3FFMA

The crystal structure of human gadd45g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
STARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest and DNA-damage-inducible protein GADD45 gamma
publication title The crystal structure of human Gadd45g
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 50
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ffmA00
3E1YA 3CD6F 3CXCF 3JCMM 1YJNF 1YI2F 1X52A 3I55F 2KTVA 1VQPF 1YJ9F 3CC7F 5GIPC 1W40A 1W41A 5FLXM 1KD1H 4BY9D 1CN7A 1SDSA 2AIFA 3NK7A 3CC2F 2QA4F 1PXWA 4BW0B 1VQ8F 3PLAC 4TZZA 2WALA 5G4UC 1N8RH 1VQ6F 5GIOC 3AGKA 1W2BF 1S72F 3OW2F 3CMAF 2VGMA 2ALEA 3LWVC 3CCMF 2FC3A 1GZ0A 5GANK 1K9MH 3LFOA 4NUTA 1VQ5F 3N4YA 3V7EA 3IR9A 3CPQA 1VQ7F 3PAFA 3LWRC 3ON1A 4C4WC 3J7AR 2KG4A 5A2QM 2OZBA 3CCSF 1NJIH 5GINC 3CCQF 5G4VC 1YIJF 3CG6A 3VMFB 5EO3A 1XBIA 3HJWC 2BO1A 2OTLF 3G71F 3NVKE 3RA5A 3CC4F 2QI2A 1VQLF 3RA6A 1GO1A 3CPWF 1VQ4F 1W3EX 3LWQC 3E20B 1VQNF 1NMUB 5DCVA 3CCEF 1K73H 1RLGA 2LBXA 3LWOC 1IPAA 3SIVA 1RA4A 3CCRF 1QVGF 1KQSF 1K8AH 3SIUA 2OHWA 3MCAB 2QEXF 3WXMB 5GAPK 1KC8H 1Q82H 3V7QA 1JJ2F 3NMUC 3J80M 3NK6A 1VQMF 1X7PA 1T0KB 3J81M 1GO0A 1YJWF 1H7MA 1Q86H 3GYQA 3OBYA 1YITF 2KTUA 3G4SF 4X3LA 5IT9M 1X7OA 1VQKF 3N4ZA 1ZWZA 1Q81H 3G6EF 2OTJF 5EWRA 2I6DA 2HVYD 3CCUF 2JNBA 3CCLF 1E7KA 1W42A 3OBWA 2CZWA 1YHQF 3HAXD 3NVIB 3CCVF 3O85A 3LWPC 3I56F 1M1KH 1M90H 1VQ9F 2VGNA 3FFMA 4X3MA 3JAMM 3CMEF 1QVFF 1VQOF 5FJ4C 1DT9A 2LBWA 1CK2A 4LCKA 3VI6A 3CCJF 1Q7YH
chains in the Genus database with same CATH superfamily
3E1YA 5KMGB 2HP0B 3M1XA 3JCMM 1YI2F 1X52A 3MDOA 4X20B 5GONA 1U43A 3MCQA 4PWTA 3CC7F 2RB9A 1KD1H 4ZK7A 2ZODA 3LDTA 2IAFA 1W57A 1PXWA 4BW0B 4G4XA 1VK3A 5JCOC 5GIOC 5EYPB 4BT7A 4I4TB 5CA1A 3OW2F 3CMAF 3N2GB 5EZYA 3RYIA 2VGMA 5ITZA 2FC3A 1GZ0A 4G4WA 5GANK 1K9MH 3LFOA 5IJ0B 1QAHA 3BYQA 3FD6A 3PAFA 2RHLA 4YJ3A 2UZHA 3J7AR 3JAKA 3ZP4A 4BVRA 2PMPA 3F0FA 5A2QM 3JASA 5EAZA 5GINC 4RQOA 5FNVB 1T0AA 5LA6B 5HP7A 1OFUA 5G4VC 2N48A 1TUBA 3CG6A 5EO3A 4BVSA 3I7TA 2CW4A 4TV8B 2GVIA 2OTLF 4FFBA 3RA5A 2QI2A 3JARA 5B8FA 3RA6A 1GO1A 3WGLA 