4O2BB

Tubulin-colchicine complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
total genus 168
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2bB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2bB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2bB01
5LOVB 4I55B 4EI7A 2GVIA 4ZI7A 3RYFB 1TUBA 5LA6A 3UT5B 5JQGB 5LYJB 1TVKB 5EZYA 4U39A 3WGKA 5LXTB 4XCQA 4DRXB 3E22A 3JATB 4O4HB 3ZBQA 4X1YA 3M89A 4O2BA 3HKDB 4EB6B 2BTOA 5JCOA 5LOVA 4I55A 4B45A 3RYFA 3UT5A 5JQGA 5LYJA 1TVKA 2VXYA 5LXTA 1W59A 4DRXA 4O4HA 3JATA 2XKAA 5IJ9B 1W5EA 5J2TB 3HKDA 4ZOLB 4EB6A 4U3JB 3N2GB 2XKBA 1JFFB 5KX5B 5M7EA 1FFXB 3JAKA 3WGNA 4KWEA 4B46A 5IJ9A 4F6RB 1RQ2A 2Q1YA 5ITZB 5J2TA 1RLUA 3HKBB 4ZOLA 4U3JA 3VPAA 3N2GA 1JFFA 5EYPB 3RYHA 1OFUA 5KX5A 3RB8A 1FFXA 4EI9A 1FSZA 2Q1XA 5LP6B 4TUYB 3C8LA 4YJ2B 3JAKB 4O2AB 5KMGB 3VOAA 4F6RA 5JCOC 3VO8A 4TV8B 4EI8A 5ITZA 4X1KB 3HKBA 4M8IA 3WGJA 4YJ3B 5EYPA 3WGMA 3ZIDA 4O4LB 1W581 2RHHA 3VOBA 5LP6A 3RYHB 4TUYA 5EIBC 4YJ2A 5C8YB 4O2AA 4X20B 5KMGA 5LP6C 4TV8A 5CA0B 4X1KA 3HKEB 4YJ3A 5IJ0B 4O4LA 5JH7A 3M8KA 3V3TA 1Z5WA 5C8YA 5GONB 3ZBPA 4X20A 3JALB 3R4VA 4FFBB 3JARB 5CA0A 5FNVB 3JASB 2RHJA 4WBNB 4O4JB 3HKEA 4HNAA 4I4TB 4IHJB 5IJ0A 4LNUB 4DXDA 3HKCB 4O4IB 3CB2A 3RYCB 5JH7B 4ZHQA 5GONA 3JALA 1W5FA 4FFBA 4I50B 3JARA 5MN5A 5FNVA 3JASA 3N2KB 5JVDB 4O4JA 4WBNA 5BMVB 2VAPA 1SA0B 5CA1A 3RYIB 2RHLA 4I4TA 4IHJA 4IIJA 4LNUA 3HKCA 4O4IA 2R6R1 4TV9B 5EIBD 5MN6A 4X1IB 4HNAB 3RYCA 5MN4A 2RHOA 5CB4B 4I50A 2BTQB 3WGLA 3N2KA 5JVDA 5IYZB 4ZHQB 5BMVA 1SA0A 3JAWB 3RYIA 5J2UB 1RQ7A 4ZI7B 2VAMA 2VAWA 1TUBB 5LA6B 4TV9A 5CA1B 1Z5VA 5EZYB 4X1IA 4IIJB 3E22B 5CB4A 4X1YB 1W5AA 2BTQA 2R751 4O2BB 4E6EA 3VO9A 5IYZA 1W5BA 3JAWA 5J2UA
chains in the Genus database with same CATH superfamily
5B58C 1CNFA 3HPRA 3FRJA 2VP0A 5HOQA 1XMQB 3WBJA 1YZUA 5C35A 2Z6QA 2PVPA 1OI2A 2NZUG 3CB4A 3OTWA 3A2LA 3LKZA 1YH3A 1TT5A 4KBFA 4Z1MA 4IG4A 4IIFA 5DNAA 1F9AA 4EY7A 3THWB 4KHPO 3JQ9C 2G04A 4L08A 1NSTA 1RHQA 1OX4B 3UQYS 3ELWA 1USVA 2WFZA 1RKBA 3TYXA 5LM3A 5ALOA 3MC1A 2W6JG 2UYNA 1H6CA 1WSAA 2D0DA 4LG1A 1T2EA 5JCPA 1OASA 3VV2A 3ZV6A 5J5VA 3ORSA 4E32A 1IY1A 1JECA 3BHMA 1V95A 4XPZA 1TEXA 2IKQA 2RJZA 3UMMA 5H9WA 4R50A 4X65B 2P0AA 5KTPA 3BYZA 3QU2A 2N47A 1W75A 1Y8QB 3KIZA 2Y1DA 2F1JA 1EZVH 3S0HA 3GZTB 3DDNA 5JSUA 2E55A 4KO1S 1CQXA 2HK6A 5DNDA 4BJ1A 3Q40A 1QG4A 1ST2A 1XFAA 2UXCB 2WG1A 3VISA 2VL7A 4DTIA 3RH0A 4B47A 1YUBA 5CVTA 3ECCA 1YONA 3OX2A 1VHDA 3FF4A 4CH4A 2PQ2A 2YW9A 3DQPA 3ZEAA 2P6UA 1PUJA 2WLLA 3ZJTA 1S5HC 2I2FA 4MVJG 3HKBB 5DX8A 3OBYA 4NULA 4BIOA 1XCMA 4NFHA 4UZEA 3LFHA 5HWSA 3F9RA 5EEHA 3PGJA 1ODEA 5A5VA 1RC8A 1TM5E 4MARA 4B17A 2W2KA 1H66A 1BQ3A 3N0TA 4E08A 1TO2E 2IODA 3ZDQA 4FKZA 1KL7A 13PKA 2H1OA 1M8KA 4AJEA 3V4ZA 2AEEA 1E6MA 2LIPA 4FLWA 1ESMA 3W7BA 1AI5A 2V0GA 1NJFA 3SXPA 1QR2A 2FPPB 3RADC 3MD9A 2H2AA 5DNCA 1Q6HA 1UPUA 2YZKA 4ZVTA 4YFVA 2HO5A 4R16A 4BTLA 2XNDG 1KK2A 2OECA 4RQTA 3RS8A 1FXHA 1E60A 2GM3A 3L6OO 1QOPB 4H9GA 3CZPA 2Z08A 2FWMX 3R0ZA 2XZOA 1MG1A 2O06A 4DJDC 2CZGA 5JJ5A 3D3EA 5DHAA 5AW8A 1J2YA 3FOCA 1W19A 1JKIA 4A8JC 3Q41A 3IJ4A 5A2GA 5BN1A 1WXQA 3W5CA 3ZDXB 3TR6A 3CEMA 2AHZA 4WN3A 4OK6A 1Z5GA 3B09A 1TD9A 3DL7A 1G7SA 1SUDA 3MRVA 1BROA 5F98A 1VF5B 5IP5A 4I8IA 3A0RB 4NOMA 1E3LA 2C97A 2OP0A 1NRIA 4MYSA 3BB3A 1Z4QA 4HQOA 1GM9A 5HJ7A 4QNHB 1S9DA 3NHSA 1EXMA 3FOZA 3K04A 1MTZA 1AI6A 3QNMA 2ACWA 1TE2A 2DBVO 3ZWPA 3IQGX 3WDSA 4WLNA 3RM3A 1G38A 1M56B 2W48A 3AJ9A 1ACLA 1M6VB 1UP6A 2NZXA 5HF8A 3EGVA 5CX1B 3PDIA 4CLOB 3RBZA 4JC4A 5JDCC 1A88A 3W05A 1R0ZA 3OP4A 3DLCA 4LMRA 1D9ZA 2GOYA 4Z0HO 5C7OO 4XVHA 2VRNA 5C31A 1JEEA 2FPRA 2QWPB 5ALQA 2Y9PB 4F71A 4L02A 2Y69C 1MHPA 3UC5A 3Q5EA 2PSFA 3ILSA 5AK6A 1X7ZA 1V43A 1V35A 3MAJA 4AY2A 3ZVKA 2CTRA 