3FFMA

The crystal structure of human gadd45g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
STARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Growth arrest and DNA-damage-inducible protein GADD45 gamma
publication title The crystal structure of human Gadd45g
rcsb
source organism Homo sapiens
total genus 50
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ffmA00
3RA6A 5GIOC 1M1KH 1IPAA 1YI2F 1XBIA 1W40A 3OBYA 1VQ5F 3WXMB 3LWOC 3CCMF 3CD6F 1K9MH 3CCQF 5EWRA 2LBWA 3V7EA 3CG6A 3VI6A 2LBXA 3CXCF 1X52A 1K8AH 1DT9A 3CCLF 1VQOF 3CC7F 3CMAF 2CZWA 2FC3A 2OZBA 2KTVA 3FFMA 3G6EF 1YJ9F 5G4UC 1YITF 5FJ4C 1QVGF 2I6DA 3LFOA 3GYQA 4TZZA 3OW2F 4X3LA 1PXWA 3CCVF 1JJ2F 2BO1A 4BY9D 3PLAC 3NK7A 3LWQC 1W42A 1KQSF 3E20B 1X7PA 1E7KA 2OTJF 1Q7YH 1YJNF 4LCKA 3CCJF 2AIFA 1X7OA 3AGKA 1VQ6F 1S72F 1T0KB 3CCSF 3J80M 3MCAB 3CPWF 2QA4F 3N4YA 3JCMM 3HJWC 3PAFA 1VQ4F 3N4ZA 1VQ9F 4NUTA 1VQMF 2KG4A 1RLGA 1CN7A 5DCVA 1YJWF 1NMUB 1W3EX 5EO3A 1W2BF 1ZWZA 5GINC 3I56F 3ON1A 1KD1H 2OTLF 3NVIB 3SIVA 1H7MA 3RA5A 3O85A 3LWVC 3CPQA 2VGNA 3OBWA 1QVFF 2KTUA 2WALA 2QI2A 1VQPF 1VQKF 1Q81H 5G4VC 2ALEA 3NMUC 1VQLF 1Q86H 3SIUA 5IT9M 1YHQF 1GZ0A 1GO1A 4BW0B 5GIPC 3CCUF 1Q82H 3CC4F 1KC8H 1W41A 3JAMM 2JNBA 3CCRF 3LWRC 5GAPK 1SDSA 1VQ8F 4X3MA 1YIJF 5FLXM 3J81M 3CMEF 3IR9A 3G71F 1VQNF 1N8RH 3CCEF 3NK6A 3NVKE 3G4SF 3V7QA 1CK2A 1RA4A 3E1YA 3VMFB 2OHWA 3HAXD 5A2QM 3LWPC 1K73H 3I55F 1NJIH 1M90H 5GANK 1VQ7F 2QEXF 3CC2F 1GO0A 4C4WC 2VGMA 3J7AR 2HVYD
chains in the Genus database with same CATH superfamily
1COMA 5LP6B 1YI2F 2GZLA 1T0AA 3LWOC 2AIZP 2BTOA 5EWRA 2Z1EA 3F6MA 4G4WA 4ZI7A 2RHJA 4B62A 2IQQA 3WGJA 1KNJA 4IIJA 1VQOF 4BT5A 2CZWA 2KTVA 1PF5A 4HNAA 1JFFB 2YXZA 4EB6B 1UI9A 5CA1A 5IJ9B 2I6DA 2P6YA 4O4LB 2CHTA 3C9UA 3B6NA 3FD5A 3CCVF 2Z1UA 3WGMA 4C8GA 4BY9D 2BTUA 4O2BA 4X1YB 2VAMA 2ZOVA 4F6RB 2OTJF 3FD6A 3FPIA 3LMEA 4O4HA 3K14A 3Q8HA 4TV9B 2AIFA 3FBAA 2F9ZC 3UT5B 1VQ6F 4M8IA 3DC2A 4ZOLB 1T0KB 2RHLA 4C8EA 3J80M 5LXTB 1NQ3A 1FFXB 3MCQA 5HY2A 2CSLA 5JVDA 3JASA 2W8BC 5C8YA 3WJPA 3JARB 5J2UB 5HY1A 1VQMF 5EYPB 1RLGA 