1W3EX 3VOBA 5HXZA 2QTPA 4IHJA 4IIJA 4DRXB 4HNAB 5CA0A 1RA4A 3CCRF 2Z1FA 4O4JA 1KQSF 1IV2A 2OHWA 1JFFA 3K2XA 3HKCA 1SZQA 1QD9A 4X1YB 3TD3A 5LXTA 3HKEB 5LP6A 3NK6A 2LCAA 1GO0A 1YJWF 4U3JB 5EIBD 1FFXA 3K12A 3VYSC 3F0EA 4O2AA 3UT5B 3G4SF 2HS3A 3F6MA 3P10A 4B62A 4BT4A 1VQKF 3VIUA 3HKBB 1ZWZA 4G4ZA 5IJ9A 3D00A 5EWRA 3B6NA 5BMVA 1JD1A 3C9UA 2HVYD 3CCUF 3JAWA 1JY8A 3CCLF 4O4IB 1W5FA 2CZWA 1YHQF 4NWOB 3NVIB 3CCVF 3LWPC 1M90H 3HTNA 5JQGB 1QVFF 1H48A 5JVDA 2CHTA 4YJ2B 4O2BA 4BT2A 3ELCA 5HY0A 3I3FA 1W5EA 4ZHWA 3CXCF 3S0WA 3RYCB 3GTZA 3QHDA 5CB4B 3WGMA 3GHZA 3ESJA 2G9IA 3HKDA 4BVTA 4ZI7A 3WJQA 2AIFA 1U3LA 1SDSA 2LBTA 4EI8A 3CC2F 1FSZA 4ZOLB 1TVKB 3S02A 1VQ8F 3PLAC 5LYJA 4TZZA 2WALA 5G4UC 3AGKA 2UYNB 3CYPB 5MN5A 4RHAA 4TV9A 2DYYA 4X1KB 4ZHVA 4O4LA 1VQ5F 4M8IA 4O4HA 3F0DA 4X1IA 3DC2A 1IV1A 5EIBC 2EWCA 3C8LA 3CPQA 3JATB 2R751 3LWRC 4LNUA 5C8YB 1KNJA 3ON1A 1CLIA 3M4SA 5HY1A 3ZOPA 3C9RA 1NJIH 1YIJF 3TD5A 3VMFB 3RYHB 2BO1A 1FNJA 4BT6A 3S0YA 5AVMA 5J2TA 2H8CA 3NVKE 3M84A 4WBNA 1VQ4F 5GONB 2HRUA 3P0ZA 2HS4A 1NMUB 3N2GA 2LBXA 5JH7A 4ERHA 1QVGF 4BT5A 1K8AH 3SIUA 2VAMA 3OONA 1RQ2A 5LP6C 3WXMB 5GAPK 4C8EA 2YXZA 3F0GA 1JJ2F 5HXUA 1VQVA 3E22B 3S0HA 1XV2A 2OTMA 2Q1XA 3K0TA 1VQMF 5EZYB 3RYIB 5ITZB 2ZAUA 2NMUA 4EB6B 3DDNA 3MQWA 1Q8RA 2H6LA 1SA0A 2IQQA 3RYFA 3WJRA 5J2UA 4YJ3B 3WGKA 4R40B 4U39A 5IT9M 2F9ZC 3JAKB 1Q81H 3G6EF 4I50A 3JASB 4NQ3A 2BTQB 2JNBA 2FGYA 3C9TA 1TUBB 1E7KA 1W42A 4ZHQA 5LOVA 3VO8A 3O85A 1VQ9F 2VGNA 4FFBB 3N2KA 4X3MA 3JAMM 1IV3A 3CMEF 4B46A 3JARB 3WGNA 2KGWA 2AIZP 2V9YA 2LBWA 4IHJB 2Z1EA 3VI6A 3CCJF 3CD6F 4IIJB 5IYZA 5CA0B 4O4JB 1JFFB 3HKCB 1IV4A 2KTVA 4G88A 5KX5A 1YJ9F 3JALA 5LXTB 5GIPC 1W40A 5FLXM 4BY9D 4C82A 5LP6B 3ZP7A 2QA4F 1XHOA 2RHHA 5EB0A 1N8RH 1VQ6F 1FFXB 4O2AB 2ZVYA 3K14A 4TUYA 3ZO8A 2ALEA 2Z1TA 5IJ9B 2K1SA 4DXDA 1UFYA 3V7EA 4G4VA 5BMVB 4KWEA 3JAWB 4F6RA 3LMEA 4C4WC 2KG4A 3IKFA 2OZBA 3ERNA 3CCSF 3IEWA 4BVQA 5JVDB 1XBIA 3EORA 1U40A 4O2BB 1TVKA 1VH8A 3CC4F 2Z1UA 1JN1A 1DBFA 3CPWF 1ONIA 3LYBA 2BTOA 1VQNF 5DCVA 1RLGA 3FD5A 3WPXA 3LWOC 3WJPA 3HKDB 3U0OA 4ZI7B 5KMGA 2HP0A 