  3L7Q A;  3N4Y A;  3WXM B;  2ZVZ A;  1YJW F;  2CSL A;  1VQ9 F;  5MN4 A;  3P10 A;  5LOV A;  4TUY A;  1VQV A;  4X1K A;  5FNV B;  4C82 A;  3DDN A;  5EZY B;  2Z01 A;  4B62 A;  1SA0 B;  3RYC A;  1YI2 F;  1UFY A;  1FSZ A;  5EO3 A;  3CMA F;  1H48 A;  3OON A;  4NWO B;  3CC2 F;  1S72 F;  2RHJ A;  3NVI B;  3SIV A;  4BT5 A;  2Z1F A;  3C9R A;  3IEW A;  2EWC A;  3VOB A;  3S0H A;  5EIB C;  3S06 A;  1N8R H;  3HKD B;  3CC7 F;  5HY4 A;  1YIJ F;  5FNV A;  1W41 A;  2KG4 A;  4ZHQ A;  4U39 A;  3CG6 A;  3JAL B;  5KMG B;  1PF5 A;  2NMU A;  3CPQ A;  1PXW A;  4O2A A;  4BT6 A;  3CCR F;  1VQO F;  1K73 H;  5EZY A;  1IV1 A;  3M1X A;  3P4E A;  3JAS B;  1VQP F;  1VQ7 F;  1OAP A;  3M84 A;  3HKD A;  2HP3 A;  5HY0 A;  4G4Z A;  4TV8 A;  3ZOP A;  1W5B A;  4BVQ A;  2VXY A;  2WAL A;  5GIN C;  3CCL F;  5JVD B;  4ZI7 A;  1QVG F;  5LP6 A;  4YJ3 A;  2ZOV A;  3RE3 A;  2HVY D;  3LME A;  2CWJ A;  4BVS A;  2ZOD A;  1JN1 A;  1R1M A;  1YGY A;  3FFM A;  1Q7Y H;  3J81 M;  4I4T A;  4PWT A;  5LYJ B;  3C9U A;  4BVR A;  4DRX B;  2VAW A;  2HX0 A;  3FBA A;  1Z5V A;  5J2T A;  2QEX F;  3E20 B;  1QU9 A;  2RB9 A;  5CB4 A;  4X3L A;  2P6Y A;  4G4V A;  2AMT A;  4I50 B;  3QUW A;  3MBM A;  4O4I B;  4O4J A;  1CN7 A;  3CYP B;  3JAT A;  5FLX M;  1NJI H;  4B45 A;  1KNK A;  1VQ5 F;  2OTL F;  1T0K B;  2GVI A;  4EI8 A;  2RHO A;  5A2Q M;  3ZP4 A;  4BVT A;  3RA5 A;  4TUY B;  4X1K B;  4C8E A;  3C9S A;  2HRY A;  1QVF F;  1Q86 H;  2PHN A;  2CHS A;  4F6R B;  1COM A;  2VGM A;  3CME F;  3JAR B;  3WGK A;  3N2G A;  3U0O A;  1FFX A;  2AIZ P;  2BTQ B;  1M90 H;  1XV2 A;  2G9I A;  3JAK B;  2L26 A;  4O2B B;  2KGW A;  2CVL A;  4G4Y A;  3I3F A;  1ONI A;  3NK7 A;  1VQM F;  2HS4 A;  1YQN A;  5J2U B;  3JAL A;  3LDT A;  3J7A R;  5EYP B;  3RYF B;  3F0D A;  1YIT F;  3KJK A;  1VHA A;  3OBY A;  5EWR A;  1H47 A;  1TUB A;  1VH8 A;  3HKE B;  4YJ2 B;  5C8Y A;  2DYY A;  2ZAU A;  4ZHW A;  3HTN A;  2Z1T A;  4TV8 B;  1W5E A;  4ZHV A;  1OFU A;  5LA6 A;  3K14 A;  4HNA A;  3RYI A;  1T0A A;  3WGJ A;  3F0E A;  4O4H A;  2OTJ F;  4ZOL A;  5EYP A;  5LP6 B;  3UT5 B;  4I55 A;  3ZO8 A;  5HY1 A;  3T80 A;  2I6D A;  3K2X A;  1DT9 A;  4C8G A;  5LXT A;  3CCJ F;  2HS0 A;  2PMP A;  1W5A A;  1TUB B;  4YJ2 A;  4B5C A;  3ON1 A;  3E1Y A;  3NVK E;  3WJP A;  2LBW A;  1VQ4 F;  5B8F A;  4LNU B;  3S0Y A;  3VYT C;  3CC4 F;  1VQL F;  5G4U C;  1JFF A;  3HJW C;  3VYU C;  2F9Z C;  2R75 1;  4RHA A;  