3IQWA 2JS3A 1IB6A 4RESA 3TEMA 2PNFA 3SDZA 5IT9M 4LKOA 4U7HA 4OYHA 1QH1A 4U63A 4GC5A 4PAWA 2O54A 2X7HA 4RDHA 2WWFA 4NV0A 3WZLA 4XX1A 5U4QA 5C53B 1QU9A 1EGAA 4Z4CA 1FPOA 5HMMA 1JT9A 1IJBA 5ALWA 3K0HA 3AVQA 3IEIA 4V3CA 1A76A 2GZSA 2ZE8A 1HFEL 1CY4A 3GJ5A 3PUKA 3VDNB 2FPGA 3O03A 1I0ZA 1XQ6A 5B3SC 2DUJA 2R8YA 3M70A 2WJPA 4ECAA 1XRLA 4LQCA 1PPJH 3KJXA 2H1WA 4YGXB 4FLVA 1RHJA 1U04A 1P3JA 2I9PA 4P9NA 4Q1CA 5CLQA 5FR2A 4LECA 5C8XA 1TECE 1VJ0A 1KI3A 2PS0A 1JLRA 5EHQA 2G5GX 1IMJA 7ADHA 1LY1A 1EH5A 1K97A 2Z57A 1TFUA 4Z2YA 1OV6A 2FMXA 1PFWA 2ZXEA 2QJ1A 1KQGA 1OHHA 5FPRA 1M6HA 4PSCA 1NBMD 4A1OA 3H9GA 4DCCA 1HT0A 3GCZA 4N8SA 3QVGB 3ZVMA 4BLTA 1BGXT 5HFJA 2D5IA 4FMCB 2G28A 1A9OA 4MS4A 2A9FA 4J3JA 4FOTA 3MWFA 4B2IA 2EX3A 2B21A 1MU0A 2A78A 3KQTA 4Q00A 1C1HA 4UVBA 2FW9A 5JNUA 4ZIRA 1ODTC 3WQSB 3FVVA 2HRQA 1II8A 2C84A 4P81A 1WXHA 3LDEA 5JMWA 1HBJA 3GT4A 1QBGA 3OFSA 1ZCJA 4C7XA 4YV2A 3CRMA 4TSFA 2ZIOA 3R6GA 1G1XB 3CMAF 3GFOA 5IM4F 1GU0A 2WNIA 1RAHA 3ON1A 4LH6A 1E5TA 3HVIA 1R5OA 4N0DA 4KVZA 2JLZA 1ILWA 2XT0A 3KSUA 3I04A 5EWJA 4JZ2A 1PS8A 1KOGA 1N0UA 4KFMA 4O08A 4Y1RA 2GCGA 1XLUA 5EMKA 4ZOAA 4ASUA 3OX3A 2R8PA 5KWJA 5EJGA 2QQEA 3KWLA 3GZ4A 2FW6A 3DEZA 5CMLA 4Z6KA 2Y71A 1E6KA 3QVLA 2VJCA 4G5XA 2X0JA 1R3DA 1H2SB 4TLAA 2ZDQA 1MJNA 1KDPA 5E7JA 3THXB 3SYKA 4KDRA 4FD2A 1HOTA 1MAVA 2J41A 4G4JA 2X3YA 4O4LF 3AHHA 3WLHA 1PFQA 4RU1A 5C37A 4KNVA 2HVKC 1QKIA 4ICGA 4JV5O 1MAUA 3ZPXA 2VSQA 3Q0EA 4DLKA 1A9XA 2C2XA 1O0CA 4DA7A 3PQ2A 4YAKA 4RHAA 2NR5A 1G6Q1 5K4AA 3WB9A 1Z0AA 1QC5A 3ZP7A 3WS7A 5FPQA 1GHTA 1RWXA 2WWVD 4MUNA 4KFTA 1JN0A 4BNKA 4RVUA 2EIJB 3TH5A 5IPFA 4MSWC 5DCYA 2DQSA 4XWTA 1SXJB 2O3QA 1I8TA 1M1UA 4IH9A 4BFUA 5FAXA 3ND9A 1L8QA 1HDEA 1UJCA 5A4MS 3D3QA 1X52A 4XJVA 4ZT2A 2ZZNA 1MHTA 5LQSA 2H5IA 4K6GA 2Y1LA 1DAOA 2X2OA 4HWGA 1BH2A 1U7HA 4OJKA 3I9NA 3DLIA 3T3IA 2PUBA 5TRTA 4LFCB 3KWJA 2WNSA 3FB1A 5CA0F 5DHSA 1AQUA 5H3CA 1KYIA 3H5OA 2D62A 3WKDA 2IUSA 5HY4A 2UUAO 3QEMB 2UVDA 3WLPA 4E4RA 4KXLA 3PC2A 2XBMA 1ISIA 1GR0A 2ZRBA 3VV3A 1GNPA 3P0RA 5JSQA 2QR5A 5JVDA 3AM4A 3TLKA 1L5WA 1T0KB 4TT8A 3CCJF 2JNWA 1LDEA 2FP4B 4NNPA 2ZF8A 2C03A 2C9MA 1AR1B 4JBYA 3ABTA 4DCGA 4Y9TA 3GAMA 4DRXA 5C7IO 2C5GA 3D3NA 5B1OA 1HEYA 1KDYA 3SMQA 4DNPA 2BPOA 2JZOA 1N4CA 2GV9A 1ZN9A 3CTMA 1DTSA 3FFQA 3RIXA 1Z4PX 3IJPA 1HKUA 4C78A 1T4CA 3GJSA 1I1NA 1K4MA 4R2MA 2YIDA 3PFFA 4TS9A 5DBGA 3Q88A 3FB8C 1MVNA 1Z6GA 2J0EA 2ODTX 2ZRDA 1YTUA 2XXAA 1NW6A 2UUPA 1WV1A 4NBWA 4RVSA 3CF4G 1PWXA 3P45A 2C9ZA 4JF3A 3QIVA 3SGIA 4M4SA 2HGSA 2XHZA 4FFVA 1H2KA 5GGXA 5IVKA 2XWJI 2WPDD 2FEMA 2O0HA 5I9TA 3LUBA 3MJTA 4F6EA 1WU8A 3DM5A 4G1CA 2DWEC 1QRTA 4DUYB 1HC7A 4E0BA 2E2WA 3OJ0A 3I42A 2WSIA 3NTRA 1C0EA 4WADA 2UZIR 4LOAA 1UPBA 2Q69A 3EFEA 3RS0A 1E7RA 3UFXA 2PR2A 5JNWA 3J7AR 3AP1A 4MKZA 1MT3A 3WL3A 3TKAA 3ISVA 3E18A 2AMLA 2CFIA 2XCTB 4P84A 2HX0A 4JYMA 4M7PA 2IP2A 3DDOA 2RFLA 4G8JA 3ROPA 5TX7A 1T1EA 1US8A 1SM4A 4P54A 3OU6A 1LQTA 4EG4A 3KEQA 1X1SA 2CHUA 2JLSA 1V11A 3BEHA 1TF5A 4D5EA 2J6IA 3LA8A 4DGQA 2OZEA 5IAGA 2Z9CA 4OLHA 4NJMA 2DQYA 3IDSA 5A4AA 4PYLA 4HFJA 3CA8A 4KX3A 3K72B 4NQ3A 3DXRA 3OOEA 3Q1KA 5LC1A 2HJ9A 2LW1A 5JYDA 4O8ZA 3ZDZB 1O8BA 2YRWA 2VTKA 3DTYA 3F2VA 1M1KW 2HCFA 1XIVA 4QBTA 3UWMA 4QXRA 4GD3Q 3CEJA 3KPYA 1KMIY 2W2XA 3DZBA 5E2AA 5HS4A 2WYUA 1BEEA 1V16A 2HXYA 3SKYA 4LYAA 2FJ0A 5DYIA 4HFMA 3OPQA 4G01B 5L3GA 4J76A 1N6PA 5HFMA 4JLUA 3ICVA 5TQJA 5JJCA 1KZYC 2BVNA 1FSSA 2WDZA 2KYRA 1FPMA 5FBHA 1M67A 2I6TA 1Y76B 2CE7A 5BV7A 2WR8A 4TMVA 4JLBA 1H2HA 5BOVA 3E7DA 3W6UA 1L6IA 1FNSA 3TB6A 2DLCX 4OQLA 2GCNA 1V25A 4WKOA 2IBMA 5IM5A 3HGTA 2OCHA 3DFKA 4Q9KA 1FTGA 1MEEA 4DV3B 3OLWA 4B8YA 1RWOA 1QVRA 4TRNA 3EIQA 4OP2A 3WFVA 3LWPC 2YL2A 1V39A 1N8TA 4TLMB 2QLBA 3GUYA 2P9BA 4XBFA 1FSZA 2WFAA 2FSUA 2FUKA 