1VQPF

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqpF00
4X3LA 1GZ0A 1T0KB 1VQMF 1VQ9F 1SDSA 1DT9A 2QI2A 3V7QA 1K8AH 5GIPC 1CN7A 2LBWA 1VQ6F 5GIOC 3J80M 1YI2F 2OTJF 3E20B 1NMUB 1E7KA 1QVGF 1VQNF 3OBYA 1JJ2F 5GAPK 2I6DA 3LWVC 1PXWA 3I56F 5GANK 1VQ7F 2BO1A 5IT9M 5EWRA 1KD1H 1CK2A 2KTUA 3N4YA 5DCVA 1VQ4F 1YHQF 3OW2F 2OTLF 3E1YA 3NK6A 2ALEA 1W2BF 1W3EX 3CCEF 1K9MH 3VI6A 1Q81H 3G4SF 1VQ5F 2KTVA 1IPAA 1VQOF 1X7OA 5GINC 3LFOA 4NUTA 4LCKA 1YITF 3PAFA 3CCRF 1KQSF 3SIUA 1YJWF 4TZZA 2CZWA 3HAXD 2AIFA 1X52A 1Q7YH 1RLGA 3JAMM 3NMUC 3LWOC 3G71F 4X3MA 1Q82H 3LWPC 1M1KH 5FLXM 3CXCF 1N8RH 1W40A 2QA4F 3AGKA 2HVYD 1S72F 1GO0A 3RA6A 3CCLF 2LBXA 5G4VC 3G6EF 2OZBA 2KG4A 3V7EA 2VGNA 3WXMB 3MCAB 3OBWA 3CCMF 3CG6A 3FFMA 2JNBA 3NK7A 2OHWA 3CCQF 3CCVF 1VQPF 3CC4F 3PLAC 3O85A 3I55F 5A2QM 4BW0B 3CD6F 3IR9A 3NVIB 2QEXF 3CCJF 1X7PA 1W41A 3HJWC 3CCSF 1GO1A 2WALA 3CPWF 3CPQA 4C4WC 3CMEF 5EO3A 1XBIA 3GYQA 1H7MA 3LWRC 1M90H 1K73H 1YJ9F 3JCMM 1ZWZA 3CC2F 1YIJF 5G4UC 1YJNF 1VQLF 3J81M 3CCUF 1Q86H 4BY9D 1NJIH 2VGMA 1KC8H 1QVFF 5FJ4C 3CMAF 3LWQC 3N4ZA 3ON1A 3J7AR 3NVKE 3CC7F 3RA5A 3SIVA 1VQ8F 3VMFB 1VQKF 1W42A 2FC3A 1RA4A
chains in the Genus database with same CATH superfamily
1TUBB 3JAWA 3S02A 5B8FA 1U40A 1KNJA 1Z5VA 5LXTB 1T0KB 3R0PA 2IAFA 2ZOVA 2LCAA 2LBWA 1TVKA 4EB6A 5C8YA 4ZHYB 1VQ6F 3J80M 3ELCA 3E20B 1NMUB 1E7KA 2RHLA 3OBYA 5KX5A 1X25A 2I6DA 3IKEA 3FBAA 4BT3A 1IV4A 1W55A 5EWRA 1CK2A 5JQGA 5MN5A 2KTUA 5ITZB 3N4YA 4X1KA 3K12A 3WGMA 2OTLF 3NK6A 4YJ3A 2RHOA 2VAPA 2GVIA 1VH8A 5EIBC 3CB2A 2ZVZA 4TV9B 2NMUA 5IJ9B 1X7OA 5KMGA 1YITF 3PAFA 2LBTA 5BMVA 2F9ZC 4KWEA 4EI9A 3QTYA 3FPIA 3WPWA 4BT4A 5BMVB 5GONA 1R1MA 4O4IA 1Q7YH 5HY4A 2AIZP 3KE1A 1W57A 4TV9A 3VO8A 2L26A 2Z1TA 4X3MA 1Q8RA 3CXCF 1W40A 5KX5B 1FFXA 1VK3A 1S72F 3IMPA 4C8IA 4X1KB 3CCLF 1ONIA 3HKBA 4C81A 5ITZA 3G6EF 1YQNA 4BVRA 3K0TA 3P4EA 3F6MA 5JQGB 3MCAB 4DRXA 1KNKA 2JNBA 3CC4F 4TUYB 4F6RA 3JAWB 3P10A 1U3PA 4BW0B 4ZI7B 2VAWA 2QEXF 3JAKA 1YGYA 1SZQA 3VYSC 5LP6B 3CCSF 1GO1A 5LA6A 3CPQA 3GHZA 1TUBA 3CMEF 