4O2BB

Tubulin-colchicine complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 168
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2bB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2bB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2bB01
5KX5B 3WGKA 4TV9A 5KMGA 5JCOC 5JQGB 5GONB 4HNAA 5KX5A 1W59A 4ZOLA 5FNVB 4YJ2B 4TV8A 5IJ0B 4ZI7A 2RHOA 3JAWB 5C8YB 2Q1YA 1TUBA 3JALA 3JAWA 4X1YB 5EZYA 5LA6A 3WGLA 5LOVB 4X1YA 1TVKB 5LYJB 4U39A 3N2GA 4X1KA 3RYFA 4O2AA 2VAPA 3HKBB 4FFBA 3HKDB 3HKBA 1SA0B 4LNUA 4X1IB 3RYCA 4O4HB 4WBNA 5CA1B 2XKAA 3VOBA 5KMGB 5IJ9A 4O2BA 4HNAB 3V3TA 1FSZA 4O4IB 4X20A 4ZOLB 1W5EA 4XCQA 4TV8B 3JASA 4O4IA 4ZI7B 2VAMA 5J2TB 2R6R1 3VO9A 1TUBB 3JAKA 1W5BA 3JALB 5J2TA 5EZYB 5LA6B 3N2KA 4EI8A 4KWEA 1RLUA 4F6RB 4EI9A 3N2GB 3RYHA 2VXYA 3E22A 4X1KB 3RYFB 4O2AB 4F6RA 5LP6A 4FFBB 1FFXA 4DXDA 5M7EA 1W5FA 1JFFA 3RYIA 3HKEB 4LNUB 5JVDB 5EYPA 1OFUA 5JH7B 3ZBPA 3HKEA 3RYCB 5JVDA 4WBNB 3HKCA 4I4TA 4O2BB 5IJ9B 2R751 4ZHQA 4X20B 5EIBD 4YJ3A 3JASB 4I55B 2Q1XA 3RB8A 3JAKB 4I55A 1W5AA 3WGNA 3ZBQA 3N2KB 5CA0B 4M8IA 3JATA 2BTOA 3CB2A 4U3JB 3RYHB 3E22B 1W581 5CA0A 5MN4A 4IHJA 2XKBA 5LP6B 5MN5A 3JARA 4U3JA 5MN6A 3M8KA 1FFXB 2GVIA 4B46A 3VPAA 1JFFB 3RYIB 3VO8A 5CB4B 1RQ7A 3C8LA 4DRXB 5EYPB 4EB6B 1Z5VA 5CB4A 4DRXA 5IYZA 2BTQA 4EB6A 5EIBC 3HKCB 4O4LA 5LP6C 2RHLA 4I4TB 5ITZA 5BMVB 1RQ2A 5C8YA 3UT5A 4ZHQB 5JH7A 4E6EA 2RHHA 1Z5WA 5BMVA 4YJ3B 4TUYB 5GONA 5JQGA 3ZIDA 4TUYA 5FNVA 3WGMA 4B45A 4YJ2A 5IJ0A 4I50B 3JATB 4I50A 3R4VA 5LXTB 4IHJB 4O4JB 5LOVA 3JARB 1TVKA 5LYJA 5LXTA 2VAWA 4O4JA 3VOAA 5J2UB 4IIJB 3HKDA 5J2UA 1SA0A 5IYZB 2BTQB 4IIJA 5JCOA 2RHJA 3WGJA 3M89A 4X1IA 4O4LB 4EI7A 5ITZB 4O4HA 4TV9B 3UT5B 5CA1A
chains in the Genus database with same CATH superfamily
4H16A 3GH3A 1Y5IA 3U4MA 3OCXA 3UMCA 3B2EA 1YVRA 3BUSA 1R5JA 3ZOZA 3O3CA 4EOGA 4IDCA 3LY8A 1JLKA 3LNMB 2HNKA 1PR9A 4DYDA 1XDZA 3U3JA 3FM9A 4CM8A 3L8HA 3IILA 2YWXA 1EVLA 1RR6A 4F4HA 3ZYCA 1KYXA 5KDDA 3KHNA 1QG4A 2FSFA 3RVKA 4K28A 2AK2A 4PFKA 3K6JA 1J99A 2Q67A 3FSRA 1PI3A 4R3NA 1AXRA 1WZIA 1KI7A 1CDOA 4IZIA 3ZCXA 3PFBA 3AF4A 1SCUA 3WL8A 4LRYA 4LBYA 3BWYA 3GMTA 3I1FA 2J5QA 4D8XA 2AMFA 1XZPA 3I3FA 3CKYA 5HY0A 1RM4A 3R7WA 3H6KA 1YJQA 3ZLUA 1QS0A 2IIQA 1HMPA 4N3GA 3OP1A 3W6NA 3TNDA 2I87A 2I76A 4YYZA 3ZU4A 1G8GA 1H8HD 3R8FA 4QDUA 3OMXA 1F1BA 2UZ3A 1E7KA 2RN9A 2Z6AA 1SHTX 4NMMA 1XO1A 1C9KA 5B36A 1RLOA 3L7IA 3KKYA 4O2AB 2IHYA 1L3CA 1C8LA 1A71A 1GRCA 1N3LA 4CDNA 4JA0A 2AUNA 5U4QA 4J0EA 2JEYA 1AHPA 4JBHA 2FG5A 2ZT9B 3MMPA 3PXGA 3IRUA 3O47A 1DC6A 1E9RA 1A2QA 1SOVA 3UQ8A 4BP1A 3FNQA 4YLEA 1E9FA 2NU9A 5EHNA 1RI2A 4HN2A 4O1IA 2BC9A 3ZWCA 3V4ZA 4O4LA 4CKWB 1FTWA 5KQLA 1I2ZA 2REQA 2O1SA 1QYWA 2GD2A 3DAFA 3VDXA 4WBNF 1S2LA 5KVQA 4ERNA 5JARA 3TS1A 1DADA 4B3SO 2OZEA 3G2JA 4DEYA 3FOFC 3K12A 4ARIA 2P9QA 1GL7A 3ZY6A 1X8XA 3VRHA 1RI1A 4WOBA 4RPLA 4GYWA 4B6SA 5T6MA 2L42A 1A7JA 5CG1A 2YI9A 1P6XA 2LIPA 1BZKA 3WGIA 3QTYA 3I6ZA 4HKTA 3BRSA 2ODBA 4RZIA 5GINC 1QAQA 4CETA 2H3HA 1L5OA 1ZOSA 3RUHA 1Z6XA 4X8MA 4RPJA 1UPBA 5AW1A 1F17A 3DHEA 1WVMA 2Q4TA 1M2WA 1Y4UA 1GN9A 5C51B 1CY8A 1WULS 3T0GA 4CL8A 1LK0A 4IFTA 3KC2A 5JRZA 4OP3A 1P9RA 4OI2A 1YJCA 5EKUA 5CDSA 4RSHA 3LA8A 3L0CA 4D96A 1CQZA 4E5KA 4QOFA 3NS7A 2BFBA 1GWNA 3ZS8A 4GGOA 4NH0A 4GO1A 5F77A 3TUJC 3CZ4A 3ENWA 4D3FA 2DF8A 2QP4A 3SFVA 3N86A 5B3SC 2VHEA 3HMKA 4FFKA 4YV1A 1EFPB 1ESDA 4GP6A 2GF2A 2JCVA 1UJ6A 3QGMA 4GGPA 1YTLA 4G1CA 1MFZA 1R8YA 3JR3A 1J9ZA 2P69A 1WBDA 4WOKA 1KWKA 2QGZA 3HACA 3L82B 4US1R 4NTXA 3PX7A 4YXWD 4G5QA 2CDAA 3C9TA 3KJZA 1ZVKA 3A6PC 1G55A 3LDFA 4F85A 3CD6V 3J7TA 4KYUA 5E7IA 2ZPUA 3LP6A 3MAAC 1PTKA 4QXQA 4IX9A 2IHJA 2NSLA 1KK3A 2HZBA 3TKYA 2C31A 3I92A 1VF6A 1YHQV 4BY9D 4OOFA 1L5YA 3CUTA 1B1AA 2R8BA 1IG3A 2QD5A 4Z51A 1Y9EA 2IYAA 2WLKA 2K2WA 3V6LA 4ITVA 4J0FA 3E23A 2VPPA 1NTKH 4RCVA 4RJKA 1E2IA 2ZANA 1H2MA 5CA3A 3G6EV 3GDFA 3GFTA 1V8BA 4PZYA 1X19A 4JZKA 3VPFA 2XQJA 1XFAA 2D2IA 3EFHA 2RB4A 1V55B 3RSFA 2X2OA 3K8OE 3HCDA 1HT2E 3DUFB 4K9SA 4LOJA 1EVYA 4EA6A 1X9HA 2GVZC 2JGIA 4UBIA 4W99A 1MAVA 2YHAA 2WYIA 2KTVA 1IDOA 2ANBA 4EI9A 3Q6MA 3SJUA 1CFZA 1OC2A 2BP7B 2FWRA 2JH3A 1Z2AA 3IFXA 4FJCC 3BZUA 3IAEA 2FKXA 3FOWA 2B25A 2EX0A 2HPZA 1FQOA 1I01A 2I34A 4YQZA 4ZO9A 5BT9A 4JXKA 2P2YA 2Z5UA 4WX2B 5IAKA 3I28A 4WT7A 1T9GS 1OY1A 2Q5OA 4P4NA 1ORRA 2JLWA 1CJTC 1EJ6A 2VTDA 4R81A 1L5ZA 2W48A 2EJTA 1L4KA 2V1UA 1L9KA 1GCIA 4QRHA 5C35A 3TECE 2J07A 5HKLA 2EF0A 1WU8A 4A8JC 5LYJA 3FWHA 4S1PA 1RMYA 3FH0A 4KXFB 1AGNA 3HZRA 3LUFA 1GSIA 1JWAB 5LHGA 5EWJB 2VPWA 2PMPA 3WWCA 2YIMA 3SOPA 4E33A 2R7AA 1CK4A 3C24A 4DCSA 3BSSA 5K3SA 5C18A 1P2TA 1R2QA 1XE3A 4CR6A 4D3YA 1WU7A 4XYLA 1HPLA 1YJAA 4CZ2A 2DSTA 3B13B 3EC1A 1GV1A 2FN9A 1IZ3A 5BWMA 5LQDA 2HWWA 4Y2TA 4I5DA 3PN1A 2KQXA 4NNJA 4QGSA 5C9ZA 3K9WA 5AKZA 4RX1A 4B3SB 4E12A 4GMFA 3FGZA 3CF4A 2PMCA 3HA7A 5I7AA 4TV8F 3C8LA 3L6CA 1MOFA 1UBSB 3QZUA 1KIAA 4U0KA 1TEHA 4MQ6A 3QSYA 4Y67A 4HDNA 1LQ2A 4LJYA 5CLFA 4QHTA 1JA8A 4JK3A 4G5YA 1TFUA 1MEOA 3DB2A 3WJRA 1IZYA 2Y1EA 5G4KA 2V65A 2NYVA 3JV7A 