2FW8A 4PBRA 5K7SA 2KSDA 3STVA 2EC5A 2W5UA 4B85A 3WE7A 4BBPA 4J4HA 2X6RA 4CU5A 1QSGA 2W8BC 2AF4C 5DMHA 5AT1A 4HADA 3VZDA 2YCBA 2CLEB 4MJ3A 2PX4A 4KQ6A 1XTIA 3MBMA 3ENWA 4U0JA 7ABPA 4HLUC 3Q9NA 3E4DA 5FBLB 5TS2A 3QPVA 3V4PB 4D9MA 3R41A 4K81B 1ZVJA 1PTJC 4RHTA 2C3MA 4UVCA 5LUAA 5ARDA 5JXJA 4UUMA 4E03A 4PLZA 4GKKO 2CL7X 1Z62A 3GLIE 2UXBO 1HQKA 1N8SA 1REQB 4QYXA 1NS1A 3G7SA 3N0XA 5A4JA 1C14A 1HDJA 4JYYA 1PFKA 1RRCA 4IDQA 2GPYA 5CM8B 4XIIA 4BN0A 1T2CA 4RVOA 3NBUA 5BZBA 2WHQA 1AQLA 1K3FA 4TYMA 4CEIB 1DCTA 3I8XA 4W5WA 1AR4A 4G09A 4RY9A 1HSOA 3HSKA 4WQMA 5E95A 1VQPV 4WY2A 2ZE7A 3K1YA 3F6YA 4ZALA 5K05A 1HMYA 2GH1A 4TS4A 5HFAA 2C7VA 3M0EA 4NYJQ 3WHIA 2ZUWA 1PUXA 4ACAA 5HIMA 2DPGA 3TPCA 1XQ1A 2I34A 2VCHA 4JQZA 2ONYA 2NP7A 1IFXA 3H2IA 2HO4A 4YTEA 4AKGA 1PJAA 4GXNA 9ABPA 1P1RA 2QJWA 4TL7A 1H8EG 4CGYA 4N1AA 3BD9A 3CXUA 4KR6A 1M33A 1J70A 5FWDA 4K9PA 2W43A 4LXQA 2VJOA 3R8FA 3WNVA 1VG9B 2HU2A 4AT1A 2I6FA 3GDFA 2Q50A 4IL5A 1JZSA 2BAGA 4PWYA 1T29A 3I73A 3EXIA 3IR9A 4KVFA 1YIOA 4V2IA 3MB8A 3G1UA 1IN5A 2DG2A 2I03A 2AW5A 2ZBQA 3ICQB 3C8LA 3OQIB 1DDGA 4J07A 4ZMSA 2YBEA 4LSMA 2DF8A 3GHZA 2HTFA 5DYNA 3LVBA 2DQ4A 3MPUA 4UE2A 4ZQBA 3EMKA 1TKCA 1KVQA 2WMOB 3LP5A 3U7HB 4FHDA 4KITB 2DHEA 4B82A 4ACBA 2E6UX 5DTEA 5LLDA 4E12A 3FWZA 5CFLA 2ZWMA 4UDOA 3O1HB 1NLYA 4XIYA 4OJYA 2PFGA 3RAEC 4DDUA 2NU6B 4L75A 1Z37A 1W0JG 1XK7A 4HDRB 1TVEA 3ESYA 1VRWA 4CTKA 1EFVB 2FB9A 2CXOA 3ORYA 2YYZA 4V1CA 4QD3A 5AVKA 1JF8A 4ZI7F 1X92A 5AWFC 4RPHA 4O2LA 1ICIA 4ZYVA 1R8QA 5FLXA 2O8BA 5E6SB 1FXWF 4AN1A 2BFFA 4RORA 4KQ2A 1EFUA 4M54A 1VQ8F 2BGNA 1JWLA 4QGSA 1ORHA 4N18A 1LWNA 1FVHA 3S1SA 2VN8A 4KR9A 1JY8A 4X41A 1RXVA 2B3TA 4BLOA 4KDFA 4ERXA 3TBKA 1E69A 5C1IA 1Z0ZA 4E33A 4RH1A 4FJ1A 1P2VA 3COJA 1PQUA 2ZXWB 1OLXA 2LCIA 1GTRA 1QQBA 5EFOA 3NAZA 2H6LA 2BD0A 3BJZA 1XI2A 3R8XA 2QRQA 3HU5A 4ND4A 3B20A 4LCJA 2EIMB 1M1YE 4FI3F 2YY6A 1CEYA 2QKCA 1E58A 1N77A 2HBZA 1Z83A 4TLCA 2EBWA 4HTFB 1FBNA 2TMKA 3AERA 1OX6A 4HKTA 3DV2A 1VQLV 2GM5A 1QIJA 3ZE1B 2GYVA 4BIZA 2PD6A 1RE0A 4WZBB 1UK8A 2LCQA 1J97A 4QKQA 1QWSA 3T1HO 1TPZA 1K4KA 4E14A 2HA3A 4S3MA 5H5NA 2IZ5A 3PLAC 1XTBA 3ZVLA 1YBFA 4M0DA 4REOA 1WBJB 3FM9A 3K0CC 5CN0A 4PIVA 5DI3B 3ZGNA 4M87A 2XQJA 4HEHA 4EAQA 5ALUA 3AESA 3HLTA 2YMQA 1RRVA 1R0KA 1E2GA 3B6IA 4R1LA 1Y8RA 3V34A 3ZQJA 2PUFA 2ISQA 1Q43A 5FTMA 2RAFA 1J0EA 1SUFA 3NK7A 3DOUA 2CTQA 4WVLA 3W2TA 2AZDA 3HI6A 4Z8YA 5DV9A 3OUTA 5LD2B 4KFRA 1KEEA 3A1FA 3LX5A 4ARZB 2AN9A 1LC3A 4LWOA 1B04A 4RJKA 4XCQA 4R7CA 2IWHA 5FIUA 2Z6AA 1ZM2A 3SIPA 1I2DA 4V0SA 2ZI9A 4RZSA 2F93B 2RKOA 4JT2A 1OXXK 3KB1A 6AT1A 1XCBA 1ZPDA 5DIFA 2XI4A 4LJRA 2PO5A 3UJNA 1UP4A 1OBHA 1SKAA 1VLQA 1UKBA 3OSUA 4GLLA 4TTRA 2QG9A 2EKZA 2ACKA 2QWXA 4EQZA 3QO5A 2X6AA 1B6TA 1E0JA 1K3EA 4J91A 4K9OA 1IBMB 4B79A 5BYAA 4S0ZA 3O6VA 2JJ2A 2YR0A 3HUDA 1O5OA 3IESA 1T4MA 4FM1A 4G1EB 1CV2A 2RGBA 4ESEA 5JD4A 1B74A 1VLLA 2IH3C 5H83A 1KO7A 4KNWA 3OHPA 1N1MA 5KYTA 2GVIA 1TYBE 1G0OA 1TAHA 4HJXA 4ETMA 4EBFA 1I9GA 4ZVPA 3WBKA 3GVHA 3T4EA 4GBED 1LSOA 3VJRA 4MJLA 3HV0A 3LWVC 2BMDA 3V1KA 1RAFA 1X80A 3OLXA 5HBRA 1VQ9V 2DTEA 4OFXA 3A6JA 4ITUA 2WTUA 2DFNA 4FDVA 2WSBA 3Q3JB 4G0QA 1RLTA 4QU9A 2EZUA 3OEED 2K5UA 3QUBA 2CWDA 1P31A 4H31A 1HEUA 1WW2A 4MMZB 3E2EA 4XYGA 1U8YA 1MAHA 4K2HA 3MELA 4AJKA 3MOGA 5DZSA 1KMIZ 3OCXA 2WAOA 2J08A 1T6BY 5FORA 2R6JA 4A3SA 3AETB 3O8CA 1ODFA 5BVHB 4Q4AB 2QHXA 4YYEA 2EEPA 3IVGA 1EESA 3OZXA 2BM1A 3CF2A 4B0OA 2QN2A 1WSDA 4OAOA 4B6QA 4EOGA 3RHZA 1Z18A 4U9IS 1S3SA 4DA0A 3D6VA 1C9MA 1T9CA 1AGYA 4O2BA 2I7DA 4UVEA 4A0QA 4W63A 4B1FA 2I2WA 1A9PA 1V2HE 3ACDA 3RIYA 4B4DA 4RD4A 1NBME 3F0EA 3D0QA 3THYA 2WLMA 1GSIA 1Z5NA 5HEKA 3NETA 3ZIUA 2B30A 3TZCA 1SS3A 1J25A 3NXSA 3VJKA 1ZGAA 2FRVA 1SNYA 4LX0A 4HYTA 4LJLA 2C7RA 2J5XA 4GRDA 2IEGA 3FR7A 