3FFMA

The crystal structure of human gadd45g
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
b'STARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest and DNA-damage-inducible protein GADD45 gamma
publication title The crystal structure of human Gadd45g
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 50
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ffmA00
3O85A 3MCAB 3PLAC 3NK6A 1T0KB 1CN7A 1K73H 1H7MA 1W42A 2JNBA 3CC2F 1X7OA 2AIFA 5EO3A 3CCUF 4LCKA 3OBWA 1RLGA 2OTJF 3CCMF 3SIVA 2HVYD 1PXWA 3VMFB 1W2BF 1VQ5F 1YIJF 3N4YA 1YJNF 1X7PA 1YITF 3NVIB 1Q86H 3I55F 3SIUA 3CCLF 1N8RH 5GAPK 1VQPF 5DCVA 5GINC 2OHWA 4BY9D 1E7KA 1NJIH 5GANK 3NK7A 1VQLF 5EWRA 1W41A 3I56F 1W40A 3VI6A 3CCVF 3J7AR 1ZWZA 3AGKA 3HJWC 2QEXF 3G4SF 5G4UC 2ALEA 3CCEF 3LWOC 1VQ4F 1Q7YH 1VQ8F 3E20B 3CG6A 1K9MH 3PAFA 3NVKE 2KTUA 3CC7F 1RA4A 3IR9A 1K8AH 1GO0A 3LWPC 3LWVC 1M1KH 3CMEF 1KD1H 1YJ9F 4X3LA 3JAMM 1VQMF 5GIOC 1W3EX 3G71F 1QVFF 2BO1A 3FFMA 3CXCF 1KQSF 4X3MA 1VQ9F 4BW0B 3NMUC 3V7EA 1KC8H 1SDSA 3CCRF 2FC3A 3OW2F 3CPQA 5GIPC 4TZZA 1GZ0A 2CZWA 1NMUB 1S72F 3CC4F 3E1YA 5FJ4C 3G6EF 1XBIA 5IT9M 1YI2F 5FLXM 1VQ6F 1YHQF 2LBXA 1YJWF 1CK2A 1IPAA 2KG4A 1DT9A 3CMAF 2QI2A 3CCJF 1JJ2F 3OBYA 2LBWA 2OTLF 3CPWF 2VGNA 2I6DA 2VGMA 1VQKF 2OZBA 2QA4F 2WALA 4C4WC 3GYQA 1VQOF 3CD6F 1GO1A 1X52A 3J80M 1M90H 1Q81H 5G4VC 3CCQF 3WXMB 4NUTA 3CCSF 3LWQC 3RA6A 3N4ZA 1QVGF 3JCMM 3LFOA 5A2QM 2KTVA 3RA5A 3V7QA 3ON1A 3LWRC 1Q82H 1VQNF 3HAXD 1VQ7F 3J81M
chains in the Genus database with same CATH superfamily
2AMTA 5BMVB 3MCAB 2EWCA 5HWEA 2GLZA 1YQNA 2BTOA 3F0FA 5BMVA 4TV9A 3R0PA 4LCKA 3OBWA 1NQ3A 4O4LB 4B5CA 3Q8HA 5IYZB 2HVYD 1SA0A 1W59A 3VO8A 1YIJF 2L26A 3N4YA 3RYHB 2RHHA 5J2UB 3RYCB 1YITF 3NVIB 3S03A 2CHTA 3RYCA 2CWJA 3WGKA 4O4JA 3JAWA 5GINC 2OHWA 5GONA 1H47A 4YJ2A 3NK7A 3K0TA 4EI8A 5CA1B 1GX1A 5C8YA 1W41A 1UI9A 5FNVB 4WBNB 2UYJA 1FNJA 2G9IA 2V9YA 1TVKB 5LYJA 3CCVF 1ZWZA 5JQGB 2HRYA 1TVKA 5HXZA 2RB9A 2ALEA 3LWOC 1Q7YH 2RHJA 3E20B 3IMPA 2NMUA 3CC7F 2VAPA 3ZP7A 2W8BC 3IR9A 5EYPA 3LWVC 1YJ9F 3JAMM 3E22A 3P4EA 4I50A 