3ZHSA 3GMDA 1C1YA 3CBQA 4BBAA 1IHDA 2VAPA 4FM1A 1RNLA 1IUOA 4RPKA 4PC1A 3E2PA 3PTZA 4EG5A 1JFLA 3JVIA 4V0LA 3FJYA 1RU3A 1WAMA 3FA2A 3T7DA 3MFQA 1E1RD 3PQ2A 3EEIA 2AHYA 3AW9A 4QU8A 1KS2A 1J2JA 2CWJA 3AGKA 4M1EA 4YHHO 3GT3A 3OPYB 4RPIA 1Z26A 3K5OA 2ODNA 3ONNA 1MG0A 2OHOA 4LHYA 3DZBA 1CQIB 3HEBA 2W90A 3COYA 1QHIA 4CMEC 1NW3A 1ECCA 4MS3B 2WIKA 1RJWA 3BK1A 2XD4A 2QVXX 1IL0A 4JU9A 3ZZUA 4DLRA 1RABA 4EEXA 1W6RA 1TUGA 3QWIA 4U9HS 1P49A 1WS6A 3X2FA 1LKZA 5DNUA 3IOEA 4PDMA 2ID7A 4AZSA 3AJ9A 1OXUA 1RVDA 2DR0A 1I7FA 5BQXA 1D2NA 5LQNA 4Z0TA 4PPYA 3EX7C 4CEHA 2FAXA 1ITZA 4OFBA 1OHHD 2GBGA 2ISQA 2BDTA 2W6OA 4QLAA 4ZT4A 3BMOB 1OVGA 3ABOB 1TF2A 5L6MB 1SWVA 1VL5A 3EYWA 1H05A 2VEDA 2NG1A 2Q4DA 3O8DA 2QW0X 4NU6A 2KMLA 2O8BA 4L76A 2V7WA 5B3AA 3UVEA 3QBVA 4WKNA 1IM5A 4F2DA 3A6JA 1Y3DE 2PWZA 1EWVA 1U65A 3AVUA 3ZMTA 2YH2A 1I5OA 2QVYX 2DR2A 2TMKA 5K3FB 5DISB 1OT3A 3AG6A 2I22A 3B4SA 1S2NA 2Q0SA 1V6AA 2JIMA 3UMYA 1N9KA 2BFDA 3F9RA 1UEJA 3S06A 3ER6A 4H3KB 1CR2A 4HDRA 2QX7A 4XSVA 1L7OA 2K2QB 2NN4A 5GAPK 2FKAA 3WB9A 4W8GA 3A1FA 3ON1A 2PJRA 1NRIA 1PT6A 5DNEA 1RI3A 1ZLXA 4P80A 1P4JA 2LR0A 1BS9A 1T6XA 1PFVA 4JLOA 2XYGA 4U7WA 4CH4A 4BZXA 1HLPA 3RUPA 1T36B 1NFQA 2OFFA 5CLLA 1FFXA 3KL4A 4YP5A 4DCMA 2Y1XA 4XDGA 5C4MA 5EKTA 3CX6A 1SUSA 1IEVA 2F4VO 1R10A 3P27A 3OGCC 1UQTA 5CH5A 1C1XA 2VHVA 4FUQA 3C9SA 2PKQO 2Z3YA 3NIGB 2PRSA 1B16A 2V59A 4J9ZB 3D36C 3I32A 1B8NA 4ISBA 2ZBQA 3T7KA 4BDSA 3KCYA 1EBFA 5IKXA 1XMVA 3SIRA 3A1NA 2NU6B 1YVDA 3N3AC 3TPCA 2CHUA 3ZJTA 5BW8A 3HGMA 1Q77A 5HR5A 3MIIA 2FQWA 4RCZA 1PW7A 3CJTA 1JCHA 3VBBA 4E5DA 4ZC1A 1H8ED 2B5UA 1LWOA 1YZFA 2PGXA 3EWAA 2MYNA 2ZE7A 1R9NA 1H9AA 3OPXA 3OF5A 1GTG1 4JYPA 3I4LA 2FHPA 1WDTA 2M9MA 2G0TA 1Q1QA 4IJQA 4EJ0A 2GZ2A 3HXKA 2PL3A 4GOXA 1UC4B 2FUKA 3CCVF 5L3QB 2W2KA 4C81A 3I8OA 1PT5A 3DGEC 4QIHA 3G1UA 1JECA 5TRTA 2J5BA 4M2LA 3EY4A 2YEVB 2W6ID 4ZI7F 3AKEA 5SY9A 1DGQA 4WFFA 4HQFA 4QXMA 4OFZA 4CQMD 1FRNA 3LD9A 2ITDC 5IHPA 3N0VA 4YBRA 3L1JA 5FPQA 3ZQKA 4GM1A 1LDMA 1NQUA 2ERYA 1CG6A 1FFBA 4KBGA 1WUTA 4DLSA 2RGRA 9GPBA 2OYQA 2WE8A 4MYUA 3GJTA 3L02A 5JAMA 5GIOE 2Z1FA 2QTMA 2GYVA 3A37A 4U5XA 4WH0A 1J5EO 3F5WC 4OK3A 4MWTA 5KOJA 4F3CA 4A0GA 3ZIUA 1VQ6F 2O8DA 3AG2C 2ADQB 2B4RO 3G2LA 1SWWA 3B9BA 4NFSA 1JV2B 5DT2A 5TEVA 1FFGA 3G9ZA 3WBKA 1YXMA 1KOGA 1TVMA 1XTUA 2IA5A 5BYJA 5A6VA 2QI9C 2X8LA 1NT4A 2QIPA 2O3UA 5J5AA 5KHKA 4X5OA 4DJJA 1EJ0A 3QELB 1QXSA 4F97A 3AB7A 1Z63A 3U3ZA 2JVKA 3WG7B 1M3SA 4LR3A 4G63A 3PQ3A 4IFEA 4P5DA 2DJ5A 3GOHA 3V8BA 2ZYVX 4D2IA 2C9CA 1FW6A 1TAUA 4MHOA 1X7WB 3V8MA 1POWA 2ZXFA 1L8OA 3GFRA 1GNSA 4HB0A 2I2AA 5HQ3A 3AOGA 4YGXB 1M1UA 2VDRB 2J9XB 3NDJA 2AJBA 1D8TA 4QU5A 3W77A 2XWQA 4FNOA 1FYXA 3JQBC 2ODAA 1R4AA 3IHKA 3SYRA 4RIEA 2ZRAA 3HU3A 3UKOA 3LDTA 3QE4A 3U31A 4JJAA 1O1YA 3RBXA 4Z4CA 1BW9A 3CKMA 4NBLA 4KXVA 1G8AA 2IH1C 3HJHA 1E3TA 3AO0B 4OGKA 2J4DA 4B8YA 1Z2CA 5A9GA 4BJ3A 4FVMA 2HW8A 3WYCA 3F90A 1JUDA 1KIMA 2LKCA 2WPDA 3RKUA 2WFMA 4EHJA 2ZVYA 2Z4SA 1NE2A 2ASEA 4BMVA 3VJKA 2H7VA 3MOGA 1NV8A 4WSOA 2OZPA 2CLCX 1WTAA 2FR0A 2F4VB 2IXEA 2YV4A 1C4KA 3NGXA 3IE1A 2I1VB 4NBRA 2C3MA 3A2FA 4EFLA 4JJ6A 4YRMA 4YK7A 2APJA 3OIVA 1MC4A 1BGWA 2IYZA 2N1MA 4DJDC 1HSOA 2IVZA 4OHMA 1FDIA 4G37A 4ASUD 5BOSA 3ZWMA 4H27A 1XTSA 3QIAA 4I4TA 1UFYA 5IK2D 4RK7A 3K9NA 4AL4A 3I9V1 4BQEA 4R6WA 4CM4B 3QMPA 4RM3A 4DZRA 4X24A 2FV8A 3QY0A 1VM6A 2IZZA 1N8RH 4HYTA 1WUJS 1RWKA 1X38A 3HCFA 4HAIA 2O2YA 3M9WA 1UT8A 1A2KC 1WPRA 2DBYA 1MN6A 3IVGA 2HYIC 3IHWA 2NQ8A 2IU3A 1YQEA 2BOBC 1FBNA 2X6CA 1QBGA 4YASA 3IT1A 4ZVMA 3WL4A 3TLGA 1ZSVA 3VH2A 4YGYA 4E46A 2I6GA 4JASA 5F23A 3UW3A 3WGLA 3L8YA 5KWEA 4UHJA 4HAYA 3WGZA 3UK1A 1VQMV 2VT6A 1T2DA 3JQAB 5B8FA 3Q15C 3Q3JB 4ABYA 1BVHA 3MWLA 3K9HA 4CMAA 3WP0A 1YRYE 1UKCA 5KTKA 1YCDA 4LCJA 3WQSB 2Y05A 4KX3A 1XRMA 4KIFA 3CNHA 3VMFB 3DPIA 4X7RA 4BW9A 1MMFB 4CHGA 1Q2XA 1GUYA 1QTNA 3DMFA 4L57A 3WLKX 3OUUA 2Z1EA 4DLNA 2RHBA 1YIAA 2WUGA 3EZLA 3TKLA 1QMGA 1J5EB 1INLA 3DYIA 1DEKA 3QHPA 5K8IA 4DWVA 2OWOA 4DWJA 4DO2A 2FN7A 4NYIR 2YJTD 1QLJA 2A4MA 5DPMA 2YDEA 1YQDA 1EXDA 4M0KA 2HDWA 2VYND 3C7AA 1NUAA 4LJKA 4HFMA 4XWGA 4ZCMA 5FWXA 2II6A 2A4KA 2CUZA 3SJBA 4C8EA 3E0XA 4UM9B 3C3KA 3QPWA 2RCNA 3GEDA 1PJ4A 5JVDB 2VWJA 3ISJA 5LLDA 4ME6A 5HE8A 2ZT8A 4RHTA 3UAVA 3I9KA 3NBYC 2VXBA 2ZS9A 4L9WA 2JIOA 2KBEA 4TT8A 3I5YA 2XOEA 2VDMB 3MHPA 5JPDA 4QIWF 1AY0A 1SXJA 4LRWA 2AC2A 2NSDA 1J9GA 1RQLA 1SIBE 2YOHA 3WB2A 4TS9A 5EBMC 2VHQA 1KD1H 3M89A 1JY8A 2JS5A 1OLSB 1ZWLA 2WFAA 5DX1A 3DMTA 1ZFNA 4GLJA 4KQMA 4YJ2B 3O4HA 1KO7A 1Z74A 3EMBA 5LA6A 4CS4A 4GR4A 2Q9UA 1XNRO 1RWVA 1SVKA 4PG8A 1U2GA 4P6VF 2O0LA 1H4VB 4CM9D 2DY1A 3FCXA 5B1AC 1HE2A 1Z0SA 3E1YA 1Z6YA 2G08A 1Q0TA 2BCCH 3T7TA 1NQWA 1U5BA 3CZAA 3ETHA 3EHDA 3QVKA 3VNRA 3L73H 1GK9A 3M1AA 3T4PA 4BJ6A 2VF5X 4QG7A 2YJ3A 1KZ9A 5LP6B 3C6BA 1U8EA 1AP6A 3JQRA 2PRZA 1QHNA 4GDMA 4LZNA 4MI1A 4IYJA 1W49A 3LZDA 2R1TB 3I9NA 1SIOA 2CCKA 4GXTA 2IC5A 3NBXX 4UASA 1K9VF 2EFCB 3FUTA 4QUBA 5CAEA 3B53X 2I6QA 1Q14A 3JZAA 1GU0A 2VUSA 5GV8A 4CMGA 4Q82A 4M9RA 1QU3A 3NASA 1NNI1 2C9ZA 2PMEA 4N54A 