3FFMA

The crystal structure of human gadd45g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
STARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Gadd45g
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Growth arrest and DNA-damage-inducible protein GADD45 gamma
total genus 50
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ffmA00
1Q86H 1W42A 1W41A 1W3EX 3I55F 1YJ9F 1T0KB 2QEXF 4BY9D 3CCJF 3LWOC 3G6EF 2LBWA 3LFOA 3CCVF 3CPWF 1YJWF 2OZBA 5EWRA 2QA4F 1S72F 2FC3A 2QI2A 1KD1H 1M90H 1M1KH 4C4WC 4X3MA 3NVKE 1YIJF 2HVYD 1IPAA 1GO1A 1VQ4F 3CD6F 2KG4A 5G4UC 3CCUF 1Q82H 1DT9A 5GINC 3CC4F 3SIVA 3NVIB 2CZWA 1YHQF 1SDSA 1NJIH 3MCAB 3LWRC 3FFMA 1VQOF 3E1YA 3J81M 3HJWC 2WALA 3CCMF 2JNBA 3GYQA 3JAMM 3G71F 1K8AH 1N8RH 3CCSF 1YITF 1PXWA 3V7QA 1QVGF 3E20B 1H7MA 5GANK 5IT9M 1Q7YH 3N4YA 1X7PA 1KQSF 1W40A 3J7AR 3LWQC 3RA6A 1YI2F 3G4SF 3ON1A 3CCEF 2AIFA 3CG6A 1Q81H 3NK6A 2BO1A 5FJ4C 1K73H 1VQ5F 1ZWZA 4TZZA 1XBIA 3CPQA 3V7EA 5GIPC 1W2BF 2LBXA 5GAPK 4LCKA 1KC8H 1VQ7F 5DCVA 3PAFA 3CCQF 3NMUC 3JCMM 1VQ8F 3AGKA 1NMUB 1E7KA 1GZ0A 2I6DA 3VI6A 1QVFF 4X3LA 3I56F 2OTLF 2OHWA 3OW2F 4BW0B 1YJNF 3CCLF 1VQLF 3LWPC 1RA4A 3HAXD 3OBYA 1VQ9F 1VQKF 3VMFB 1VQNF 1X7OA 5G4VC 3SIUA 1CK2A 3CMAF 1VQPF 2OTJF 3PLAC 2KTVA 2VGMA 5A2QM 5GIOC 2ALEA 3CC2F 3CC7F 3CCRF 3OBWA 5EO3A 3WXMB 1RLGA 1VQ6F 1CN7A 2VGNA 1K9MH 3O85A 3NK7A 3RA5A 5FLXM 1VQMF 3IR9A 2KTUA 1X52A 4NUTA 3J80M 3CMEF 3N4ZA 1GO0A 3CXCF 1JJ2F 3LWVC
chains in the Genus database with same CATH superfamily
1Q86H 3I55F 1W3EX 1QU9A 3HWUA 3CCVF 3G6EF 4I55A 4B45A 4EI8A 4WBNA 3N2KB 3D00A 3M84A 3IEWA 4O2AA 4EB6A 2QI2A 4IHJB 2CHTA 1M1KH 2NMUA 1U3LA 3KJKA 1IPAA 1NQ3A 1VQ4F 2IG8A 3CD6F 4X1KA 2KG4A 1DBFA 2ZVZA 1DT9A 3WPWA 3SIVA 1VH8A 2CZWA 3KJJA 3S0WA 5B8FA 1KNJA 3U0OA 1NJIH 3MCAB 3P4EA 1FFXA 3LWRC 3FD5A 3FFMA 3JAKB 2H8EA 5JVDA 4R40B 1JN1A 2RB9A 3F0GA 3HJWC 2JNBA 2K1SA 1JFFB 1IV3A 3LMEA 4O4IA 5HY0A 5EZYA 1W5AA 3E20B 5FNVB 3MDOA 4X20A 1H7MA 1TVKA 1Q7YH 5IT9M 3N4YA 2PHNA 1W55A 3RA6A 4F6RA 3JAWA 4BT2A 5GONA 5HP7A 2AIFA 3D01A 4X1IB 3HKDB 5FJ4C 4O2BB 5LA6A 