1QVFF 2F9ZC 5HY1A 1KC8H 3HKCB 4G4VA 3S0WA 4BT5A 4C8IA 3HWUA 3S0YA 2HQSC 3HKDB 2ZVYA 3P10A 3V3TA 4LNUB 1QD9A 5IT9M 4ZHWA 3HKDA 5FLXM 1VQ6F 3I7TA 4X1KB 4X1IB 4B45A 2ZVZA 4O4HB 3K14A 2P6YA 2GVIA 5LXTB 1IV4A 1VQ7F 3FBAA 5CA0A 2ZAUA 5MN6A 3OBYA 3LYBA 4G4XA 2Z1UA 4U3JB 4G88A 1JY8A 4HNAB 5LP6A 3CPWF 4ZOLA 2VGMA 1VQKF 1FSZA 2QA4F 1RQ7A 2WALA 3C9SA 4C82A 2Q1YA 3N2GA 4EB6A 4IHJB 5HXUA 4E6EA 3MQWA 3CCQF 3WGLA 3BYQA 4G4WA 5JVDB 3S0HA 3TD5A 3RA6A 4BVRA 3DDNA 3JCMM 5A2QM 3ZO8A 5KX5B 3VOAA 1Q82H 5JH7B 2H6LA 3LDTA 1QU9A 5KX5A 1VQVA 3MBMA 3JALA 3RYFB 1T0KB 3JATB 1K73H 1W42A 3CC2F 4NWOB 1RLGA 1SZQA 2UZHA 5J2TB 2AIZP 4M8IA 3JAKA 1W2BF 3WPXA 3GHZA 1YJNF 1X7PA 5HP7A 4YJ3A 3VYSC 1TUBB 4I4TA 3I55F 1XHOA 2HX0A 2VAWA 2RHLA 1RQ2A 1U3PA 1TUBA 3HKBB 5DCVA 2DYYA 1PF5A 4X1YA 5EIBD 4TV9B 4BT3A 4C8GA 5EWRA 5EB0A 3S02A 5LP6C 2YYEA 1SA0B 2LCAA 3HJWC 3UT5A 5G4UC 3MDOA 1R1MA 3CCEF 1VH8A 1VQ8F 3ESJA 5HY2A 2CW4A 3CG6A 5LOVA 1W5AA 2KTUA 1OAPA 2I6RA 2MQEA 3JAWB 4O4JB 1K8AH 1U43A 3LWPC 5GONB 3JASB 4YJ2B 1KD1H 1DBFA 3IEWA 4X3LA 4O2BA 2OTMA 5C8YB 3JASA 5GIOC 1W3EX 1IV3A 3DC2A 1VQ9F 1CLIA 5LYJB 1SDSA 3CCRF 3EORA 4R40B 4TZZA 1GZ0A 3F0DA 3CC4F 3E1YA 3G6EF 2HS3A 1YHQF 5EAZA 2PMPA 2N48A 5IJ0A 2KG4A 4NQ3A 5EYPB 4I55A 3LMEA 3CB2A 3E22B 4I50B 2HS4A 1T0AA 3M4SA 2OTLF 2R751 2VGNA 2I6DA 4IIJB 4C4WC 4TUYA 2K1SA 4IIJA 1JD1A 5IJ9A 1GO1A 1X52A 1M90H 3JARB 3K2XA 3WGNA 4ZHVA 4NUTA 3CCSF 1VHAA 3JARA 4RHAA 4FFBB 3ERNA 2ZODA 4ZHQB 1JFFA 3F0EA 3KJKA 3D54A 3RYIA 4FFBA 2HP0A 3HKEA 4ZHQA 5CA0B 3LWRC 5LP6B 3O85A 4ZOLB 2CVLA 3VYUC 3PLAC 2Z01A 2CHSA 3NK6A 1CN7A 2CSLA 3N2GB 1H7MA 4EB6B 2JNBA 1X7OA 3CCUF 5EO3A 2QTPA 4B62A 5CB4B 4KWEA 1UFYA 2GZLA 3VMFB 5CB4A 5JCOC 1VQ5F 3ZOPA 3C8LA 4B46A 3CYPB 1Q86H 1VK3A 3CCLF 1N8RH 4X20A 1VQPF 3KHNA 1KNKA 4O4IB 4BY9D 1E7KA 5HY0A 3JVHA 3QUWA 1FFXA 1NJIH 3JALB 5GANK 4O4IA 1VQLF 5LA6A 3I56F 1W40A 2VAMA 3VI6A 1YGYA 3J7AR 3AGKA 4O2AA 3IKFA 1U3LA 4ZK7A 1IV2A 5AVMA 3JAKB 3QHDA 3WGJA 1VQ4F 4TV8A 3TD4A 1W5EA 4YJ3B 3VOBA 5EIBC 4BT2A 4I4TB 1K9MH 1IV1A 3NVKE 2DT4A 3GTZA 4XCQA 1ODEA 3D01A 1M1KH 3CMEF 2UYNA 4X1YB 4F6RA 