5C3UA 3KQOA 3TZQA 4WLEA 1WMBA 4J90A 3FRHA 4WOPA 5I7WA 5GJVC 4Q4LA 1RRKA 4MKRA 3T5BA 4U6NA 2HRUA 1SCKA 3EGXB 1SRYA 2FPXA 3LWQC 4FGUA 3IUPA 1IPFA 1CJBA 4X6LA 4O4JA 2QZJA 4RPKA 1KTIA 3KCXA 1QVVA 4ND8A 3I5UA 3I56V 3EIWA 3R3YA 3ABKB 1L5HB 4LF7O 5COQA 1FQKA 3ADDA 4NECA 4B32A 1U5CA 5I7HA 4A7PA 4DABA 3NAQA 4JEIA 4GSLA 3KEGA 2WWIA 2QE7D 3AR5A 1K08A 3DMHA 4P9OA 2JFQA 3CWQA 5J2TB 1T5LA 2DQKA 5CBGA 5CYGA 4YRTA 1RM0A 4X3MA 4X62B 1P1JA 4X64B 2XJ4A 3L6DA 1X25A 5JZSA 4BDTA 2GSMB 4G8BA 3CKKA 2QEQA 4KYVA 3FSJX 3TQFA 3ZBUA 5A7HA 1WCYA 1OFHA 3OMLA 4Q7JB 2PZLA 3ZU2A 3FWPA 5F73A 3ZWWA 4NXNB 3DKVA 5TGZA 4P80A 4BOYA 1ES9A 4HNAA 2AF3C 4KLRA 3SC3A 1VQ5V 3ZCTA 2ZIGA 3ZS9A 4KPYA 1CR0A 1YR9A 3SXUA 2BM9A 4REQB 3EASA 1DGSA 2GHQA 1RADA 3LRPA 4II7A 4EF5A 4WCFB 2AG5A 4CXMA 3DDUA 2F3QA 1Z88A 1EUQA 3Q3EA 4JLOA 5FB3A 3ZCQA 3S29A 2O2CA 1OYYA 3G02A 1I6LA 3RUCA 5BSGA 4Z2WA 4OPHA 3IP3A 2NO0A 3UIEA 4RHUA 3E1KA 4D42A 2R9VA 5ELXA 1R27A 5JQGA 1GZ3A 5K6AA 1SHJA 3BMQB 4B3MO 3OAAG 4XGIA 1EK2A 4M60A 3IQEA 3OPVA 2JVDA 1JHZA 3TD5A 1IULA 1QF7A 1E79A 5FRDA 5AVRA 2VF5X 4NEQA 1BVHA 1WS6A 3T3MB 5TQ2B 1J0AA 4RVFA 5FNVF 4KAXA 1MGOA 1XPUA 3A9VA 4H7HA 5KBYA 1ZQ1A 1DUSA 3TW8A 4AKIA 2X8AA 2ZBPA 4J29A 2O2SA 2BOBC 2EGGA 1MQAA 1Q7GA 2F1OA 1Z63A 2BOCC 5EIBD 5F1YA 5K2OA 3PXBA 4TLBA 4CEJA 2H1HA 3QHPA 2FUNB 5BNZA 5CXXA 2XPCA 1G59A 3TCXB 5HHTA 5ECYA 2ITCC 1YAHA 1JEDA 2FGKA 4J4BA 3J7TA 3K2XA 2AX3A 3RYFB 3KXLA 3RSQA 1G9XA 4B5KA 4U7NA 3DYVA 3LHSA 3WXMB 3SKVA 3IO3A 3MBOA 4QGAA 5TQ0B 4CBCA 1X7WA 4GYWA 2DSNA 4AZ3B 2Z6UA 1YS7A 1VM6A 3KZIZ 3TOSA 4Q01A 1L7VC 4NWOB 2BUAA 1BCRA 1HDCA 3OM1A 1G5RA 1UKCA 1YVRA 2XZLA 1HLDA 1SC6A 3QU5A 1CN7A 3BH7A 4QGHA 1UJBA 4J0JA 1SUSA 4BX8A 3CGGA 1J21A 3MSXA 5DGDA 3LWZA 4A36A 2IIQA 2XWQA 5HY1A 1A7UA 1J07A 4MVJP 4M0LA 1QQTA 2CVOA 2XQGA 3X1ZA 5K0NA 3LSYA 2OESA 3KJQA 1GCOA 4H7DA 1KJ8A 5KYXA 2JIRA 1W5TA 3UCXA 1QQ5A 5HY0A 4JU9A 5AJZA 2ZW9A 1CXZA 4G4ZA 4XCXA 3CCEV 5AM1A 4D3XA 1B8PA 2Z2IA 4JL6A 4EARA 5A9RA 5K51A 1QO7A 2PFKA 3N5KA 1EAMA 3U3XA 3KOUA 4OL9A 1Z73A 3CIOA 2HVYD 1I80A 4ZMBA 3SM3A 4MRVA 2ZT6A 4RK4A 3M4ZA 1HLFA 1PJ4A 3PGKA 3NRBA 5ICCA 2PS3A 2ZVDA 2MMCA 1IN1A 2P4HX 4F4LA 4ZJPA 1PR4A 5DSXA 5CRIA 4RV9A 2OG1A 1T15A 5BWOA 3QNEA 5IZCC 4H1HA 3ONNA 4EG0A 4Z4EA 3SJZA 3KBOA 3JAMM 1XDZA 1DEKA 1GN8A 2O3SA 4FYXA 3C8HA 2YHSA 1KSFX 2IW1A 2E1RA 3QYFA 3MEQA 4Y2XA 5G0TA 1T0UA 3DZ8A 1O94A 1WE2A 1IY0A 5ENVA 3O75A 4DM4A 2B1QA 3TQOA 2C2KA 3HCFA 4DMGA 2GKOA 2I33A 4RZIA 1TYZA 1NQWA 3GUVA 1OCRB 1N25A 4PYNA 4ZDWA 2ZE5A 4RVHA 4O1IA 3ZLBA 3KB2A 4HB4A 1RBQA 5FBQB 3OBIA 3MCVA 4U5QA 1YL6A 3JR7A 3HN7A 3BGSA 3T6KA 4C20A 3L7IA 4LZJA 4MZXA 1U1EA 1UUFA 3EMDA 3LRXA 2FZVA 2A67A 4H0NA 2I4LA 2VI5A 1U4NA 3QBJA 3U49A 4LE1A 3FTFA 5CT6A 2G5PA 1OLUA 3ZRSA 3JQEA 1XYGA 3DDSA 1FFCA 5JAQA 3TBHA 5DNYB 2XSZA 4OH1A 3DJFA 1PM9A 2LW7A 2WSSD 4RGQA 2P4UA 4BT4A 2P67A 1XZAA 3JQPA 4XLLA 3Q7TA 4MQUA 3LT4A 1RRFA 5AVZA 5U1PA 2F43B 1QYWA 4PONA 1DDIA 3D4IA 3GLHE 2HLHA 4I55B 4PTLA 3FG9A 5BUSA 4KE9A 1G66A 3KLBA 3COYA 2B1GA 4Q9JA 2Q2WA 3CHXA 4FGLA 4AJ1A 2RH4A 1J09A 4HH4A 2HF2A 2QI9F 5UKDA 1P77A 3M5WA 3BN3A 3T5GA 3FSEA 5LR6A 3BB4A 3IV9A 3JAKA 4FJCC 1ZLYA 1B26A 4JC8A 4G9BA 3IAAA 2PWZA 3SS7X 4CC5A 2A9JA 4LVNA 3GGDA 1S8NA 4RD1A 4KBYA 3KDAA 1UWKA 4UD2A 4BQQA 1UPFA 2JCVA 5DCLA 1U7XA 1MDBA 1M34A 5DHRA 1BD4A 4IJ6A 4LP8A 4ZZ1A 3LC2O 1CUZA 1Q0HA 5REQA 1DO2A 3Q0IA 5IANA 3GTZA 3M6MD 1R0RE 4D9GA 3DPSA 4Y98A 1DSSG 2ZJ5A 2R6HA 2OILA 3H1TA 4JR1A 1IM8A 3EDCA 5LYJF 1RXWA 3V9AA 2C1EA 4QOHA 1TZJA 2YXZA 2VP9A 3ZN1A 2E49A 1T8WA 4GIBA 1GIAA 3B48A 4M8NE 4KQ1A 3DL0A 3IRVA 4EA6A 1NE2A 3AVUA 1OFUX 3RGGA 3VMFB 1DIOB 3NHBA 3LWNA 1YZFA 2Q6IA 5JS1A 2C5EA 5CH5A 3QJGA 4FZRA 2GCOA 4CQMB 3IOYA 3BWXA 3MXTA 2H4JA 5KIAA 5KSYA 3NT4A 5KKNB 4BKOA 4FONA 