3R0PA 5JH7B 1W5EA 5EIBD 5EZYB 4BVRA 1JY8A 5GAPK 2YYEA 2H6LA 4PWTA 3PAFA 2I6RA 3JATB 3AGKA 1E7KA 4X1IA 4O2BA 1XRGA 4IIJB 4O4HA 3I56F 1SZQA 1YGYA 5IJ0B 2OTLF 2OHWA 3OW2F 2BTOA 3M1XA 4BW0B 3S0HA 2HX0A 3K14A 2W8BC 3WGMA 5FNVA 3HAXD 1IV2A 3GHZA 3VMFB 1IV4A 4RHAA 5G4VC 1CK2A 1COMA 4IHJA 2VGMA 3RYIB 3VO8A 3OBWA 3WXMB 1CN7A 3TD5A 2QTPA 3ESJA 3HKCB 2G9IA 4I50B 3WGLA 5HWEA 2FGYA 3F0EA 3Q8HA 2UYJA 3QTYA 5IJ0A 3VYUC 1XV2A 4B46A 4BT4A 2UZHA 1QAHA 3JALB 5BMVB 3J80M 3CMEF 3IKEA 1GO0A 2ZOVA 2CSLA 1W41A 5LXTA 1IV1A 2B33A 1T0KB 2UYPA 5J2UB 3KIZA 5LP6C 2Q1XA 4KWEA 5JVDB 4M8IA 2OZBA 3VTIC 1M90H 1KD1H 4U3JB 1PF5A 2GZLA 4X3MA 3NVKE 5KX5B 2HRYA 4YJ3B 3WPXA 4G4XA 2RHOA 5HP8A 5GONB 5G4UC 2H8CA 5JCOA 3C9SA 3JARB 2GLZA 3CC4F 4G4ZA 1SDSA 2RHHA 2VAWA 5KMGB 5KX5A 3UT5B 3KHNA 1SA0A 2UYKA 3JAMM 3CCSF 1QVGF 5EYPA 2ZAUA 5GANK 1RQ7A 1X7PA 5CA0A 1W40A 3J7AR 3K12A 3S0YA 5HY1A 2HS0A 3HTNA 3ON1A 5HXZA 3CCEF 3DC2A 2Z1EA 2BO1A 3JASA 5CA1B 3C9RA 4F6RB 5CA0B 3WGJA 1JD1A 3E22B 3CPQA 3D54A 5EYPB 2LBXA 4O4LA 2LBTA 4BVQA 2ZODA 3MQWA 3RYFA 2Q1YA 3M4SA 3EORA 4ZHVA 5DCVA 4X1YA 4ZI7A 3NMUC 4DRXB 4EI9A 1VQ8F 3JALA 5KMGA 2CWJA 3JASB 5CA1A 3K2XA 3UT5A 2I6DA 4X3LA 4ZHWA 5IYZB 4BVTA 2CVLA 3JATA 3CCLF 2AIZP 5LYJB 4DRXA 3LWPC 3LYBA 1RA4A 1VQ9F 1X7OA 1YQNA 3SIUA 1VQPF 4I4TB 3V3TA 1KNKA 4U3JA 3CC7F 4NWOB 5JH7A 4TV9B 3RE3A 2GVIA 3VCZA 3JAKA 4C81A 3O85A 3CYPB 1K9MH 2P6YA 1VQMF 2KTUA 2R751 5MN5A 3L7QA 1UFYA 4TV8A 3N4ZA 4G88A 1VQLF 3FD6A 4LNUB 2MQEA 4ZHQB 4X20B 1W42A 1YJ9F 5HY4A 5IJ9A 5AVMA 4G4WA 3CCJF 4BVSA 4O4IB 1YJWF 2HQSC 2BTUA 4WBNB 1Z5WA 3VYTC 2FC3A 4ZHYB 4C8EA 5LA6B 5J2UA 1TUBA 3CYQA 5EB1B 5IJ9B 2CW4A 4TUYB 4ZHQA 1X25A 3QHDA 5LYJA 5JCOC 4LNUA 3CCUF 1Q82H 2R6R1 5GINC 5EAZA 1YHQF 1TUBB 5ITZA 3JVHA 3V4DA 1VQOF 1W581 3HKCA 3P0ZA 3J81M 2UYNA 2WALA 5LP6A 1OAPA 3S03A 3QUWA 3RYFB 4X1YB 4ZI7B 4YJ2A 1JFFA 3V7QA 3LDTA 5ITZB 4O4JB 3RYHB 5MN4A 3VIUA 2HRUA 5JQGA 4EI7A 3VYSC 1YI2F 4BT7A 3G4SF 2RHLA 5IYZA 3IKFA 4O4HB 1ONIA 2ZVYA 2V9YA 2PMPA 5JQGB 3RYIA 5LOVA 4O4JA 4I4TA 2HP3A 3V7EA 3RYHA 4C8IA 2DYYA 5CB4B 1VQ7F 3HKEA 4BT5A 3E22A 