3Q8HA 4X20A 3KJKA 5HY2A 4I55B 1KC8H 5LYJB 4XCQA 4B5CA 4EI7A 3NMUC 1KNKA 3J80M 3KE1A 4TV9B 1X7PA 2GZLA 1W59A 2Q1YA 1COMA 1H7MA 4O4LB 5HY4A 4O4HB 4X1IB 5EB1B 3S03A 1W55A 5EYPA 1Q86H 1YITF 2UYKA 4I4TA 3VYTC 4EI9A 4X3LA 1X7OA 2ZF8A 4LNUB 3N4ZA 5HWEA 1R1MA 2OTJF 1ODEA 5IJ0A 1VHAA 2VAPA 2I6DA 1W5BA 3C9SA 3T80A 3VYUC 5MN6A 3I56F 5J2TB 1M1KH 3FFMA 5CA1B 1H47A 3E22A 3WGJA 5FNVA 5LA6A 1W581 4WBNB 5FJ4C 1RLUA 1QU9A 4LCKA 4TV8A 3JVHA 1X25A 4EB6A 3RE3A 5JH7B 3S06A 4C8IA 3R0PA 1YJNF 4B45A 3D01A 1Z5WA 3I55F 2H8EA 3FBAA 5MN4A 3V3TA 1VQPF 2CSLA 2HX0A 4C8GA 4DRXA 4HNAA 1W41A 1CN7A 3NK7A 1FNKA 4ZHYB 2YYEA 3HWUA 4X1YA 2GLZA 3HKEA 1W2BF 1SA0B 3IEQA 3QUWA 3RYFB 1S72F 5J2UB 3VTIC 2HP3A 3CCMF 3LWVC 2HRYA 5JCOA 2DT4A 2IG8A 3IMPA 4BT3A 4E6EA 1UI9A 4NUTA 4I50B 1OAPA 3N4YA 4U3JA 1Z5VA 2ZVZA 3CYQA 3UT5A 3IR9A 1VQ7F 1J7HA 4C81A 4ZHQB 3HKBA 3V4DA 5LOVB 2Z01A 2L26A 2RHOA 3N2KB 3CCQF 3MBMA 5HP8A 2CVLA 4O4IA 3P4EA 3HJWC 1GX1A 1NQ3A 2PHNA 5IYZB 3G71F 5JQGA 2VXYA 1VQLF 2W8BC 3IKEA 3LWQC 3E20B 4YJ2A 3CCEF 2R6R1 1K73H 2HS0A 5KX5B 3JALB 1IPAA 3SIVA 3WPWA 3RYCA 3MCAB 1U3PA 2QEXF 3QTYA 3VOAA 5CB4A 1YQNA 1Q82H 3V7QA 3D54A 1XRGA 3KIZA 2CWJA 3KJJA 4TUYB 3VCZA 2CHSA 2P6YA 1T0KB 3J81M 1YGYA 4ZOLA 2UYPA 2B33A 3GYQA 2I6RA 3OBYA 3FPIA 2UYNA 2KTUA 3KHNA 1RQ7A 4F6RB 3L7QA 1PF5A 4X1KA 2BTUA 2VAWA 2MQEA 3CB2A 3JATA 3OBWA 5C8YA 2AMTA 4I55A 3HAXD 2RHJA 4G4YA 1VQOF 2HQSC 1DT9A 2ZOVA 1CK2A 1W5AA 3RYHA 2UYJA 1Q7YH 3TD4A
chains in the Genus database with same CATH topology
3E1YA 5HY0A 3CD6F 3CXCF 3JCMM 1YJNF 1YI2F 1X52A 3I55F 2KTVA 1VQPF 3V3TA 1YJ9F 3CC7F 5GIPC 1W40A 1W41A 5FLXM 1KD1H 4BY9D 4BVTA 1CN7A 1SDSA 2AIFA 3NK7A 4EI8A 3CC2F 2QA4F 1PXWA 4BW0B 1VQ8F 3PLAC 4TZZA 2WALA 2GLZA 1N8RH 1VQ6F 5G4UC 5GIOC 3AGKA 1W2BF 1S72F 3OW2F 3CMAF 2VGMA 2ALEA 3LWVC 3CCMF 2FC3A 1GZ0A 5GANK 1K9MH 3LFOA 4NUTA 1VQ5F 3N4YA 3V7EA 3IR9A 3CPQA 1VQ7F 3PAFA 3LWRC 3ON1A 4C4WC 3J7AR 2KG4A 4BVRA 5A2QM 2OZBA 3CCSF 5HY1A 4BVQA 1NJIH 5GINC 3CCQF 5G4VC 1YIJF 3CG6A 3VMFB 5EO3A 1XBIA 4BVSA 3HJWC 2BO1A 2OTLF 3G71F 3NVKE 3RA5A 3CC4F 2QI2A 1VQLF 3RA6A 1GO1A 