4Q7KA 1QU7A 3OCVA 1Y4AE 1KP9A 2YKGA 3S8MA 4BO6A 3GP3A 1FXSA 3OZEA 1V9LA 3GEEA 2VBCA 4ICIA 1B76A 5BW4A 2XDQA 1UXIA 4YUZA 1JZQA 2JJQA 2VHCA 3EDMA 4PLYA 3HBFA 1II8B 3DMYA 1Z2OX 1UR5A 5K0EA 4KOEC 3ICVA 1EWKA 4TMWA 4DQ0A 3ABUA 5EUCA 3UXEA 1URPA 2I99A 3W2TA 3R3UA 1RTKA 3JZMA 1EBUA 3QWFA 1Z5WA 2BBTA 2GZSA 4Y1RA 4UHBA 4FHZA 2FB9A 3JW8A 4CG3A 1U3PA 3U3OA 1PZMA 2G06A 5FEMA 4KJZA 5BXZA 4Q4LA 1KAEA 1XUOA 4R1SA 1I6WA 5ULLA 2ZDQA 2AR9A 4C3UA 5AOVA 2C58A 4RD6A 5H9CA 1BYUA 3SNKA 2MU1A 3HYCA 1QQCA 1ZMRA 1JI0A 2J0SA 5FBKA 1Y8ZA 2D5AA 2ZTVA 1XQ1A 2HJRA 1VQ7F 2F48A 2BJWA 4MVJA 2OCBA 2ZRNA 2X0EA 3FWNA 5IX8A 2O8CB 4V0RA 1Z0AA 3NTQA 5ES3A 4RFSB 2C7PA 4ZVPA 1YITF 3QVGA 1SQ0A 4UCUA 3D6FA 4QM6A 3QE3A 3D7MA 2RARA 5JUWA 1VP9A 4LQ4A 1S6YA 4F3YA 5CBGA 1JMKC 4PA4A 2VHXA 5CB4B 4HH4A 1ONSA 1W8IA 4UHHA 2RGXA 4JT4A 1I36A 5AH0A 1G3IA 2W0FC 3SDZA 1P74A 3G8DA 1JKXA 1Y8RA 3JCZA 4HNHA 3AFIA 5JNVA 4GZ5A 2GASA 2ONYA 5AG2A 1QZ3A 1YRQA 4OQQA 4N6OA 3USCS 2VP4A 5UKDA 3LBYA 5EE3A 3JALA 1U97A 3GRVA 2GTHA 5JAPA 1GU7A 3KSZO 1AM4D 3ZHYA 3UF0A 2W8BB 3SJAA 2FCRA 4JJ8A 3IE0A 1ONIA 3MJDA 1LV8A 1S3FA 1Q0PA 5ADVA 3LT0A 2CFTA 3M2TA 2QDOA 3VQXA 4J0KA 4OKSA 4IIJF 4RE6A 1QJ4A 4IIBA 4MRNA 5LMUO 1NE7A 1H2KA 1SHKA 2VZ8A 5ALKA 4TRRA 1G42A 2BFEA 2P79A 4C0KA 4ZKDA 1NI3A 4I2NA 2GSWA 5IULC 4OCZA 3KNZA 5TQ0A 1XNRB 3R5SA 2HF9A 4KHPO 1RRPA 4EATA 5A2QN 2FWNA 5KSPA 4CDGA 3R3VA 4JOBA 1T5EA 1CJUC 3LQ1A 1KKMA 3I04A 2QXUA 4ZQHA 3TN7A 2NVBA 4KHZA 1Z4IA 2JFFA 1OCZB 2P62A 1SH7A 4X54A 2J30A 5LHIA 3A11A 4UHCA 2VJQA 3CZCA 1QE0A 3FKQA 2OTJF 3DTVB 2VP3A 1Z7BA 4EX7A 2AG6A 5B2EA 1KUQA 2E4ZA 3MTJA 5EKSA 1SBNE 1J0BA 3ESDA 4RL6A 4TQAA 1W0CA 3EVKA 1WSDA 2O59A 3E82A 1SF9A 3L0BA 3VYVA 5BMOA 1M1YA 1OFUX 4G36A 3BIFA 1CD5A 1TO2E 3BFXA 5AK3A 1WMDA 5TF0A 4RDCA 5THXA 2COKA 4YPVA 1IG0A 2PZEA 2ZQZA 2ZDIC 1HEUA 2JJYA 4OQYA 5HBRA 3B5JA 1RSZA 3LV8A 1YI0A 5A03A 1NW4A 4HGNA 4BO9A 2X8AA 2VSQA 1ZIYA 1QOZA 3ZXYA 4F8YA 1KAOA 3R0JA 3VR6H 3ON5A 2OORA 2KB1A 4I9GA 1HEIA 3GWKC 2DWEC 4L7VA 1VKZA 1L7EA 1WSWA 1VB5A 4BR6A 2CDRA 4JEMA 3ZJZA 5JLAA 3AM5A 3RBAA 5LFAA 4R68A 1ZRMA 1E9AA 3IUNA 7ABPA 5EWLB 4YEDA 3ZG6A 2GVDC 2RK4A 2BFAA 1NW5A 4AN4A 4JC0A 1ESEA 3QXCA 4UTZA 5KYGA 5TQJA 5E2IA 4ZPXA 3R0ZA 2GYYA 5EL0A 2QUJA 3U39A 3QLVC 3GEIA 3ABSB 3PR2B 4DV4O 2G72A 1F2TB 4IQ8A 4R6XA 4DV1B 4KAFA 1K5QA 3NATA 4YAUA 3IJPA 1XD8A 4C43A 3OQJA 2I7XA 2N42A 1HKUA 1MB9A 2ZUEA 5KSWB 4B46A 3T12A 4ZEOA 4J90A 4F21A 2GTSA 4CF7A 3P4XA 5K4AA 3UHOA 7GPBA 5DHRA 1EA7A 4MQBA 4JT2A 4FGUA 1JX6A 1CE8A 1UJ5A 4HN9A 4XUDA 5FH9A 1HE5A 1WG8A 3ZWWA 5FBWB 2QLFA 3EXEA 2Y48A 5DECA 3CT4A 4LHZA 1CVLA 3DDUA 3T4DA 1OAOA 5KSZA 2YC2C 2O3RA 2WD7B 1Q3TA 2OM2A 4MW3A 2WZQA 2EZUA 2VCHA 3EG5A 1FNMA 2PY6A 3V4SA 3N2GA 4WE3A 2EF1A 1SKYE 4ZD6A 4ZT3A 3SM9A 1DDIA 5HRCA 4ZBMA 1XEQA 2RFLA 5KQRA 3RA5A 2HVKC 3LUHA 2HMSA 3DXFA 5J4YA 4FIPC 2WMOB 2E3JA 2OYCA 1GFZA 3SC2A 2UUOA 1TAGA 5GADl 3U62A 1E2EA 4H7IA 4UCOA 2OBXA 1U8XX 4HD8A 3LGXA 2HFEC 3M6WA 1W36B 3OTHA 3ADCA 4PNPA 3C5CA 2C2KA 5F3WB 1Q0RA 4MW9A 4QULA 2XZOA 2YMMA 4UCSA 1TOAA 3O94A 5ER6A 2ZR2A 4FZ1A 2V1DA 5G0VA 3R5KA 4PN7A 4EWLA 2I2BA 3P8ZA 2QY6A 3OONA 2A30A 4FCTA 3TXXA 2Y27A 4QOJA 2ZREA 4MYCA 5KNCH 1G9TA 5DLQC 5L3CA 4QUKA 2G4VA 4HZ3A 4BRSA 1OZFA 1DF5A 1FMTA 2E76B 1TAQA 4TL7A 4X97A 3VOTA 3EUEA 4J76A 5LMUB 2FPGA 5AESA 3CW9A 4BNXA 4YCLA 1VIVA 4LDPA 2FX5A 2R60A 1YIDA 4UDXX 2FNAA 1U1FA 3FPGA 4KZPA 3VR2A 1CUSA 1E9EA 3HO6A 2UZAA 2YCBA 5MFPA 4PW0A 2M6RA 5B1NA 4KHPB 1D6JA 5L3ZA 1BTOA 3NLLA 5J5CA 3FXAA 3KFLA 1HFKA 3WSTA 5LUAA 2R8XA 3MGCA 5CH8A 5CNKA 4HS4A 3G2PA 3KTAA 2W6JD 4QAJA 3MTDA 4M36A 5BSHA 2XAQA 3D3WA 1MB4A 2IYOA 2E1RA 3WK6A 3C3JA 1WMEA 2ZXEA 4S2UA 3EXAA 3CC7F 4WTOA 1NJ8A 3O93A 1OZGA 3WMEA 2B2NA 2ZG6A 1FNDA 1VP7A 3R65A 3VCZA 2VWHA 1JEYA 2IUUA 2YOGA 4IXNA 1PFKA 4B31A 8AT1A 1SOWA 3PLAE 2YWCA 1OH6A 1GZ4A 1E66A 4PC6A 4M0CA 1O9HA 4JIMA 3A3OA 2B2XA 2H1LA 1ZH4A 2B8JA 1JEEA 3L92A 2XE4A 2WLMA 4FJ1A 4BQRA 2XOKA 4EZIA 4LJ9A 3O31A 1MNQA 1FNSA 2OAGA 3LO8A 1Y6GA 4X7MA 2CK3D 4I4NA 4FIDA 1QTIA 1R5OA 2WG2A 3F9IA 4CUZA 1MABB 1ZQ1A 4UEKA 3D8SA 4C03A 5HILA 4TXNA 2AN3A 2XJ4A 3I9OA 4Z8XA 4BYMA 2QRJA 5EJ5A 2CT8A 3QTCA 3RPEA 3OZGA 2R79A 5B57C 3T61A 3LUBA 1JR9A 5JD3A 3T1TA 2XCOA 2N3ZA 2BY4A 1N9ZA 2ZW9A 4B34A 2EX1A 2B35A 3NXSA 2Z2YA 5LZ8A 1I4TD 3DAGA 3RT1A 3KWLA 3NM4A 1NR1A 1UBLS 3K6SB 5JCJA 5IM4A 2ZFUA 4GPTA 3KIZA 3CMEF 1B04A 5AK0A 4DV4B 3N05A 3F67A 2J4CA 5TVKA 4QYXA 2GM3A 3LW7A 1NIJA 5LKAA 3VKGA 1RTTA 2CB0A 4LC9A 1QHXA 3FYIB 2XUGA 3NHUA 4PS0A 3ZDFA 3ZWBA 5J4LA 5AVOA 3ZEAA 1VSBA 2CGNA 5BUSA 5D1NA 4B87A 1AGXA 1ETUA 2A3QA 4CR7A 3OU6A 3SSNA 1A5TA 3V8PA 4KLCA 1V11B 1RS0A 1MZPA 1LDYA 1W76A 4FLWA 4FE4A 4WFIA 3KX2A 1R0BA 4GP7A 1K8YB 2CJFA 3DT6A 3PNSA 5CA0A 4JJGA 3KHSA 3GPDG 3GZNB 3LBAA 5GONA 1UPFA 3LDCA 4H7HA 3W7VA 2H4HA 1KMHB 4IYIA 1KDVA 3CPEA 3OJLA 1NPYA 3SLKA 3VYWA 4N8EA 1XVVA 5FL3A 4HB2A 2D4AA 3AIOA 3G2MA 4UB8Z 1PF7E 2JNWA 3G5LA 1UM9A 1NT2A 1IX9A 3FPCA 1ZK4A 4RAQA 5CNJA 4Z54A 2X8JB 2NYUA 1GDHA 2XOXA 2EFYA 2QLLA 4YAIA 4TTAA 1QR8A 4GYCB 2L0XA 1TA4A 