3C9TA 3IEQA 5EZYB 2CWJA 3MCQA 1ODEA 2Z1UA 2RHJA 3TD3A 3HKBB 4M8IA 5IJ0A 2CVLA 3HWUA 2VGMA 1FFXB 2HRYA 5FJ4C 5EYPA 4ZHQA 3MDOA 3IEWA 3C9SA 4U3JB 3D01A 3J7AR 1RA4A 3SIVA 3JARA 3M4SA 3I3FA 4O4IB 5JVDA 3F0GA 4R40B 1W42A 3C8LA 4BT7A 5JH7B 4NWOB 2FC3A 2P6YA 1PF5A 2N48A 3QUWA 2UYJA 5KMGB 2UYKA 4ZHVA 5HP7A 3JASA 2HP3A 5IJ9A 1VQMF 3WGNA 5JCOC 2QI2A 5GIPC 4DXDA 5IYZB 5HY1A 1W581 1JY8A 5LOVB 1FSZA 1VQNF 1QU9A 1JJ2F 3I56F 3IKFA 4B5CA 5GANK 4NQ3A 5IT9M 1W5BA 4G4YA 1KD1H 1CLIA 3GTZA 4IHJB 3Q8HA 4TV8A 5FNVB 2R6R1 1GX1A 2HP0A 2DT4A 2ALEA 3JALB 1W2BF 4EB6B 3I7TA 3CCEF 1K9MH 2CW4A 2UYNB 4O4LA 1IPAA 1VQOF 5GINC 3N2KB 4X20A 5CA1A 1IV3A 3CCRF 3HKDB 1KQSF 3SIUA 1YJWF 4TZZA 1JFFB 3HAXD 2AIFA 3VOAA 5MN4A 1IV2A 1SA0B 1XHOA 2HQSC 4O2BA 1RLGA 3JAMM 3LWOC 3WGKA 4I55A 3LWPC 3N2GA 3KIZA 5FLXM 5CB4A 1N8RH 5J2TA 5MN6A 5CA0B 2IG8A 5HY2A 2LBXA 5G4VC 2OZBA 4BT5A 2KG4A 3V7EA 2HS4A 1U43A 4I4TA 3RYHB 3CG6A 3WGJA 3CCQF 3S06A 3O85A 3P0ZA 3K2XA 3RYIB 3CD6F 1H48A 5J2UB 3RYFA 3C9RA 3HJWC 4O4HA 5LYJA 1XRGA 3RYCA 4O2AA 2WALA 3K14A 3VIUA 3VOBA 2PMPA 3TD5A 3V3TA 4BVTA 4X1IB 1K73H 1YIJF 5G4UC 1QAHA 2YYEA 2HS0A 3CYPB 4BY9D 1NJIH 1IV1A 3QHDA 3F0FA 3V4DA 4C82A 3HKCB 3MBMA 3CMAF 3LWQC 3U0OA 3HKEA 3CC7F 3LMEA 2W8BC 1JD1A 2BTUA 3F0DA 1GO0A 4YJ2B 1J7HA 2UZHA 3DDNA 3EORA 2ZODA 4LNUA 2H8EA 4X3LA 4G4ZA 1VQ9F 2HX0A 1SDSA 3JVHA 1K8AH 1VHAA 1DBFA 2R751 2CSLA 5GIOC 4RQOA 4X1YB 1QD9A 4I50A 1YI2F 3HKCA 1W5EA 3JATA 2BTQB 4EI8A 5GAPK 4E6EA 2ZAUA 3UT5B 1PXWA 3E22A 1VQ7F 1FNJA 3S03A 2QTPA 3D54A 4BT2A 3VCZA 1H47A 5DCVA 1YHQF 3OW2F 4ZOLA 1W3EX 5EB0A 3D00A 4O4HB 5LYJB 2V9YA 1Q81H 2KTVA 4BT6A 3VYUC 4NUTA 4G88A 4WBNB 3RYFB 4HNAB 3LDTA 3FD6A 4ZOLB 5LP6C 1X52A 3F0EA 3KJJA 3RYIA 2CHTA 3ERNA 4G4WA 3NMUC 3G71F 3WJPA 1M1KH 3UT5A 4IIJA 3RE3A 2Z01A 1RQ2A 3AGKA 2HVYD 4RHAA 5CA0A 4X1YA 3RA6A 3C9UA 2MQEA 4I55B 3TD4A 2VGNA 3OBWA 1T0AA 5JCOA 3E22B 3FFMA 3WPXA 3CCVF 2OHWA 1OFUA 1VQPF 3I55F 3WJRA 4O4JB 5EAZA 3JATB 3KJKA 4ZHWA 3IR9A 3WGLA 3M1XA 4FFBB 3HTNA 5CA1B 1X7PA 1W41A 2Q1YA 4LNUB 4FFBA 3CPWF 2OTMA 1Z5WA 4C4WC 