3CPWF 1VQ4F 1W3EX 3LWQC 3E20B 5HXZA 1VQNF 1NMUB 5DCVA 3CCEF 1K73H 1RLGA 2LBXA 3LWOC 1IPAA 3SIVA 1RA4A 3CCRF 1QVGF 1KQSF 1K8AH 3SIUA 2OHWA 3MCAB 5HY2A 2QEXF 3WXMB 5GAPK 1KC8H 1Q82H 3V7QA 4XCQA 1JJ2F 5HXUA 4EI7A 3NMUC 3J80M 3NK6A 1VQMF 1X7PA 1T0KB 3J81M 1GO0A 1YJWF 1H7MA 5HY4A 1Q86H 3GYQA 3OBYA 1YITF 2KTUA 4EI9A 4X3LA 3G4SF 5IT9M 1X7OA 1VQKF 2F9ZC 3N4ZA 5HWEA 1ZWZA 1Q81H 3G6EF 3D00A 2OTJF 5EWRA 4NQ3A 2I6DA 2HVYD 3CCUF 2JNBA 2FGYA 3CCLF 1E7KA 1W42A 3OBWA 2CZWA 1YHQF 3HAXD 3NVIB 3CCVF 3O85A 3LWPC 3I56F 1M1KH 1M90H 1VQ9F 2VGNA 3FFMA 4X3MA 3JAMM 3CMEF 1QVFF 1VQOF 5FJ4C 1DT9A 2LBWA 1CK2A 4LCKA 3VI6A 3CCJF 1Q7YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1Y A;  3CD6 F;  3CXC F;  3JCM M;  1YJN F;  1YI2 F;  1X52 A;  3I55 F;  2KTV A;  1VQP F;  1YJ9 F;  3CC7 F;  5GIP C;  1W40 A;  1W41 A;  5FLX M;  1KD1 H;  4BY9 D;  1CN7 A;  1SDS A;  2AIF A;  3NK7 A;  3CC2 F;  2QA4 F;  1PXW A;  4BW0 B;  1VQ8 F;  3PLA C;  4TZZ A;  2WAL A;  5G4U C;  1N8R H;  1VQ6 F;  5GIO C;  3AGK A;  1W2B F;  1S72 F;  3OW2 F;  3CMA F;  2VGM A;  2ALE A;  3LWV C;  3CCM F;  2FC3 A;  1GZ0 A;  5GAN K;  1K9M H;  3LFO A;  4NUT A;  1VQ5 F;  3N4Y A;  3V7E A;  3IR9 A;  3CPQ A;  1VQ7 F;  3PAF A;  3LWR C;  3ON1 A;  4C4W C;  3J7A R;  2KG4 A;  5A2Q M;  2OZB A;  3CCS F;  1NJI H;  5GIN C;  3CCQ F;  5G4V C;  1YIJ F;  3CG6 A;  3VMF B;  5EO3 A;  1XBI A;  3HJW C;  2BO1 A;  2OTL F;  3G71 F;  3NVK E;  3RA5 A;  3CC4 F;  2QI2 A;  1VQL F;  3RA6 A;  1GO1 A;  3CPW F;  1VQ4 F;  1W3E X;  3LWQ C;  3E20 B;  1VQN F;  1NMU B;  5DCV A;  3CCE F;  1K73 H;  1RLG A;  2LBX A;  3LWO C;  1IPA A;  3SIV A;  1RA4 A;  3CCR F;  1QVG F;  1KQS F;  1K8A H;  3SIU A;  2OHW A;  3MCA B;  2QEX F;  3WXM B;  5GAP K;  1KC8 H;  1Q82 H;  3V7Q A;  1JJ2 F;  3NMU C;  3J80 M;  3NK6 A;  1VQM F;  1X7P A;  1T0K B;  3J81 M;  1GO0 A;  1YJW F;  1H7M A;  1Q86 H;  3GYQ A;  3OBY A;  1YIT F;  2KTU A;  3G4S F;  4X3L A;  5IT9 M;  1X7O A;  1VQK F;  3N4Z A;  1ZWZ A;  1Q81 H;  3G6E F;  2OTJ F;  5EWR A;  2I6D A;  2HVY D;  3CCU F;  2JNB A;  3CCL F;  1E7K A;  1W42 A;  3OBW A;  2CZW A;  1YHQ F;  3HAX D;  3NVI B;  3CCV F;  3O85 A;  3LWP C;  3I56 F;  1M1K H;  1M90 H;  1VQ9 F;  2VGN A;  3FFM A;  4X3M A;  3JAM M;  3CME F;  1QVF F;  1VQO F;  5FJ4 C;  1DT9 A;  2LBW A;  1CK2 A;  4LCK A;  3VI6 A;  3CCJ F;  1Q7Y H; 