3I7TA 3K6SA 1SH7A 1LQ2A 3I9FA 4AF7A 1EZ4A 1YQTA 4RQAA 3UO3A 2N9UA 2I55A 5F52A 2CAZC 4MVJH 2CW5A 3ASVA 2X19A 3H7AA 1H42A 1RRPA 2QWOB 2MYNA 2O8NA 5JIBA 1DO8A 2WTMA 1SC1A 5ANRB 2XB2A 4LRXA 1R6VA 2V9CA 4KV7A 3QBVA 1P2UA 3PXUA 3SX2A 1GZ7A 2UZ3A 1NVPD 2HHLA 1XV2A 4FDLA 5I3CA 3H4VA 2FDRA 1OIWA 4ON9A 3OONA 4H44B 4MS1B 1A9QA 1TKAA 3E22B 3SR0A 1PHPA 4EO4A 2JLAA 3LNMB 2ZUFA 4PS1A 2PL1A 1SOMA 2P8SA 1T1RA 3JS5A 1FAFA 4UZFA 1SBCA 1Y0BA 1ZBDA 4B9EA 4AIRA 1VGVA 3FHCB 1P29A 1ZL0A 3ZCCA 2QU8A 4LF8O 4MUJA 4KH1A 1M0WA 1G21E 4GZMA 5IUJC 2QQFA 2NUPA 5HCIA 1EDOA 2J6HA 2OAEA 2ADOA 4FJ2A 4IDPA 2AH5A 2UVPB 1GITA 4DLXA 1WAMA 2OVFA 4JI0O 3RWMB 1JMVA 5AW9A 2QMOA 1KS9A 1NZJA 1ZSPA 3R4VA 5FFNA 1FB5A 1QV6A 2IXBA 3G23A 4YEDA 3VYSB 2BKLA 2AQHA 2WAXA 5AUQA 1QRSA 4H7JA 4RHFA 3HXLA 5KLVH 1E9VA 4I50F 4V0OA 3WY9A 4RLSA 1P7WA 1EMDA 4NCIA 3OOHA 1N9GB 1QIGA 2V45A 4LZOA 4CCWA 2IYUA 3P1JA 1U0SY 1OJLA 4LZWA 3E53A 4IYHA 3KE9A 1R4NB 1I7DA 2QROA 4EA8A 3ZOKA 2A9QA 5TSDA 4TSFD 2B82A 3R0JA 4F6RB 4IBOA 4LJ4A 3T7AA 5D3MA 4IGGA 3K32A 4CH3A 1YDEA 1U4SA 4LGVA 3BGOS 2C2AA 4DR2O 1KEUA 3RC2A 1FLVA 1YR7A 3VNQA 5IEBA 1VRVA 2XCLA 1I2ZA 3K70B 2IZ7A 5F3DA 2B2CA 1OWPA 1FE8A 4ASUD 4XB1A 3RHTA 3MUNA 3C3JA 2QXYA 1URFA 3IEMA 4WLUA 1NVWQ 2QNRA 1ZD8A 3I01M 2EULA 4BFXA 4I0WB 4FFBA 3JARA 1JWBB 4R7TA 4KUGA 2EX0A 2K4MA 3ROQA 4YHHO 3F74A 1FK8A 4JY7A 4E2FA 4ZPJA 4ALNA 1JFLA 1SKQA 2J3LA 3EISA 4LZZA 5E6RB 4HDSB 1Z25A 1QOZA 5BYJA 5GIPE 1KJ9A 4RLHA 1IG3A 3TIXB 3H11B 1ZW6A 5E7MA 2Y3IA 3KQUA 4ZYWA 2Y99A 1FYJA 1D5WA 1KO4A 5P8WA 3UY4A 3W6OA 3U48A 1INLA 4XDHA 3RIMA 3R6DA 1Y9JA 4J0FA 1IJKA 3CCSF 3FWNA 4YRPA 3DNFA 2GEKA 4MYTA 1D5NA 4B7ZA 1XA0A 2CDYA 3PJEA 3WSVA 2NXCA 5B4TA 5F7XA 3ND8A 1NIPA 1E32A 1KOJA 3GVCA 2VEOA 1M6WA 3HWRA 3FLMA 4ZIBA 1PQPA 5B3JA 4FT2A 3ZJVA 3B1XA 5JSZA 1LLQA 1DOZA 5DECA 1T0PA 1JPUA 1A4XA 3QLUA 2ZRNA 1Q92A 2JD1A 1PFUA 3EOZA 3PG5A 1U94A 5JUWA 2VJNA 3ANXA 3UQZA 1NU6A 1M0EA 1P39A 2F3UA 1LVUA 1QPGA 5L7WA 4LHWA 3ESAA 3ZYZA 2P9TA 2R11A 4BVBA 2FR8A 5H80A 5D87A 3PI6A 4FNOA 1WMEA 3C8ZA 4OUDB 3RGBA 2O1EA 4PHZA 5B7QA 4B46A 3BD8A 4YQFA 4GI2A 2ZSKA 3E89A 4RLQA 4IO1A 4NYIR 4AG3A 1W85B 3AIKA 3GCDA 1U8FO 2DFLA 2QMQA 5HQTA 1NNSA 2CVLA 1GXSA 2FMHA 2NO4A 4IEEA 1P4JA 2P62A 4ISCA 4AHCA 5JZMA 5COAA 3NYWA 3T52A 2EBFX 3AF2A 1SC3A 2CLHB 1G20E 2RHLA 3ZWMA 2VFAA 4OOEA 3SZ3A 2ZJ7A 3F4KA 4OJQA 3H8VA 1UFRA 2AGVA 5DHTA 4BMPB 2VUHB 3DWIA 2H4ZA 3WWZA 2QVBA 1HXHA 2EP8A 1HE1C 4R2XA 2W70A 2Z2ZA 1T0BA 1K8YB 4QTZA 4U6SA 3KVNA 3K0FA 5ALTA 4E15A 2DUWA 3SCZA 1GL7A 1CR1A 2WABA 2WPDG 1XDSA 2V7QA 1VG0B 4HATA 4LJSA 4O2AB 5LBTA 4ND7A 3A3OA 3KHSA 2RB9A 5CM9C 1F2UA 2YXLA 4BNNA 1NJ2A 1S6YA 2W2NA 2ZYUX 1PZEA 2H5LA 2Z1MA 4ONEA 4DNOA 1HYQA 5K4HA 2XB8A 4KTVE 1VFPA 2OXEA 1ZAYA 3QFSA 2C5HA 3DF9A 3R4CA 3F5WC 4L73A 1GUZA 5G3ZA 4WJKB 3S2GA 2EF1A 3MN1A 2HEIA 1FA9A 1OH5A 2XGOA 3TTYA 2AWOA 3S06A 2GZ1A 3KKZA 3FNBA 4DV1O 1FD9A 5EPOA 3WVNA 2RGYA 1NMEA 3V46A 1XCGB 2JGNA 3TNYA 1R18A 2QRZA 2WHYA 3PUIA 1DE0A 5LZ8A 3CFYA 2AC4A 3OQJA 3H1EA 1RS0A 3E3AA 3DWFA 1IUOA 1XFDA 4WXMA 3G71V 2PRYA 4KUMA 2QW8A 1OV4A 2NQ8A 3L18A 5JNLA 1VYTA 3DR5A 2BISA 3JQQA 2DW4A 1E99A 3CYOA 4ZEOA 4M86A 2JARA 4OG2A 2ZINA 2CNWA 3T3NA 1EM8B 1SQSA 1N7HA 5ENDA 3NBKA 2ZM6O 4Y2PA 2Z3WA 2J3EA 4JI7B 4EGJA 1PZGA 4YRCA 5A3VA 5DYYA 2HLDD 5DOZA 3SYNA 5A5FA 3ZQ6A 1JVBA 1C7IA 5JASA 2OLKA 3EMVA 1UBEA 4GPD1 3VU9B 3GVPA 3UK2A 2P9HA 1KY5A 1OTXA 4DBVO 2CXNA 4B87A 5KWSA 1ACJA 2SBTA 1GKYA 1CDDA 1D0SA 1DF5A 3FDXA 5IMSA 2MU1A 3HJFA 1ZGCA 3ANNA 2R97A 2ATEA 2A5YB 1V71A 4AROA 3WGIA 3TB4A 5J9FA 1F8YA 1X1DA 5BYKA 3IJRA 1OT3A 4CQNA 3NGXA 1GRQA 5J4KA 2YV4A 2ZJ3A 5KJCA 1Y67A 2BR5A 4H3HB 4KQGA 4IGIA 3BFXA 3BSFA 2D1TA 4I9QA 1U0RA 3DBIA 3KQKA 2P69A 3T3OA 1OWMA 5ICFA 3TLXA 4S1WA 5HRUA 3AG3B 3GEBA 1UCFA 