1CN7A 1W3EX 5GINC 3EORA 3S06A 3HKBB 3K2XA 3RA5A 4FFBB 2GVIA 2ZVZA 1VQVA 2V9YA 3OBWA 1X25A 2KTUA 3WJQA 2WALA 5HP7A 4E6EA 2PHNA 5G4VC 2ALEA 1VQLF 5HP8A 3HTNA 3N2KA 4BT3A 5IT9M 1GZ0A 1IV3A 3CCUF 3F0DA 1U43A 1Q82H 1VH8A 1W41A 2N48A 3S02A 3CCRF 4I4TA 1Q8RA 1TVKA 1YIJF 3IEWA 5JH7B 4O4JA 1VQNF 3RYCB 3S0HA 2UYJA 3G4SF 4C82A 4U3JB 3ESJA 3VMFB 3E1YA 3HAXD 2OHWA 1TUBA 5LA6A 2LCAA 1RLUA 5GONB 5KX5B 3J7AR 3JAWB 2HVYD 1QU9A 2RHOA 5LYJB 4TUYA 3BYQA 3I7TA 1U3PA 1XBIA 1W5AA 1ONIA 5KMGA 4G4XA 4WBNB 1K9MH 4EI9A 5JQGB 5CA0A 3C8LA 1W5FA 1YGYA 3F0GA 3VI6A 4BVSA 1X52A 3CXCF 1DT9A 3P0ZA 3CCLF 3V3TA 3RYHB 3TD3A 3CMAF 5J2TA 4U39A 3VOBA 1JY8A 1YJ9F 5LOVA 3KE1A 1H47A 5FJ4C 3LFOA 2GLZA 3HKEB 3OW2F 4IHJB 4X3LA 1W59A 3F0FA 3PLAC 4TV8B 1X7PA 2UYKA 1E7KA 1Q7YH 5IYZB 4LNUB 3CCJF 4ZHVA 3C9RA 3AGKA 4YJ3B 1S72F 3ERNA 1ODEA 3MCAB 3JAKB 4EI8A 1JFFA 4BVRA 2R751 4YJ2B 3N4YA 4NWOB 1VQ9F 1DBFA 3HKDA 3VTIC 1J7HA 1SA0A 5EAZA 4BVQA 4ZI7B 5BMVB 3K0TA 1ZWZA 1W2BF 3ON1A 2MQEA 4RQOA 3SIVA 2HP0A 1QAHA 3IKEA 1QVFF 5JCOA 4TV9A 2QI2A 1VQPF 2H8CA 3UT5A 3ZP7A 2NMUA 1Q86H 4HNAB 5CA1B 1YHQF 4BVTA 1GO1A 1FFXA 1VK3A 5GIPC 5EB1B 3CC4F 1KC8H 3JAMM 2ZAUA 3KHNA 3JARA 3LWRC 3E22A 2FGYA 1VQ8F 3LYBA 3CMEF 3RYIB 1N8RH 3NK6A 5HWEA 2Z01A 3T80A 4EI7A 1CK2A 4O4IB 2Z1FA 1RA4A 4B45A 3IEQA 5A2QM 2HP3A 3S0WA 1K73H 1VQ7F 3D01A 1NJIH 4O2AB 2UYNA 2QEXF 4C4WC 2IG8A 5ITZB 1H48A 3RA6A 5GIOC 1IPAA 2HRYA 1GX1A 1W55A 3TD5A 2CVLA 4I50B 1KNKA 3WXMB 1Z5VA 4X1IA 3CCQF 5CB4B 2LBWA 5EZYA 2KGWA 1CLIA 3CG6A 4G88A 3ZO8A 3V4DA 2Q1YA 4U3JA 1W581 1XHOA 2ZVYA 2K1SA 2RB9A 1R1MA 2Q1XA 3FFMA 3G6EF 3P10A 5GONA 3ZP4A 5KX5A 3VCZA 4X1KB 3JAWA 4BT2A 2DT4A 3IKFA 1PXWA 5EB0A 4I4TB 1TVKB 3WGKA 1JJ2F 2BO1A 2HS3A 4O4JB 3D54A 3JALB 4I55A 1FNJA 3LWQC 1KQSF 3E20B 1YJNF 1QD9A 1IV1A 5MN6A 2PMPA 4G4YA 3U0OA 2Z1TA 3K12A 4ZHYB 1TUBB 3HKCB 3CB2A 5LA6B 4ERHA 3N2GB 4X20B 3CCSF 3VYUC 4BT6A 1U3LA 3S0YA 3WJRA 3CYPB 3RYFB 4DRXB 2VAWA 3PAFA 3HKEA 3N4ZA 3C9TA 1FNKA 1OFUA 3GTZA 3IMPA 4ZHQB 5KMGB 3OONA 5LP6A 2KG4A 5IJ0B 5DCVA 5EIBD 3D00A 2R6R1 5FNVB 3JATB 5EIBC 2DYYA 5LP6C 1H7MA 3O85A 3CPQA 2VGNA 