#chains in the Genus database with same CATH topology
 3E1Y A;  5KMG B;  2HP0 B;  3M1X A;  3JCM M;  1YI2 F;  1X52 A;  3MDO A;  4X20 B;  5GON A;  1U43 A;  3MCQ A;  4PWT A;  3CC7 F;  2RB9 A;  1KD1 H;  4ZK7 A;  2ZOD A;  3LDT A;  2IAF A;  1W57 A;  1PXW A;  4BW0 B;  4G4X A;  1VK3 A;  5JCO C;  5GIO C;  5EYP B;  4BT7 A;  4I4T B;  5CA1 A;  3OW2 F;  3CMA F;  3N2G B;  5EZY A;  3RYI A;  2VGM A;  5ITZ A;  2FC3 A;  1GZ0 A;  4G4W A;  5GAN K;  1K9M H;  3LFO A;  5IJ0 B;  1QAH A;  3BYQ A;  3FD6 A;  3PAF A;  2RHL A;  4YJ3 A;  2UZH A;  3J7A R;  3JAK A;  3ZP4 A;  4BVR A;  2PMP A;  3F0F A;  5A2Q M;  3JAS A;  5EAZ A;  5GIN C;  4RQO A;  5FNV B;  1T0A A;  5LA6 B;  5HP7 A;  1OFU A;  5G4V C;  2N48 A;  1TUB A;  3CG6 A;  5EO3 A;  4BVS A;  3I7T A;  2CW4 A;  4TV8 B;  2GVI A;  2OTL F;  4FFB A;  3RA5 A;  2QI2 A;  3JAR A;  5B8F A;  3RA6 A;  1GO1 A;  3WGL A;  1W3E X;  3VOB A;  5HXZ A;  2QTP A;  4IHJ A;  4IIJ A;  4DRX B;  4HNA B;  5CA0 A;  1RA4 A;  3CCR F;  2Z1F A;  4O4J A;  1KQS F;  1IV2 A;  2OHW A;  1JFF A;  3K2X A;  3HKC A;  1SZQ A;  1QD9 A;  4X1Y B;  3TD3 A;  5LXT A;  3HKE B;  5LP6 A;  3NK6 A;  2LCA A;  1GO0 A;  1YJW F;  4U3J B;  5EIB D;  1FFX A;  3K12 A;  3VYS C;  3F0E A;  4O2A A;  3UT5 B;  3G4S F;  2HS3 A;  3F6M A;  3P10 A;  4B62 A;  4BT4 A;  1VQK F;  3VIU A;  3HKB B;  1ZWZ A;  4G4Z A;  5IJ9 A;  3D00 A;  5EWR A;  3B6N A;  5BMV A;  1JD1 A;  3C9U A;  2HVY D;  3CCU F;  3JAW A;  1JY8 A;  3CCL F;  4O4I B;  1W5F A;  2CZW A;  1YHQ F;  4NWO B;  3NVI B;  3CCV F;  3LWP C;  1M90 H;  3HTN A;  5JQG B;  1QVF F;  1H48 A;  5JVD A;  2CHT A;  4YJ2 B;  4O2B A;  4BT2 A;  3ELC A;  5HY0 A;  3I3F A;  1W5E A;  4ZHW A;  3CXC F;  3S0W A;  3RYC B;  3GTZ A;  3QHD A;  5CB4 B;  3WGM A;  3GHZ A;  3ESJ A;  2G9I A;  3HKD A;  4BVT A;  4ZI7 A;  3WJQ A;  2AIF A;  1U3L A;  1SDS A;  2LBT A;  4EI8 A;  3CC2 F;  