4C8EA 4O4JA 5EO3A 3GYQA 1JN1A 1RQ7A 4YJ2A 1YJ9F 3JCMM 1ZWZA 3B6NA 3CC2F 3WJQA 4B46A 2HRUA 5HWEA 5HY0A 3FD5A 3L7QA 5HP8A 3HKEB 4B62A 3J81M 3ZOPA 3CCUF 2PHNA 4X1IA 2G9IA 5LOVA 1KC8H 4IIJB 3RYCB 1NQ3A 3N4ZA 3ON1A 3NVKE 5EIBD 3RA5A 2DYYA 2CHSA 3VMFB 1VQKF 1FNKA 4BVSA 5JH7A 4HNAA 2RHHA 3S0YA 4WBNA 4EI7A 4O2AB 1GZ0A 3BYQA 2H6LA 1DT9A 3V7QA 4ZK7A 1CN7A 3CYQA 4ZHQB 2OTJF 1QVGF 5J2TB 2ZF8A 3LWVC 3OONA 3S0WA 3VTIC 1VQVA 2BO1A 2EWCA 2I6RA 3LYBA 2K1SA 3KHNA 5EZYA 4G4VA 4ERHA 1VQ4F 4I50B 3E1YA 1UI9A 3M84A 5LA6B 3N2KA 5CB4B 3VI6A 3G4SF 1VQ5F 2UYNA 5LP6A 3LFOA 4LCKA 1W59A 3JAKB 1SA0A 3JALA 2HP0B 5EB1B 4C8GA 2CZWA 4ZI7A 5FNVA 4IHJA 2YXZA 3HKDA 4F6RB 4TUYA 4X20B 4DRXB 4O4LB 2GZLA 4G4XA 1Q82H 1RLUA 3ZO8A 3ZP4A 2QA4F 4BVQA 3ESJA 4TV8B 2B33A 2GLZA 3WXMB 3CCMF 3JASB 3NK7A 2VAMA 2VXYA 5GONB 3PLAC 2UYPA 2HS3A 1UFYA 4B45A 5A2QM 3NVIB 3CCJF 5IYZA 3JARB 3T80A 5J2UA 4YJ3B 1COMA 3S0HA 3ZP7A 1XBIA 5AVMA 2Q1XA 1H7MA 2ZVYA 5IJ0B 3LWRC 1M90H 5JVDB 4PWTA 1OAPA 4I4TB 3RYHA 3VYTC 1U3LA 1YJNF 1W5AA 1VQLF 4U3JA 1Q86H 5EYPB 5HXUA 3DC2A 4XCQA 1XV2A 1QVFF 2FGYA 2KGWA 3N2GB 5C8YB 2H8CA 1TVKB 4U39A 2AMTA 2BTOA 1W5FA 5HXZA 4O2BB 5LXTA 1VQ8F 2RB9A 2IQQA 3MQWA 2Z1EA 2Z1FA 1JFFA
chains in the Genus database with same CATH topology
4EI7A 4X3LA 1GZ0A 1T0KB 1VQMF 1VQ9F 1SDSA 1DT9A 2QI2A 3V7QA 1K8AH 5GIPC 1CN7A 2LBWA 1VQ6F 5HY1A 5GIOC 3J80M 1YI2F 2OTJF 3E20B 1NMUB 1E7KA 1QVGF 1VQNF 3OBYA 1JJ2F 4EI8A 5GAPK 2I6DA 3LWVC 1PXWA 3I56F 5GANK 4NQ3A 1VQ7F 2BO1A 5IT9M 5EWRA 1KD1H 1CK2A 2KTUA 3N4YA 5DCVA 1VQ4F 1YHQF 3OW2F 2OTLF 3E1YA 3NK6A 2ALEA 1W2BF 1W3EX 3CCEF 3D00A 1K9MH 3VI6A 1Q81H 3G4SF 1VQ5F 2KTVA 1IPAA 1VQOF 1X7OA 5GINC 3LFOA 4NUTA 4LCKA 1YITF 3PAFA 3CCRF 1KQSF 3SIUA 1YJWF 2F9ZC 4EI9A 4TZZA 2CZWA 3HAXD 2AIFA 1X52A 1Q7YH 5HY4A 1RLGA 3JAMM 3NMUC 3LWOC 3G71F 4X3MA 1Q82H 3LWPC 1M1KH 5FLXM 3CXCF 1N8RH 1W40A 2QA4F 3AGKA 2HVYD 4BVQA 1S72F 1GO0A 3RA6A 3CCLF 5HY2A 2LBXA 5G4VC 3G6EF 2OZBA 2KG4A 4BVRA 3V7EA 2GLZA 2VGNA 3WXMB 3MCAB 3OBWA 3CCMF 3CG6A 3FFMA 2JNBA 3NK7A 2OHWA 3CCQF 3CCVF 1VQPF 