4LNUA 2UYPA 3MDOA 3RE3A 3WGLA 1Q81H 2G9IA 4YJ3A 3NMUC 3SIUA 3TD4A 4G4VA 1FSZA 2I6RA 3JAKA 3QUWA 4EB6A 4YJ2A 5IJ9A 4O4LA 2JNBA 3R0PA 3M84A 4BT7A 1JD1A 5GAPK 1W5BA 1SDSA 2CHSA 2ZF8A 3J81M 5BMVA 1U40A 5MN5A 4X1YA 4F6RA 4RHAA 2LBTA 3KJJA 3V7QA 4IIJB 2ZODA 1W5EA 5HY4A 3M1XA 4C8IA 4ZOLA 1GO0A 1XRGA 3QHDA 1M90H 5GANK 3WPXA 3VOAA 5JCOC 2VAPA 5LXTA 2HX0A 2HS0A 3DDNA 3HKDB 1M1KH 1SA0B 1VHAA 3CYQA 1W40A 3OBYA 5B8FA 5J2UA 1VQ5F 4O2BB 4KWEA 5EYPA 3CCMF 3CD6F 2B33A 2HP0B 2BTQB 3RYIA 4O4HB 3V7EA 1JN1A 3HKBA 2LBXA 1K8AH 4ZHWA 3VYTC 4FFBA 3VYSC 2HQSC 4O4IA 3CC7F 2FC3A 2OZBA 3HWUA 2VXYA 5G4UC 3M4SA 4O2AA 1YITF 3VIUA 2IAFA 1QVGF 5JVDB 2EWCA 3JASB 3GYQA 3L7QA 3WGNA 2OTMA 5C8YB 4TZZA 5ITZA 2YYEA 3E22B 1UFYA 3KIZA 4I50A 3F0EA 3NK7A 1W42A 2HS4A 4R40B 5JH7A 5HY0A 5CB4A 3RYCA 4LCKA 3P4EA 5HXZA 1RQ2A 1SZQA 1X7OA 4G4ZA 3S03A 3ELCA 2L26A 4XCQA 2UYNB 3N2KB 3CPWF 1W57A 2QA4F 1XV2A 4X1KA 3JCMM 3HJWC 1VQ4F 4PWTA 4C81A 4ZK7A 4NUTA 5LYJA 4X1IB 1YJWF 1NMUB 5EO3A 5EZYB 2RHHA 3JALA 3I56F 1KD1H 4WBNA 2H8EA 2OTLF 3NVIB 3MQWA 1YQNA 3KJKA 5JQGA 3GHZA 3LWVC 1RQ7A 3I3FA 4DXDA 3HKCA 1VQKF 2QTPA 3RYHA 3N2GA 4X20A 1Z5WA 3C9SA 3WPWA 4BW0B 3RYFA 4DRXA 2H6LA 3LDTA 4TUYB 4IHJA 5AVMA 4B5CA 4ZHQA 1IV4A 4I55B 5IJ0A 4X3MA 2HRUA 5FLXM 3QTYA 3IR9A 3ZOPA 5CA0B 3G71F 2AMTA 3JATA 4TV8A 5FNVA 3CCEF 3NVKE 3JVHA 2CW4A 4NQ3A 3VO8A 5IYZA 5MN4A 2CWJA 5J2TB 5LOVB 1OAPA 3LWPC 5HXUA 3I55F 3CC2F 1IV2A 2VGMA 2UZHA 3MBMA 4B46A 4BT4A
chains in the Genus database with same CATH topology
3RA6A 5GIOC 1M1KH 1IPAA 1YI2F 1XBIA 1W40A 3OBYA 1VQ5F 3WXMB 3LWOC 3CCMF 3CD6F 1K9MH 3CCQF 5EWRA 4EI9A 2LBWA 3V7EA 3CG6A 3VI6A 2LBXA 4BVSA 1X52A 3CXCF 1DT9A 1K8AH 3CCLF 3V3TA 1VQOF 3CC7F 3CMAF 2CZWA 2FC3A 2OZBA 2KTVA 3FFMA 3G6EF 1YJ9F 5G4UC 1YITF 5FJ4C 1QVGF 2I6DA 3LFOA 3GYQA 2GLZA 4TZZA 3OW2F 4X3LA 1PXWA 3CCVF 1JJ2F 2BO1A 4BY9D 3PLAC 3NK7A 3LWQC 1W42A 1KQSF 3E20B 1X7PA 1E7KA 5HY0A 2OTJF 1Q7YH 1YJNF 4LCKA 3CCJF 2AIFA 5HXZA 2F9ZC 1X7OA 3AGKA 1VQ6F 1S72F 4XCQA 1T0KB 3CCSF 3J80M 3MCAB 4EI8A 3CPWF 5HY2A 2QA4F 3N4YA 3JCMM 3HJWC 3PAFA 1VQ4F 3N4ZA 1VQ9F 5HY1A 