5C8YB 3ELCA 4TV8B 1NMUB 3ERNA 3VI6A 1Z5VA 3BYQA 5EB0A 1OFUA 2AMTA 3WGKA 2LCAA 1RQ2A 4G4VA 5BMVA 3I3FA 1UI9A 4G4YA 3MBMA 4ZK7A 3OBYA 5CB4A 1VQNF 3N2GB 3CMAF 3IEQA 4HNAA 2F9ZC 2OTMA 2ALEA 3CC2F 1VQ6F 3CCRF 5EO3A 2Z1FA 3CB2A 3ZP7A 1T0AA 5HXUA 1ODEA 1VQVA 3NK7A 3RA5A 1W59A 3FPIA 3GTZA 4NUTA 3C9UA 3F0FA 2RHJA 2HP0A 4ERHA 2QEXF 4BY9D 3LWOC 2LBWA 3LFOA 4RQOA 2Z1TA 3TD4A 1FSZA 3B6NA 4YJ2B 3CPWF 5J2TA 1U40A 1SA0B 3DDNA 3OONA 5EWRA 3C9TA 3TD3A 4E6EA 4FFBB 2QA4F 5HY2A 1S72F 2N48A 2KGWA 4C4WC 1YIJF 2HVYD 2HP0B 1GO1A 1FFXB 2VXYA 2ZF8A 2EWCA 3S02A 4B5CA 4C82A 4BT6A 3IMPA 3JARA 3KE1A 3NVIB 1U43A 3RYCA 4C8GA 1FNKA 4U39A 2VAPA 4TUYA 3E1YA 3CCMF 1TVKB 3GYQA 2VAMA 1Q8RA 3G71F 1K8AH 3HKEB 1N8RH 4I55B 1W57A 1PXWA 1U3PA 1YITF 2HS3A 1W5FA 2HS4A 2UYNB 1KQSF 3C8LA 3LWQC 1CLIA 1J7HA 1W5BA 3CG6A 1Q81H 3NK6A 2L26A 4ZOLB 3VOBA 4I50A 2BTQB 1H48A 3ZOPA 1K73H 3WJRA 1VQ5F 1XHOA 1ZWZA 4TZZA 1XBIA 1QD9A 4TV9A 4HNAB 1RLUA 5GIPC 1W2BF 3ZO8A 4LCKA 4O4LB 4FFBA 3N2GA 1KC8H 3P10A 2DT4A 2IQQA 4O2AB 4EB6B 3S06A 5LP6B 3CCQF 2Z01A 4BT3A 3JCMM 4ZOLA 1GZ0A 3FBAA 3HKDA 2Z1UA 1QVFF 1R1MA 1VK3A 3WJPA 3RYCB 3JAWB 3F0DA 5C8YA 3ZP4A 1YJNF 1VHAA 2IAFA 1GX1A 1H47A 4YJ3A 3WJQA 3HKBB 3I7TA 1VQKF 3MCQA 4B62A 2OTJF 5MN6A 4NQ3A 3PLAC 2KTVA 5A2QM 5GIOC 1RLGA 5EIBC 5LOVB 5J2TB 2VGNA 3N2KA 3HKBA 4DXDA 5FLXM 3IR9A 4XCQA 2CHSA 3K0TA 5LXTB 1X52A 1FNJA 3F6MA 3T80A 4IIJA 2YXZA 3VOAA 3WGNA 4X1KB 3CXCF 1JJ2F 3LWVC
chains in the Genus database with same CATH topology
1Q86H 1W42A 1W41A 1W3EX 5HY4A 3I55F 1YJ9F 1T0KB 2QEXF 4BY9D 3CCJF 3LWOC 3G6EF 2LBWA 3LFOA 4BVSA 3CCVF 3CPWF 1YJWF 4EI8A 3D00A 2OZBA 5EWRA 2QA4F 1S72F 2FC3A 2QI2A 1KD1H 5HY2A 1M90H 1M1KH 4C4WC 4X3MA 3NVKE 1YIJF 2HVYD 1IPAA 1GO1A 1VQ4F 3CD6F 2KG4A 5G4UC 3CCUF 1Q82H 1DT9A 5GINC 3CC4F 2GLZA 3SIVA 3NVIB 2CZWA 1YHQF 1SDSA 1NJIH 3MCAB 3LWRC 3FFMA 1VQOF 3E1YA 3J81M 3HJWC 2WALA 3CCMF 2JNBA 3GYQA 3JAMM 3G71F 1K8AH 1N8RH 3CCSF 1YITF 1PXWA 5HY0A 3V7QA 1QVGF 3E20B 1H7MA 5GANK 5IT9M 1Q7YH 3N4YA 1X7PA 1KQSF 1W40A 4EI7A 3LWQC 3J7AR 3RA6A 5HY1A 1YI2F 3G4SF 5HXZA 3ON1A 3CCEF 2AIFA 3CG6A 