3FFMA

The crystal structure of human gadd45g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
STARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Gadd45g
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Growth arrest and DNA-damage-inducible protein GADD45 gamma
total genus 50
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ffmA00
2JNBA 3OW2F 3CCVF 3HJWC 1QVGF 3AGKA 3JAMM 1Q86H 4BY9D 1IPAA 3PLAC 3CCQF 3PAFA 3CMAF 3NVIB 1GZ0A 1Q82H 3HAXD 4C4WC 3SIUA 1VQOF 1YIJF 1K73H 1YJ9F 1YJNF 3LWVC 1VQMF 1M1KH 3IR9A 1GO0A 5FJ4C 2QI2A 1T0KB 1W2BF 1VQKF 1VQLF 3CD6F 3CCRF 2CZWA 3LWQC 1W42A 1XBIA 3NVKE 5G4UC 3J7AR 1KQSF 3ON1A 5GAPK 1S72F 3V7QA 2QA4F 1Q81H 5GIOC 2KG4A 1PXWA 5EWRA 3LWPC 5IT9M 1K9MH 3CC4F 5FLXM 1KC8H 3CCUF 3OBWA 1YHQF 3LFOA 3SIVA 3NK6A 3G6EF 1QVFF 3J80M 3CCSF 4X3LA 3CCEF 3E20B 1CN7A 5GANK 2VGNA 1GO1A 5EO3A 5G4VC 1E7KA 3CPQA 2LBXA 2OTJF 1VQ7F 2LBWA 1CK2A 3JCMM 3GYQA 1VQNF 3VMFB 1YI2F 1NMUB 3I56F 3CCJF 3NMUC 2FC3A 3E1YA 3LWOC 3LWRC 1KD1H 2HVYD 2OZBA 1X7OA 1VQ8F 1RLGA 1JJ2F 4BW0B 2AIFA 3CXCF 4TZZA 3CC7F 1YJWF 4NUTA 1VQ6F 1SDSA 1VQ4F 3WXMB 1RA4A 3RA6A 1K8AH 1X7PA 2VGMA 1YITF 2WALA 2KTUA 3FFMA 2BO1A 1M90H 3VI6A 1W41A 3G4SF 3CMEF 2OTLF 3OBYA 1ZWZA 1NJIH 3MCAB 1VQ9F 1W3EX 1Q7YH 4X3MA 4LCKA 1DT9A 3J81M 1VQPF 3CC2F 2ALEA 2OHWA 5A2QM 5GINC 3CCLF 2QEXF 3V7EA 1X52A 1VQ5F 3RA5A 3N4ZA 3I55F 5GIPC 3O85A 3G71F 2I6DA 1N8RH 3CPWF 3CCMF 1H7MA 2KTVA 1W40A 3N4YA 5DCVA 3NK7A 3CG6A
chains in the Genus database with same CATH superfamily
2CHTA 3VIUA 4ZHQB 3OW2F 2IG8A 1QVGF 3AGKA 5IYZB 1Q86H 4BY9D 4TV9B 4G88A 3ESJA 3PAFA 4B5CA 5KMGA 5LOVB 3CB2A 1YIJF 3MBMA 3VCZA 4WBNB 1YJNF 2CSLA 4ZI7A 4TV8B 5KMGB 1XHOA 2VAPA 5IYZA 1GX1A 2HP0A 3V3TA 1W2BF 2PMPA 1VQKF 4ZHWA 3LWQC 4ZHQA 1XBIA 1PF5A 5IJ0A 3UT5A 1JFFB 2L26A 4G4WA 5LA6B 1QU9A 5J2TA 2DT4A 4O4IB 3RYCB 3V7QA 1RQ2A 1KNJA 5GIOC 2UYPA 3N2KA 4EB6B 5EWRA 5CA0A 3JATB 2VAWA 3IEQA 1U40A 3CC4F 3HKEA 1JY8A 3M4SA 4BT6A 3CCUF 1YHQF 3S06A 3WJRA 2ZVYA 4DRXB 5CB4B 2CHSA 5EIBC 5JVDB 1CLIA 3ZP7A 3NK6A 3KJKA 3F0FA 4LNUA 4O2BA 1H48A 4O4JA 3CCSF 3CCEF 