1VQMF 3TD3A 1KQSF 4X3MA 3M1XA 4BW0B 3ZP4A 3V7EA 2B33A 4C8EA 3OW2F 3CPQA 5GIPC 4ZI7A 1NMUB 1S72F 3UT5B 5FJ4C 3B6NA 3N2KA 1XBIA 3L7QA 5LOVB 3T80A 2LBXA 1IPAA 2Z1EA 5KMGA 5EZYA 4ERHA 2QI2A 4BVSA 5B8FA 3WJPA 4O2BB 1QAHA 3CCJF 1JJ2F 3MCQA 3I3FA 2UYPA 3C9TA 1VQOF 5ITZB 1JN1A 2H8CA 3ELCA 3CD6F 3VIUA 5JCOA 2Q1XA 3CYQA 3J80M 4DRXB 5ITZA 1J7HA 1KNJA 4O4LA 5IYZA 4DRXA 2VXYA 3LWQC 5IJ0B 3RYHA 3FPIA 2H8EA 5J2UA 3N4ZA 4I55B 1W5FA 1QVGF 3LFOA 1VQNF 3V7QA 4BVQA 3J81M 3HTNA 1W55A 2HP3A 2ZOVA 4BT6A 4TUYB 5CA1A 2R6R1 4BT7A 5IJ9B 2AIFA 5FNVA 1Z5WA 3C9RA 4WBNA 2OTJF 3IEQA 1RLUA 3CCMF 5JQGA 2KGWA 3SIVA 1PXWA 3OONA 4G4YA 1XRGA 3C9UA 1JFFB 3F0GA 3IKEA 3S06A 3RYIB 2HP0B 2IG8A 3HKEB 4G4ZA 2RHOA 3SIUA 3VCZA 4RQOA 1ONIA 2Z1FA 4U39A 5GAPK 3WGMA 1XV2A 3FD5A 3P0ZA 2BTUA 2FGYA 3F6MA 1COMA 3D00A 3HKCA 4ZHYB 1W57A 3G4SF 2HS0A 4LNUA 2QEXF 2ZF8A 3WJRA 2IAFA 3PAFA 4X1KA 4X1IA 1RA4A 4X20B 4O4HA 1GO0A 5HP8A 1FFXB 5LXTA 2PHNA 1X25A 4PWTA 5LA6B 2LBTA 3WPWA 3G71F 2BO1A 3FFMA 4U3JA 1Q8RA 4C81A 3CXCF 4HNAA 3NMUC 3RE3A 2YXZA 5MN4A 2FC3A 4O2AB 2BTQB 3K12A 2CZWA 4IHJA 3V4DA 2IQQA 4DXDA 4TV8B 1YI2F 3M84A 4BT4A 3VYTC 1YJWF 1CK2A 1FNKA 5JVDA 1DT9A 3KE1A 4BVTA 3CMAF 1W5BA 2UYNB 4EI7A 4F6RB 3U0OA 1OFUA 2UYKA 2LBWA 5JH7A 3KIZA 5HY4A 1Z5VA 2HRUA 2OZBA 3GYQA 3RYFA 1U40A 3JATA 5MN5A 4ZI7B 3N2KB 1Q81H 5G4VC 5EB1B 5J2TA 3WXMB 3WJQA 3QTYA 3VTIC 5KMGB 1W581 3FD6A 5EZYB 3KJJA 2KTVA 1H48A 3RA5A 4EI9A 3ON1A 3HAXD 2Z1TA 3HKBA
chains in the Genus database with same CATH topology
3O85A 3MCAB 5HWEA 3PLAC 2GLZA 3NK6A 1T0KB 1CN7A 1K73H 1H7MA 1W42A 2JNBA 3CC2F 1X7OA 2AIFA 5EO3A 3CCUF 4LCKA 3OBWA 1RLGA 2OTJF 3CCMF 3SIVA 2HVYD 1PXWA 3VMFB 1W2BF 1VQ5F 1YIJF 3N4YA 1YJNF 1X7PA 1YITF 3NVIB 1Q86H 3I55F 3SIUA 3CCLF 1N8RH 5GAPK 1VQPF 5DCVA 5GINC 2OHWA 4BY9D 1E7KA 5HY0A 1NJIH 5GANK 3NK7A 4EI8A 1VQLF 5EWRA 1W41A 3I56F 1W40A 2FGYA 3VI6A 3D00A 3CCVF 3J7AR 1ZWZA 3AGKA 5HXZA 3HJWC 2QEXF 3G4SF 5G4UC 2ALEA 3CCEF 3LWOC 1VQ4F 1Q7YH 1VQ8F 3E20B 5HY2A 3CG6A 1K9MH 3PAFA 3NVKE 2KTUA 3CC7F 1RA4A 3IR9A 1K8AH 1GO0A 3LWPC 4XCQA 3LWVC 1M1KH 3CMEF 1KD1H 1YJ9F 