1Q81H 3NK6A 2BO1A 5FJ4C 1K73H 1VQ5F 1ZWZA 4TZZA 1XBIA 3CPQA 3V7EA 5GIPC 1W2BF 2LBXA 4BVRA 5GAPK 4LCKA 4BVQA 1KC8H 1VQ7F 5DCVA 3PAFA 3CCQF 3NMUC 3JCMM 4EI9A 1VQ8F 3AGKA 1NMUB 1E7KA 1GZ0A 2I6DA 3VI6A 1QVFF 4X3LA 3I56F 2OTLF 2OHWA 3OW2F 4BVTA 4BW0B 1YJNF 3CCLF 1VQLF 3LWPC 1RA4A 3HAXD 3OBYA 1VQ9F 1VQKF 3VMFB 1VQNF 1X7OA 5G4VC 3SIUA 1CK2A 3CMAF 1VQPF 2OTJF 3PLAC 4NQ3A 3V3TA 2F9ZC 2KTVA 2VGMA 5A2QM 2ALEA 5GIOC 3CC2F 3CC7F 3CCRF 3OBWA 5EO3A 3WXMB 1RLGA 1VQ6F 1CN7A 2VGNA 1K9MH 3O85A 5HXUA 5HWEA 3NK7A 2FGYA 3RA5A 5FLXM 1VQMF 3IR9A 4XCQA 2KTUA 1X52A 4NUTA 3J80M 3CMEF 3N4ZA 1GO0A 3CXCF 1JJ2F 3LWVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 H;  1W42 A;  1W41 A;  1W3E X;  3I55 F;  1YJ9 F;  1T0K B;  2QEX F;  4BY9 D;  3CCJ F;  3LWO C;  3G6E F;  2LBW A;  3LFO A;  3CCV F;  3CPW F;  1YJW F;  2OZB A;  5EWR A;  2QA4 F;  1S72 F;  2FC3 A;  2QI2 A;  1KD1 H;  1M90 H;  1M1K H;  4C4W C;  4X3M A;  3NVK E;  1YIJ F;  2HVY D;  1IPA A;  1GO1 A;  1VQ4 F;  3CD6 F;  2KG4 A;  5G4U C;  3CCU F;  1Q82 H;  1DT9 A;  5GIN C;  3CC4 F;  3SIV A;  3NVI B;  2CZW A;  1YHQ F;  1SDS A;  1NJI H;  3MCA B;  3LWR C;  3FFM A;  1VQO F;  3E1Y A;  3J81 M;  3HJW C;  2WAL A;  3CCM F;  2JNB A;  3GYQ A;  3JAM M;  3G71 F;  1K8A H;  1N8R H;  3CCS F;  1YIT F;  1PXW A;  3V7Q A;  1QVG F;  3E20 B;  1H7M A;  5GAN K;  5IT9 M;  1Q7Y H;  3N4Y A;  1X7P A;  1KQS F;  1W40 A;  3J7A R;  3LWQ C;  3RA6 A;  1YI2 F;  3G4S F;  3ON1 A;  3CCE F;  2AIF A;  3CG6 A;  1Q81 H;  3NK6 A;  2BO1 A;  5FJ4 C;  1K73 H;  1VQ5 F;  1ZWZ A;  4TZZ A;  1XBI A;  3CPQ A;  3V7E A;  5GIP C;  1W2B F;  2LBX A;  5GAP K;  4LCK A;  1KC8 H;  1VQ7 F;  5DCV A;  3PAF A;  3CCQ F;  3NMU C;  3JCM M;  1VQ8 F;  3AGK A;  1NMU B;  1E7K A;  1GZ0 A;  2I6D A;  3VI6 A;  1QVF F;  4X3L A;  3I56 F;  2OTL F;  2OHW A;  3OW2 F;  4BW0 B;  1YJN F;  3CCL F;  1VQL F;  3LWP C;  1RA4 A;  3HAX D;  3OBY A;  1VQ9 F;  1VQK F;  3VMF B;  1VQN F;  1X7O A;  5G4V C;  3SIU A;  1CK2 A;  3CMA F;  1VQP F;  2OTJ F;  3PLA C;  2KTV A;  2VGM A;  5A2Q M;  5GIO C;  2ALE A;  3CC2 F;  3CC7 F;  3CCR F;  3OBW A;  5EO3 A;  3WXM B;  1RLG A;  1VQ6 F;  1CN7 A;  2VGN A;  1K9M H;  3O85 A;  3NK7 A;  3RA5 A;  5FLX M;  1VQM F;  3IR9 A;  2KTU A;  1X52 A;  4NUT A;  3J80 M;  3CME F;  3N4Z A;  1GO0 A;  3CXC F;  1JJ2 F;  3LWV C; 