4EI7A 1VH8A 5GANK 4I55A 1COMA 3BYQA 5EO3A 3V4DA 1VQ7F 4RHAA 3VMFB 3JASA 3I56F 3CCJF 3F6MA 4M8IA 5HY1A 2UZHA 3JASB 3WGNA 1RLGA 4BW0B 4TZZA 2ZAUA 2BTOA 3P4EA 5EB1B 1VQ4F 1T0AA 2N48A 3LYBA 2B33A 1IV1A 2VXYA 4O4JB 4RQOA 3DDNA 1M90H 1W41A 1ODEA 1UI9A 3CMEF 5KX5B 2HRUA 2OTLF 2NMUA 4NWOB 3VTIC 1QD9A 3Q8HA 2R751 3MCAB 5CB4A 1VQ9F 1W3EX 1TUBA 2BTQB 2Z1EA 4EI8A 3J81M 3GTZA 5CA0B 3CC2F 2ALEA 3C9UA 5A2QM 2QEXF 4O2AB 3RYCA 3N4ZA 3CPWF 2CWJA 3UT5B 2H8EA 3TD4A 1X25A 3NK7A 2UYKA 3C8LA 2VAMA 5LP6C 3CYPB 2CW4A 2P6YA 4HNAA 3CCVF 2RHJA 1JN1A 3JAMM 3PLAC 3CCQF 3CMAF 1W57A 3FD6A 1Q82H 4C4WC 4TV9A 1VQOF 1VQMF 5MN4A 3K12A 2KGWA 3IR9A 1VHAA 1T0KB 1RQ7A 2HX0A 2CZWA 2AMTA 5LYJB 2Z1FA 3JARB 4U3JA 2H8CA 1KQSF 1S72F 3IEWA 2Q1YA 5HXUA 3JAKA 2KG4A 1PXWA 5BMVA 1K9MH 1U3PA 1FSZA 3S0HA 2EWCA 5JVDA 2QTPA 2K1SA 4DRXA 3KE1A 3CYQA 3HKEB 3WGKA 4B45A 4BT2A 3J80M 4X3LA 3D00A 4O4LB 1Q8RA 3F0EA 4EB6A 3JAWA 1FFXA 5G4VC 2YYEA 3CPQA 2LBXA 4FFBB 4KWEA 2OTJF 3RYIA 3WPWA 5J2TB 3JCMM 1VQNF 3QUWA 1QAHA 3QTYA 1NMUB 3IKFA 2FC3A 4X1YA 2RB9A 2IAFA 2Q1XA 1FNKA 3LWOC 1XV2A 3WGLA 2R6R1 3B6NA 2IQQA 4TV8A 4ZI7B 3CXCF 3KHNA 3K2XA 3M84A 3HKCB 3WXMB 1RA4A 2CVLA 5J2UB 1YITF 3MCQA 2WALA 2UYNA 3FFMA 3VI6A 1XRGA 2H6LA 2HS3A 5AVMA 3VYUC 2AIZP 2FGYA 3R0PA 1DBFA 5EB0A 1NQ3A 4C82A 3FBAA 2YXZA 4X3MA 1SA0A 3U0OA 4LCKA 1VQPF 2F9ZC 2OHWA 5GINC 3S0YA 3V7EA 1R1MA 3K0TA 3S02A 5LP6B 2HQSC 3ZP4A 4I4TA 3I55F 5C8YA 3HTNA 3G71F 4YJ2A 5J2UA 2Z01A 3WPXA 3M1XA 2DYYA 4ZHYB 4PWTA 4DXDA 4TUYB 2HS0A 5JH7B 4IIJB 5HWEA 3C9SA 4U39A 2V9YA 3E22A 2ZF8A 3RYHA 2GLZA 3ZO8A 1IPAA 4IHJA 4X1KA 1GZ0A 3SIUA 3RYFA 4ZOLB 4ZOLA 4FFBA 5IJ9A 1YJ9F 3KJJA 4YJ3A 5HP8A 2Z1TA 1M1KH 4IHJB 2MQEA 4BVRA 3CD6F 1TVKA 4IIJA 1W42A 3NVKE 5G4UC 2HS4A 3HKBA 3ON1A 3VOAA 5GONB 2QA4F 5ITZA 4G4VA 3I7TA 3HKDB 3LWPC 3RE3A 4F6RA 1J7HA 3LFOA 4X20A 1SA0B 3K14A 3VOBA 5CA1B 4G4YA 4I50A 3FPIA 5JQGB 3E20B 5B8FA 3LDTA 1UFYA 1GO1A 3WGMA 2HP3A 2LBTA 3VO8A 2OTMA 1CK2A 3GYQA 4BT4A 5EIBD 1FNJA 3LWRC 1KD1H 1Z5VA 2HVYD 4HNAB 2RHLA 2OZBA 4X1IA 5EYPB 1VQ8F 3JALA 3CC7F 1VQ6F 1W59A 3JVHA 3IKEA 3RA6A 1W581 