4B6FA 2E3JA 5FXMA 3VM6A 1GN3A 1YQUA 3R24A 4Z4FA 1GGJA 1EAYA 1PGJA 5T4BA 3M3PA 4GI1A 5IM4A 1LUAA 1YQNA 1AB5A 1KI6B 2VAXA 4IIJB 1VQ6V 4IVQA 4TN5A 1HLPA 4AY3A 2VT6A 2WBLC 3LD9A 1I32A 2IEDA 5CM2Z 1LLDA 3BZBA 4GECA 4P7FA 3TVDA 3F8TA 1Z8DA 4B4OA 4DJEC 5ELMA 1NP6A 3GJ7A 3TSCA 3CCRV 3W4KA 3LIPA 1G5IA 2YWGA 4LH7A 3ELCA 4N5DA 4DCNA 4OLBA 1EI9A 1VQ1A 4EX7A 3WLAA 3QRWA 1WETA 1TAUA 1N34B 4IS2A 1EXWA 3HCPA 2IGTA 5I4BA 3HACA 3HB0A 4O4LA 3KOYA 1KPIA 1ORTA 4R8KA 4U7TB 1KEVA 4TL8A 3C3WA 1TM4E 2Q07A 4G6ZA 2DPXA 3IL2A 4MYUA 2I7VA 4F93B 3C5EA 2HWYA 4HI0E 3ZCVA 2YNMA 1HY3A 1N2OA 3F7YC 1FDIA 3WI7A 4BNWA 2RGRA 1OI3A 1CX9B 1BSMA 4IJWA 1XZNA 5SZHB 3O4IA 1U8CB 4EHAA 4DR3B 2HS0A 2QX4A 2G7MC 3CYPB 1N4DA 4CMBA 2QAGA 821PA 1VMGA 4TT3D 5EJ5A 1IM2A 3C1AA 2A35A 5HKLA 5DSTA 3JVHA 3RC8A 1WDMA 2F3RA 4S0XA 3NWEA 2J6BA 3P0FA 4QPJC 4XD2A 5KKCA 4WK2B 4KREA 4J8PA 5JCOC 2HA2A 5KYVA 4W5HA 1AB6A 1ZJZA 3U4CA 4UU1A 1E7SA 1FYDA 5I47A 5IC5A 2NUBA 3A6PC 1VYVA 2G76A 3DBRA 5CA0A 5KQMA 3SJCA 5ERYA 1OFTA 1Y9DA 1JXAA 1QYVA 2JFUA 1R6AA 4IUCS 1PD3A 1GFZA 4MVYA 3T54A 2W8ZA 2IYVA 3FPKA 3FCCA 4R7ZA 3PFHA 4L8YA 3TUIC 3A3YA 5TV2A 1URPA 1GQRA 4UHFA 2JGFA 1ZEJA 1NL3A 2WYVA 2REXB 4ZAWA 3TW6A 3ABSB 3D8HA 3IB6A 1T0IA 1WXIA 2W6QA 2BP7B 4AUKA 1F1BA 1WXFA 1UMBB 1OIVA 1TADA 3WYGA 3LBYA 3SC2A 4W4LA 3C85A 4OFZA 4OHPA 3ADKA 1ZUD1 3M9LA 1KKCA 1Z8FA 1FTNA 4CLEA 3EC7A 3O8OB 3C8UA 1NT4A 4CKWA 1YS1X 3DTVB 2AQIA 5AM0A 4TRMA 2GWHA 5TEVA 1G4HA 2NAPA 4Q16A 1QH0A 3PDJA 2ZIWB 4YV7A 3N2ZB 4Z0NA 4O4IB 4RHXA 3M1AA 4R5HA 3RIEA 2LBXA 3BDVA 3CC2F 4JT4A 2WG0A 1VBKA 3PDWA 3O9MA 4DMUB 3RRZA 4CG2A 3WRWA 2V0CA 5E3JA 3CVXA 3BORA 3PSHA 2GERA 2FX2A 2I67A 4TYQA 3BA6A 3E9YA 3CW2A 1QUEA 2P5UA 2HK9A 4DEXA 5TVGA 5EHNA 2AA3A 3QG1A 4BT3A 2AHRA 4WGFA 4N0PA 1ELOA 4ZC8A 4ZVRA 3A25A 3WV5A 3RVJA 1D2NA 1P60A 2A5FA 4ZHYB 5HE9A 1IZ9A 5FOWA 4WJZA 1E4EB 3HZOA 5EXEA 4ZYUA 4Y6LA 2D00A 2XT6A 5J4YA 3UAWA 4Z7NB 3OUSA 3ZRVA 1K92A 4HGZA 4A82A 1M2GA 1X70A 2NLJC 1KHTA 4JJ6A 2GJ4A 2YMPA 4X66O 5H6RA 3TZHA 4I4TB 1BHJA 5B2FA 4K03A 3DTNA 5DN6A 3WLIA 3ZHXA 4BQSA 1KAOA 4WK0B 3ZDEA 4G0UA 1EVKA 4ILKA 4Y1EA 2FCAA 3PF9A 4XUCA 5GZ3A 2G80A 4KWCA 2W11A 3GFPA 1R16A 3A36A 4R1NA 3L6EA 3NDJA 2WWWA 4E88A 4E30A 1K7XB 1YS6A 4J9YB 2BE7A 4M55A 4PPNA 1T5BA 2QQ5A 2FWIA 1Z47A 3K6KA 3CUUA 1VL1A 5BR1A 2ZIVB 4D74A 1A1SA 2ZTSA 3Q3VA 3HR8A 5EG5A 5KWVA 3WL6A 2DBYA 5JBNA 3UK0A 3KYBA 1QDEA 4KG7A 2I2XB 5C1DA 3F3SA 1E5QA 1AI7A 5CPFA 5ENZA 1RM5A 3FUTA 1CD5A 4O1HA 5HXAA 4HH1A 1ZOOA 5KHAA 1ZD2P 4CMKA 5KTRA 3MQ4A 1QG0A 2ZVQX 2PWAA 4ZK2A 4FMDB 1RWBA 3HB3B 3S81A 1EWRA 4LEIA 2WTNA 3KYDB 1FYEA 1SKYB 3DBVO 4BUJA 2BUBA 1RHUA 3FD8A 1RFGE 3FHOA 5ES3A 4M7WA 1MDFA 4JBIA 4ABYA 2ZNIA 4HDMA 3WK6A 2CZCA 5AP9A 2RSLA 4ABTA 3K14A 5B7PA 2PUEA 2BFMA 1N1GA 2UZ1A 3DL4A 1SMKA 1LX6A 1G98A 4NZNA 4PX9A 2XKKA 3VVMA 3KJEA 2UUCO 2XZTA 2CE4A 3NHWA 1SBQA 4P33A 1N6LA 2D5LA 5ARCA 4X88A 1Q1AA 1XHEA 3F98A 2NP6A 1DWQA 2PVCA 4CL3A 2ZRCA 3GAAA 2BRUA 1SKUA 1GM7A 2BH9A 1TIPA 3F5FA 3KQYA 2R5NA 1UZMA 2QTSA 2NSDA 1YFLA 3NBYC 3KZKA 3JYCA 5AXCA 3CV3A 1KMHA 3JZAA 5ESXA 4WEQA 4AZ0A 1G6OA 3EWIA 1XDUA 3AL2A 2Z3YA 1Z7WA 4LJ7A 3N2KB 4AI8A 3BXXA 2HUPA 3IE0A 1DRUA 1ZUHA 4LF9O 1M5UA 1G8SA 3MWKA 3HZHA 1CDOA 4UCWA 2QLLA 3E9NA 3CMAV 3NV7A 3BRWA 5KHGA 2PQ0A 1KQFA 4AMZA 4FLMA 3GDHA 1QTIA 3LKVA 3OJOA 1WW8A 4UTNA 4LMPA 2LBTA 1ULZA 1IBSA 3D81A 1CZKA 4ZODA 4KAFA 2H8CA 3U4DA 3PR1A 1XNHA 3CLTD 1AR5A 3U1VA 4DSUA 3KKYA 1BCCH 1NC3A 5F2EA 1VF6A 3PX2A 4O5AA 1F2TB 1WQ3A 3VDMA 3GUUA 2Q4BA 1Y3CE 1Z6PA 3CCFA 3C9UA 1E3WA 4HWSA 4OI1A 5G4VC 5BP7A 4EKYA 2XYVA 2QT0A 5JH7A 3H19A 3G2NA 3ZWBA 1GNLA 2B3DA 2UVQA 4I5FA 4NHOA 4LQDA 1Q0TA 1VL5A 3IERA 3ZHYA 2HLPA 4AMGA 2CHQA 3A4IA 1JPNA 3LLCA 1AXRA 2OB1A 4ND2A 5T41A 1H1TA 2F67A 4UCSA 2GSWA 5LNK1 