3CC4F 3PLAC 3O85A 3I55F 5A2QM 4BW0B 3CD6F 3IR9A 3NVIB 2QEXF 3CCJF 1X7PA 1W41A 3HJWC 3CCSF 1GO1A 2WALA 3CPWF 3CPQA 4C4WC 3CMEF 3V3TA 5EO3A 1XBIA 3GYQA 4BVTA 1H7MA 3LWRC 1M90H 1K73H 1YJ9F 3JCMM 1ZWZA 3CC2F 5HWEA 1YIJF 5G4UC 5HY0A 1YJNF 1VQLF 3J81M 3CCUF 1Q86H 4BY9D 1NJIH 5HXUA 4XCQA 2VGMA 1KC8H 1QVFF 5FJ4C 3CMAF 2FGYA 3LWQC 3N4ZA 3ON1A 3J7AR 3NVKE 3CC7F 3RA5A 3SIVA 5HXZA 1VQ8F 3VMFB 1VQKF 1W42A 4BVSA 2FC3A 1RA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3L A;  1GZ0 A;  1T0K B;  1VQM F;  1VQ9 F;  1SDS A;  1DT9 A;  2QI2 A;  3V7Q A;  1K8A H;  5GIP C;  1CN7 A;  2LBW A;  1VQ6 F;  5GIO C;  3J80 M;  1YI2 F;  2OTJ F;  3E20 B;  1NMU B;  1E7K A;  1QVG F;  1VQN F;  3OBY A;  1JJ2 F;  5GAP K;  2I6D A;  3LWV C;  1PXW A;  3I56 F;  5GAN K;  1VQ7 F;  2BO1 A;  5IT9 M;  5EWR A;  1KD1 H;  1CK2 A;  2KTU A;  3N4Y A;  5DCV A;  1VQ4 F;  1YHQ F;  3OW2 F;  2OTL F;  3E1Y A;  3NK6 A;  2ALE A;  1W2B F;  1W3E X;  3CCE F;  1K9M H;  3VI6 A;  1Q81 H;  3G4S F;  1VQ5 F;  2KTV A;  1IPA A;  1VQO F;  1X7O A;  5GIN C;  3LFO A;  4NUT A;  4LCK A;  1YIT F;  3PAF A;  3CCR F;  1KQS F;  3SIU A;  1YJW F;  4TZZ A;  2CZW A;  3HAX D;  2AIF A;  1X52 A;  1Q7Y H;  1RLG A;  3JAM M;  3NMU C;  3LWO C;  3G71 F;  4X3M A;  1Q82 H;  3LWP C;  1M1K H;  5FLX M;  3CXC F;  1N8R H;  1W40 A;  2QA4 F;  3AGK A;  2HVY D;  1S72 F;  1GO0 A;  3RA6 A;  3CCL F;  2LBX A;  5G4V C;  3G6E F;  2OZB A;  2KG4 A;  3V7E A;  2VGN A;  3WXM B;  3MCA B;  3OBW A;  3CCM F;  3CG6 A;  3FFM A;  2JNB A;  3NK7 A;  2OHW A;  3CCQ F;  3CCV F;  1VQP F;  3CC4 F;  3PLA C;  3O85 A;  3I55 F;  5A2Q M;  4BW0 B;  3CD6 F;  3IR9 A;  3NVI B;  2QEX F;  3CCJ F;  1X7P A;  1W41 A;  3HJW C;  3CCS F;  1GO1 A;  2WAL A;  3CPW F;  3CPQ A;  4C4W C;  3CME F;  5EO3 A;  1XBI A;  3GYQ A;  1H7M A;  3LWR C;  1M90 H;  1K73 H;  1YJ9 F;  3JCM M;  1ZWZ A;  3CC2 F;  1YIJ F;  5G4U C;  1YJN F;  1VQL F;  3J81 M;  3CCU F;  1Q86 H;  4BY9 D;  1NJI H;  2VGM A;  1KC8 H;  1QVF F;  5FJ4 C;  3CMA F;  3LWQ C;  3N4Z A;  3ON1 A;  3J7A R;  3NVK E;  3CC7 F;  3RA5 A;  3SIV A;  1VQ8 F;  3VMF B;  1VQK F;  1W42 A;  2FC3 A;  1RA4 A; 