1X7PA 1ONIA 1SZQA 2VGMA 1W55A 2LCAA 3DC2A 5MN5A 1IV4A 2KTUA 5EZYB 1OAPA 5FNVB 5CA1A 3G4SF 3JAWB 1NJIH 1H47A 1KNKA 1W5BA 3MDOA 1DT9A 1W5FA 3ZOPA 5KX5A 1IV2A 4O4HA 4BT3A 5ITZB 3F0GA 3P10A 5HP7A 5GIPC 4O4HB 1YQNA 3O85A 2BTUA 3GHZA 1N8RH 2I6DA 2Z1UA 3CCMF 1H7MA 2KTVA 1W40A 1TVKB 1IV3A 5DCVA 4U3JB 4XCQA 4G4XA 1U3LA 2JNBA 1VK3A 4YJ3B 1YGYA 3HJWC 5FNVA 5EZYA 3NVIB 3HAXD 4ZHVA 4X1KB 3I3FA 5HY0A 3RYHB 1K73H 4C8EA 3LWVC 3E22B 3JALB 4BVQA 1GO0A 3OONA 4X1IB 5EYPA 4BVTA 2UYJA 4TUYA 4C8GA 5FJ4C 2QI2A 4LNUB 4O2BB 3C9RA 1VQLF 3CCRF 3J7AR 4BT5A 5GAPK 4I4TB 4BVSA 5LP6A 3S03A 1Q81H 3EORA 3P0ZA 3JATA 4R40B 3VYSC 5IT9M 3D54A 5JQGA 5FLXM 1KC8H 2PHNA 4I50B 4O2AA 1W5EA 2GVIA 4O4IA 3OBWA 3SIVA 4X20B 1JFFA 3VYTC 1TUBB 5IJ0B 4B62A 2HP0B 3G6EF 1QVFF 2UYNB 2G9IA 2ZVZA 4F6RB 3TD3A 1CN7A 3HKDA 2VGNA 4BT7A 1E7KA 2RHOA 4WBNA 5GONA 3HKCA 3F0DA 2LBWA 3HKBB 5LOVA 1YI2F 3MQWA 2W8BC 3WGJA 3NMUC 2RHHA 1U43A 3E1YA 4C81A 2HRYA 2ZOVA 3IMPA 3LMEA 3S0WA 4X1YB 1W5AA 1OFUA 1X7OA 3T80A 1JJ2F 2AIFA 3RYIB 3ELCA 1YJWF 4NUTA 4C8IA 1SDSA 5IJ9B 3RYFB 4EI9A 1K8AH 3WJQA 1FFXB 4ZK7A 3TD5A 3D01A 4O4LA 4NQ3A 2BO1A 4B46A 4I55B 3FD5A 3N2GA 5JH7A 4ERHA 3OBYA 1ZWZA 3L7QA 2GZLA 4G4ZA 5LXTA 3KIZA 5LXTB 5JCOA 1Q7YH 2I6RA 1JD1A 3QHDA 4YJ2B 5BMVB 3N2GB 3JAKB 3CCLF 5C8YB 5HXZA 1X52A 5HY2A 1VQ5F 3RA5A 4E6EA 5HY4A 5EAZA 3N2KB 3JARA 1VQVA 3WJPA 5JCOC 5MN6A 5LYJA 3N4YA 3C9TA 2ZODA 1Z5WA 3CG6A 3ERNA 5LA6A 1RLUA 3HWUA
chains in the Genus database with same CATH topology
2JNBA 5HWEA 3OW2F 3CCVF 3HJWC 1QVGF 3AGKA 2GLZA 3JAMM 1Q86H 4BY9D 1IPAA 3PLAC 3CCQF 3PAFA 3CMAF 3NVIB 1GZ0A 1Q82H 3HAXD 4C4WC 3SIUA 1VQOF 5HY0A 1YIJF 1K73H 1YJ9F 1YJNF 3LWVC 1VQMF 1M1KH 3IR9A 4BVQA 1GO0A 4BVTA 5FJ4C 2QI2A 1T0KB 3V3TA 4BVRA 1W2BF 1VQKF 1VQLF 3CD6F 3CCRF 2CZWA 3LWQC 1W42A 1XBIA 3NVKE 5G4UC 3J7AR 1KQSF 3ON1A 5GAPK 1S72F 3V7QA 4BVSA 2QA4F 5HXUA 1Q81H 5GIOC 2KG4A 1PXWA 5EWRA 3LWPC 5IT9M 1K9MH 3CC4F 5FLXM 1KC8H 3CCUF 3OBWA 1YHQF 3LFOA 3SIVA 3NK6A 3G6EF 1QVFF 3J80M 3CCSF 4X3LA 3D00A 3CCEF 3E20B 4EI7A 1CN7A 5GANK 2VGNA 1GO1A 5EO3A 5G4VC 1E7KA 3CPQA 2LBXA 2OTJF 