4YMLA 3AKCA 1VQPV 1VLZA 1L5KA 4F5EA 2WG0A 4ZVTA 4II3A 1KAGA 4AIIA 3BRQA 1NR5A 3R5HA 3W5IA 1AHIA 2LV8A 2GTIA 4WCVA 2FW9A 1MZVA 3CRW1 3LUPA 1FVFA 1B6TA 4IO1A 4HO1X 4ZT7A 1U0LA 3JZDA 2C03A 4BEVA 4D8VA 5CLJA 4BVSA 3W8EA 5JDCC 1Q44A 3TTWA 4U3JA 5JJIA 3HNRA 1FZQA 1XALA 5EZYF 5FULA 5G4VC 5DWVA 2H1RA 3OFKA 2MCFA 3PWTA 3LPLA 3CRMA 3JWGA 3JYCA 4CKXA 1UP4A 3MQ2A 1U7UA 4L6AA 3WA6A 1YFKA 4DCPA 4CQLA 3OPMA 5EXDA 3DEJA 3QNWA 3BFPA 1AOXA 1C3XA 4GR5A 4DN6A 3G8CA 2NLOA 1WABA 2QVGA 3ZIAG 1YR9A 4PANA 4PI0A 2MWMA 4EUSA 3T7IA 4V24A 4D4HA 3NRBA 2QQ5A 3D4LA 1YXBA 4HGPA 5DOZA 4EMUA 3TAHA 3W7SA 1NW7A 1PL8A 3UY4A 4KUEA 4I08A 2VPYA 3H3FA 1NJGA 3AF0A 5EVJA 5DX0A 3KK0A 2VJNA 1G4HA 2Z2ZA 2LE0A 4IDAA 1NVPB 2PZ8A 1N6KA 2CNBA 2V4ZA 3ISVA 4BO8A 2YNMC 3EIFA 2A5LA 1NRWA 5M5BA 3R40A 4TRMA 4ZARA 1MJGM 1CYEA 1Q11A 1EZ1A 5EGNA 2YIAA 1Z4QA 1P61B 5JWHA 4CV3A 1P7GA 2D1TA 1P39A 5JCXA 4JV5O 2RI0A 5EPOA 4L9SA 3I2FA 3IYLW 4O29A 5DE3A 4BNDA 3EOAI 4R8RA 2PX5A 1FX0B 2HXGA 3ODGA 3RRZA 4GR9A 4ZI5A 2YUIA 3HJRA 2FB5A 4BNJA 4RANA 2I03A 1OMOA 4WL0A 2YJNA 2JFBA 3RC7A 2UDPA 2PZMA 1CQJA 4L02A 1LWNA 1Z34A 5HIMA 5DM1A 1ZCFA 1JHMA 1RJDA 2RCYA 2YR0A 3IR6A 1BQZA 4X6UA 2XY4A 1HEYA 3I55F 3WRXC 1GEGA 5E1OA 2C4WA 4C5BA 1NX6A 2E5LO 1W96A 3H9BA 1CEZA 3MPOA 5A71A 1AUQA 4OP2A 4JLKA 1ADCA 3N6RA 4NX2A 5K6AC 1Y6FA 3MB5A 2RNBA 5EQDA 1ZW6A 4YMGA 1EK1A 4FMBB 4M9ZA 3QEAZ 1DAOA 3PRYA 2C2YA 4GLOA 2N48A 3WQQA 2I2XB 3U60B 5BQ3A 1BG6A 2R9VA 1Q82W 3ABKB 4D9MA 1ZTEA 3MTIA 1LX6A 1G2IA 1L5FA 1US6A 1Z17A 4RFLA 4DVJA 1ZY2A 3GARA 4TZKA 5KYXB 4B82A 3HVJA 4QJIA 4NWOB 5ALQA 3SQOA 2Q4PA 3H1KH 3ICPA 3M2PA 1LLQA 2G07A 5IKOA 2O05A 1V16B 5GTDA 1EQAA 3SOZA 1MJGA 1PK7A 4E70A 3OOWA 2UU9O 1X8KA 2WF6A 1DJOA 1NLZA 4RGYA 3DHWC 2VHUA 2E1PA 1KJQA 1P4SA 2ZT5A 1KRXA 2O1WA 3UV6A 2CLHB 1KEKA 1OIVA 2HJFC 2OK8A 4D3DA 4D82A 4FR5A 5G02A 4JBYA 4NKRA 1IATA 3NEJA 3CLTD 4IG4A 4NJOA 1M0EA 2QWOB 1L4EA 3P2IA 1YFLA 1F4MA 4Q4JB 4LDRA 1DBFA 2OA0A 3HJTA 4MW8A 2BJHA 4LJ8A 3OF3A 5TR9A 1F14A 4I0WB 4ZHVA 1LPMA 2WAMA 1PL6A 5CG2A 2WU1A 4QBHA 4EJSC 4G4GA 4OXKA 5EZ5A 3T0FA 2DHEA 4RIIA 3TGPA 3TEJA 1K33A 1J9EA 1Z4OA 4NK4A 1DF4A 3C48A 4K9MA 2WHPB 1I6KA 1WNTA 4PYNA 3VR5D 4YJHA 5AHRA 1W3EX 2RMKB 2Y0DA 3FCYA 4IM7A 3RRFA 1LNSA 4OHVA 1EN5A 2F95B 4O3MA 4UVHA 3BSYA 5EKXA 4UPDA 2Y93A 2OCLA 4UU8A 4NTYA 1T4GA 4O5AA 2O7NA 3A2KA 4MVXA 3CZ5A 3GCGA 3PDHA 3PXDA 4W5QA 1BHJA 2Y66A 4CW7A 2I6UA 4MYDA 4H0FA 2GCOB 2QKAA 5EE9A 4FHGA 4Z1MD 1UDXA 2O8FB 3Q11A 2PJUA 5IH7A 3U3MA 1L8XA 2XJ9A 4TS3A 3K0FB 1LBEA 1Z0JA 1NQ5A 2OD7A 4QGBA 4JHXA 4EO4A 1E1CB 3I2HA 4ENUA 2V5VA 3ONVA 5AM4A 3IKEA 5KVAA 1ZWZA 2KG7B 1J1IA 3UV3A 1Y7TA 2GN0A 3MCZA 1ZICA 1F9EA 3DLAA 1PL4A 1PT9A 3WV4A 3WK5A 3A9WA 1Q6IA 4OHUA 3GAAA 2BM8A 1XAJA 3ICWA 1C3LA 4UCXA 3KLPX 3Q41A 4OD0A 4CKBB 1T1GA 3TD3A 3VC7A 2PEZA 3HXLA 3I56V 2HX0A 3AR6A 4JL8A 5KX5F 4ZOLF 1VLMA 4C4XA 3KQMA 4JV5B 1GOTA 5F5LA 3KZIZ 2J3HA 2EIHA 1AVTA 3MG9A 3IMGA 4D6TH 2R68A 3DWEX 1NONA 3TNJA 3KV1A 4TN1A 1GZ0A 1K6XA 3BHIA 1KI1A 5DBGA 1F3LA 4H1UA 1WJGA 1MU0A 3FUCA 2LDBA 4MWCA 4BRZA 4FXPA 4MSWC 4M83A 4LP8A 1H4TA 1FFTB 2IS1A 5LYYA 2YYSA 1HT0A 3SG0A 1ACLA 2ORIA 3W78A 1DXQA 1SIUA 3K5IA 4CS2A 1NKSA 1BDBA 4IVRA 3GLGE 3CN7A 1A50B 3W9BA 4AP6A 3F1KA 5F12A 1QWSA 4IOJA 1KF0A 2DBVO 1XDUA 5BQOA 3PGKA 1ADYA 2PUSA 1UWVA 5BYKA 1OD6A 4C2UA 1I10A 2C98A 4Q48A 4XYBA 2WALA 2CFOA 3U19A 4NEHB 4IDHA 1W581 2P2CA 5LQSA 3HEMA 4F2GA 3M7MX 1KDTA 2NO9A 5JXJA 2Q1TA 2CFSA 1GZDA 3VNBA 1GFIA 5A62A 4JJEA 3M6VA 1SQXH 4DA0A 4L16A 3CG6A 4KNWA 3P9ZA 4EO7A 2V5AA 5E0KB 1L7DA 2XAHA 4BCCA 4AMZA 4CGZA 4X91A 10MHA 1V8PA 3QVTA 3K30A 1U80A 1HXHA 5KJ6A 1BEEA 4DLXA 1PR0A 2JAWA 4PNZA 1G4AE 3JWEA 4PCLA 3WU2Z 3K9QO 1CZOA 5G1NA 5DH9A 2QWNB 2LZ0A 2N46A 2JG3A 3SZGA 4NQZA 3W5UA 1EZZA 2PUTA 4D6YA 4KV9A 3RVLA 3SJCA 3WO1A 3JTMA 3BCSA 3C43A 3AUTA 4NNOA 4PG4A 4CVNA 1JIQA 3MZ0A 4XX0A 1E8MA 4KH0A 5TISZ 2F1IA 2XTZA 2J7KA 3IXMA 2JIZA 4MWOA 1Y7IA 5JQGF 3DTTA 1JFFB 3DC6A 5B64A 4Z7NB 3O83A 4OG2A 3LDDA 2QWQB 3FYUC 3C6MA 2AR7A 2NOAA 1USGA 3L7BA 1S8NA 1HW7A 2EVWX 4R1PA 3ZP4A 4FI3C 1XA4A 2K87A 5DW3A 5FJJA 2AI2A 1C0PA 5JS2A 4CKEA 1YU9A 1ODFA 1KQFA 5K09A 4GG1A 1QF7A 1TVKB 4ER7A 3LF1A 2NUAA 4HB4A 2QENA 3COZA 2O1EA 3JQAD 1PEAA 3G1WA 1L4LA 5IJ9A 4KIGA 1KFJB 2PRKA 5E6RA 3AEXA 1XZCA 1WCIB 4JX9A 4PYIA 4M8NE 3F0TA 2OILA 2Z08A 1O3YA 2QUAA 4TZ0A 2ZJ5A 3VTIC 4EAAA 5CJPA 1IIBA 2ZVJA 3QA9A 1FLDA 3D81A 4YN3A 4JBNA 3RCBA 3LXUX 2JCBA 1CHDA 1EUQA 2I4OA 2G28A 2UYOA 4LHWA 1C0KA 4KQ2A 3HZZA 2GN6A 4K81B 4H33A 2G4CA 3U4IA 2VLIA 1NVFA 4LK2A 4TUYB 1BGXT 1WHTA 1GGVA 3FMOB 1E2DA 4R54A 2CSUA 4RMIA 3H19A 2VYQA 2ORYA 2YN0A 3UENA 1MOPA 3VTFA 4N8DA 3V7WA 1ZI6A 4IO0A 1TU3A 1D2GA 4KH1A 2GN9A 5FL7D 2NO4A 3O92A 4YRTA 2FG6C 2R96A 3D4OA 1IPEA 5JAZA 1G0NA 3DDOA 1KZGB 3RYFA 1MAAA 1PV2A 1UFQA 2RB9A 2Q1SA 1U0GA 3Q8KA 3WHPA 4UM9D 2HB6A 3TTXA 3LHFA 5JY1A 3HK2A 4EGAA 3DMRA 1KMMA 4JL5A 2QJOA 3M9LA 5HKKA 4ZAXA 5CYPA 1S96A 2NPOA 1R1MA 3CEJA 4UCWA 3CCRV 3ZKWA 3GQBA 2PGLA 3TZHA 3OZSA 4CM1A 2F9MA 1Q3KA 4MIEA 4E08A 2C2XA 5HTKA 5GTIZ 4XRGA 1DCFA 2FSGA 