4X3LA 3JAMM 1VQMF 5GIOC 1W3EX 3G71F 1QVFF 2F9ZC 2BO1A 3FFMA 5HY1A 3CXCF 1KQSF 4X3MA 1VQ9F 4BW0B 3HAXD 3NMUC 3V7EA 1KC8H 1SDSA 3CCRF 2FC3A 3OW2F 3CPQA 5GIPC 4TZZA 1GZ0A 2CZWA 1NMUB 1S72F 3CC4F 3E1YA 3V3TA 5FJ4C 3G6EF 1XBIA 5IT9M 1YI2F 5FLXM 1VQ6F 1YHQF 2LBXA 1YJWF 1CK2A 1IPAA 2KG4A 4NQ3A 1DT9A 4BVTA 3CMAF 2QI2A 4BVSA 4EI7A 3CCJF 1JJ2F 3OBYA 2LBWA 2OTLF 3CPWF 2VGNA 2I6DA 5HY4A 2VGMA 1VQKF 2OZBA 2QA4F 2WALA 4C4WC 3GYQA 1VQOF 3CD6F 1GO1A 5HXUA 1X52A 3J80M 1M90H 1Q81H 5G4VC 3CCQF 3WXMB 4NUTA 3CCSF 3LWQC 3RA6A 3N4ZA 4BVRA 1QVGF 3JCMM 3LFOA 5A2QM 2KTVA 3RA5A 3V7QA 3ON1A 4BVQA 4EI9A 3LWRC 1Q82H 1VQNF 1VQ7F 3J81M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O85 A;  3MCA B;  3PLA C;  3NK6 A;  1T0K B;  1CN7 A;  1K73 H;  1H7M A;  1W42 A;  2JNB A;  3CC2 F;  1X7O A;  2AIF A;  5EO3 A;  3CCU F;  4LCK A;  3OBW A;  1RLG A;  2OTJ F;  3CCM F;  3SIV A;  2HVY D;  1PXW A;  3VMF B;  1W2B F;  1VQ5 F;  1YIJ F;  3N4Y A;  1YJN F;  1X7P A;  1YIT F;  3NVI B;  1Q86 H;  3I55 F;  3SIU A;  3CCL F;  1N8R H;  5GAP K;  1VQP F;  5DCV A;  5GIN C;  2OHW A;  4BY9 D;  1E7K A;  1NJI H;  5GAN K;  3NK7 A;  1VQL F;  5EWR A;  1W41 A;  3I56 F;  1W40 A;  3VI6 A;  3CCV F;  3J7A R;  1ZWZ A;  3AGK A;  3HJW C;  2QEX F;  3G4S F;  5G4U C;  2ALE A;  3CCE F;  3LWO C;  1VQ4 F;  1Q7Y H;  1VQ8 F;  3E20 B;  3CG6 A;  1K9M H;  3PAF A;  3NVK E;  2KTU A;  3CC7 F;  1RA4 A;  3IR9 A;  1K8A H;  1GO0 A;  3LWP C;  3LWV C;  1M1K H;  3CME F;  1KD1 H;  1YJ9 F;  4X3L A;  3JAM M;  1VQM F;  5GIO C;  1W3E X;  3G71 F;  1QVF F;  2BO1 A;  3FFM A;  3CXC F;  1KQS F;  4X3M A;  1VQ9 F;  4BW0 B;  3NMU C;  3V7E A;  1KC8 H;  1SDS A;  3CCR F;  2FC3 A;  3OW2 F;  3CPQ A;  5GIP C;  4TZZ A;  1GZ0 A;  2CZW A;  1NMU B;  1S72 F;  3CC4 F;  3E1Y A;  5FJ4 C;  3G6E F;  1XBI A;  5IT9 M;  1YI2 F;  5FLX M;  1VQ6 F;  1YHQ F;  2LBX A;  1YJW F;  1CK2 A;  1IPA A;  2KG4 A;  1DT9 A;  3CMA F;  2QI2 A;  3CCJ F;  1JJ2 F;  3OBY A;  2LBW A;  2OTL F;  3CPW F;  2VGN A;  2I6D A;  2VGM A;  1VQK F;  2OZB A;  2QA4 F;  2WAL A;  4C4W C;  3GYQ A;  1VQO F;  3CD6 F;  1GO1 A;  1X52 A;  3J80 M;  1M90 H;  1Q81 H;  5G4V C;  3CCQ F;  3WXM B;  4NUT A;  3CCS F;  3LWQ C;  3RA6 A;  3N4Z A;  1QVG F;  3JCM M;  3LFO A;  5A2Q M;  2KTV A;  3RA5 A;  3V7Q A;  3ON1 A;  3LWR C;  1Q82 H;  1VQN F;  3HAX D;  1VQ7 F;  3J81 M; 