4NUTA 1VQMF 2KG4A 1RLGA 1CN7A 5DCVA 4BVQA 1NMUB 1YJWF 1W3EX 5EO3A 1W2BF 1ZWZA 3D00A 5GINC 3ON1A 3I56F 1KD1H 2OTLF 3NVIB 3SIVA 1H7MA 3RA5A 3O85A 3LWVC 3CPQA 2VGNA 3OBWA 1QVFF 2KTUA 2WALA 2QI2A 1VQPF 1VQKF 1Q81H 5G4VC 2ALEA 3NMUC 1VQLF 1Q86H 3SIUA 5IT9M 1YHQF 4BVTA 1GZ0A 1GO1A 4BW0B 5GIPC 3CCUF 1Q82H 3CC4F 1KC8H 1W41A 3JAMM 2JNBA 3CCRF 3LWRC 5GAPK 1SDSA 2FGYA 4X3MA 1YIJF 1VQ8F 5FLXM 3J81M 3CMEF 3IR9A 3G71F 1VQNF 1N8RH 3CCEF 3NK6A 4NQ3A 3NVKE 3G4SF 5HWEA 3V7QA 4EI7A 1CK2A 1RA4A 3E1YA 3VMFB 2OHWA 3HAXD 5HY4A 5A2QM 3LWPC 1K73H 5HXUA 3I55F 1NJIH 5GANK 1M90H 2QEXF 3CC2F 1VQ7F 1GO0A 4C4WC 2VGMA 3J7AR 4BVRA 2HVYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RA6 A;  5GIO C;  1M1K H;  1IPA A;  1YI2 F;  1XBI A;  1W40 A;  3OBY A;  1VQ5 F;  3WXM B;  3LWO C;  3CCM F;  3CD6 F;  1K9M H;  3CCQ F;  5EWR A;  2LBW A;  3V7E A;  3CG6 A;  3VI6 A;  2LBX A;  3CXC F;  1X52 A;  1K8A H;  1DT9 A;  3CCL F;  1VQO F;  3CC7 F;  3CMA F;  2CZW A;  2FC3 A;  2OZB A;  2KTV A;  3FFM A;  3G6E F;  1YJ9 F;  5G4U C;  1YIT F;  5FJ4 C;  1QVG F;  2I6D A;  3LFO A;  3GYQ A;  4TZZ A;  3OW2 F;  4X3L A;  1PXW A;  3CCV F;  1JJ2 F;  2BO1 A;  4BY9 D;  3PLA C;  3NK7 A;  3LWQ C;  1W42 A;  1KQS F;  3E20 B;  1X7P A;  1E7K A;  2OTJ F;  1Q7Y H;  1YJN F;  4LCK A;  3CCJ F;  2AIF A;  1X7O A;  3AGK A;  1VQ6 F;  1S72 F;  1T0K B;  3CCS F;  3J80 M;  3MCA B;  3CPW F;  2QA4 F;  3N4Y A;  3JCM M;  3HJW C;  3PAF A;  1VQ4 F;  3N4Z A;  1VQ9 F;  4NUT A;  1VQM F;  2KG4 A;  1RLG A;  1CN7 A;  5DCV A;  1YJW F;  1NMU B;  1W3E X;  5EO3 A;  1W2B F;  1ZWZ A;  5GIN C;  3I56 F;  3ON1 A;  1KD1 H;  2OTL F;  3NVI B;  3SIV A;  1H7M A;  3RA5 A;  3O85 A;  3LWV C;  3CPQ A;  2VGN A;  3OBW A;  1QVF F;  2KTU A;  2WAL A;  2QI2 A;  1VQP F;  1VQK F;  1Q81 H;  5G4V C;  2ALE A;  3NMU C;  1VQL F;  1Q86 H;  3SIU A;  5IT9 M;  1YHQ F;  1GZ0 A;  1GO1 A;  4BW0 B;  5GIP C;  3CCU F;  1Q82 H;  3CC4 F;  1KC8 H;  1W41 A;  3JAM M;  2JNB A;  3CCR F;  3LWR C;  5GAP K;  1SDS A;  1VQ8 F;  4X3M A;  1YIJ F;  5FLX M;  3J81 M;  3CME F;  3IR9 A;  3G71 F;  1VQN F;  1N8R H;  3CCE F;  3NK6 A;  3NVK E;  3G4S F;  3V7Q A;  1CK2 A;  1RA4 A;  3E1Y A;  3VMF B;  2OHW A;  3HAX D;  5A2Q M;  3LWP C;  1K73 H;  3I55 F;  1NJI H;  1M90 H;  5GAN K;  1VQ7 F;  2QEX F;  3CC2 F;  1GO0 A;  4C4W C;  2VGM A;  3J7A R;  2HVY D; 