2EW1A 2QTNA 3V1LA 1JYFA 4K9LA 1GPNA 1NYQA 2BKUA 4KE6A 4JBGA 2B69A 3BH7A 3NEAA 3S0JA 1FVOA 3AG3C 1MENA 3WMFA 1C3OB 3K9SA 1MXHA 2BEWA 2XXAA 1S5HC 1N6NA 4JI3O 5IEBA 2FUEA 4WERA 3E70C 5JWOA 5BN3B 2H4ZA 3JYHA 1L5MA 2FWJA 3ZDCA 3WYGA 4HMQA 2HEPA 1V54C 2WTMA 3F78A 2GARA 4X1KA 3OE5A 3KDAA 3K1AB 2BRUC 4G5XA 5K6TA 1NTOA 4IUYA 5KWVA 2YN4A 2FZ5A 5CMLA 2RH9B 4FHFA 3BTVA 2H5IA 1VFNA 2NMUA 1SULA 4OBWA 4R8SA 3JTEA 3DXRB 4G0QA 1CKEA 4WBNB 4QX6A 5D3KA 2J87A 2CNWD 4XWKA 5AFSA 3EIWA 5E4TA 4Q9DA 2OBYA 2QM0A 2GN8A 2BGKA 1ZAKA 5HCUA 5IH3A 5GGYA 3W79A 2C5BA 4DYVA 2HU8A 3ROPA 4YUVA 3L6RA 3FVQA 1OPXA 3LDUA 1PFGA 3ZQ4A 2HQSA 2CVPA 3R4VA 4XLTA 1HDOA 3CSXA 3EGVA 3VFDA 1AKQA 1AKYA 4DNFA 1QIIA 1QIHA 1ZUNB 1XX6A 2NX2A 4EY6A 1DGSA 1W85A 2PD4A 3QHAA 1VLJA 3RSLA 4UUBA 2XCLA 3AZPA 4G09A 3LT1A 4WXRA 1FB5A 1L9XA 2YFYA 2WD9A 2W7TA 4DGSA 3UTDA 2L18A 1RAHA 1JJ7A 5B66Z 2DQKA 4D9EA 4BQSA 3OM9A 2GYWA 3FRHA 2ZYAA 4Q7JB 2O0KA 3OQBA 2YZMA 2QL5A 3O1HB 5JO0A 2JJ2D 1YZHA 2QTRA 3GJSA 1DJNA 1MVOA 3FE2A 2HN9A 1O03A 2JD1A 3ELDA 2F64A 1E2HA 1C9EA 1Z5PA 3DD5A 5CGQB 4AWBA 2Q5LA 4ZVSA 5K0CA 3FSEA 1KETA 2NR5A 4TMZA 1VHDA 5DEIA 4YHHB 4LK3A 2QD1A 3O2QB 3ODPA 4AKGA 3D3EA 1D2CA 4CCYB 4U63A 2WA1A 4P1ZA 4DUPA 1KORA 3K32A 2DTDA 4CEIB 4ZQCB 3W5BA 2D54A 1AI6A 1D2RA 3GG2A 2Z04A 5A1JA 1SVLA 3PWZA 4C22A 1TECE 1G63A 4Y2HA 3TTUA 4P4SA 2QORA 1XVIA 3DV0B 2WSSD 1NY5A 2VNIA 1X7XB 3BDVA 1U90A 1B73A 1XPUA 4PBRA 3RAGA 4JAVA 1MA0A 5KVCA 1NF8A 1QJCA 3KSMA 1B7GO 3C8MA 1OTYA 2A88A 4I1IA 1QO0D 3RJTA 2HEIA 2HU7A 2YVKA 3CZ9A 3HYLA 2AUMA 2ATCA 1T13A 3BD8A 1R4MA 1IEWA 3H8SA 4YMVA 5KCZA 1XBLA 3FDJA 1K9MH 2HVYD 2C2GA 4M88A 1K4YA 1UMCA 3QVLA 2PPLA 1M83A 1EA5A 4FFWA 2VK1A 3OFSA 2OT3B 2PHNA 4EUNA 4HJRA 5G3ZA 4ARZB 2WKWA 3R77A 2HV8A 4RV4A 2V0GA 3GJRA 4IIXA 5ICMA 4MV5A 2OBNA 5ELXA 2NV0A 1PF5A 1YVUA 4G07A 2F1JA 4X3LA 5AOAA 4DG8A 1AKMA 1JU3A 4BEJA 3RFTA 3ADDA 1KY2A 3VR4D 3SYLA 1Y6JA 1HDRA 1S3GA 1T4CB 2BR4A 4JYAO 3L6BA 3EXHA 4Q18A 1MA1A 2N1BA 2IRWA 3CNEA 3RHSA 1DDOA 3I9FA 4PIVA 3ZQUA 1SEPA 2FN8A 5GP1A 1W5EA 4H0LB 4JQZA 3V8RA 2GK4A 1DOZA 4JNCA 1EMDA 1X8JA 4LSGA 2VYVD 1QRUA 2X8BA 2NV6A 1WVGA 4OMCA 4FEEA 1SUIA 4AF6A 3I5AA 1SCNE 3OZTA 4D0RA 2VJAA 3M1IA 4JI3B 2B5WA 4D9IA 1S8AA 5TB5A 2M1XA 4P31A 5EK0A 5I9MA 2QUHA 5JWPA 1A82A 5G4LA 3IEQA 3H1EA 4YQFA 3D4NA 4MZDA 2ZWIA 2DSNA 4IYHA 2E4XA 2ZBEA 3RVQA 5EXSA 2OV8A 1FJ2A 2MSWA 1N9GB 2M6SA 2EGUA 3E9MA 4X90A 5JMTA 1UDWA 3WK7A 5IP5A 1ZGZA 1SPBS 3L6OO 3AFHA 3A4TA 3TQQA 2RHCA 1BCRA 4C0HA 2DBRA 4CLEA 1W0JG 2JEXA 3I09A 2JHPA 4KQWA 5KKCA 3OEHG 3T6KA 3R9WA 4ZCRA 2QOEA 3V3TA 1WB8A 2QRNA 4TV8B 1LJLA 3WB1A 4DIKA 4XOUA 2NZWA 4J6EA 2QEXV 1UJ4A 4ZHQF 1VKJA 2HL6A 5I6DA 2QM7A 2G17A 4DPKA 2NNUA 5DNWA 3CB4A 3WFVA 4Q3CA 1Y67A 3SQMA 1TPYA 1R4ZA 3KOXA 2FE1A 2GKOA 3EUFA 1EP3B 1X7PA 3B2EE 3JQ9C 4PCAA 1KK2A 1U4SA 4PSCA 3IPYA 1F5NA 1CFJA 4MWBA 4MWGA 1ZJWA 2V74B 1MOSA 1B41A 4IP0A 3NBMA 3DCYA 2I6RA 4R8KA 4DK0A 3WLJA 2JGDA 3OMNB 5KHHA 2PR2A 3PQ4A 4HH0A 3BMNA 3HPQA 2QVCA 1TJNA 5DCYA 1ZU4A 1FFDA 1I14A 2G63A 4TTIA 3WB0A 1NDHA 4Q9IA 1TZBA 5F7JA 2CDCA 2OHVA 4Q7LA 4ABTA 4HNGA 2GV9A 1IJEA 2PQ6A 1N2CA 4F93B 1CK2A 1D6SA 5BV1A 4QUEA 3C3BA 3WWDA 4PZ0A 3SVZA 3QF4A 4MW0A 2XITA 4LOLA 3LBNA 3QBTA 1WLSA 2H11A 3VX4A 1BHO1 3AX6A 4F3KA 1LVGA 3ZX6A 1NU6A 5AXCA 5F5XA 1GGMA 5DNYB 2Z8XA 3TTYA 4K1XA 3C0KA 4G23A 4TPKA 3B36A 5F5NA 3KEOA 4HPJB 3E8HA 1WMAA 3Q7IA 2Q0AA 3M4JA 4O6VA 1WW3A 2IYNA 1L7PA 4NPCA 3UT5A 4EDFA 3UM7A 5BMVA 3AHFA 3K5NA 1JYEA 3I2JA 2ZJAA 3T34A 3ZY2A 4DTCA 4C7MA 3JATB 5IAEA 1RPAA 1ECPA 2FRDA 2FP4A 2O7SA 3SR4A 4REOA 4P22A 2Q6KA 4P7JA 1VBMA 1KAMA 2NVUA 1EUZA 1G8KA 4P2GA 4MIKA 2PJDA 1A72A 5KTPA 3RS2A 5LOVB 1UXJA 2X9NA 3RSHA 1B1CA 3S5JA 2ZLBA 1DAIA 4G1BA 3PDIB 3O2JA 2H0AA 3U0BA 4AQYO 3OGIB 1AQNA 1WUKS 2WT8A 1V4VA 2UXDO 2YL2A 4N5HX 3AOEC 4RY2A 1YSCA 4CBVA 2HK6A 3BF7A 4RSGA 5LJIA 3INNA 2O8EB 1C7ZA 5A4DA 5ELLA 1AS0A 3FHOA 3A1CA 1J7JA 5E38A 3FOZA 1WEHA 3C85A 4DSOA 3ENKA 3O8BA 3TQTA 4JYAB 2BH2A 3NM6B 3WXBA 4G4JA 1U7HA 1VPLA 2ZCJA 4R71A 3U4HA 3LSQA 5K8CA 5AKJA 3OFVA 1I3MA 2AX3A 3HSKA 1AU9A 3COVA 2H17A 1T9BA 1ZH6A 1A96A 1Q86H 5B30A 1XTTA 1WA8A 2HSGA 2D59A 3D01A 1I5YA 4R5MA 4FTWA 1CUGA 1OGYA 2IYWA 3NETA 4ECAA 2VFAA 1O2DA 1PG5A 4ZOQI 1JN1A 3GAMA 2RGAA 2AKYA 3H4MA 1CJVC 1ZMTA 2LKDA 5JNLA 3WL6A 1VHJA 2J8ZA 5LD2C 5M7EA 2ZJBA 1OU4A 1XOIA 2GZLA 3KT0A 4D92A 3Q9SA 5K0ZA 2V98A 1VPTA 5DRYA 4WKBA 4TV9F 3DM9B 1QANA 3VU1A 1W8DA 4EGFA 3JQEA 1V0JA 2DPLA 5AJWA 4X44A 5TT1A 4G1MB 4G8JA 3SC3A 5J9FA 3OAAD 1PJRA 5AVZA 1U2SA 5KPDA 1L7RA 1MR3F 5CLHA 3PXAA 2B37A 2Q8QA 6CHYA 2MJLA 3GB7C 3CG0A 4Y6LA 5TQ2B 2IJJA 1JVNA 3BHJA 3LX8A 4G9BA 2QI9F 5YASA 2DUMA 3ZWVA 1M6EX 4N7RA 3FSGD 1K6JA 2ZIXB 3T95A 4YCDA 1FDRA 1XLTA 3G67A 3U9LA 4ZI7B 4MUIA 1ZISA 1BCSA 2Y8EA 2RGYA 4QUDA 2A9HA 3SIPA 2VJMA 2FFJA 4QXPA 2JGUA 2ZBPA 1EVEA 3Q8XB 1LVHA 4A15A 4RVDA 1G21B 1EN6A 2XSZD 3HB0A 2G8NA 4CH3A 3BRWD 1ILEA 3TZCA 5EP4A 2NSJA 2I6DA 2I6SA 1JVMA 4BO3A 4O1HA 1U7ZA 1JF8A 2EILC 1OZAA 1A69A 4S0XA 5IYCO 3PLAC 1KEEA 2C3PA 3K0CC 3RSSA 1RQ2A 3F0DA 3HE3A 3P0RA 