#chains in the Genus database with same CATH topology
 1Q86 H;  3I55 F;  1W3E X;  1QU9 A;  3HWU A;  3CCV F;  3G6E F;  4I55 A;  4B45 A;  4EI8 A;  4WBN A;  3N2K B;  3D00 A;  3M84 A;  3IEW A;  4O2A A;  4EB6 A;  2QI2 A;  4IHJ B;  2CHT A;  1M1K H;  2NMU A;  1U3L A;  3KJK A;  1IPA A;  1NQ3 A;  1VQ4 F;  2IG8 A;  3CD6 F;  4X1K A;  2KG4 A;  1DBF A;  2ZVZ A;  1DT9 A;  3WPW A;  3SIV A;  1VH8 A;  2CZW A;  3KJJ A;  3S0W A;  5B8F A;  1KNJ A;  3U0O A;  1NJI H;  3MCA B;  3P4E A;  1FFX A;  3LWR C;  3FD5 A;  3FFM A;  3JAK B;  2H8E A;  5JVD A;  4R40 B;  1JN1 A;  2RB9 A;  3F0G A;  3HJW C;  2JNB A;  2K1S A;  1JFF B;  1IV3 A;  3LME A;  4O4I A;  5HY0 A;  5EZY A;  1W5A A;  3E20 B;  5FNV B;  3MDO A;  4X20 A;  1H7M A;  1TVK A;  1Q7Y H;  5IT9 M;  3N4Y A;  2PHN A;  1W55 A;  3RA6 A;  4F6R A;  3JAW A;  4BT2 A;  5GON A;  5HP7 A;  2AIF A;  3D01 A;  4X1I B;  3HKD B;  5FJ4 C;  4O2B B;  5LA6 A;  3R0P A;  5JH7 B;  1W5E A;  5EIB D;  5EZY B;  4BVR A;  1JY8 A;  5GAP K;  2YYE A;  2H6L A;  4PWT A;  3PAF A;  2I6R A;  3JAT B;  3AGK A;  1E7K A;  4X1I A;  4O2B A;  1XRG A;  4IIJ B;  4O4H A;  3I56 F;  1SZQ A;  1YGY A;  5IJ0 B;  2OTL F;  2OHW A;  3OW2 F;  2BTO A;  3M1X A;  4BW0 B;  3S0H A;  2HX0 A;  3K14 A;  2W8B C;  3WGM A;  5FNV A;  3HAX D;  1IV2 A;  3GHZ A;  3VMF B;  1IV4 A;  4RHA A;  5G4V C;  1CK2 A;  1COM A;  4IHJ A;  2VGM A;  3RYI B;  3VO8 A;  3OBW A;  3WXM B;  1CN7 A;  3TD5 A;  2QTP A;  3ESJ A;  3HKC B;  2G9I A;  4I50 B;  3WGL A;  5HWE A;  2FGY A;  3F0E A;  3Q8H A;  2UYJ A;  3QTY A;  5IJ0 A;  3VYU C;  1XV2 A;  4B46 A;  4BT4 A;  2UZH A;  1QAH A;  3JAL B;  5BMV B;  3J80 M;  3CME F;  3IKE A;  1GO0 A;  2ZOV A;  2CSL A;  1W41 A;  5LXT A;  1IV1 A;  2B33 A;  1T0K B;  2UYP A;  5J2U B;  3KIZ A;  5LP6 C;  2Q1X A;  4KWE A;  5JVD B;  4M8I A;  2OZB A;  3VTI C;  1M90 H;  1KD1 H;  4U3J B;  1PF5 A;  2GZL A;  4X3M