#chains in the Genus database with same CATH topology
 1TUB B;  3JAW A;  3S02 A;  5B8F A;  1U40 A;  1KNJ A;  1Z5V A;  5LXT B;  1T0K B;  3R0P A;  2IAF A;  2ZOV A;  2LCA A;  2LBW A;  1TVK A;  4EB6 A;  5C8Y A;  4ZHY B;  1VQ6 F;  3J80 M;  3ELC A;  3E20 B;  1NMU B;  1E7K A;  2RHL A;  3OBY A;  5KX5 A;  1X25 A;  2I6D A;  3IKE A;  3FBA A;  4BT3 A;  1IV4 A;  1W55 A;  5EWR A;  1CK2 A;  5JQG A;  5MN5 A;  2KTU A;  5ITZ B;  3N4Y A;  4X1K A;  3K12 A;  3WGM A;  2OTL F;  3NK6 A;  4YJ3 A;  2RHO A;  2VAP A;  2GVI A;  1VH8 A;  5EIB C;  3CB2 A;  2ZVZ A;  4TV9 B;  2NMU A;  5IJ9 B;  1X7O A;  5KMG A;  1YIT F;  3PAF A;  2LBT A;  5BMV A;  2F9Z C;  4KWE A;  4EI9 A;  3QTY A;  3FPI A;  3WPW A;  4BT4 A;  5BMV B;  5GON A;  1R1M A;  4O4I A;  1Q7Y H;  5HY4 A;  2AIZ P;  3KE1 A;  1W57 A;  4TV9 A;  3VO8 A;  2L26 A;  2Z1T A;  4X3M A;  1Q8R A;  3CXC F;  1W40 A;  5KX5 B;  1FFX A;  1VK3 A;  1S72 F;  3IMP A;  4C8I A;  4X1K B;  3CCL F;  1ONI A;  3HKB A;  4C81 A;  5ITZ A;  3G6E F;  1YQN A;  4BVR A;  3K0T A;  3P4E A;  3F6M A;  5JQG B;  3MCA B;  4DRX A;  1KNK A;  2JNB A;  3CC4 F;  4TUY B;  4F6R A;  3JAW B;  3P10 A;  1U3P A;  4BW0 B;  4ZI7 B;  2VAW A;  2QEX F;  3JAK A;  1YGY A;  1SZQ A;  3VYS C;  5LP6 B;  3CCS F;  1GO1 A;  5LA6 A;  3CPQ A;  3GHZ A;  1TUB A;  3CME F;  3C9T A;  3IEQ A;  5EZY B;  2CWJ A;  3MCQ A;  1ODE A;  2Z1U A;  2RHJ A;  3TD3 A;  3HKB B;  4M8I A;  5IJ0 A;  2CVL A;  3HWU A;  2VGM A;  1FFX B;  2HRY A;  5FJ4 C;  5EYP A;  4ZHQ A;  3MDO A;  3IEW A;  3C9S A;  4U3J B;  3D01 A;  3J7A R;  1RA4 A;  3SIV A;  3JAR A;  3M4S A;  3I3F A;  4O4I B;  5JVD A;  3F0G A;  4R40 B;  1W42 A;  3C8L A;  4BT7 A;  5JH7 B;  4NWO B;  2FC3 A;  2P6Y A;  1PF5 A;  2N48 A;  3QUW A;  2UYJ A;  5KMG B;  2UYK A;  4ZHV A;  5HP7 A;  3JAS A;  2HP3 A;  5IJ9 A;  1VQM F;  3WGN A;  5JCO C;  2QI2 A;  5GIP C;  4DXD A;  5IYZ B;  5HY1 A;  1W58 1;  1JY8 A;  5LOV B;  1FSZ A;  1VQN F;  1QU9 A;  1JJ2 F;  3I56 F;  3IKF A;  4B5C A;  5GAN K;  