4LCK A;  2MQE A;  3C8L A;  4WBN A;  2LBX A;  3F6M A;  3KJJ A;  1ZWZ A;  3EOR A;  4YJ3 B;  3JCM M;  1DBF A;  1SZQ A;  5JCO C;  3VOA A;  3NK6 A;  5GIO C;  3FD5 A;  1FNK A;  2H8C A;  1VQN F;  2KTV A;  4BT2 A;  4C8I A;  2OHW A;  2KTU A;  4G88 A;  3PLA C;  4BT4 A;  5LXT B;  5HWE A;  3WPW A;  1XBI A;  3VO8 A;  3LWQ C;  3C9T A;  1JJ2 F;  3M4S A;  4EI7 A;  3VCZ A;  1SA0 A;  2GLZ A;  5KX5 A;  3G4S F;  2H8E A;  3VMF B;  4EB6 A;  2Z1E A;  3CCM F;  4X1Y A;  1VQ8 F;  4O4L B;  2RHH A;  2VAM A;  2VAP A;  3N2K B;  3S03 A;  3B6N A;  1TVK B;  3CD6 F;  2AIF A;  3D01 A;  5JQG B;  2YXZ A;  5CA1 A;  5GAN K;  3F0F A;  3CCQ F;  1K8A H;  1RLU A;  3VTI C;  5LA6 B;  2Q1X A;  3MCQ A;  3QTY A;  1TVK A;  5IT9 M;  2IQQ A;  5HP8 A;  5MN6 A;  5J2U A;  4X1Y B;  1W2B F;  1W58 1;  3V4D A;  3I55 F;  2UYP A;  4U3J B;  2OZB A;  3JAM M;  1QAH A;  1Q82 H;  2GZL A;  3J80 M;  4X20 B;  5EAZ A;  3N4Z A;  1JY8 A;  3JAT B;  1U43 A;  2JNB A;  1FFX B;  2UYJ A;  2H6L A;  3ERN A;  3KHN A;  1KC8 H;  4F6R A;  2LBT A;  2CZW A;  1H7M A;  5IYZ B;  5GON B;  4IHJ B;  3LYB A;  3CPW F;  3TD4 A;  5LYJ A;  5CA0 B;  1IPA A;  5HXU A;  3RA6 A;  2I6R A;  1JFF B;  3IR9 A;  4LNU A;  3NMU C;  4FFB A;  1FNJ A;  3RYC B;  3S02 A;  1RQ2 A;  1W40 A;  3D54 A;  2Q1Y A;  5GON A;  3E22 B;  1RQ7 A;  3JVH A;  4O4J B;  5DCV A;  4DRX A;  3OW2 F;  1RLG A;  1GO1 A;  1X7P A;  4EB6 B;  4G4X A;  4I4T B;  1NQ3 A;  5CA1 B;  4R40 B;  3VIU A;  1YHQ F;  2ZF8 A;  5HXZ A;  3GYQ A;  4O2A B;  1CLI A;  1Q81 H;  1YJN F;  3N2K A;  5KMG A;  2BTO A;  1JD1 A;  2FC3 A;  3IKE A;  4B46 A;  1UI9 A;  1SDS A;  2Z1U A;  3WGN A;  3KIZ A;  3O85 A;  4X3M A;  3P0Z A;  5BMV B;  3LWO C;  1RA4 A;  2UYN A;  1W5F A;  2QTP A;  3LFO A;  3HWU A;  5JQG A;  3N2G B;  3G6E F;  4KWE A;  4ERH A;  3IMP A;  3JAR A;  3S0W A;  3R0P A;  4EI9 A;  5EIB D;  3DC2 A;  5AVM A;  3V7E A;  3SIU A;  5IJ0 B;  1KD1 H;  2VGN A;  2HRU A;  3QHD A;  3LWP C;  3PAF A;  3ZP7 A;  3GHZ A;  2LCA A;  5IJ9 A;  1E7K A;  4BW0 B;  3WGL A;  4I50 A;  3LWV C;  2OTM A;  1CK2 A;  3HKC A;  3I7T A;  1W42 A;  3JAW A;  4RQO A;  5EB0 A;  4IIJ B;  5J2T B;  1GX1 A;  1NMU B;  5EB1 B;  1U40 A;  2BO1 A;  1KNJ A;  5IJ0 A;  1M1K H;  4ZHY B;  1W3E X;  4I55 B;  3TD3 A;  3G71 F;  4X1I A;  2HP0 A;  4BY9 D;  1K9M H;  4O4H B;  3ELC A;  5CB4 B;  2ZVY A;  5GIP C;  4BT7 A;  3VYS C;  3RYH B;  3CXC F;  5ITZ B;  4NQ3 A;  1X7O A;  3E22 A;  2N48 A;  1VK3 