4Y9UA 3D6MA 3I09A 4OGGA 3VYRB 1KGSA 4PLHA 3VAAA 2DCMA 2V7TA 2NZ2A 3WRYA 4UEKA 1J5XA 1XT6A 4XZ3A 1XE3A 2VXYA 1AS0A 4JXJA 1N36B 3N2GB 1ZCAA 1Z0DA 4PFKA 2C9CA 1FU4A 4YUYA 2QE7G 1Y34E 3A9SA 1QP4A 1KDTA 1NQAO 2Q2NA 3QHDA 2DWDC 1MOQA 3CSXA 2IH4A 4BP1A 4V0ME 3UWPA 1QWOA 4C03A 3LF1A 3SKXA 4TMYA 3EUEA 1MOZA 4GF5A 4IG9A 4TLDA 5J4VA 1ZLXA 4B3SB 2NYRA 2O7QA 1U9JA 3EZ6A 3A1VA 3JALA 3H13A 4DHWA 1JKJA 1VHWA 3PTZA 1N2BA 1JR9A 2ZCEA 2O8VA 1ESZA 4IIVA 3L4BA 2W6IA 4YR9A 1YJCA 3QFFA 5DB4A 3D9QX 2Q9BA 2N74A 3G9XA 3VU1A 2G36A 3VUEA 1NVGA 4EHIA 4DYDA 1H85A 5EZYA 1N33O 1HEIA 3E58A 3VVLA 4L2IA 3QVNA 1UM9B 2PEYA 1BMFD 5K8CA 3GHHA 1NOIA 3RHFA 4BAUA 5DWDA 2ZJ4A 3PQCA 4I1IA 1J0DA 3A3NA 3UV3A 4IHAA 3CCJV 3DKRA 1FXWA 3GJRA 3JQFC 2CVHA 4GR5A 5IRCD 2AJCA 1R6XA 4EGFA 2XWSA 3G9UA 3N2LA 4EEKA 5DM60 3ZE6A 4C21A 4BO2A 3ZMUA 3NHJA 3E35A 1V1RB 3FMFA 3GJTA 3ISJA 2OD7A 1PVOA 1FMTA 1Z5PA 1TGOA 1H2YA 4YQZA 3LW8A 1VSVA 3JYLA 4ZDKA 1TDJA 2I6SA 3OZFA 3EH1A 3L1JA 3R2JA 4Q4CA 1E79D 4ZVUA 3PITA 4D4HA 2RC6A 1QBZA 1VJTA 2XQFA 3ZY4A 2FHSA 4H7EA 3UJ9A 5CP8A 3GQBB 3OW2F 5ELLA 5JC8A 2BSAA 5IF3A 5HNKA 2DJIA 2EIHA 3WWEA 1NVBA 4OB6A 3Q7SA 1H3FA 4I9WA 1LC0A 3STYA 1A32A 4PX5A 2RK3A 1JLSA 2VSOA 2QRKA 1ULSA 2R5FA 5HY2A 3OESA 3I5YA 1QLWA 3NTLA 3QKWA 3GUZA 1F12A 5SY6A 4W4TA 4IXNA 5ILGA 3AEZA 4TWBA 1EFPB 2Q3DA 1Y7LA 3T1OA 3ZKAA 2TECE 4FMTA 1VECA 2G1UA 4BJ6A 4PTZA 1DKOA 3KJKA 3WKCA 2GQ0A 1TF2A 1SEPA 3Q8MA 1EM6A 4KMMA 2CLSA 2ZAIA 1QIHA 2VDWA 4DR4B 2Y0CA 5JHHB 5CB4B 1DS6A 4JK3A 4CQJA 3HWSA 3F7TA 4DUGA 1CVIA 1CJUC 3FSRA 2ATKC 1S77D 4JA0A 2OQIA 2PU5A 4WXPA 1QF9A 1QS0B 4ZRMA 2YS6A 3PTLA 4LDRA 2CYBA 2BJHA 2F3SA 5JLJA 2XUZA 1I9CA 4AO8A 2WYIA 1AZSC 4R9RA 3BCSA 3R66A 2WTBA 4XDLA 4LK2A 5GIPC 4R5MA 2VNAA 2Q5QA 2XE7A 3T5PA 1L5MA 5T8KA 2Q0AA 3WGMA 4QTYA 3LFUA 3A70A 3PCRB 3HCAA 1E6UA 2HQRA 4YP6A 3FHJA 1H6DA 1U1CA 3SLRA 1O6ZA 2CCGA 3ZW9A 3AFOA 5EXSA 4BKQA 3X2QB 4WFFA 2VSYA 2JA2A 3KJZA 4ZHQA 1GEEA 4QEZA 5IJZA 2YW2A 5KCZA 4M9QA 4EJMA 2B99A 5EWLB 4PCVA 3DB1A 2ZITA 3TDMA 2V5UA 1H2BA 1I4DD 3TD3A 3C4JA 3G59A 3HM9A 2ETNA 4RBNA 2GJ8A 1RJFA 2DJVA 1IHXA 4D8XA 5BN3B 5KOYA 4YRZA 1GVHA 1R0BA 3KQSA 3TRHA 1VKNA 1UK6A 1SWVA 1CY2A 2YMLA 1JS1X 3ZU3A 5CLHA 2WHPB 3CE9A 3VZQA 5LMZA 1W47A 1JW9B 4Q3AA 2PGIA 3NM5A 5JJKA 1XB2A 4ZVSA 4L16A 1ZNYA 3E84A 3WKAA 2BO1A 1ZA1A 4L87A 4L3VA 4I5IA 1N3YA 1FKAO 1WRBA 4PGFA 4GP9A 1QFXA 5KNCA 1ML3A 2QIPA 5JS2A 5GZ6A 3N53A 1W2BU 2JEUA 3B6NA 4MUEA 3N2YA 1X7YB 1NX9A 1KI1A 3AKZA 2C8KA 1ENYA 1JG4A 2DUUA 4UARA 2JZCA 2XBUA 3GRAA 1TMGE 2I6GA 2WSSG 4XDYA 3G0BA 1B2LA 1EXVA 1Z7EA 3OIWA 1KP3A 5FFFA 1XJWA 3MHTA 3JYNA 4QLAA 2GD1O 2HT6A 4DMMA 3CSUA 3U3KA 1YDMA 5BPHA 2XSZD 1E9AA 2QJTA 4JEUA 2QBYB 1ZISA 3AEKA 4YJFA 4LXIA 1IWBB 4MR9B 3ZTTA 1RMYA 5E6UA 1IQ0A 5I3ZA 1KMMA 2QLTA 5IDQA 2UXDO 4PYMA 1QHNA 1MZVA 1XD8A 2QRPA 1DBQA 1DQNA 4NC9A 2DPHA 3FYUC 4WNAB 1PL8A 3OMWA 3ESDA 1YJWF 1C4KA 1Y74A 2ECFA 4B09A 4DS3A 2MR5A 3GDGA 3MUEA 2P11A 1PL4A 4QPDA 5K3DA 3C4QA 1QHHB 1DT9A 3WWPA 1N2XA 3IMKA 1X6VA 4WFIA 4AQYB 3EY4A 3F3YA 1YTLA 3S3XA 4OATA 5IKMA 1ZP6A 1V3UA 2ZJOA 2VJMA 3RN4A 3W1VA 2DTXA 2R8BA 2IL1A 1G3MA 1N5RA 2Z6VA 1HFWA 3OPNA 3EG9A 1G2OA 2ZJAA 3M1LA 4O4HB 2ZQMA 2ROQA 3A6EA 2B83A 3V2HA 5FH9A 2UXXA 1ZWKA 1WHTA 4TYPA 3FMVA 4DV0B 2FRDC 4U8HA 4HGOA 4GVPA 3RRJA 2DETA 5LFAA 4G3XA 3LMEA 4DTCA 3G5UA 4NE7A 2JGMA 1JXOA 5K8UA 4RZ2A 4B3RO 2W71A 1MEOA 2GK7A 4JDPA 3QLJA 4JVOA 4EPRA 4BVEA 4EUEA 3P9ZA 1SUPA 1KZ6A 5JWRA 1SOVA 3VBEA 3WQQA 1R3LC 1VP3A 3H65A 4MVQA 3F9IA 4NZYA 4I0XA 2QL9A 2Q3EA 1FYVA 3NYIA 3SF8B 2G06A 3FPBA 1U2RA 1B43A 2F8TA 4FD3A 3NRJA 3SOZA 2QL6A 3MDSA 5BUZA 1Z07A 3EYWA 4JXKA 1E2QA 1L0BA 3R75A 5INTA 4C4XA 4YP0A 4QYWA 3EWSA 2J6CA 4IH4A 4OIFA 1DKPA 1VA5A 5DT9A 4C82A 3I5XA 4JI8O 3LL4A 3M3HA 3H99A 4HXEB 3QE3A 