4NQ3 A;  5IT9 M;  1W5B A;  4G4Y A;  1KD1 H;  1CLI A;  3GTZ A;  4IHJ B;  3Q8H A;  4TV8 A;  5FNV B;  2R6R 1;  1GX1 A;  2HP0 A;  2DT4 A;  2ALE A;  3JAL B;  1W2B F;  4EB6 B;  3I7T A;  3CCE F;  1K9M H;  2CW4 A;  2UYN B;  4O4L A;  1IPA A;  1VQO F;  5GIN C;  3N2K B;  4X20 A;  5CA1 A;  1IV3 A;  3CCR F;  3HKD B;  1KQS F;  3SIU A;  1YJW F;  4TZZ A;  1JFF B;  3HAX D;  2AIF A;  3VOA A;  5MN4 A;  1IV2 A;  1SA0 B;  1XHO A;  2HQS C;  4O2B A;  1RLG A;  3JAM M;  3LWO C;  3WGK A;  4I55 A;  3LWP C;  3N2G A;  3KIZ A;  5FLX M;  5CB4 A;  1N8R H;  5J2T A;  5MN6 A;  5CA0 B;  2IG8 A;  5HY2 A;  2LBX A;  5G4V C;  2OZB A;  4BT5 A;  2KG4 A;  3V7E A;  2HS4 A;  1U43 A;  4I4T A;  3RYH B;  3CG6 A;  3WGJ A;  3CCQ F;  3S06 A;  3O85 A;  3P0Z A;  3K2X A;  3RYI B;  3CD6 F;  1H48 A;  5J2U B;  3RYF A;  3C9R A;  3HJW C;  4O4H A;  5LYJ A;  1XRG A;  3RYC A;  4O2A A;  2WAL A;  3K14 A;  3VIU A;  3VOB A;  2PMP A;  3TD5 A;  3V3T A;  4BVT A;  4X1I B;  1K73 H;  1YIJ F;  5G4U C;  1QAH A;  2YYE A;  2HS0 A;  3CYP B;  4BY9 D;  1NJI H;  1IV1 A;  3QHD A;  3F0F A;  3V4D A;  4C82 A;  3HKC B;  3MBM A;  3CMA F;  3LWQ C;  3U0O A;  3HKE A;  3CC7 F;  3LME A;  2W8B C;  1JD1 A;  2BTU A;  3F0D A;  1GO0 A;  4YJ2 B;  1J7H A;  2UZH A;  3DDN A;  3EOR A;  2ZOD A;  4LNU A;  2H8E A;  4X3L A;  4G4Z A;  1VQ9 F;  2HX0 A;  1SDS A;  3JVH A;  1K8A H;  1VHA A;  1DBF A;  2R75 1;  2CSL A;  5GIO C;  4RQO A;  4X1Y B;  1QD9 A;  4I50 A;  1YI2 F;  3HKC A;  1W5E A;  3JAT A;  2BTQ B;  4EI8 A;  5GAP K;  4E6E A;  2ZAU A;  3UT5 B;  1PXW A;  3E22 A;  1VQ7 F;  1FNJ A;  3S03 A;  2QTP A;  3D54 A;  4BT2 A;  3VCZ A;  1H47 A;  5DCV A;  1YHQ F;  3OW2 F;  4ZOL A;  1W3E X;  5EB0 A;  3D00 A;  4O4H B;  5LYJ B;  2V9Y A;  1Q81 H;  2KTV A;  4BT6 A;  3VYU C;  4NUT A;  4G88 A;  4WBN B;  3RYF B;  4HNA B;  3LDT A;  3FD6 A;  4ZOL B;  5LP6 C;  1X52 A;  3F0E A;  3KJJ A;  3RYI A;  2CHT A;  3ERN A;  4G4W A;  3NMU C;  3G71 F;  3WJP A;  1M1K H;  3UT5 A;  4IIJ A;  3RE3 A;  2Z01 A;  1RQ2 A;  3AGK A;  2HVY D;  4RHA A;  5CA0 A;  4X1Y A;  3RA6 A;  