#chains in the Genus database with same CATH topology
 2AMT A;  5BMV B;  3MCA B;  2EWC A;  5HWE A;  2GLZ A;  1YQN A;  2BTO A;  3F0F A;  5BMV A;  4TV9 A;  3R0P A;  4LCK A;  3OBW A;  1NQ3 A;  4O4L B;  4B5C A;  3Q8H A;  5IYZ B;  2HVY D;  1SA0 A;  1W59 A;  3VO8 A;  1YIJ F;  2L26 A;  3N4Y A;  3RYH B;  2RHH A;  5J2U B;  3RYC B;  1YIT F;  3NVI B;  3S03 A;  2CHT A;  3RYC A;  2CWJ A;  3WGK A;  4O4J A;  3JAW A;  5GIN C;  2OHW A;  5GON A;  1H47 A;  4YJ2 A;  3NK7 A;  3K0T A;  4EI8 A;  5CA1 B;  1GX1 A;  5C8Y A;  1W41 A;  1UI9 A;  5FNV B;  4WBN B;  2UYJ A;  1FNJ A;  2G9I A;  2V9Y A;  1TVK B;  5LYJ A;  3CCV F;  1ZWZ A;  5JQG B;  2HRY A;  1TVK A;  5HXZ A;  2RB9 A;  2ALE A;  3LWO C;  1Q7Y H;  2RHJ A;  3E20 B;  3IMP A;  2NMU A;  3CC7 F;  2VAP A;  3ZP7 A;  2W8B C;  3IR9 A;  5EYP A;  3LWV C;  1YJ9 F;  3JAM M;  3E22 A;  3P4E A;  4I50 A;  1QVF F;  2F9Z C;  5HY1 A;  1KC8 H;  3HKC B;  4G4V A;  3S0W A;  4BT5 A;  4C8I A;  3HWU A;  3S0Y A;  2HQS C;  3HKD B;  2ZVY A;  3P10 A;  3V3T A;  4LNU B;  1QD9 A;  5IT9 M;  4ZHW A;  3HKD A;  5FLX M;  1VQ6 F;  3I7T A;  4X1K B;  4X1I B;  4B45 A;  2ZVZ A;  4O4H B;  3K14 A;  2P6Y A;  2GVI A;  5LXT B;  1IV4 A;  1VQ7 F;  3FBA A;  5CA0 A;  2ZAU A;  5MN6 A;  3OBY A;  3LYB A;  4G4X A;  2Z1U A;  4U3J B;  4G88 A;  1JY8 A;  4HNA B;  5LP6 A;  3CPW F;  4ZOL A;  2VGM A;  1VQK F;  1FSZ A;  2QA4 F;  1RQ7 A;  2WAL A;  3C9S A;  4C82 A;  2Q1Y A;  3N2G A;  4EB6 A;  4IHJ B;  5HXU A;  4E6E A;  3MQW A;  3CCQ F;  3WGL A;  3BYQ A;  4G4W A;  5JVD B;  3S0H A;  3TD5 A;  3RA6 A;  4BVR A;  3DDN A;  3JCM M;  5A2Q M;  3ZO8 A;  5KX5 B;  3VOA A;  1Q82 H;  5JH7 B;  2H6L A;  3LDT A;  1QU9 A;  5KX5 A;  1VQV A;  3MBM A;  3JAL A;  3RYF B;  1T0K B;  3JAT B;  1K73 H;  1W42 A;  3CC2 F;  4NWO B;  1RLG A;  1SZQ A;  2UZH A;  5J2T B;  2AIZ P;  4M8I A;  3JAK A;  1W2B F;  3WPX A;  