1VQ7F 2LBWA 1CK2A 3JCMM 3GYQA 1VQNF 3VMFB 1YI2F 1NMUB 3I56F 3CCJF 3NMUC 2FC3A 3E1YA 3LWOC 3LWRC 1KD1H 2HVYD 2OZBA 5HY1A 1X7OA 1VQ8F 1RLGA 1JJ2F 4BW0B 2AIFA 3CXCF 4TZZA 3CC7F 1YJWF 4NUTA 1VQ6F 1SDSA 1VQ4F 3WXMB 1RA4A 3RA6A 4EI9A 1K8AH 1X7PA 2VGMA 1YITF 2WALA 2KTUA 4NQ3A 3FFMA 2BO1A 1M90H 3VI6A 1W41A 3G4SF 3CMEF 2OTLF 2FGYA 3OBYA 1ZWZA 1NJIH 3MCAB 1VQ9F 1W3EX 1Q7YH 4X3MA 4LCKA 1DT9A 4EI8A 3J81M 1VQPF 3CC2F 2ALEA 2F9ZC 2OHWA 5A2QM 5GINC 3CCLF 2QEXF 5HXZA 3V7EA 1X52A 5HY2A 1VQ5F 3RA5A 3N4ZA 3I55F 5GIPC 3O85A 5HY4A 3G71F 2I6DA 1N8RH 3CPWF 3CCMF 1H7MA 2KTVA 1W40A 3N4YA 5DCVA 3NK7A 3CG6A 4XCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNB A;  3OW2 F;  3CCV F;  3HJW C;  1QVG F;  3AGK A;  3JAM M;  1Q86 H;  4BY9 D;  1IPA A;  3PLA C;  3CCQ F;  3PAF A;  3CMA F;  3NVI B;  1GZ0 A;  1Q82 H;  3HAX D;  4C4W C;  3SIU A;  1VQO F;  1YIJ F;  1K73 H;  1YJ9 F;  1YJN F;  3LWV C;  1VQM F;  1M1K H;  3IR9 A;  1GO0 A;  5FJ4 C;  2QI2 A;  1T0K B;  1W2B F;  1VQK F;  1VQL F;  3CD6 F;  3CCR F;  2CZW A;  3LWQ C;  1W42 A;  1XBI A;  3NVK E;  5G4U C;  3J7A R;  1KQS F;  3ON1 A;  5GAP K;  1S72 F;  3V7Q A;  2QA4 F;  1Q81 H;  5GIO C;  2KG4 A;  1PXW A;  5EWR A;  3LWP C;  5IT9 M;  1K9M H;  3CC4 F;  5FLX M;  1KC8 H;  3CCU F;  3OBW A;  1YHQ F;  3LFO A;  3SIV A;  3NK6 A;  3G6E F;  1QVF F;  3J80 M;  3CCS F;  4X3L A;  3CCE F;  3E20 B;  1CN7 A;  5GAN K;  2VGN A;  1GO1 A;  5EO3 A;  5G4V C;  1E7K A;  3CPQ A;  2LBX A;  2OTJ F;  1VQ7 F;  2LBW A;  1CK2 A;  3JCM M;  3GYQ A;  1VQN F;  3VMF B;  1YI2 F;  1NMU B;  3I56 F;  3CCJ F;  3NMU C;  2FC3 A;  3E1Y A;  3LWO C;  3LWR C;  1KD1 H;  2HVY D;  2OZB A;  1X7O A;  1VQ8 F;  1RLG A;  1JJ2 F;  4BW0 B;  2AIF A;  3CXC F;  4TZZ A;  3CC7 F;  1YJW F;  4NUT A;  1VQ6 F;  1SDS A;  1VQ4 F;  3WXM B;  1RA4 A;  3RA6 A;  1K8A H;  1X7P A;  2VGM A;  1YIT F;  2WAL A;  2KTU A;  3FFM A;  2BO1 A;  1M90 H;  3VI6 A;  1W41 A;  3G4S F;  3CME F;  2OTL F;  3OBY A;  1ZWZ A;  1NJI H;  3MCA B;  1VQ9 F;  1W3E X;  1Q7Y H;  4X3M A;  4LCK A;  1DT9 A;  3J81 M;  1VQP F;  3CC2 F;  2ALE A;  2OHW A;  5A2Q M;  5GIN C;  3CCL F;  2QEX F;  3V7E A;  1X52 A;  1VQ5 F;  3RA5 A;  3N4Z A;  3I55 F;  5GIP C;  3O85 A;  3G71 F;  2I6D A;  1N8R H;  3CPW F;  3CCM F;  1H7M A;  2KTV A;  1W40 A;  3N4Y A;  5DCV A;  3NK7 A;  3CG6 A; 