#chains in the Genus database with same CATH topology
 1COM A;  5LP6 B;  1YI2 F;  2GZL A;  1T0A A;  3LWO C;  2AIZ P;  2BTO A;  5EWR A;  2Z1E A;  3F6M A;  4G4W A;  4ZI7 A;  2RHJ A;  4B62 A;  2IQQ A;  3WGJ A;  1KNJ A;  4IIJ A;  1VQO F;  4BT5 A;  2CZW A;  2KTV A;  1PF5 A;  4HNA A;  1JFF B;  2YXZ A;  4EB6 B;  1UI9 A;  5CA1 A;  5IJ9 B;  2I6D A;  2P6Y A;  4O4L B;  2CHT A;  3C9U A;  3B6N A;  3FD5 A;  3CCV F;  2Z1U A;  3WGM A;  4C8G A;  4BY9 D;  2BTU A;  4O2B A;  4X1Y B;  2VAM A;  2ZOV A;  4F6R B;  2OTJ F;  3FD6 A;  3FPI A;  3LME A;  4O4H A;  3K14 A;  3Q8H A;  4TV9 B;  2AIF A;  3FBA A;  2F9Z C;  3UT5 B;  1VQ6 F;  4M8I A;  3DC2 A;  4ZOL B;  1T0K B;  2RHL A;  4C8E A;  3J80 M;  5LXT B;  1NQ3 A;  1FFX B;  3MCQ A;  5HY2 A;  2CSL A;  5JVD A;  3JAS A;  2W8B C;  5C8Y A;  3WJP A;  3JAR B;  5J2U B;  5HY1 A;  1VQM F;  5EYP B;  1RLG A;  1CN7 A;  1W3E X;  5GIN C;  3EOR A;  3S06 A;  3HKB B;  3K2X A;  3RA5 A;  4FFB B;  2GVI A;  2ZVZ A;  1VQV A;  2V9Y A;  3OBW A;  1X25 A;  2KTU A;  3WJQ A;  2WAL A;  5HP7 A;  4E6E A;  2PHN A;  5G4V C;  2ALE A;  1VQL F;  5HP8 A;  3HTN A;  3N2K A;  4BT3 A;  5IT9 M;  1GZ0 A;  1IV3 A;  3CCU F;  3F0D A;  1U43 A;  1Q82 H;  1VH8 A;  1W41 A;  2N48 A;  3S02 A;  3CCR F;  4I4T A;  1Q8R A;  1TVK A;  1YIJ F;  3IEW A;  5JH7 B;  4O4J A;  1VQN F;  3RYC B;  3S0H A;  2UYJ A;  3G4S F;  4C82 A;  4U3J B;  3ESJ A;  3VMF B;  3E1Y A;  3HAX D;  2OHW A;  1TUB A;  5LA6 A;  2LCA A;  1RLU A;  5GON B;  5KX5 B;  3J7A R;  3JAW B;  2HVY D;  1QU9 A;  2RHO A;  5LYJ B;  4TUY A;  3BYQ A;  3I7T A;  1U3P A;  1XBI A;  1W5A A;  1ONI A;  5KMG A;  4G4X A;  4WBN B;  1K9M H;  4EI9 A;  5JQG B;  5CA0 A;  3C8L A;  1W5F A;  1YGY A;  3F0G A;  3VI6 A;  4BVS A;  1X52 A;  3CXC F;  1DT9 A;  3P0Z A;  3CCL F;  3V3T A;  3RYH B;  3TD3 A;  3CMA F;  5J2T A;  4U39 A;  3VOB A;  1JY8 A;  1YJ9 F;  