A;  4NUT A;  5C8Y B;  1QD9 A;  1VQK F;  3D00 A;  4C4W C;  2ALE A;  2HQS C;  5FJ4 C;  3LWR C;  3JAS A;  3MCA B;  3RYF A;  4O2B A;  5MN5 A;  1ODE A;  5JCO A;  2HS3 A;  4M8I A;  3AGK A;  3HAX D;  4HNA B;  3RYI B;  2W8B C;  3CCS F;  5ITZ A;  3I56 F;  1W57 A;  3MDO A;  4TV9 B;  1VQ6 F;  3HKB A;  5JH7 B;  4E6E A;  4TZZ A;  2CW4 A;  3TD5 A;  1GO0 A;  2RHL A;  2BTU A;  1XRG A;  2HP0 B;  3CB2 A;  2UYK A;  3ESJ A;  3GTZ A;  3V3T A;  3IKF A;  2FGY A; 
#chains in the Genus database with same CATH homology
 3V7Q A;  1Q81 H;  4BVS A;  1YJN F;  3CCE F;  4LCK A;  3FFM A;  1Q7Y H;  3J81 M;  1KQS F;  2LBX A;  2FC3 A;  1ZWZ A;  4BVR A;  3JCM M;  5G4V C;  1SDS A;  3NK6 A;  5GIO C;  3CCV F;  5HY2 A;  3O85 A;  1VQN F;  4X3M A;  2KTV A;  2OHW A;  2KTU A;  3LWO C;  3PLA C;  2QEX F;  3E20 B;  5HWE A;  1RA4 A;  4X3L A;  1XBI A;  2QI2 A;  3LFO A;  3G6E F;  3LWQ C;  1CN7 A;  4EI9 A;  1JJ2 F;  4EI7 A;  5FLX M;  2GLZ A;  1NJI H;  1VQ5 F;  2OTL F;  3G4S F;  3V7E A;  3VMF B;  1T0K B;  3OBW A;  3SIU A;  4EI8 A;  3CCM F;  5A2Q M;  1KD1 H;  3VI6 A;  1X52 A;  1VQ8 F;  2VGN A;  4BVT A;  3RA5 A;  1GZ0 A;  1QVF F;  4XCQ A;  3LWP C;  3PAF A;  1Q86 H;  3CD6 F;  5GAP K;  2AIF A;  2VGM A;  2QA4 F;  1E7K A;  3CME F;  4BW0 B;  5GAN K;  3CCQ F;  1YJ9 F;  1K8A H;  3LWV C;  1CK2 A;  1W42 A;  5IT9 M;  1M90 H;  3CCU F;  1W2B F;  3N4Y A;  3WXM B;  1NMU B;  1YJW F;  1VQ9 F;  2BO1 A;  3I55 F;  2OZB A;  1M1K H;  3JAM M;  3NK7 A;  1Q82 H;  1W3E X;  1VQM F;  3J80 M;  3G71 F;  1YI2 F;  3N4Z A;  5EO3 A;  3CMA F;  4BY9 D;  3J7A R;  1K9M H;  3CC2 F;  2JNB A;  1YIT F;  1S72 F;  3OBY A;  5EWR A;  3NVI B;  3SIV A;  5GIP C;  1KC8 H;  3CXC F;  2CZW A;  1H7M A;  4NQ3 A;  1X7O A;  1N8R H;  4NUT A;  5HY4 A;  3CPW F;  1YIJ F;  3CC7 F;  1W41 A;  2KG4 A;  1VQK F;  3D00 A;  4C4W C;  2ALE A;  3CG6 A;  5FJ4 C;  3LWR C;  1IPA A;  3MCA B;  5HXU A;  3RA6 A;  2OTJ F;  3IR9 A;  3CPQ A;  1PXW A;  1VQO F;  3CCR F;  1K73 H;  3AGK A;  3NMU C;  3HAX D;  5HY1 A;  2I6D A;  1DT9 A;  1VQP F;  1VQ7 F;  3CCS F;  1W40 A;  3I56 F;  3CCJ F;  5HY0 A;  1VQ6 F;  5DCV A;  3OW2 F;  1RLG A;  3ON1 A;  3E1Y A;  4BVQ A;  2WAL A;  4TZZ A;  3NVK E;  1GO1 A;  2LBW A;  5GIN C;  1VQ4 F;  1X7P A;  1GO0 A;  3CCL F;  1YHQ F;  1QVG F;  5HXZ A;  3V3T A;  1VQL F;  3CC4 F;  3HJW C;  5G4U C;  3GYQ A;  2HVY D;  2F9Z C;  2FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...