4ATNA 1E9BA 4Q1EA 5K0TA 1W7AA 2JFYA 3AM4A 1T2CA 1TT7A 5F2OA 4UC0A 4JNKA 2QTTA 3D2LA 1U3GA 2JFZA 1SCQA 4XKJA 3FGOA 1B93A 3KZXA 2I3ZA 4N76A 1IY9A 3OH8A 1T9CA 1GQQA 4XIIA 1R5NA 2UYNB 4OXRA 2A06H 4JDPA 5EERA 1UWLA 3T7RA 3QUCA 3B51X 5L3SA 5FADA 1IN7A 3N1UA 1B43A 4AJLA 2FW6A 4RQAA 3IKMB 1BFKA 4PLWA 5JLJA 3Q40A 2PS3A 3ROGA 3RG2A 1LRKA 3BC1A 3TTTA 3SEAA 2FR1A 4IMIB 2FPIA 3RYHB 1N0HA 4GOLD 2F3PA 3SMVA 4BVGA 3UAOA 3IKTA 2CVLA 3EGXA 4YMIA 1Q7BA 2P0EA 3GLIB 2PY5A 3N4YA 5J5VA 2Q28A 4AQYB 3QW2A 3EA5A 2HA2A 1CRLA 2KSQA 2UXDB 1VIBA 1ZN2A 3W2HA 1H0SA 1A4IA 1YZKA 2BELA 5E95A 3WQBA 1D5WA 5FFMA 2ZXWC 1ZW1A 5HIJA 4OO3A 3ADOA 3M9XA 3K16A 4L74A 2Q6AA 1Q3HA 2VJCA 4G8BA 4KEAA 1YRWA 2QG4A 2ZULA 4BQQA 1KVSA 2BJVA 3M0EA 4IW3B 2NU7A 4LDNA 1RYYA 4FCWA 2O50A 3EVGA 5KNDA 4RHAA 2ZF8A 3EBLA 4MUYA 4JP1A 4GS5A 3R5XA 2X3YA 1Y76B 3X2SA 1FP1D 2BEVA 1I1HA 3K8YA 4HZUB 1KI6B 3IXLA 1GG2A 1JR3A 4QNMA 5DGCA 1N36O 1DUIA 4WK4B 1BMFA 2NMVA 1TLTA 1YO6A 4U2BA 1ZONA 1SZQA 1DTWB 1MUUA 1RM1C 1GHTA 4BPBA 2RC5A 3AR3A 1DO8A 3C8UA 1EI9A 3TCXB 2AT1A 2GPWA 4UOEA 5IAGA 3AVYA 3W2FA 5B1BC 2E4YA 1GADO 2W00A 4D5GA 3AEUB 4F45A 3DOFA 3QWHA 2WM3A 3BFJA 4IQGA 3T8YA 4G0XA 2C4HA 5A3VA 2DAPA 5CBFA 3GLTA 2AG1A 1IE3A 1G38A 4Q9HA 1A4UA 3L7LA 4HNUA 4LTDA 4PQEA 1SBZA 1H0HA 3EZ7A 5F1PA 5J2TA 4XM0A 3Q4HA 1DKOA 5ESXA 3SHQA 2WFLB 1SVMA 2XRMA 1Q19A 4P32A 3NANA 5CJJA 4NEGA 3H9EO 1NMEA 4YAJA 1TCAA 5AWFC 4DXWA 1DZIA 4FLYA 4DKXA 1X7HA 5ETJA 3UGJA 1OX4B 2JBAB 1Y3AA 3D02A 5CNIA 1GPBA 3MD0A 1MRZA 4UFOA 1M6VA 1LPAB 3DVAA 1IEQA 3D00A 4F12A 1LC0A 3WK4A 4TSFA 2HKIA 4I8XA 3CNNA 2B9EA 2AJLI 2HJDA 5LUBA 5ICEA 3O1IC 4IYRA 1GG8A 3FFBA 1KEPA 3RTBA 5E3IA 5IN5A 2I4IA 3VISA 2XA9A 3B2QA 3TD9A 4B4UA 5REQB 1NJ2A 2XBLA 5A4IS 1YDGA 3VPHA 3T3NA 4TYYA 5BPFA 3G8AA 3VZQA 5I3CA 1WCWA 2Q50A 1VKRA 1GN2A 4FN5A 4CLRB 4DCUA 4J9UE 1P4AA 2X1MA 3I53A 4L51A 5JH7F 3FUXA 5EMNA 2A84A 2Q8NA 4CMIB 4EY7A 2P67A 5ECDA 4X95A 3RYIA 4RQFA 1GQOA 4E31A 4IZHA 2O0MA 5CJ2A 5ALZA 4RH1A 4IJWA 4OSPA 1E62A 4ZAZA 3BYQA 4ROTA 3EXIA 3HDGA 5KSYA 1E79A 4Z4QA 2JLQA 5FJIA 4M6WA 5F64A 3VAAA 5DSTA 3KWMA 5GV7A 1BXRB 2FWPA 4MCAA 2ATEA 4EYKA 4FT2A 5KTTA 1EUCA 2CVHA 1JBQA 3HJUA 2OOKA 3ZHTA 1NBMA 3FTNA 2W71A 4JEUA 5KHJA 3B2NA 3NVDA 4EDHA 1Q1EA 4ZI2A 1GM5A 1IVYA 3O4IA 2HFJA 3G8YA 4JT8A 4I1UA 2Z5FA 4GF5A 4BXOA 2QTAA 3RRYA 2XX3A 1XU7A 3FAZA 3P30A 2NZJA 3L8MA 2BTUA 1FMFA 2V7GA 1ND5A 4C7OB 1GCGA 4MP6A 3D8NA 3EARA 5FB3A 1FLVA 3JVHA 4KGDA 3GVCA 4JGBA 1WLEA 4HGRA 3NJRA 2Q68A 2EL9A 1G2PA 3RS4A 2I4TA 1V8DA 4BZWA 5A5GA 1P4GA 5BT8A 4DQLA 3VQYA 2BH9A 3UO8B 2HY7A 3AETB 5E4JA 5GPBA 2YHSA 4DQKA 1R0SA 3VO8A 2ZXUA 4PA7A 4BVAA 2G8LA 2CXXA 2IOHA 4WKCA 4TT3G 4INZA 3HJFA 4D8UA 3VUEA 3BSWA 3ENVA 3WOVA 5L3FA 1JXAA 1EFVA 2NV2B 2OCYC 4B79A 3E8FA 3I34X 1R6BX 3B9PA 5JPIA 2BCGY 3ITDA 1XZMA 3BMQB 4F60A 5JSUA 1C1DA 3HM9A 4PY2A 2ZNIA 3NH6A 3M6UA 4MRMA 4YT2A 1I0HA 4L9RA 4MUNA 4HEJA 3U49A 1WZ2A 3OIWA 3WNZA 1MT0A 1N36B 2YMQA 1TEZA 2WLNA 2V8BA 4FLZA 4MQFB 1XZQA 1OTXA 4WN9A 4PSKA 3CYQA 1ABBA 1G20B 2LCIA 5AM5A 1Y5LA 3MGAA 2YUAA 2NTVA 3BD9A 4M9QA 4EY5A 1F48A 2BGGA 3AY7A 3L1HA 2EKBA 4MS4B 3T4XA 3DW3X 4IKPA 1UZMA 1DRWA 2VDNB 1ZCZA 5ILGA 2IJGX 5BWCA 1L7QA 4BYGA 2GEDA 5CX4A 3N75A 4XA8A 2JRCA 2A3RA 1BDHA 2J9YB 3W8NA 3NFYA 1IHUA 2AR0A 5GOTA 3HVKA 4XJTA 3ZVRA 4KGVA 4L6IA 3QEBZ 1KEUA 3IC9A 4U7FA 4J1TC 1TRHA 1LF0A 1AE1A 5DNCA 1GYRA 2C88A 4JZYA 3FI9A 2JGLA 5JJEB 1IWPB 1PFWA 1VPDA 2VCEA 5C5DA 2C2MA 4OHCA 4IHJA 5DEOA 3BHMA 5DYNA 5CFOA 3B1FA 3EPJA 5EIBC 5KOYA 2Y68A 3BGWA 1UBTS 2Y4TA 3JCUZ 3GFQA 3MCWA 1OLUA 3ZDBA 3M4XA 3UEOA 4L0DA 5CM2Z 2EWCA 4EBBA 1HGXA 2VZEA 4C4RA 5DWDA 3E83A 4XM2A 3VA7A 3I6MA 2XYVA 2HS3A 4JCOA 2OO5A 2D06A 4JU8A 1S72F 4IXTA 4CI9A 3W3AD 1MG5A 1NYRA 3A04A 1CZRA 3TFQA 3I8XA 1Y4MA 4YREA 2Z4RA 4Q6BA 4WK6A 1ADGA 1UDRA 4OQZA 3B1JA 1JFSA 3OBWA 5BSVA 3GGDA 4DQDA 2ZODA 3BWEA 1X59A 3RB8A 4WZAB 1X1TA 3M3DA 3KQNA 4XBFA 2BBSA 2IT1A 1XHZA 1W55A 2BCJQ 4I5SA 3K70B 4NZZA 2AXEA 3AFOA 2JFGA 4DB2A 1W44A 4CLHA 2RKWA 2OGZA 4L4XA 4Z7QB 3EY9A 5JDIC 4ML3A 2JGJA 4URHA 3LHSA 5H82A 1WB4A 1KI9A 2HCJB 2PM8A 3H2HA 1L4UA 3CF6R 3QMMA 2F43A 3HP1A 5DFAA 4QJBA 3UUEA 1CRWG 1JQEA 2ZAOA 2AXNA 4DG5A 1KOFA 3IEWA 5ESDA 4TKMA 1DEAA 4ISCA 3KZMA 1O5IA 5K2MA 3UA3A 5B7GA 2QMEA 4HT3B 4X60A 1O95C 3GMIA 5DXAA 2WJGA 4L3WA 4BWGA 3FBAA 1L7BA 3WJPA 5CYOA 2P6NA 3DE6X 2EX3A 1NI4B 2WWHA 3OJWA 1XRRA 2RAUA 4PELA 4NCXA 3WL3A 1LNZA 3ZNOA 2HX1A 2ZYGA 1NUTA 4EF4A 4S1NA 3QXSA 5K51A 2GLUA 1RXWA 5D8DA 2J85A 5IF9A 5KLVH 5BNFA 3MWEB 2QYOA 3GZTB 4JGSA 5DYIA 3LFUA 3V46A 2WVGA 4FSXA 3HHEA 5HTOA 1QGUA 1SC6A 3ND7A 2C9DA 1T8TA 4RENA 4HR7A 4G0OA 3ZWPA 3ECAA 4KN9S 1XTPA 3QVVA 5CDHA 2LCAA 4LOIA 3IP5A 1GZ6A 4DLKA 1T91A 3OLVA 2HNAA 3R23A 4ZDWA 3FAVB 3A4IA 1R0KA 4F96A 1V39A 4FDLA 5JCOC 1W59A 2AOUA 2H9IA 3IFSA 5DO9A 2GEKA 2CWWA 1V8ZA 5IDVA 1CF4A 1X80A 3U9TA 1D2DA 1T5DX 4QA9A 3MDSA 2BDEA 3OQMA 4QBGB 5DLYA 1JDZA 1Z7YA 3L7OA 2HU5A 3EASA 1KR2A 3F6EX 3RJ9A 5FTNA 3OT7A 3G7UA 4TLDA 1RJ9A 1G8SA 3GLFB 4LE2A 2ZSBA 2NNWB 2XNDG 3QEJA 5HCIA 4Q3AA 2AI3A 7YASA 