#chains in the Genus database with same CATH topology
 2CHT A;  3VIU A;  4ZHQ B;  3OW2 F;  2IG8 A;  1QVG F;  3AGK A;  5IYZ B;  1Q86 H;  4BY9 D;  4TV9 B;  4G88 A;  3ESJ A;  3PAF A;  4B5C A;  5KMG A;  5LOV B;  3CB2 A;  1YIJ F;  3MBM A;  3VCZ A;  4WBN B;  1YJN F;  2CSL A;  4ZI7 A;  4TV8 B;  5KMG B;  1XHO A;  2VAP A;  5IYZ A;  1GX1 A;  2HP0 A;  3V3T A;  1W2B F;  2PMP A;  1VQK F;  4ZHW A;  3LWQ C;  4ZHQ A;  1XBI A;  1PF5 A;  5IJ0 A;  3UT5 A;  1JFF B;  2L26 A;  4G4W A;  5LA6 B;  1QU9 A;  5J2T A;  2DT4 A;  4O4I B;  3RYC B;  3V7Q A;  1RQ2 A;  1KNJ A;  5GIO C;  2UYP A;  3N2K A;  4EB6 B;  5EWR A;  5CA0 A;  3JAT B;  2VAW A;  3IEQ A;  1U40 A;  3CC4 F;  3HKE A;  1JY8 A;  3M4S A;  4BT6 A;  3CCU F;  1YHQ F;  3S06 A;  3WJR A;  2ZVY A;  4DRX B;  5CB4 B;  2CHS A;  5EIB C;  5JVD B;  1CLI A;  3ZP7 A;  3NK6 A;  3KJK A;  3F0F A;  4LNU A;  4O2B A;  1H48 A;  4O4J A;  3CCS F;  3CCE F;  4EI7 A;  1VH8 A;  5GAN K;  4I55 A;  1COM A;  3BYQ A;  5EO3 A;  3V4D A;  1VQ7 F;  4RHA A;  3VMF B;  3JAS A;  3I56 F;  3CCJ F;  3F6M A;  4M8I A;  5HY1 A;  2UZH A;  3JAS B;  3WGN A;  1RLG A;  4BW0 B;  4TZZ A;  2ZAU A;  2BTO A;  3P4E A;  5EB1 B;  1VQ4 F;  1T0A A;  2N48 A;  3LYB A;  2B33 A;  1IV1 A;  2VXY A;  4O4J B;  4RQO A;  3DDN A;  1M90 H;  1W41 A;  1ODE A;  1UI9 A;  3CME F;  5KX5 B;  2HRU A;  2OTL F;  2NMU A;  4NWO B;  3VTI C;  1QD9 A;  3Q8H A;  2R75 1;  3MCA B;  5CB4 A;  1VQ9 F;  1W3E X;  1TUB A;  2BTQ B;  2Z1E A;  4EI8 A;  3J81 M;  3GTZ A;  5CA0 B;  3CC2 F;  2ALE A;  3C9U A;  5A2Q M;  2QEX F;  4O2A B;  3RYC A;  3N4Z A;  3CPW F;  2CWJ A;  3UT5 B;  2H8E A;  3TD4 A;  1X25 A;  3NK7 A;  2UYK A;  3C8L A;  2VAM A;  5LP6 C;  3CYP B;  2CW4 A;  2P6Y A;  4HNA A;  3CCV F;  2RHJ A;  1JN1 A;  3JAM M;  3PLA C;  3CCQ F;  3CMA F;  1W57 A;  3FD6 A;  1Q82 H;  4C4W C;  4TV9 A;  1VQO F;  1VQM F;  5MN4 A;  3K12 A;  2KGW