3C9U A;  2MQE A;  4I55 B;  3TD4 A;  2VGN A;  3OBW A;  1T0A A;  5JCO A;  3E22 B;  3FFM A;  3WPX A;  3CCV F;  2OHW A;  1OFU A;  1VQP F;  3I55 F;  3WJR A;  4O4J B;  5EAZ A;  3JAT B;  3KJK A;  4ZHW A;  3IR9 A;  3WGL A;  3M1X A;  4FFB B;  3HTN A;  5CA1 B;  1X7P A;  1W41 A;  2Q1Y A;  4LNU B;  4FFB A;  3CPW F;  2OTM A;  1Z5W A;  4C4W C;  4C8E A;  4O4J A;  5EO3 A;  3GYQ A;  1JN1 A;  1RQ7 A;  4YJ2 A;  1YJ9 F;  3JCM M;  1ZWZ A;  3B6N A;  3CC2 F;  3WJQ A;  4B46 A;  2HRU A;  5HWE A;  5HY0 A;  3FD5 A;  3L7Q A;  5HP8 A;  3HKE B;  4B62 A;  3J81 M;  3ZOP A;  3CCU F;  2PHN A;  4X1I A;  2G9I A;  5LOV A;  1KC8 H;  4IIJ B;  3RYC B;  1NQ3 A;  3N4Z A;  3ON1 A;  3NVK E;  5EIB D;  3RA5 A;  2DYY A;  2CHS A;  3VMF B;  1VQK F;  1FNK A;  4BVS A;  5JH7 A;  4HNA A;  2RHH A;  3S0Y A;  4WBN A;  4EI7 A;  4O2A B;  1GZ0 A;  3BYQ A;  2H6L A;  1DT9 A;  3V7Q A;  4ZK7 A;  1CN7 A;  3CYQ A;  4ZHQ B;  2OTJ F;  1QVG F;  5J2T B;  2ZF8 A;  3LWV C;  3OON A;  3S0W A;  3VTI C;  1VQV A;  2BO1 A;  2EWC A;  2I6R A;  3LYB A;  2K1S A;  3KHN A;  5EZY A;  4G4V A;  4ERH A;  1VQ4 F;  4I50 B;  3E1Y A;  1UI9 A;  3M84 A;  5LA6 B;  3N2K A;  5CB4 B;  3VI6 A;  3G4S F;  1VQ5 F;  2UYN A;  5LP6 A;  3LFO A;  4LCK A;  1W59 A;  3JAK B;  1SA0 A;  3JAL A;  2HP0 B;  5EB1 B;  4C8G A;  2CZW A;  4ZI7 A;  5FNV A;  4IHJ A;  2YXZ A;  3HKD A;  4F6R B;  4TUY A;  4X20 B;  4DRX B;  4O4L B;  2GZL A;  4G4X A;  1Q82 H;  1RLU A;  3ZO8 A;  3ZP4 A;  2QA4 F;  4BVQ A;  3ESJ A;  4TV8 B;  2B33 A;  2GLZ A;  3WXM B;  3CCM F;  3JAS B;  3NK7 A;  2VAM A;  2VXY A;  5GON B;  3PLA C;  2UYP A;  2HS3 A;  1UFY A;  4B45 A;  5A2Q M;  3NVI B;  3CCJ F;  5IYZ A;  3JAR B;  3T80 A;  5J2U A;  4YJ3 B;  1COM A;  3S0H A;  3ZP7 A;  1XBI A;  5AVM A;  2Q1X A;  1H7M A;  2ZVY A;  5IJ0 B;  3LWR C;  1M90 H;  5JVD B;  4PWT A;  1OAP A;  4I4T B;  3RYH A;  3VYT C;  1U3L A;  1YJN F;  1W5A A;  1VQL F;  4U3J A;  1Q86 H;  5EYP B;  5HXU A;  3DC2 A;  4XCQ A;  1XV2 A;  1QVF F;  2FGY A;  2KGW A;  3N2G B;  5C8Y B;  2H8C A;  1TVK B;  4U39 A;  2AMT A;  2BTO A;  1W5F A;  5HXZ A;  4O2B B;  5LXT A;  1VQ8 F;  2RB9 A;  2IQQ A;  3MQW A;  2Z1E A;  2Z1F A;  1JFF A; 