A;  3NVK E;  5KX5 B;  2HRY A;  4YJ3 B;  3WPX A;  4G4X A;  2RHO A;  5HP8 A;  5GON B;  5G4U C;  2H8C A;  5JCO A;  3C9S A;  3JAR B;  2GLZ A;  3CC4 F;  4G4Z A;  1SDS A;  2RHH A;  2VAW A;  5KMG B;  5KX5 A;  3UT5 B;  3KHN A;  1SA0 A;  2UYK A;  3JAM M;  3CCS F;  1QVG F;  5EYP A;  2ZAU A;  5GAN K;  1RQ7 A;  1X7P A;  5CA0 A;  1W40 A;  3J7A R;  3K12 A;  3S0Y A;  5HY1 A;  2HS0 A;  3HTN A;  3ON1 A;  5HXZ A;  3CCE F;  3DC2 A;  2Z1E A;  2BO1 A;  3JAS A;  5CA1 B;  3C9R A;  4F6R B;  5CA0 B;  3WGJ A;  1JD1 A;  3E22 B;  3CPQ A;  3D54 A;  5EYP B;  2LBX A;  4O4L A;  2LBT A;  4BVQ A;  2ZOD A;  3MQW A;  3RYF A;  2Q1Y A;  3M4S A;  3EOR A;  4ZHV A;  5DCV A;  4X1Y A;  4ZI7 A;  3NMU C;  4DRX B;  4EI9 A;  1VQ8 F;  3JAL A;  5KMG A;  2CWJ A;  3JAS B;  5CA1 A;  3K2X A;  3UT5 A;  2I6D A;  4X3L A;  4ZHW A;  5IYZ B;  4BVT A;  2CVL A;  3JAT A;  3CCL F;  2AIZ P;  5LYJ B;  4DRX A;  3LWP C;  3LYB A;  1RA4 A;  1VQ9 F;  1X7O A;  1YQN A;  3SIU A;  1VQP F;  4I4T B;  3V3T A;  1KNK A;  4U3J A;  3CC7 F;  4NWO B;  5JH7 A;  4TV9 B;  3RE3 A;  2GVI A;  3VCZ A;  3JAK A;  4C81 A;  3O85 A;  3CYP B;  1K9M H;  2P6Y A;  1VQM F;  2KTU A;  2R75 1;  5MN5 A;  3L7Q A;  1UFY A;  4TV8 A;  3N4Z A;  4G88 A;  1VQL F;  3FD6 A;  4LNU B;  2MQE A;  4ZHQ B;  4X20 B;  1W42 A;  1YJ9 F;  5HY4 A;  5IJ9 A;  5AVM A;  4G4W A;  3CCJ F;  4BVS A;  4O4I B;  1YJW F;  2HQS C;  2BTU A;  4WBN B;  1Z5W A;  3VYT C;  2FC3 A;  4ZHY B;  4C8E A;  5LA6 B;  5J2U A;  1TUB A;  3CYQ A;  5EB1 B;  5IJ9 B;  2CW4 A;  4TUY B;  4ZHQ A;  1X25 A;  3QHD A;  5LYJ A;  5JCO C;  4LNU A;  3CCU F;  1Q82 H;  2R6R 1;  5GIN C;  5EAZ A;  1YHQ F;  1TUB B;  5ITZ A;  3JVH A;  3V4D A;  1VQO F;  1W58 1;  3HKC A;  3P0Z A;  3J81 M;  2UYN A;  2WAL A;  5LP6 A;  1OAP A;  3S03 A;  3QUW A;  3RYF B;  4X1Y B;  4ZI7 B;  4YJ2 A;  1JFF A;  3V7Q A;  3LDT A;  5ITZ B;  4O4J B;  3RYH B;  5MN4 A;  3VIU A;  2HRU A;  5JQG A;  4EI7 A;  3VYS C;  1YI2 F;  4BT7 A;  3G4S F;  2RHL A;  5IYZ A;  3IKF A;  4O4H B;  1ONI A;  2ZVY A;  2V9Y A;  2PMP A;  5JQG B;  3RYI A;  5LOV A;  4O4J A;  4I4T A;  2HP3 A;  