5LOV A;  3KE1 A;  1H47 A;  5FJ4 C;  3LFO A;  2GLZ A;  3HKE B;  3OW2 F;  4IHJ B;  4X3L A;  1W59 A;  3F0F A;  3PLA C;  4TV8 B;  1X7P A;  2UYK A;  1E7K A;  1Q7Y H;  5IYZ B;  4LNU B;  3CCJ F;  4ZHV A;  3C9R A;  3AGK A;  4YJ3 B;  1S72 F;  3ERN A;  1ODE A;  3MCA B;  3JAK B;  4EI8 A;  1JFF A;  4BVR A;  2R75 1;  4YJ2 B;  3N4Y A;  4NWO B;  1VQ9 F;  1DBF A;  3HKD A;  3VTI C;  1J7H A;  1SA0 A;  5EAZ A;  4BVQ A;  4ZI7 B;  5BMV B;  3K0T A;  1ZWZ A;  1W2B F;  3ON1 A;  2MQE A;  4RQO A;  3SIV A;  2HP0 A;  1QAH A;  3IKE A;  1QVF F;  5JCO A;  4TV9 A;  2QI2 A;  1VQP F;  2H8C A;  3UT5 A;  3ZP7 A;  2NMU A;  1Q86 H;  4HNA B;  5CA1 B;  1YHQ F;  4BVT A;  1GO1 A;  1FFX A;  1VK3 A;  5GIP C;  5EB1 B;  3CC4 F;  1KC8 H;  3JAM M;  2ZAU A;  3KHN A;  3JAR A;  3LWR C;  3E22 A;  2FGY A;  1VQ8 F;  3LYB A;  3CME F;  3RYI B;  1N8R H;  3NK6 A;  5HWE A;  2Z01 A;  3T80 A;  4EI7 A;  1CK2 A;  4O4I B;  2Z1F A;  1RA4 A;  4B45 A;  3IEQ A;  5A2Q M;  2HP3 A;  3S0W A;  1K73 H;  1VQ7 F;  3D01 A;  1NJI H;  4O2A B;  2UYN A;  2QEX F;  4C4W C;  2IG8 A;  5ITZ B;  1H48 A;  3RA6 A;  5GIO C;  1IPA A;  2HRY A;  1GX1 A;  1W55 A;  3TD5 A;  2CVL A;  4I50 B;  1KNK A;  3WXM B;  1Z5V A;  4X1I A;  3CCQ F;  5CB4 B;  2LBW A;  5EZY A;  2KGW A;  1CLI A;  3CG6 A;  4G88 A;  3ZO8 A;  3V4D A;  2Q1Y A;  4U3J A;  1W58 1;  1XHO A;  2ZVY A;  2K1S A;  2RB9 A;  1R1M A;  2Q1X A;  3FFM A;  3G6E F;  3P10 A;  5GON A;  3ZP4 A;  5KX5 A;  3VCZ A;  4X1K B;  3JAW A;  4BT2 A;  2DT4 A;  3IKF A;  1PXW A;  5EB0 A;  4I4T B;  1TVK B;  3WGK A;  1JJ2 F;  2BO1 A;  2HS3 A;  4O4J B;  3D54 A;  3JAL B;  4I55 A;  1FNJ A;  3LWQ C;  1KQS F;  3E20 B;  1YJN F;  1QD9 A;  1IV1 A;  5MN6 A;  2PMP A;  4G4Y A;  3U0O A;  2Z1T A;  3K12 A;  4ZHY B;  1TUB B;  3HKC B;  3CB2 A;  5LA6 B;  4ERH A;  3N2G B;  4X20 B;  3CCS F;  3VYU C;  4BT6 A;  1U3L A;  3S0Y A;  3WJR A;  3CYP B;  3RYF B;  4DRX B;  2VAW A;  3PAF A;  3HKE A;  3N4Z A;  3C9T A;  1FNK A;  1OFU A;  3GTZ A;  3IMP A;  4ZHQ B;  5KMG B;  3OON A;  5LP6 A;  2KG4 A;  5IJ0 B;  5DCV A;  5EIB D;  3D00 A;  2R6R 1;  5FNV B;  3JAT B;  