3GHZ A;  1YJN F;  1X7P A;  5HP7 A;  4YJ3 A;  3VYS C;  1TUB B;  4I4T A;  3I55 F;  1XHO A;  2HX0 A;  2VAW A;  2RHL A;  1RQ2 A;  1U3P A;  1TUB A;  3HKB B;  5DCV A;  2DYY A;  1PF5 A;  4X1Y A;  5EIB D;  4TV9 B;  4BT3 A;  4C8G A;  5EWR A;  5EB0 A;  3S02 A;  5LP6 C;  2YYE A;  1SA0 B;  2LCA A;  3HJW C;  3UT5 A;  5G4U C;  3MDO A;  1R1M A;  3CCE F;  1VH8 A;  1VQ8 F;  3ESJ A;  5HY2 A;  2CW4 A;  3CG6 A;  5LOV A;  1W5A A;  2KTU A;  1OAP A;  2I6R A;  2MQE A;  3JAW B;  4O4J B;  1K8A H;  1U43 A;  3LWP C;  5GON B;  3JAS B;  4YJ2 B;  1KD1 H;  1DBF A;  3IEW A;  4X3L A;  4O2B A;  2OTM A;  5C8Y B;  3JAS A;  5GIO C;  1W3E X;  1IV3 A;  3DC2 A;  1VQ9 F;  1CLI A;  5LYJ B;  1SDS A;  3CCR F;  3EOR A;  4R40 B;  4TZZ A;  1GZ0 A;  3F0D A;  3CC4 F;  3E1Y A;  3G6E F;  2HS3 A;  1YHQ F;  5EAZ A;  2PMP A;  2N48 A;  5IJ0 A;  2KG4 A;  4NQ3 A;  5EYP B;  4I55 A;  3LME A;  3CB2 A;  3E22 B;  4I50 B;  2HS4 A;  1T0A A;  3M4S A;  2OTL F;  2R75 1;  2VGN A;  2I6D A;  4IIJ B;  4C4W C;  4TUY A;  2K1S A;  4IIJ A;  1JD1 A;  5IJ9 A;  1GO1 A;  1X52 A;  1M90 H;  3JAR B;  3K2X A;  3WGN A;  4ZHV A;  4NUT A;  3CCS F;  1VHA A;  3JAR A;  4RHA A;  4FFB B;  3ERN A;  2ZOD A;  4ZHQ B;  1JFF A;  3F0E A;  3KJK A;  3D54 A;  3RYI A;  4FFB A;  2HP0 A;  3HKE A;  4ZHQ A;  5CA0 B;  3LWR C;  5LP6 B;  3O85 A;  4ZOL B;  2CVL A;  3VYU C;  3PLA C;  2Z01 A;  2CHS A;  3NK6 A;  1CN7 A;  2CSL A;  3N2G B;  1H7M A;  4EB6 B;  2JNB A;  1X7O A;  3CCU F;  5EO3 A;  2QTP A;  4B62 A;  5CB4 B;  4KWE A;  1UFY A;  2GZL A;  3VMF B;  5CB4 A;  5JCO C;  1VQ5 F;  3ZOP A;  3C8L A;  4B46 A;  3CYP B;  1Q86 H;  1VK3 A;  3CCL F;  1N8R H;  4X20 A;  1VQP F;  3KHN A;  1KNK A;  4O4I B;  4BY9 D;  1E7K A;  5HY0 A;  3JVH A;  3QUW A;  1FFX A;  1NJI H;  3JAL B;  5GAN K;  4O4I A;  1VQL F;  5LA6 A;  3I56 F;  1W40 A;  2VAM A;  3VI6 A;  1YGY A;  3J7A R;  3AGK A;  4O2A A;  3IKF A;  1U3L A;  4ZK7 A;  1IV2 A;  5AVM A;  3JAK B;  3QHD A;  3WGJ A;  1VQ4 F;  4TV8 A;  3TD4 A;  1W5E A;  4YJ3 B;  3VOB A;  5EIB C;  4BT2 A;  4I4T B;  1K9M H;  1IV1 A;  3NVK E;  2DT4 A;  3GTZ A;  4XCQ A;  1ODE