A;  3IR9 A;  1VHA A;  1T0K B;  1RQ7 A;  2HX0 A;  2CZW A;  2AMT A;  5LYJ B;  2Z1F A;  3JAR B;  4U3J A;  2H8C A;  1KQS F;  1S72 F;  3IEW A;  2Q1Y A;  5HXU A;  3JAK A;  2KG4 A;  1PXW A;  5BMV A;  1K9M H;  1U3P A;  1FSZ A;  3S0H A;  2EWC A;  5JVD A;  2QTP A;  2K1S A;  4DRX A;  3KE1 A;  3CYQ A;  3HKE B;  3WGK A;  4B45 A;  4BT2 A;  3J80 M;  4X3L A;  3D00 A;  4O4L B;  1Q8R A;  3F0E A;  4EB6 A;  3JAW A;  1FFX A;  5G4V C;  2YYE A;  3CPQ A;  2LBX A;  4FFB B;  4KWE A;  2OTJ F;  3RYI A;  3WPW A;  5J2T B;  3JCM M;  1VQN F;  3QUW A;  1QAH A;  3QTY A;  1NMU B;  3IKF A;  2FC3 A;  4X1Y A;  2RB9 A;  2IAF A;  2Q1X A;  1FNK A;  3LWO C;  1XV2 A;  3WGL A;  2R6R 1;  3B6N A;  2IQQ A;  4TV8 A;  4ZI7 B;  3CXC F;  3KHN A;  3K2X A;  3M84 A;  3HKC B;  3WXM B;  1RA4 A;  2CVL A;  5J2U B;  1YIT F;  3MCQ A;  2WAL A;  2UYN A;  3FFM A;  3VI6 A;  1XRG A;  2H6L A;  2HS3 A;  5AVM A;  3VYU C;  2AIZ P;  2FGY A;  3R0P A;  1DBF A;  5EB0 A;  1NQ3 A;  4C82 A;  3FBA A;  2YXZ A;  4X3M A;  1SA0 A;  3U0O A;  4LCK A;  1VQP F;  2F9Z C;  2OHW A;  5GIN C;  3S0Y A;  3V7E A;  1R1M A;  3K0T A;  3S02 A;  5LP6 B;  2HQS C;  3ZP4 A;  4I4T A;  3I55 F;  5C8Y A;  3HTN A;  3G71 F;  4YJ2 A;  5J2U A;  2Z01 A;  3WPX A;  3M1X A;  2DYY A;  4ZHY B;  4PWT A;  4DXD A;  4TUY B;  2HS0 A;  5JH7 B;  4IIJ B;  5HWE A;  3C9S A;  4U39 A;  2V9Y A;  3E22 A;  2ZF8 A;  3RYH A;  2GLZ A;  3ZO8 A;  1IPA A;  4IHJ A;  4X1K A;  1GZ0 A;  3SIU A;  3RYF A;  4ZOL B;  4ZOL A;  4FFB A;  5IJ9 A;  1YJ9 F;  3KJJ A;  4YJ3 A;  5HP8 A;  2Z1T A;  1M1K H;  4IHJ B;  2MQE A;  4BVR A;  3CD6 F;  1TVK A;  4IIJ A;  1W42 A;  3NVK E;  5G4U C;  2HS4 A;  3HKB A;  3ON1 A;  3VOA A;  5GON B;  2QA4 F;  5ITZ A;  4G4V A;  3I7T A;  3HKD B;  3LWP C;  3RE3 A;  4F6R A;  1J7H A;  3LFO A;  4X20 A;  1SA0 B;  3K14 A;  3VOB A;  5CA1 B;  4G4Y A;  4I50 A;  3FPI A;  5JQG B;  3E20 B;  5B8F A;  3LDT A;  1UFY A;  1GO1 A;  3WGM A;  2HP3 A;  2LBT A;  3VO8 A;  2OTM A;  1CK2 A;  3GYQ A;  4BT4 A;  5EIB D;  1FNJ A;  3LWR C;  1KD1 H;  1Z5V A;  2HVY D;  4HNA B;  2RHL A;  2OZB A;  4X1I A;  5EYP B;  