1FSZ A;  4ZOL B;  1TVK B;  3S02 A;  1VQ8 F;  3PLA C;  5LYJ A;  4TZZ A;  2WAL A;  5G4U C;  3AGK A;  2UYN B;  3CYP B;  5MN5 A;  4RHA A;  4TV9 A;  2DYY A;  4X1K B;  4ZHV A;  4O4L A;  1VQ5 F;  4M8I A;  4O4H A;  3F0D A;  4X1I A;  3DC2 A;  1IV1 A;  5EIB C;  2EWC A;  3C8L A;  3CPQ A;  3JAT B;  2R75 1;  3LWR C;  4LNU A;  5C8Y B;  1KNJ A;  3ON1 A;  1CLI A;  3M4S A;  5HY1 A;  3ZOP A;  3C9R A;  1NJI H;  1YIJ F;  3TD5 A;  3VMF B;  3RYH B;  2BO1 A;  1FNJ A;  4BT6 A;  3S0Y A;  5AVM A;  5J2T A;  2H8C A;  3NVK E;  3M84 A;  4WBN A;  1VQ4 F;  5GON B;  2HRU A;  3P0Z A;  2HS4 A;  1NMU B;  3N2G A;  2LBX A;  5JH7 A;  4ERH A;  1QVG F;  4BT5 A;  1K8A H;  3SIU A;  2VAM A;  3OON A;  1RQ2 A;  5LP6 C;  3WXM B;  5GAP K;  4C8E A;  2YXZ A;  3F0G A;  1JJ2 F;  5HXU A;  1VQV A;  3E22 B;  3S0H A;  1XV2 A;  2OTM A;  2Q1X A;  3K0T A;  1VQM F;  5EZY B;  3RYI B;  5ITZ B;  2ZAU A;  2NMU A;  4EB6 B;  3DDN A;  3MQW A;  1Q8R A;  2H6L A;  1SA0 A;  2IQQ A;  3RYF A;  3WJR A;  5J2U A;  4YJ3 B;  3WGK A;  4R40 B;  4U39 A;  5IT9 M;  2F9Z C;  3JAK B;  1Q81 H;  3G6E F;  4I50 A;  3JAS B;  4NQ3 A;  2BTQ B;  2JNB A;  2FGY A;  3C9T A;  1TUB B;  1E7K A;  1W42 A;  4ZHQ A;  5LOV A;  3VO8 A;  3O85 A;  1VQ9 F;  2VGN A;  4FFB B;  3N2K A;  4X3M A;  3JAM M;  1IV3 A;  3CME F;  4B46 A;  3JAR B;  3WGN A;  2KGW A;  2AIZ P;  2V9Y A;  2LBW A;  4IHJ B;  2Z1E A;  3VI6 A;  3CCJ F;  3CD6 F;  4IIJ B;  5IYZ A;  5CA0 B;  4O4J B;  1JFF B;  3HKC B;  1IV4 A;  2KTV A;  4G88 A;  5KX5 A;  1YJ9 F;  3JAL A;  5LXT B;  5GIP C;  1W40 A;  5FLX M;  4BY9 D;  4C82 A;  5LP6 B;  3ZP7 A;  2QA4 F;  1XHO A;  2RHH A;  5EB0 A;  1N8R H;  1VQ6 F;  1FFX B;  4O2A B;  2ZVY A;  3K14 A;  4TUY A;  3ZO8 A;  2ALE A;  2Z1T A;  5IJ9 B;  2K1S A;  4DXD A;  1UFY A;  3V7E A;  4G4V A;  5BMV B;  4KWE A;  3JAW B;  4F6R A;  3LME A;  4C4W C;  2KG4 A;  3IKF A;  2OZB A;  3ERN A;  3CCS F;  3IEW A;  4BVQ A;  5JVD B;  1XBI A;  3EOR A;  1U40 A;  4O2B B;  1TVK A;  1VH8 A;  3CC4 F;  2Z1U A;  1JN1 A;  1DBF A;  3CPW F;  1ONI A;  3LYB A;  2BTO A;  1VQN F;  5DCV A;  1RLG A;  3FD5 A;  3WPX A;  