A;  3D01 A;  1M1K H;  3CME F;  2UYN A;  4X1Y B;  4F6R A;  1VQM F;  3TD3 A;  1KQS F;  4X3M A;  3M1X A;  4BW0 B;  3ZP4 A;  3V7E A;  2B33 A;  4C8E A;  3OW2 F;  3CPQ A;  5GIP C;  4ZI7 A;  1NMU B;  1S72 F;  3UT5 B;  5FJ4 C;  3B6N A;  3N2K A;  1XBI A;  3L7Q A;  5LOV B;  3T80 A;  2LBX A;  1IPA A;  2Z1E A;  5KMG A;  5EZY A;  4ERH A;  2QI2 A;  4BVS A;  5B8F A;  3WJP A;  4O2B B;  1QAH A;  3CCJ F;  1JJ2 F;  3MCQ A;  3I3F A;  2UYP A;  3C9T A;  1VQO F;  5ITZ B;  1JN1 A;  2H8C A;  3ELC A;  3CD6 F;  3VIU A;  5JCO A;  2Q1X A;  3CYQ A;  3J80 M;  4DRX B;  5ITZ A;  1J7H A;  1KNJ A;  4O4L A;  5IYZ A;  4DRX A;  2VXY A;  3LWQ C;  5IJ0 B;  3RYH A;  3FPI A;  2H8E A;  5J2U A;  3N4Z A;  4I55 B;  1W5F A;  1QVG F;  3LFO A;  1VQN F;  3V7Q A;  4BVQ A;  3J81 M;  3HTN A;  1W55 A;  2HP3 A;  2ZOV A;  4BT6 A;  4TUY B;  5CA1 A;  2R6R 1;  4BT7 A;  5IJ9 B;  2AIF A;  5FNV A;  1Z5W A;  3C9R A;  4WBN A;  2OTJ F;  3IEQ A;  1RLU A;  3CCM F;  5JQG A;  2KGW A;  3SIV A;  1PXW A;  3OON A;  4G4Y A;  1XRG A;  3C9U A;  1JFF B;  3F0G A;  3IKE A;  3S06 A;  3RYI B;  2HP0 B;  2IG8 A;  3HKE B;  4G4Z A;  2RHO A;  3SIU A;  3VCZ A;  4RQO A;  1ONI A;  2Z1F A;  4U39 A;  5GAP K;  3WGM A;  1XV2 A;  3FD5 A;  3P0Z A;  2BTU A;  2FGY A;  3F6M A;  1COM A;  3D00 A;  3HKC A;  4ZHY B;  1W57 A;  3G4S F;  2HS0 A;  4LNU A;  2QEX F;  2ZF8 A;  3WJR A;  2IAF A;  3PAF A;  4X1K A;  4X1I A;  1RA4 A;  4X20 B;  4O4H A;  1GO0 A;  5HP8 A;  1FFX B;  5LXT A;  2PHN A;  1X25 A;  4PWT A;  5LA6 B;  2LBT A;  3WPW A;  3G71 F;  2BO1 A;  3FFM A;  4U3J A;  1Q8R A;  4C81 A;  3CXC F;  4HNA A;  3NMU C;  3RE3 A;  2YXZ A;  5MN4 A;  2FC3 A;  4O2A B;  2BTQ B;  3K12 A;  2CZW A;  4IHJ A;  3V4D A;  2IQQ A;  4DXD A;  4TV8 B;  1YI2 F;  3M84 A;  4BT4 A;  3VYT C;  1YJW F;  1CK2 A;  1FNK A;  5JVD A;  1DT9 A;  3KE1 A;  4BVT A;  3CMA F;  1W5B A;  2UYN B;  4EI7 A;  4F6R B;  3U0O A;  1OFU A;  2UYK A;  2LBW A;  5JH7 A;  3KIZ A;  5HY4 A;  1Z5V A;  2HRU A;  2OZB A;  3GYQ A;  3RYF A;  1U40 A;  3JAT A;  5MN5 A;  4ZI7 B;  3N2K B;  1Q81 H;  5G4V C;  5EB1 B;  5J2T A;  3WXM B;  3WJQ A;  3QTY A;  3VTI C;  5KMG B;  1W58 1;  3FD6 A;  5EZY B;  3KJJ A;  2KTV A;  1H48 A;  3RA5 A;  4EI9 A;  3ON1 A;  3HAX D;  2Z1T A;  3HKB A; 