4BQPA 5HDBB 4DJTA 2Q0QA 5AXAA 1U3VA 2H63A 1R0WA 1EIZA 1PGNA 5E6UB 2UZIR 1U8YA 4NJMA 2IV7A 2C0PA 3ZRWA 1PLKA 4EFKA 4DHEA 1AN0A 1KS9A 4HRVA 1EE9A 5D00A 2A1IA 1KIFA 1GPAA 4WA8A 3KAPA 1KJ9A 4V02A 4B3TO 2A0YA 2H4YA 4UBLA 4HNSA 5DI9A 3BE6A 1RXYA 3KPVA 1T1IA 3E8GA 1YA8A 3VOAA 2C5EA 5JAIA 4EI7A 4TRJA 3KJEA 4URYR 4GZ6A 4IQFA 4GPZA 2GTPA 2AF3C 2EBHX 3HB3B 4B7EA 2HT1A 1H0KA 2DPXA 4PPFA 3RHTA 2O2ZA 3BCCH 3HP4A 4EKEA 2I2DA 1U7DA 5TXGA 1SXJE 1PR2A 3F6YA 4RGBA 2XADA 1YVWA 3R5JA 4JKIA 2BM0A 1VRWA 1VCIA 4BU1A 3VTAA 3MERA 4OYLA 2Q69A 4AG6A 2ZI9A 4F4LA 1M2JA 1US8A 4MGKR 3JWPA 4BT6A 5EWRA 2WSBA 2LCFA 1RMQA 3C45A 2PU7A 4CQNA 1SZDA 3NEPX 1VQ8F 4RQUA 1D9ZA 2OPHA 2ZUWA 3ONEA 1U2QA 4KKVA 1F8FA 1XP8A 3IT0A 1JEQA 1JU9A 4HDAA 1SNYA 4C88A 4D80A 1NOJA 3L8DA 2YCLA 2Q7GA 2Z8YM 2CVFA 5KYWB 3L8EA 3TJZA 1SQFA 3EBOA 3TYXA 4XIFA 3C6YA 4DCVA 5LBUA 5FPOA 4ZGWA 4UARA 4F71A 5T8KC 1VL1A 1T0KB 1QWOA 1NXOA 4HDSB 3OY2A 2F8TA 3KQYA 2LBTA 1SZPA 1ADBA 1MIOA 2R7MA 5IYZF 1W5BA 4RNDB 2H9YA 5SYAA 5KBYA 1KQSU 2B4AA 3T3HA 2Z0AA 4OV6B 5H83A 4JI8O 7AT1A 5B1EA 2G67A 3CO0S 1AJEA 3ITEA 3QFSA 3OEEG 1JVSA 3C1TA 3ZN1A 3VR3D 3GUCA 1VYVA 2PTHA 1RHRA 1XG5A 2YIDA 1U7XA 3QKTA 3Q0EA 4JVLA 2GOYA 3BCHA 3KHKA 4FQ5A 1E7RA 2VTEA 4B47A 1XHEA 1JG7A 3ZGVA 2WWIA 4X93A 2X5NA 3DCJA 1I2MA 2XAJA 1OYYA 5LLTA 3V2IA 1NXQA 1DUVG 4LHEA 4D7TA 4H77A 1A32A 1PJLA 2IDMA 2KBFA 2XWJI 1PS0A 5AYVA 2CF6A 3VOBA 4OP1A 2I4NA 3C7TA 1X2BA 5A0VA 1MJFA 2QRPA 2EIMB 1ZK3A 2WEKA 2Q3JA 3MBMA 1T0JB 5BO5A 1XL4A 1ZCAA 3QLTA 1G18A 1CJCA 3FB7C 3L84A 1FSSA 4S05A 1YBAA 5DYWA 4QU0A 3LPNA 3DSRA 2G83A 1LQUA 4QWMA 4XIGS 3EUAA 3MCAA 2VNKA 3PB3A 1XRGA 2NM0A 3UBTA 5KB3A 2IPOA 1KKDA 1XA0A 1W9HA 1ZX1A 1IHXA 5AJVB 3MJCA 3S1AB 3D5QA 4TYNA 4RSRA 3O4RA 2QZ9A 4MVJE 4L5BA 3F6RA 4RHFA 3QNEA 5GM1A 3RC1A 5FWAA 4MUXA 3GRUA 2EHDA 3B8MA 3KT3A 2BBOA 1LSUA 2DJIA 3JAWB 4FOLA 5EINA 4DSUA 4A5SA 1K27A 1HUQA 4KG7A 2EJWA 1D2AA 1P5HA 1H8HA 1I6LA 3MJEA 1S4MA 4EBFA 2B1IA 3O8LA 3F5TA 1NVKA 1RZRA 1BAPA 3GT0A 4Q1BA 1S2GA 3Q8WA 3NHRA 2PBLA 4QPDA 3TX6A 1C8BA 3H99A 2WWXA 3I2KA 3RVJA 1JHUA 4N3CA 3VO1A 2JB9A 5GIOC 4IGFA 3UT6A 4R7GA 3JQCA 1TIKA 4UE3S 1CY0A 4M0UA 1XQYA 2ASVA 1E3QA 1VPWA 4RYLA 3OT4A 1T35A 2E0IA 3RDPA 3DKVA 2R6JA 4KQ9A 2E82A 2E5LB 2I2FA 1U9IC 2JK1A 1GQRA 3FNHA 3KTDA 3ZV7A 5DIFA 4GMXA 2VWGA 1SRRA 4ZZIA 4I1YA 1P77A 4AROA 2Y9MB 5SICE 2ESRA 3G5MA 4KTVE 5JNRA 2FZLA 1JXQA 3A0RA 1AF7A 1VQLV 4EG4A 2PS9A 3BBLA 4CWAA 4LG1A 3CXCU 4QWWA 4Q9AA 5FJ4C 1URFA 4A6EA 3I76A 4TTTS 5D85A 4X3OA 3W6ZA 3HKCA 1X6VA 3MQFA 1SK9A 1K8AW 3N59A 2JCGA 2F55A 2BZGA 1Q7CA 2JCXA 4JELA 6GPBA 1H9CA 2PDAA 3FCCA 5HRUA 1IAVA 1IYZA 1VOTA 3AGQA 3DDWA 3O73A 4RFVA 4LWPA 1E9CA 2UU9B 2HTFA 1JE0A 3EOBI 3KVVA 1UBGA 5KAPA 4BB9A 3C8DA 2FUG1 1R4NB 1A8IA 5AT1A 5T6BA 4MCJA 4Y1GA 3ZU2A 1K2VN 1M75A 4EHHA 4J16A 2Q4RA 2CBXA 3REOA 5JNUA 4IGIA 2KX7A 1RC1A 4D8TA 4JI8B 5G3YA 1DKLA 1OIXA 4AQ7A 1VZ2A 1U0OC 1YHNA 3IS3A 1NUQA 2F90A 5PGMA 5DF1A 3UMFA 4KITB 2Y69C 1JPXA 1EFRD 4PC7A 2WMNB 3KUDA 5ES4B 4ZOBA 1AKTA 4IRUB 1WXEA 3EPLA 1FJXA 3W5VA 2F9FA 3HCNA 3PTAA 3PUXA 4ZOAA 5EZYB 3U7RA 3NEYA 1V5WA 3GOQA 3LVQE 2P7HA 1D3AA 1P1FA 4YXWA 2DT4A 2ODWA 1OT5A 4HDOB 2OWEA 4M53A 1JE1A 4OJMX 3MXTA 5IFKA 4HDMA 1K5PA 5T5QA 3DD1A 1S76D 3IIJA 1LV7A 2XWPA 4XIJA 5P21A 3CNQS 3L04A 3TXQA 4EMSA 4C8GA 2OBLA 2IS6A 2RHLA 1ZD9A 4BNYA 2HWKA 2JA2A 2X0FA 3NRCA 5ADUS 2YTZA 3T1VA 1NLMA 5IJ0A 1TYCA 1XU9A 4RTPA 2WSMA 4D79A 3S2EA 1XK6A 2QLJA 1R66A 4PE5B 3FMGA 4GMDA 4V0NA 3GUHA 3D2CA 3OMIB 2WLHA 3WNQA 1E7SA 1Z28A 3D1JA 5HUQA 3EOZA 5DTIA 3RHFA 3KAKA 5BV8A 5EJ8A 3VTZA 4IG9A 1OI7A 1DKPA 4CCSA 2Z5VA 4RORA 1ZSNA 3IAAA 1VHAA 3ABZA 3IAS6 1Y1RA 1AT1A 1YEWA 3N5KA 3WFJA 5AI5A 3QXHA 1S02A 3CWCA 4DA6A 4IRMA 5D7BA 4H35A 2UYKA 3T7SA 4UZSA 2DYSC 1VA4A 3F3YA 1D0IA 1FUEA 3CCBA 4CIBA 4GYKA 5D7NA 2RJNA 3X2QB 2GNAA 2HJWA 3S55A 2QTSA 3IP3A 3NT2A 3EVTA 3QUAA 2YDYA 3UC5A 1EB8A 2FYTA 1YDXA 4B5CA 2PLFA 5LXTA 3TIGA 1G6Q1 2G6TA 1BVRA 1VL6A 2ZDHA 2XTAA 5FAKA 1B6GA 1EZ4A 2WM8A 5FTWA 2ZKLA 4B4OA 2EGGA 1GRQA 3VI4B 1H1LB 2QX9A 2XMDA 3HKBA 4AYTA 3K8QA 4EEQA 1V6CA 1MOQA 4DM7A 5K1XA 4UTXA 4ZHSA 2DCMA 2BMWA 4MPJA 2X40A 1CR0A 3SIUA 1MB2A 2YJ4A 2QTBA 5AXBA 2PX2A 1OLXA 5ALHA 2MYPA 5IDYA 1XZAA 4PSDA 3LG2A 1CUAA 1EWYA 4LVCA 5HP8A 3MWGA 1QF6A 4RYDA 1QKIA 1UOQA 1BQ4A 4RLFA 3TSYA 1CLEA 3KKNA 1NJSA 2G3YA 3HJBA 2P2LA 1V41E 3S0HA 2AFHB 4BOYA 5ENZA 2Q3BA 4RHEA 1J20A 4QPNA 1OF1A 4WXEA 3JYNA 4GI7A 1E3WB 2HA4A 621PA 4NE7A 1A04A 4KDFA 3E7XA 3BB1A 3KQTA 4MAFA 3FUVA 1HBJA 2QP9X 2VUIB 3EF0A 4BP3A 3TSAA 3EQ9A 4JP2A 3TNLA 1GNVA 3KL2A 3QFHA 5B6IA 1CTQA 4UAJA 4FFBB 1QRDA 2E7ZA 2GUWA 3L18A 4PR3A 4ZK7A 1YS6A 1XXHB 5HZGA 1ZJJA 2SKCA 1R6VA 3AF2A 2RBEA 4IIDA 3O3MB 5KYUB 1LF5A 5COBA 3ND6A 2GETA 1I3LA 1Y9AA 3UOGA 1YQ9A 4MI9A 4GVLA 4OA8A 2EHJA 3FY4A 2H4FA 1YJ9F 1XTVA 4WEOA 4BU0A 1ESZA 2LCQA 1I2CA 5G0UA 4YJFB 3WLEA 1NXVA 5CR9A 4M54A 2IOFA 2RG7A 1GFSA 3CVWA 3ZXXA 2CGEA 3DBHB 1GFWA 5KPJA 3N4ZA 3WVNA 4W1RA 4RABA 4RTMA 1EIWA 4UBNA 1MD9A 1Q6YA 3DT8A 2QF7A 4P34A 5HFLA 1CY6A 5HIKA 1RXUA 3DWFA 4M98A 2P40A 