3LWO C;  3WJP A;  3HKD B;  3U0O A;  4ZI7 B;  5KMG A;  2HP0 A;  3Q8H A;  4X20 A;  3KJK A;  5HY2 A;  4I55 B;  1KC8 H;  5LYJ B;  4XCQ A;  4B5C A;  4EI7 A;  3NMU C;  1KNK A;  3J80 M;  3KE1 A;  4TV9 B;  1X7P A;  2GZL A;  1W59 A;  2Q1Y A;  1COM A;  1H7M A;  4O4L B;  5HY4 A;  4O4H B;  4X1I B;  5EB1 B;  3S03 A;  1W55 A;  5EYP A;  1Q86 H;  1YIT F;  2UYK A;  4I4T A;  3VYT C;  4EI9 A;  4X3L A;  1X7O A;  2ZF8 A;  4LNU B;  3N4Z A;  5HWE A;  1R1M A;  2OTJ F;  1ODE A;  5IJ0 A;  1VHA A;  2VAP A;  2I6D A;  1W5B A;  3C9S A;  3T80 A;  3VYU C;  5MN6 A;  3I56 F;  5J2T B;  1M1K H;  3FFM A;  5CA1 B;  1H47 A;  3E22 A;  3WGJ A;  5FNV A;  5LA6 A;  1W58 1;  4WBN B;  5FJ4 C;  1RLU A;  1QU9 A;  4LCK A;  4TV8 A;  3JVH A;  1X25 A;  4EB6 A;  3RE3 A;  5JH7 B;  3S06 A;  4C8I A;  3R0P A;  1YJN F;  4B45 A;  3D01 A;  1Z5W A;  3I55 F;  2H8E A;  3FBA A;  5MN4 A;  3V3T A;  1VQP F;  2CSL A;  2HX0 A;  4C8G A;  4DRX A;  4HNA A;  1W41 A;  1CN7 A;  3NK7 A;  1FNK A;  4ZHY B;  2YYE A;  3HWU A;  4X1Y A;  2GLZ A;  3HKE A;  1W2B F;  1SA0 B;  3IEQ A;  3QUW A;  3RYF B;  1S72 F;  5J2U B;  3VTI C;  2HP3 A;  3CCM F;  3LWV C;  2HRY A;  5JCO A;  2DT4 A;  2IG8 A;  3IMP A;  4BT3 A;  4E6E A;  1UI9 A;  4NUT A;  4I50 B;  1OAP A;  3N4Y A;  4U3J A;  1Z5V A;  2ZVZ A;  3CYQ A;  3UT5 A;  3IR9 A;  1VQ7 F;  1J7H A;  4C81 A;  4ZHQ B;  3HKB A;  3V4D A;  5LOV B;  2Z01 A;  2L26 A;  2RHO A;  3N2K B;  3CCQ F;  3MBM A;  5HP8 A;  2CVL A;  4O4I A;  3P4E A;  3HJW C;  1GX1 A;  1NQ3 A;  2PHN A;  5IYZ B;  3G71 F;  5JQG A;  2VXY A;  1VQL F;  2W8B C;  3IKE A;  3LWQ C;  3E20 B;  4YJ2 A;  3CCE F;  2R6R 1;  1K73 H;  2HS0 A;  5KX5 B;  3JAL B;  1IPA A;  3SIV A;  3WPW A;  3RYC A;  3MCA B;  1U3P A;  2QEX F;  3QTY A;  3VOA A;  5CB4 A;  1YQN A;  1Q82 H;  3V7Q A;  3D54 A;  1XRG A;  3KIZ A;  2CWJ A;  3KJJ A;  4TUY B;  3VCZ A;  2CHS A;  2P6Y A;  1T0K B;  3J81 M;  1YGY A;  4ZOL A;  2UYP A;  2B33 A;  3GYQ A;  2I6R A;  3OBY A;  3FPI A;  2UYN A;  2KTU A;  3KHN A;  1RQ7 A;  4F6R B;  3L7Q A;  1PF5 A;  4X1K A;  2BTU A;  2VAW A;  2MQE A;  3CB2 A;  3JAT A;  3OBW A;  5C8Y A;  2AMT A;  4I55 A;  3HAX D;  2RHJ A;  4G4Y A;  1VQO F;  2HQS C;  1DT9 A;  2ZOV A;  1CK2 A;  1W5A A;  3RYH A;  2UYJ A;  1Q7Y H;  3TD4 A; 