#chains in the Genus database with same CATH homology
 4EI7 A;  4X3L A;  1GZ0 A;  1T0K B;  1VQM F;  1VQ9 F;  1SDS A;  1DT9 A;  2QI2 A;  3V7Q A;  1K8A H;  5GIP C;  1CN7 A;  2LBW A;  1VQ6 F;  5HY1 A;  5GIO C;  3J80 M;  1YI2 F;  2OTJ F;  3E20 B;  1NMU B;  1E7K A;  1QVG F;  1VQN F;  3OBY A;  1JJ2 F;  4EI8 A;  5GAP K;  2I6D A;  3LWV C;  1PXW A;  3I56 F;  5GAN K;  4NQ3 A;  1VQ7 F;  2BO1 A;  5IT9 M;  5EWR A;  1KD1 H;  1CK2 A;  2KTU A;  3N4Y A;  5DCV A;  1VQ4 F;  1YHQ F;  3OW2 F;  2OTL F;  3E1Y A;  3NK6 A;  2ALE A;  1W2B F;  1W3E X;  3CCE F;  3D00 A;  1K9M H;  3VI6 A;  1Q81 H;  3G4S F;  1VQ5 F;  2KTV A;  1IPA A;  1VQO F;  1X7O A;  5GIN C;  3LFO A;  4NUT A;  4LCK A;  1YIT F;  3PAF A;  3CCR F;  1KQS F;  3SIU A;  1YJW F;  2F9Z C;  4EI9 A;  4TZZ A;  2CZW A;  3HAX D;  2AIF A;  1X52 A;  1Q7Y H;  5HY4 A;  1RLG A;  3JAM M;  3NMU C;  3LWO C;  3G71 F;  4X3M A;  1Q82 H;  3LWP C;  1M1K H;  5FLX M;  3CXC F;  1N8R H;  1W40 A;  2QA4 F;  3AGK A;  2HVY D;  4BVQ A;  1S72 F;  1GO0 A;  3RA6 A;  3CCL F;  5HY2 A;  2LBX A;  5G4V C;  3G6E F;  2OZB A;  2KG4 A;  4BVR A;  3V7E A;  2GLZ A;  2VGN A;  3WXM B;  3MCA B;  3OBW A;  3CCM F;  3CG6 A;  3FFM A;  2JNB A;  3NK7 A;  2OHW A;  3CCQ F;  3CCV F;  1VQP F;  3CC4 F;  3PLA C;  3O85 A;  3I55 F;  5A2Q M;  4BW0 B;  3CD6 F;  3IR9 A;  3NVI B;  2QEX F;  3CCJ F;  1X7P A;  1W41 A;  3HJW C;  3CCS F;  1GO1 A;  2WAL A;  3CPW F;  3CPQ A;  4C4W C;  3CME F;  3V3T A;  5EO3 A;  1XBI A;  3GYQ A;  4BVT A;  1H7M A;  3LWR C;  1M90 H;  1K73 H;  1YJ9 F;  3JCM M;  1ZWZ A;  3CC2 F;  5HWE A;  1YIJ F;  5G4U C;  5HY0 A;  1YJN F;  1VQL F;  3J81 M;  3CCU F;  1Q86 H;  4BY9 D;  1NJI H;  5HXU A;  4XCQ A;  2VGM A;  1KC8 H;  1QVF F;  5FJ4 C;  3CMA F;  2FGY A;  3LWQ C;  3N4Z A;  3ON1 A;  3J7A R;  3NVK E;  3CC7 F;  3RA5 A;  3SIV A;  5HXZ A;  1VQ8 F;  3VMF B;  1VQK F;  1W42 A;  4BVS A;  2FC3 A;  1RA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...