2NYRA 1RYDA 1CXZA 1I13A 1CUXA 3W34A 3W5DA 1OHHA 2VAMA 2X22A 3VU0A 2HVJC 3BGSA 4W5HA 1IHPA 3HZOA 5AHOA 5C80A 2HDOA 2YBDA 1K63A 4MWSA 4LYHA 1PWEA 1FXWA 2WSIA 4BEWA 1P81A 2R5FA 4WWHA 4TKLA 2AIZP 3VYUB 1RYMA 3ZHOA 1R15A 1FZTA 4CLOA 1Y1SA 1FRFS 2JJ1G 3PEVA 4ABMA 4AG3A 2AC4A 1J2RA 5G4UC 3U37A 1JT9A 4DRXA 2ZAUA 1DFIA 3LXXA 2NUPB 4RVFA 2EIKB 4WV3A 1M90H 4LF8O 4XTRA 5A4FS 2EDCA 2WUFA 2W2PA 3ND5A 3N5CA 2B3TA 3JRWA 3ZMUA 1K08A 2GHTA 3GCDA 1Q84A 1QOPB 2OT5A 1WMFA 1Z5NA 3KSRA 2ZIUB 1Z15A 4RPCA 1FXHA 4Q05A 4YXFA 1HT1E 3AL2A 4AZ3A 2EEPA 3FWPA 1X2EA 1O9GA 3AV0B 3BAFA 3EGWA 3RH0A 3WMGA 2PRJA 4C0BA 4H4EA 2UXBO 2P7IA 3C3WA 2Q1WA 1RKBA 1X70A 4ZOLB 3OA0A 4FHDA 4U7NA 4HP8A 4EITA 4CIAA 1DUSA 1P4RA 1MPTA 2AFIE 4ND6A 3U16A 2N74A 3KYCA 3UANA 3G9TA 5DKFA 4UE6A 5LQUA 4Q15A 1P31A 4JBWA 1F2UB 4PZAA 3ABLB 1WEKA 4MUEA 4ENRA 4QHYA 4UULA 5AM0A 5EBLC 3HCRA 2BKVA 4YT8A 2N9UA 4HADA 1Q6ZA 3DP9A 5KHLB 2C2WA 2LVBA 3ETDA 1XP5A 2IF0A 1K3UB 1SZCA 2R66A 5JISA 2IZ7A 1BE1A 3SDSA 4DLAA 3G02A 2F7SA 2RBGA 3GHZA 4DMRA 3BQMB 4PIPA 1T0IA 4Q1CA 1BEUB 2ZRMA 5C1OA 3E7DA 4JUCA 2VSYA 3IULA 3DXYA 4L9AA 3V4DA 1M93A 1YJ8A 3WYDA 3ASNB 1O0CA 1H8EA 5J59A 4MYRA 1ZAUA 3A6LA 5FUBA 4UB6Z 2P68A 4P3PA 2A1TR 4G26A 5DHFA 5HCNA 3B12A 1Y42X 4FI3F 1TO1E 1MX3A 2FRXA 1J21A 4LVNA 4PEVA 4F2HA 1NWCA 1UDBA 5EJGA 4X3MA 3GN2A 4J7UA 3VNVA 1YMQA 4Q20A 3OWXA 2C4MA 2DT5A 4YHBA 2I8LA 3FFXA 1VDZA 3TGLA 4BLRA 1LPBB 2R48A 4KACA 4TROA 1K4CC 4P0TA 4WCFA 3DTVD 5FNVA 1RHQA 3V55A 4CQMA 3Q1KA 3PUHA 2IXTA 4E2YA 3B5IA 5FWYB 3ZDAA 3H9JA 5WRFA 1QIMA 4L8GA 3PRHA 2OZVA 5EJ4A 2XT6A 5L4NA 2FPLA 5LHHA 1Y98A 5I4BA 3HYSA 3S28A 4QE3A 2GGSA 3MMZA 2PMKA 3EIXA 1MTZA 3K0KA 4NUTA 2JF0A 5JATA 3FPSA 1N2SA 2ONJA 4D97A 5FA5A 1N3IA 5EHGA 4OHOA 4YDSA 5LVAA 1CHNA 1GAJA 2BE9A 5ALOA 4NZMA 5AJUA 3ZOKA 1XNJA 1EJ2A 4F06A 3KSAC 2G0AA 3WYNA 3SLGA 1NC3A 3KXPA 4KP4A 4X3CA 1QBKC 2E87A 5BQ5A 1ZK2A 4DQVA 5HM6A 1XMQO 2A7XA 4QECA 4KXWA 4QFDA 5EJ9A 1WXFA 5BSEA 3KQKA 4C82A 2QIOA 2QYSA 1GTOA 2C00A 2PGAA 4WHMA 4S1WA 2FUNB 2JJMA 4RF5A 1S2IA 1A1VA 1W34A 1EDDA 4BNVA 3M83A 3OWOA 3NOXA 3SPJA 3PE3A 1GZ5A 1U2ZA 3T3EA 3WYFA 4YQEA 3RO7A 4ZDKA 3D7SA 2DOSA 5AW0A 1BU5A 1QYVA 4LF8B 2VPTA 1KDZA 4J6FA 5FPSA 2HUPA 5IM5A 1XVLA 1ISPA 4AI6A 3BJIC 3C4QA 9ATCA 3FKSD 4R01A 1W4CA 5GJBA 3NUGA 2V7EA 3DMDA 3RVPA 3X1YA 4Q00A 2UXBB 1J09A 3A1VA 4BE7B 4GL4A 2GHQA 4F5DA 2CTPA 3HZHA 2W6QA 5AJYA 4O4IF 4RVOA 2PNJA 5CVEA 3T1CA 4D44A 1QGOA 4QGGA 4RJJA 3ADBA 4I1RA 4MW6A 5T67A 5JSHA 4PGGA 3RWRD 4YFYA 2YHIA 4QEZA 1FYEA 1AURA 4E03A 2QVZX 4RTLA 3GA0A 1EPUA 3L75H 1TVCA 4BZZA 4BV8A 4ZV7A 3UYLA 3WNDA 4ZMRA 1W36D 3UFXB 4HX9A 1QE3A 5EZQA 2L82A 3CQ9A 1K75A 4ZK6A 2K9PA 1XFDA 3WRVA 2RHRA 4RKFA 4F6RB 4G8CA 3KU4A 3WMRA 2WWYA 4F9TA 3S2ZA 2PA0A 4OAQA 1DMSA 2ZNJA 3DYBA 2IPMA 4B9AA 5FAXA 4U7DA 4GBMA 3U0ZA 4HVTA 3HGTA 2ZTLA 5IK2A 1COMA 3NVKI 4HFNA 4R40B 3CCVV 4AG5A 4K88A 3INTA 3AEZA 4ZKIA 4NCIA 2JHCA 4I3HA 1NTMH 1KOLA 4FX5A 3PLNA 3WLRA 4ZJUA 3UWKA 1S2DA 5FDFA 2XCIA 3HB1A 3RUAA 1Y6ZA 4QYTA 3IA2A 3I61A 3ZR4B 3BIWA 4N8SA 1SKVA 1QR2A 5AVSA 5A9RA 4FYMA 3KB8A 4N3NA 2HU2A 1YE8A 4JR1A 4L6CA 3Q3HA 3L1IA 3U4AA 2DHQA 1JQDA 4YV2A 2N04A 1VQ6V 4R2HA 1K7YA 3OZBA 2JHFA 5TNXA 1VMDA 4ZC8A 3QWAA 4Q6GA 1ZJ4A 3LWPC 1Q7YH 3R2JA 1DPFA 1QP7A 5ITZA 1KP2A 2D2VA 3B9RA 4G0NA 1V9SA 1E64A 1VQKF 4JI1O 2ZQMA 5CK5A 4NOMA 1WV1A 2XVYA 2HMUA 2PK3A 2OXTA 5EG5A 4A10A 3L7JA 4B48A 3U1VA 4MLDA 3OI7A 4Z2YA 3ITKA 5AVRA 1C7RA 3BJEA 4LSMA 4LGYA 4LV6A 4ZK2A 3EFBA 5H8WA 5B1DA 1G1XB 6ADHA 2B0JA 4PFJA 3YASA 1HMYA 5CCXA 4UVAA 4J9YB 1M8PA 2BV3A 3CXCF 2HMWA 4LKOA 1SOMA 1LX7A 2A14A 1NU1H 4YJGB 1GLGA 3E35A 3PPXA 1YU6A 1T9ZA 2VSFA 3EIEA 3LDHA 3HNOA 1EEXB 4G5HA 4K6HA 3W4KA 2O19A 1W19A 3WQHA 3NHSA 4CMKA 1WY7A 3ZDZB 4ALNA 4D4IA 5THQA 3BXEA 3H9CA 4WXHA 3Q6NA 4DCGA 2GBOA 3GDHA 3FCOA 2X0RA 4F6EA 1Z7GA 3MD9A 5HF5A 2ON6A 3AMVA 1JHAA 3A31A 4Q3OA 4ACAA 3PVZA 1NHWA 2XTMA 4A8JB 3KOUA 4EA9A 5K0BA 1UMBA 4E7PA 3BX1A 3IDAA 4U6SA 4QLOA 4S04A 3VR6D 4Q1FA 2HJSA 5B58C 3IP7A 3ZGXA 5C3UA 1QQBA 3FNEA 3AF5A 1IQRA 1KNQA 4V1CI 1KKLA 1SN7A 1D4AA 4O2LA 4PSAA 3K03A 2A1UA 4QO7A 4H44B 5EYPA 2IHVA 4J4HA 2P7TC 4IZ6A 3CZRA 1GT6A 1IULA 5KA6A 3E3MA 1TF5A 1NJIW 2F1OA 3OG9A 3H5RA 2XAAA 1PKXA 3ZV6A 3GV0A 1PV4A 4RLSA 4JWKA 3W9YA 2P6JA 2OCDA 1MPXA 1BRMA 1CZLA 2CFCA 2A0WA 3EVEA 1YKSA 2I1QA 1ZSPA 1KNKA 1DC4A 2D8MA 2GRAA 4LS3A 5LPNA 4Y9UA 4O4HA 4B09A 2IDZA 4C7XA 1KU6A 1IV4A 3OX3A 4FGKA 3UG6A 4O2BF 1T1EA 4E88A 5CBPA 1P0CA 3GRFA 1RQGA 3M6AA 3JRXA 2P5TB 1A8HA 1XWFA 3OCJA 4N65A 3WJ7A 2GBCA 2F66C 5E4YA 2JHAA 4TKZA 4DCNA 1TNDA 1NXTA 3NIBA 3ETGA 2D1QA 4QDXA 3IJRA 1CU1A 3EVNA 3N2KB 3ROZA 3R44A 1C14A 3K9LA 5C8YF 4DM4A 4MVUA 1PW5A 3PFNA 2F9ZC 5LQAA 4CFYA 3FVRA 4K87A 2NSHA 3IT2A 6AT1A 1MDFA 2YY7A 2AN5A 3R09A 3H9QA 3VYSB 5K99A 4PBSA 1EUDA 2DU8A 1UK6A 4B4KA 4H3VA 3IOCA 2HEGA 1E2JA 5AICA 4EM6A 1GR0A 2SHKA 1D09A 1NVTA 2HBRA 3Q2IA 3WLIA 5ILOA 3L0DA 1XNGA 3K72B 2GEVA 1ZNWA 2Y1LA 2W43A 1JLMA 4W4LA 2DPGA 4UNPA 4RVNA 1VE1A 4DK1A 2ZRLA 5KNCD 5I9SA 5HIAA 1ICEA 3QW4B 1AKRA 4LX0A 3ND9A 4BO4A 5A9TA