#chains in the Genus database with same CATH homology
 3O85 A;  3MCA B;  5HWE A;  3PLA C;  2GLZ A;  3NK6 A;  1T0K B;  1CN7 A;  1K73 H;  1H7M A;  1W42 A;  2JNB A;  3CC2 F;  1X7O A;  2AIF A;  5EO3 A;  3CCU F;  4LCK A;  3OBW A;  1RLG A;  2OTJ F;  3CCM F;  3SIV A;  2HVY D;  1PXW A;  3VMF B;  1W2B F;  1VQ5 F;  1YIJ F;  3N4Y A;  1YJN F;  1X7P A;  1YIT F;  3NVI B;  1Q86 H;  3I55 F;  3SIU A;  3CCL F;  1N8R H;  5GAP K;  1VQP F;  5DCV A;  5GIN C;  2OHW A;  4BY9 D;  1E7K A;  5HY0 A;  1NJI H;  5GAN K;  3NK7 A;  4EI8 A;  1VQL F;  5EWR A;  1W41 A;  3I56 F;  1W40 A;  2FGY A;  3VI6 A;  3D00 A;  3CCV F;  3J7A R;  1ZWZ A;  3AGK A;  5HXZ A;  3HJW C;  2QEX F;  3G4S F;  5G4U C;  2ALE A;  3CCE F;  3LWO C;  1VQ4 F;  1Q7Y H;  1VQ8 F;  3E20 B;  5HY2 A;  3CG6 A;  1K9M H;  3PAF A;  3NVK E;  2KTU A;  3CC7 F;  1RA4 A;  3IR9 A;  1K8A H;  1GO0 A;  3LWP C;  4XCQ A;  3LWV C;  1M1K H;  3CME F;  1KD1 H;  1YJ9 F;  4X3L A;  3JAM M;  1VQM F;  5GIO C;  1W3E X;  3G71 F;  1QVF F;  2F9Z C;  2BO1 A;  3FFM A;  5HY1 A;  3CXC F;  1KQS F;  4X3M A;  1VQ9 F;  4BW0 B;  3HAX D;  3NMU C;  3V7E A;  1KC8 H;  1SDS A;  3CCR F;  2FC3 A;  3OW2 F;  3CPQ A;  5GIP C;  4TZZ A;  1GZ0 A;  2CZW A;  1NMU B;  1S72 F;  3CC4 F;  3E1Y A;  3V3T A;  5FJ4 C;  3G6E F;  1XBI A;  5IT9 M;  1YI2 F;  5FLX M;  1VQ6 F;  1YHQ F;  2LBX A;  1YJW F;  1CK2 A;  1IPA A;  2KG4 A;  4NQ3 A;  1DT9 A;  4BVT A;  3CMA F;  2QI2 A;  4BVS A;  4EI7 A;  3CCJ F;  1JJ2 F;  3OBY A;  2LBW A;  2OTL F;  3CPW F;  2VGN A;  2I6D A;  5HY4 A;  2VGM A;  1VQK F;  2OZB A;  2QA4 F;  2WAL A;  4C4W C;  3GYQ A;  1VQO F;  3CD6 F;  1GO1 A;  5HXU A;  1X52 A;  3J80 M;  1M90 H;  1Q81 H;  5G4V C;  3CCQ F;  3WXM B;  4NUT A;  3CCS F;  3LWQ C;  3RA6 A;  3N4Z A;  4BVR A;  1QVG F;  3JCM M;  3LFO A;  5A2Q M;  2KTV A;  3RA5 A;  3V7Q A;  3ON1 A;  4BVQ A;  4EI9 A;  3LWR C;  1Q82 H;  1VQN F;  1VQ7 F;  3J81 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...