3V7E A;  3RYH A;  4C8I A;  2DYY A;  5CB4 B;  1VQ7 F;  3HKE A;  4BT5 A;  3E22 A;  5C8Y B;  3ELC A;  4TV8 B;  1NMU B;  3ERN A;  3VI6 A;  1Z5V A;  3BYQ A;  5EB0 A;  1OFU A;  2AMT A;  3WGK A;  2LCA A;  1RQ2 A;  4G4V A;  5BMV A;  3I3F A;  1UI9 A;  4G4Y A;  3MBM A;  4ZK7 A;  3OBY A;  5CB4 A;  1VQN F;  3N2G B;  3CMA F;  3IEQ A;  4HNA A;  2F9Z C;  2OTM A;  2ALE A;  3CC2 F;  1VQ6 F;  3CCR F;  5EO3 A;  2Z1F A;  3CB2 A;  3ZP7 A;  1T0A A;  5HXU A;  1ODE A;  1VQV A;  3NK7 A;  3RA5 A;  1W59 A;  3FPI A;  3GTZ A;  4NUT A;  3C9U A;  3F0F A;  2RHJ A;  2HP0 A;  4ERH A;  2QEX F;  4BY9 D;  3LWO C;  2LBW A;  3LFO A;  4RQO A;  2Z1T A;  3TD4 A;  1FSZ A;  3B6N A;  4YJ2 B;  3CPW F;  5J2T A;  1U40 A;  1SA0 B;  3DDN A;  3OON A;  5EWR A;  3C9T A;  3TD3 A;  4E6E A;  4FFB B;  2QA4 F;  5HY2 A;  1S72 F;  2N48 A;  2KGW A;  4C4W C;  1YIJ F;  2HVY D;  2HP0 B;  1GO1 A;  1FFX B;  2VXY A;  2ZF8 A;  2EWC A;  3S02 A;  4B5C A;  4C82 A;  4BT6 A;  3IMP A;  3JAR A;  3KE1 A;  3NVI B;  1U43 A;  3RYC A;  4C8G A;  1FNK A;  4U39 A;  2VAP A;  4TUY A;  3E1Y A;  3CCM F;  1TVK B;  3GYQ A;  2VAM A;  1Q8R A;  3G71 F;  1K8A H;  3HKE B;  1N8R H;  4I55 B;  1W57 A;  1PXW A;  1U3P A;  1YIT F;  2HS3 A;  1W5F A;  2HS4 A;  2UYN B;  1KQS F;  3C8L A;  3LWQ C;  1CLI A;  1J7H A;  1W5B A;  3CG6 A;  1Q81 H;  3NK6 A;  2L26 A;  4ZOL B;  3VOB A;  4I50 A;  2BTQ B;  1H48 A;  3ZOP A;  1K73 H;  3WJR A;  1VQ5 F;  1XHO A;  1ZWZ A;  4TZZ A;  1XBI A;  1QD9 A;  4TV9 A;  4HNA B;  1RLU A;  5GIP C;  1W2B F;  3ZO8 A;  4LCK A;  4O4L B;  4FFB A;  3N2G A;  1KC8 H;  3P10 A;  2DT4 A;  2IQQ A;  4O2A B;  4EB6 B;  3S06 A;  5LP6 B;  3CCQ F;  2Z01 A;  4BT3 A;  3JCM M;  4ZOL A;  1GZ0 A;  3FBA A;  3HKD A;  2Z1U A;  1QVF F;  1R1M A;  1VK3 A;  3WJP A;  3RYC B;  3JAW B;  3F0D A;  5C8Y A;  3ZP4 A;  1YJN F;  1VHA A;  2IAF A;  1GX1 A;  1H47 A;  4YJ3 A;  3WJQ A;  3HKB B;  3I7T A;  1VQK F;  3MCQ A;  4B62 A;  2OTJ F;  5MN6 A;  4NQ3 A;  3PLA C;  2KTV A;  5A2Q M;  5GIO C;  1RLG A;  5EIB C;  5LOV B;  5J2T B;  2VGN A;  3N2K A;  3HKB A;  4DXD A;  5FLX M;  3IR9 A;  4XCQ A;  2CHS A;  3K0T A;  5LXT B;  1X52 A;  1FNJ A;  3F6M A;  3T80 A;  4IIJ A;  2YXZ A;  3VOA A;  3WGN A;  4X1K B;  3CXC F;  1JJ2 F;  3LWV C; 