5EIB C;  2DYY A;  5LP6 C;  1H7M A;  3O85 A;  3CPQ A;  2VGN A;  4LNU A;  2UYP A;  3MDO A;  3RE3 A;  3WGL A;  1Q81 H;  2G9I A;  4YJ3 A;  3NMU C;  3SIU A;  3TD4 A;  4G4V A;  1FSZ A;  2I6R A;  3JAK A;  3QUW A;  4EB6 A;  4YJ2 A;  5IJ9 A;  4O4L A;  2JNB A;  3R0P A;  3M84 A;  4BT7 A;  1JD1 A;  5GAP K;  1W5B A;  1SDS A;  2CHS A;  2ZF8 A;  3J81 M;  5BMV A;  1U40 A;  5MN5 A;  4X1Y A;  4F6R A;  4RHA A;  2LBT A;  3KJJ A;  3V7Q A;  4IIJ B;  2ZOD A;  1W5E A;  5HY4 A;  3M1X A;  4C8I A;  4ZOL A;  1GO0 A;  1XRG A;  3QHD A;  1M90 H;  5GAN K;  3WPX A;  3VOA A;  5JCO C;  2VAP A;  5LXT A;  2HX0 A;  2HS0 A;  3DDN A;  3HKD B;  1M1K H;  1SA0 B;  1VHA A;  3CYQ A;  1W40 A;  3OBY A;  5B8F A;  5J2U A;  1VQ5 F;  4O2B B;  4KWE A;  5EYP A;  3CCM F;  3CD6 F;  2B33 A;  2HP0 B;  2BTQ B;  3RYI A;  4O4H B;  3V7E A;  1JN1 A;  3HKB A;  2LBX A;  1K8A H;  4ZHW A;  3VYT C;  4FFB A;  3VYS C;  2HQS C;  4O4I A;  3CC7 F;  2FC3 A;  2OZB A;  3HWU A;  2VXY A;  5G4U C;  3M4S A;  4O2A A;  1YIT F;  3VIU A;  2IAF A;  1QVG F;  5JVD B;  2EWC A;  3JAS B;  3GYQ A;  3L7Q A;  3WGN A;  2OTM A;  5C8Y B;  4TZZ A;  5ITZ A;  2YYE A;  3E22 B;  1UFY A;  3KIZ A;  4I50 A;  3F0E A;  3NK7 A;  1W42 A;  2HS4 A;  4R40 B;  5JH7 A;  5HY0 A;  5CB4 A;  3RYC A;  4LCK A;  3P4E A;  5HXZ A;  1RQ2 A;  1SZQ A;  1X7O A;  4G4Z A;  3S03 A;  3ELC A;  2L26 A;  4XCQ A;  2UYN B;  3N2K B;  3CPW F;  1W57 A;  2QA4 F;  1XV2 A;  4X1K A;  3JCM M;  3HJW C;  1VQ4 F;  4PWT A;  4C81 A;  4ZK7 A;  4NUT A;  5LYJ A;  4X1I B;  1YJW F;  1NMU B;  5EO3 A;  5EZY B;  2RHH A;  3JAL A;  3I56 F;  1KD1 H;  4WBN A;  2H8E A;  2OTL F;  3NVI B;  3MQW A;  1YQN A;  3KJK A;  5JQG A;  3GHZ A;  3LWV C;  1RQ7 A;  3I3F A;  4DXD A;  3HKC A;  1VQK F;  2QTP A;  3RYH A;  3N2G A;  4X20 A;  1Z5W A;  3C9S A;  3WPW A;  4BW0 B;  3RYF A;  4DRX A;  2H6L A;  3LDT A;  4TUY B;  4IHJ A;  5AVM A;  4B5C A;  4ZHQ A;  1IV4 A;  4I55 B;  5IJ0 A;  4X3M A;  2HRU A;  5FLX M;  3QTY A;  3IR9 A;  3ZOP A;  5CA0 B;  3G71 F;  2AMT A;  3JAT A;  4TV8 A;  5FNV A;  3CCE F;  3NVK E;  3JVH A;  2CW4 A;  4NQ3 A;  3VO8 A;  5IYZ A;  5MN4 A;  2CWJ A;  5J2T B;  5LOV B;  1OAP A;  3LWP C;  5HXU A;  3I55 F;  3CC2 F;  1IV2 A;  2VGM A;  2UZH A;  3MBM A;  4B46 A;  4BT4 A; 