1VQ8 F;  3JAL A;  3CC7 F;  1VQ6 F;  1W59 A;  3JVH A;  3IKE A;  3RA6 A;  1W58 1;  1X7P A;  1ONI A;  1SZQ A;  2VGM A;  1W55 A;  2LCA A;  3DC2 A;  5MN5 A;  1IV4 A;  2KTU A;  5EZY B;  1OAP A;  5FNV B;  5CA1 A;  3G4S F;  3JAW B;  1NJI H;  1H47 A;  1KNK A;  1W5B A;  3MDO A;  1DT9 A;  1W5F A;  3ZOP A;  5KX5 A;  1IV2 A;  4O4H A;  4BT3 A;  5ITZ B;  3F0G A;  3P10 A;  5HP7 A;  5GIP C;  4O4H B;  1YQN A;  3O85 A;  2BTU A;  3GHZ A;  1N8R H;  2I6D A;  2Z1U A;  3CCM F;  1H7M A;  2KTV A;  1W40 A;  1TVK B;  1IV3 A;  5DCV A;  4U3J B;  4XCQ A;  4G4X A;  1U3L A;  2JNB A;  1VK3 A;  4YJ3 B;  1YGY A;  3HJW C;  5FNV A;  5EZY A;  3NVI B;  3HAX D;  4ZHV A;  4X1K B;  3I3F A;  5HY0 A;  3RYH B;  1K73 H;  4C8E A;  3LWV C;  3E22 B;  3JAL B;  4BVQ A;  1GO0 A;  3OON A;  4X1I B;  5EYP A;  4BVT A;  2UYJ A;  4TUY A;  4C8G A;  5FJ4 C;  2QI2 A;  4LNU B;  4O2B B;  3C9R A;  1VQL F;  3CCR F;  3J7A R;  4BT5 A;  5GAP K;  4I4T B;  4BVS A;  5LP6 A;  3S03 A;  1Q81 H;  3EOR A;  3P0Z A;  3JAT A;  4R40 B;  3VYS C;  5IT9 M;  3D54 A;  5JQG A;  5FLX M;  1KC8 H;  2PHN A;  4I50 B;  4O2A A;  1W5E A;  2GVI A;  4O4I A;  3OBW A;  3SIV A;  4X20 B;  1JFF A;  3VYT C;  1TUB B;  5IJ0 B;  4B62 A;  2HP0 B;  3G6E F;  1QVF F;  2UYN B;  2G9I A;  2ZVZ A;  4F6R B;  3TD3 A;  1CN7 A;  3HKD A;  2VGN A;  4BT7 A;  1E7K A;  2RHO A;  4WBN A;  5GON A;  3HKC A;  3F0D A;  2LBW A;  3HKB B;  5LOV A;  1YI2 F;  3MQW A;  2W8B C;  3WGJ A;  3NMU C;  2RHH A;  1U43 A;  3E1Y A;  4C81 A;  2HRY A;  2ZOV A;  3IMP A;  3LME A;  3S0W A;  4X1Y B;  1W5A A;  1OFU A;  1X7O A;  3T80 A;  1JJ2 F;  2AIF A;  3RYI B;  3ELC A;  1YJW F;  4NUT A;  4C8I A;  1SDS A;  5IJ9 B;  3RYF B;  4EI9 A;  1K8A H;  3WJQ A;  1FFX B;  4ZK7 A;  3TD5 A;  3D01 A;  4O4L A;  4NQ3 A;  2BO1 A;  4B46 A;  4I55 B;  3FD5 A;  3N2G A;  5JH7 A;  4ERH A;  3OBY A;  1ZWZ A;  3L7Q A;  2GZL A;  4G4Z A;  5LXT A;  3KIZ A;  5LXT B;  5JCO A;  1Q7Y H;  2I6R A;  1JD1 A;  3QHD A;  4YJ2 B;  5BMV B;  3N2G B;  3JAK B;  3CCL F;  5C8Y B;  5HXZ A;  1X52 A;  5HY2 A;  1VQ5 F;  3RA5 A;  4E6E A;  5HY4 A;  5EAZ A;  3N2K B;  3JAR A;  1VQV A;  3WJP A;  5JCO C;  5MN6 A;  5LYJ A;  3N4Y A;  3C9T A;  2ZOD A;  1Z5W A;  3CG6 A;  3ERN A;  5LA6 A;  1RLU A;  3HWU A; 