#chains in the Genus database with same CATH homology
 3E1Y A;  5HY0 A;  3CD6 F;  3CXC F;  3JCM M;  1YJN F;  1YI2 F;  1X52 A;  3I55 F;  2KTV A;  1VQP F;  3V3T A;  1YJ9 F;  3CC7 F;  5GIP C;  1W40 A;  1W41 A;  5FLX M;  1KD1 H;  4BY9 D;  4BVT A;  1CN7 A;  1SDS A;  2AIF A;  3NK7 A;  4EI8 A;  3CC2 F;  2QA4 F;  1PXW A;  4BW0 B;  1VQ8 F;  3PLA C;  4TZZ A;  2WAL A;  2GLZ A;  1N8R H;  1VQ6 F;  5G4U C;  5GIO C;  3AGK A;  1W2B F;  1S72 F;  3OW2 F;  3CMA F;  2VGM A;  2ALE A;  3LWV C;  3CCM F;  2FC3 A;  1GZ0 A;  5GAN K;  1K9M H;  3LFO A;  4NUT A;  1VQ5 F;  3N4Y A;  3V7E A;  3IR9 A;  3CPQ A;  1VQ7 F;  3PAF A;  3LWR C;  3ON1 A;  4C4W C;  3J7A R;  2KG4 A;  4BVR A;  5A2Q M;  2OZB A;  3CCS F;  5HY1 A;  4BVQ A;  1NJI H;  5GIN C;  3CCQ F;  5G4V C;  1YIJ F;  3CG6 A;  3VMF B;  5EO3 A;  1XBI A;  4BVS A;  3HJW C;  2BO1 A;  2OTL F;  3G71 F;  3NVK E;  3RA5 A;  3CC4 F;  2QI2 A;  1VQL F;  3RA6 A;  1GO1 A;  3CPW F;  1VQ4 F;  1W3E X;  3LWQ C;  3E20 B;  5HXZ A;  1VQN F;  1NMU B;  5DCV A;  3CCE F;  1K73 H;  1RLG A;  2LBX A;  3LWO C;  1IPA A;  3SIV A;  1RA4 A;  3CCR F;  1QVG F;  1KQS F;  1K8A H;  3SIU A;  2OHW A;  3MCA B;  5HY2 A;  2QEX F;  3WXM B;  5GAP K;  1KC8 H;  1Q82 H;  3V7Q A;  4XCQ A;  1JJ2 F;  5HXU A;  4EI7 A;  3NMU C;  3J80 M;  3NK6 A;  1VQM F;  1X7P A;  1T0K B;  3J81 M;  1GO0 A;  1YJW F;  1H7M A;  5HY4 A;  1Q86 H;  3GYQ A;  3OBY A;  1YIT F;  2KTU A;  4EI9 A;  4X3L A;  3G4S F;  5IT9 M;  1X7O A;  1VQK F;  2F9Z C;  3N4Z A;  5HWE A;  1ZWZ A;  1Q81 H;  3G6E F;  3D00 A;  2OTJ F;  5EWR A;  4NQ3 A;  2I6D A;  2HVY D;  3CCU F;  2JNB A;  2FGY A;  3CCL F;  1E7K A;  1W42 A;  3OBW A;  2CZW A;  1YHQ F;  3HAX D;  3NVI B;  3CCV F;  3O85 A;  3LWP C;  3I56 F;  1M1K H;  1M90 H;  1VQ9 F;  2VGN A;  3FFM A;  4X3M A;  3JAM M;  3CME F;  1QVF F;  1VQO F;  5FJ4 C;  1DT9 A;  2LBW A;  1CK2 A;  4LCK A;  3VI6 A;  3CCJ F;  1Q7Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...