#chains in the Genus database with same CATH homology
 1Q86 H;  1W42 A;  1W41 A;  1W3E X;  5HY4 A;  3I55 F;  1YJ9 F;  1T0K B;  2QEX F;  4BY9 D;  3CCJ F;  3LWO C;  3G6E F;  2LBW A;  3LFO A;  4BVS A;  3CCV F;  3CPW F;  1YJW F;  4EI8 A;  3D00 A;  2OZB A;  5EWR A;  2QA4 F;  1S72 F;  2FC3 A;  2QI2 A;  1KD1 H;  5HY2 A;  1M90 H;  1M1K H;  4C4W C;  4X3M A;  3NVK E;  1YIJ F;  2HVY D;  1IPA A;  1GO1 A;  1VQ4 F;  3CD6 F;  2KG4 A;  5G4U C;  3CCU F;  1Q82 H;  1DT9 A;  5GIN C;  3CC4 F;  2GLZ A;  3SIV A;  3NVI B;  2CZW A;  1YHQ F;  1SDS A;  1NJI H;  3MCA B;  3LWR C;  3FFM A;  1VQO F;  3E1Y A;  3J81 M;  3HJW C;  2WAL A;  3CCM F;  2JNB A;  3GYQ A;  3JAM M;  3G71 F;  1K8A H;  1N8R H;  3CCS F;  1YIT F;  1PXW A;  5HY0 A;  3V7Q A;  1QVG F;  3E20 B;  1H7M A;  5GAN K;  5IT9 M;  1Q7Y H;  3N4Y A;  1X7P A;  1KQS F;  1W40 A;  4EI7 A;  3LWQ C;  3J7A R;  3RA6 A;  5HY1 A;  1YI2 F;  3G4S F;  5HXZ A;  3ON1 A;  3CCE F;  2AIF A;  3CG6 A;  1Q81 H;  3NK6 A;  2BO1 A;  5FJ4 C;  1K73 H;  1VQ5 F;  1ZWZ A;  4TZZ A;  1XBI A;  3CPQ A;  3V7E A;  5GIP C;  1W2B F;  2LBX A;  4BVR A;  5GAP K;  4LCK A;  4BVQ A;  1KC8 H;  1VQ7 F;  5DCV A;  3PAF A;  3CCQ F;  3NMU C;  3JCM M;  4EI9 A;  1VQ8 F;  3AGK A;  1NMU B;  1E7K A;  1GZ0 A;  2I6D A;  3VI6 A;  1QVF F;  4X3L A;  3I56 F;  2OTL F;  2OHW A;  3OW2 F;  4BVT A;  4BW0 B;  1YJN F;  3CCL F;  1VQL F;  3LWP C;  1RA4 A;  3HAX D;  3OBY A;  1VQ9 F;  1VQK F;  3VMF B;  1VQN F;  1X7O A;  5G4V C;  3SIU A;  1CK2 A;  3CMA F;  1VQP F;  2OTJ F;  3PLA C;  4NQ3 A;  3V3T A;  2F9Z C;  2KTV A;  2VGM A;  5A2Q M;  2ALE A;  5GIO C;  3CC2 F;  3CC7 F;  3CCR F;  3OBW A;  5EO3 A;  3WXM B;  1RLG A;  1VQ6 F;  1CN7 A;  2VGN A;  1K9M H;  3O85 A;  5HXU A;  5HWE A;  3NK7 A;  2FGY A;  3RA5 A;  5FLX M;  1VQM F;  3IR9 A;  4XCQ A;  2KTU A;  1X52 A;  4NUT A;  3J80 M;  3CME F;  3N4Z A;  1GO0 A;  3CXC F;  1JJ2 F;  3LWV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...