#chains in the Genus database with same CATH homology
 3RA6 A;  5GIO C;  1M1K H;  1IPA A;  1YI2 F;  1XBI A;  1W40 A;  3OBY A;  1VQ5 F;  3WXM B;  3LWO C;  3CCM F;  3CD6 F;  1K9M H;  3CCQ F;  5EWR A;  4EI9 A;  2LBW A;  3V7E A;  3CG6 A;  3VI6 A;  2LBX A;  4BVS A;  1X52 A;  3CXC F;  1DT9 A;  1K8A H;  3CCL F;  3V3T A;  1VQO F;  3CC7 F;  3CMA F;  2CZW A;  2FC3 A;  2OZB A;  2KTV A;  3FFM A;  3G6E F;  1YJ9 F;  5G4U C;  1YIT F;  5FJ4 C;  1QVG F;  2I6D A;  3LFO A;  3GYQ A;  2GLZ A;  4TZZ A;  3OW2 F;  4X3L A;  1PXW A;  3CCV F;  1JJ2 F;  2BO1 A;  4BY9 D;  3PLA C;  3NK7 A;  3LWQ C;  1W42 A;  1KQS F;  3E20 B;  1X7P A;  1E7K A;  5HY0 A;  2OTJ F;  1Q7Y H;  1YJN F;  4LCK A;  3CCJ F;  2AIF A;  5HXZ A;  2F9Z C;  1X7O A;  3AGK A;  1VQ6 F;  1S72 F;  4XCQ A;  1T0K B;  3CCS F;  3J80 M;  3MCA B;  4EI8 A;  3CPW F;  5HY2 A;  2QA4 F;  3N4Y A;  3JCM M;  3HJW C;  3PAF A;  1VQ4 F;  3N4Z A;  1VQ9 F;  5HY1 A;  4NUT A;  1VQM F;  2KG4 A;  1RLG A;  1CN7 A;  5DCV A;  4BVQ A;  1NMU B;  1YJW F;  1W3E X;  5EO3 A;  1W2B F;  1ZWZ A;  3D00 A;  5GIN C;  3ON1 A;  3I56 F;  1KD1 H;  2OTL F;  3NVI B;  3SIV A;  1H7M A;  3RA5 A;  3O85 A;  3LWV C;  3CPQ A;  2VGN A;  3OBW A;  1QVF F;  2KTU A;  2WAL A;  2QI2 A;  1VQP F;  1VQK F;  1Q81 H;  5G4V C;  2ALE A;  3NMU C;  1VQL F;  1Q86 H;  3SIU A;  5IT9 M;  1YHQ F;  4BVT A;  1GZ0 A;  1GO1 A;  4BW0 B;  5GIP C;  3CCU F;  1Q82 H;  3CC4 F;  1KC8 H;  1W41 A;  3JAM M;  2JNB A;  3CCR F;  3LWR C;  5GAP K;  1SDS A;  2FGY A;  4X3M A;  1YIJ F;  1VQ8 F;  5FLX M;  3J81 M;  3CME F;  3IR9 A;  3G71 F;  1VQN F;  1N8R H;  3CCE F;  3NK6 A;  4NQ3 A;  3NVK E;  3G4S F;  5HWE A;  3V7Q A;  4EI7 A;  1CK2 A;  1RA4 A;  3E1Y A;  3VMF B;  2OHW A;  3HAX D;  5HY4 A;  5A2Q M;  3LWP C;  1K73 H;  5HXU A;  3I55 F;  1NJI H;  5GAN K;  1M90 H;  2QEX F;  3CC2 F;  1VQ7 F;  1GO0 A;  4C4W C;  2VGM A;  3J7A R;  4BVR A;  2HVY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...