#chains in the Genus database with same CATH homology
 2JNB A;  5HWE A;  3OW2 F;  3CCV F;  3HJW C;  1QVG F;  3AGK A;  2GLZ A;  3JAM M;  1Q86 H;  4BY9 D;  1IPA A;  3PLA C;  3CCQ F;  3PAF A;  3CMA F;  3NVI B;  1GZ0 A;  1Q82 H;  3HAX D;  4C4W C;  3SIU A;  1VQO F;  5HY0 A;  1YIJ F;  1K73 H;  1YJ9 F;  1YJN F;  3LWV C;  1VQM F;  1M1K H;  3IR9 A;  4BVQ A;  1GO0 A;  4BVT A;  5FJ4 C;  2QI2 A;  1T0K B;  3V3T A;  4BVR A;  1W2B F;  1VQK F;  1VQL F;  3CD6 F;  3CCR F;  2CZW A;  3LWQ C;  1W42 A;  1XBI A;  3NVK E;  5G4U C;  3J7A R;  1KQS F;  3ON1 A;  5GAP K;  1S72 F;  3V7Q A;  4BVS A;  2QA4 F;  5HXU A;  1Q81 H;  5GIO C;  2KG4 A;  1PXW A;  5EWR A;  3LWP C;  5IT9 M;  1K9M H;  3CC4 F;  5FLX M;  1KC8 H;  3CCU F;  3OBW A;  1YHQ F;  3LFO A;  3SIV A;  3NK6 A;  3G6E F;  1QVF F;  3J80 M;  3CCS F;  4X3L A;  3D00 A;  3CCE F;  3E20 B;  4EI7 A;  1CN7 A;  5GAN K;  2VGN A;  1GO1 A;  5EO3 A;  5G4V C;  1E7K A;  3CPQ A;  2LBX A;  2OTJ F;  1VQ7 F;  2LBW A;  1CK2 A;  3JCM M;  3GYQ A;  1VQN F;  3VMF B;  1YI2 F;  1NMU B;  3I56 F;  3CCJ F;  3NMU C;  2FC3 A;  3E1Y A;  3LWO C;  3LWR C;  1KD1 H;  2HVY D;  2OZB A;  5HY1 A;  1X7O A;  1VQ8 F;  1RLG A;  1JJ2 F;  4BW0 B;  2AIF A;  3CXC F;  4TZZ A;  3CC7 F;  1YJW F;  4NUT A;  1VQ6 F;  1SDS A;  1VQ4 F;  3WXM B;  1RA4 A;  3RA6 A;  4EI9 A;  1K8A H;  1X7P A;  2VGM A;  1YIT F;  2WAL A;  2KTU A;  4NQ3 A;  3FFM A;  2BO1 A;  1M90 H;  3VI6 A;  1W41 A;  3G4S F;  3CME F;  2OTL F;  2FGY A;  3OBY A;  1ZWZ A;  1NJI H;  3MCA B;  1VQ9 F;  1W3E X;  1Q7Y H;  4X3M A;  4LCK A;  1DT9 A;  4EI8 A;  3J81 M;  1VQP F;  3CC2 F;  2ALE A;  2F9Z C;  2OHW A;  5A2Q M;  5GIN C;  3CCL F;  2QEX F;  5HXZ A;  3V7E A;  1X52 A;  5HY2 A;  1VQ5 F;  3RA5 A;  3N4Z A;  3I55 F;  5GIP C;  3O85 A;  5HY4 A;  3G71 F;  2I6D A;  1N8R H;  3CPW F;  3CCM F;  1H7M A;  2KTV A;  1W40 A;  3N4Y A;  5DCV A;  3NK7 A;  3CG6 A;  4XCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...