4QQNA 2O8CB 4KSBA 4PSUA 3FCXA 1TX4B 4BMYA 3S2UA 1L1FA 4Y2SA 2XW6A 1XWIA 3WGYA 2XIJA 1LBIA 3B36A 3PEUA 3H9EO 4IJKA 1OAKA 1K9VF 4BVQA 4DLLA 3QVMA 4CIDA 4TM7A 1M5TA 1VQ8V 3EULA 1F20A 3UQ8A 5IT4A 4UHHA 4DG9A 3MF4A 3OQ1A 4U7DA 4FXPA 5FNVA 2HHHO 4XB2A 5AR1A 5JU6A 4Q3OA 3VAYA 2ZPAA 4PZPA 2ATVA 1RHRA 1ZVVA 3WGLA 3VSDA 2AXPA 3AOEC 2AFHA 1DC5A 3P26A 4B9AA 4EYQA 4OTZA 2AXTZ 5JOQA 1FNKA 5BYBA 2Q5HA 3OZAA 1Z5OA 4DV6O 1HETA 3URKA 3C45A 3Q7EA 1EE1A 2G9NA 2JK5C 2GTPA 2I3DA 4BFSA 1E66A 4JFAA 1J2RA 3AG5A 4DMCA 2NUTB 2YZGA 3A14A 3DOOA 1N32B 3DZHA 4O33A 2OHHA 1GZ0A 1KJJA 2A0WA 1RI2A 3HA2A 3UKJA 3KR9A 1NJIH 2A58A 4BT2A 2ZYWX 3FYDA 2Q68A 3AXTA 1ZRHA 1W8DA 3K0KA 3R0XA 3DEJA 4I14A 4YRIA 1QDLB 3VPFA 1GGMA 3STLC 4W8HA 2D7JA 4FTWA 4Z1MD 4CEHA 4BV3A 3FGZA 4DT1A 1JTFA 5T4FA 3QKIA 3VZSA 2V4ZA 3IIKA 4RZQA 1JAIA 3U16A 1IQUA 3QWFA 4INAA 1ZIYA 3RVNA 1B0ZA 4NBRA 3G0GA 3W7AA 3GLKA 4AF8A 3WC4A 4R83A 4ZVOA 4CR8A 3D4BA 4RIIA 3ZV3A 1Y82A 3ORRA 1KC1A 5ERXA 4BXOA 2XX3A 4D43A 1JNXX 2XTNA 3NANA 3DC2A 2DEUA 1MO3A 2V6MA 2D74A 4WVFA 1EM1A 3VTIC 4BATA 4I4NA 3A6GA 1NYLA 2BR3A 2W2LA 3MQFA 5EIBC 3ZS8A 3VQVA 5C5EA 1Z68A 1W76A 3H75A 4L4UA 5K8IA 1ZW1A 1E3TA 4IZOA 3KAPA 1R3KC 2PU7A 3D2BA 2CVPA 1YVDA 5J4HA 1EN5A 1OW3B 1UKVY 1DQPA 3LZ6A 2Q4EA 1QYXA 2OOKA 4JCCA 4UM7A 4AKSA 2QTHA 1M5IA 3C1TA 1R0LA 2J59A 3V1LA 4CC6A 1J8FA 1DCKA 4CE6A 4TTQA 1QE3A 3TFQA 1QR6A 1LTHR 4LZAA 4DL9A 2ZRFA 1M75A 1AE1A 1PR9A 1LDMA 3VU0A 1OREA 2CNNA 5EL0A 4KGXA 1AGRA 2JEOA 3X1DA 1XQ9A 2FUCA 4RIFA 4W9MC 3IE1A 3OFNA 1RTKA 5BR4A 2BHLA 4ZXPA 1D03A 4KO4S 1UOEA 3HFJA 4IIGA 4QUDA 5LP6C 4PQGA 3EOBI 4AWBA 1NVVR 3LNCA 3FFMA 1JPVA 2F1RA 1RAGA 4XI9A 3GJ4A 2V8OA 4MRSA 3QKUA 3HDVA 1RNLA 3ZLJA 4MLPA 4IJ5A 1Q50A 4KE8A 5TPZA 5D51S 1RYFA 3GW8A 3L6UA 2B1IA 5JPCA 1GUFA 1NASA 1ZXLA 1LBHA 5BNIA 5FWYB 3P27A 4DZTA 4YAJA 2AWNA 2GTSA 1UK9A 4DLVA 3A7DA 5LOVB 4BX3A 4RA6A 1ONOA 3DHEA 2NO7A 5BR8B 2WIJA 3E70C 5F1KA 2LR0A 3ZU6A 1ZEMA 5IAAA 1SU7A 1FXKC 3FKSA 2VRBA 2GCPA 4NV1A 2KWIA 3BQ9A 5BN4A 2OO5A 3N6RA 4M1KA 2ANCA 3MS7A 4OD0A 4IDFA 1XG5A 1ILEA 4R2HA 4FXOA 3S8YA 5A4FS 2Q3MA 1DBWA 1OTYA 2CXXA 4LY9A 2Q6KA 3GLUA 5EJAA 1KSJA 2R48A 3RA5A 1HZZA 3VQYA 2ZWIA 1K5GA 3U5TA 1JIXA 2X7JA 2AJ8A 2JD0A 2PKYX 3ABIA 4FE3A 3B6JA 1SN7A 5HPYB 4X1IB 2NG1A 4UUQA 2DT8A 1PI3A 1T8RA 3QTBA 4D9BA 1MC1A 3L1HA 3N0WA 4I7EA 2QZPA 3ZDRA 1N5LA 3HDQA 3HFGA 1GPAA 2BTEA 3D7LA 1ZIOA 4JVSB 3TSYA 1BC5A 2PYDA 2FRXA 4TN1A 5LYJA 3BDAA 3K3PA 2G9ZA 5GOTA 2ZI7A 4EPYA 4CCSA 3MGGA 5C8DA 3AWIA 3KAQA 1CLEA 2P2NA 3GPBA 1GMGA 1Z74A 2EHDA 2G38A 1KRHA 3B1KA 1OC4A 1KXZA 3AHFA 3PQ5A 4D02A 2UUBB 1B8VA 4D3FA 1DG3A 3ADBA 3GR6A 3OD5A 4NTXA 3UGKA 3DJYA 4QBKA 3CZMA 3GJ3A 2E9SA 3F0FA 3WADA 5IWAO 3FB5C 1N5OX 1W0CA 4UHDA 2QLMA 1Q20A 2VH2A 4J7UA 1PL7A 2H51A 3SEFA 4MVOA 2B33A 5CK4A 1PGPA 1NBMG 3KT0A 1A97A 1HR0O 3DONA 3SN6A 1VQOF 1HF3A 1P7YA 2ILVA 1U7ZA 4Y2HA 1G63A 3P9PA 3DC7A 2A0XA 4X7BA 2Q6TA 2WD7B 2N05A 1Y5IA 5B4UA 4NAHA 4FCWA 5DNVA 5DE3A 3BFKA 2WM8A 1OHHD 1L7XA 3L05A 1AZTA 1YMQA 3VPHA 4C01A 3AG2C 3E3LA 3FR8A 4RMGA 2RI1A 3TAXA 3K94A 1FNDA 1S1CA 4YI5A 4JI6B 2OV2A 3WYAA 3KYJB 1DTOA 4GYCB 3Q15C 4ND5A 4F1KA 3E7WA 4IP0A 2GO1A 1H0RA 1FEZA 5K3SA 9GPBA 1VCIA 3HK2A 1H65A 3DO5A 4HAOA 3I9JA 2BGKA 4P82A 4TV9F 2FXIA 2XCRB 2AVNA 2XMDA 5AM4A 1S0VA 3PLRA 1PWYE 3IAYA 2YFYA 4FM2A 2IXFA 3PFWO 3N87A 4QYSA 3FFAA 2QENA 3IKJA 3TMYA 1HT3A 5F2VO 1KVUA 4Z49A 3IIIA 4WJLA 3W7TA 3KPWA 3ASNC 4L3WA 2EW1A 5BUCA 4URXR 2ZJ0A 5AVQA 2R4TA 3IB3A 4MXDA 1CUEA 1P4AA 3SSOA 1N0JA 4BU1A 3RARA 3HKDA 2BZ1A 3MNFA 4MP8A 2XASA 2D2EA 2IPNA 1TCVA 4EEZA 2VTVA 2ZTUA 5AI5A 3UB2A 4CMIA 4BIIA 3K96A 3T99A 3WGGA 1KS2A 1VL8A 1Z2GA 4OXXA 1S8OA 4RSGA 1P0QA 1C41A 1P9RA 3ESXA 3KAJA 3ZUGA 2O8FB 3K4QA 1LR1A 4B62A 4C22A 1NBHA 3BFRA 4AX8A 1VP7A 5K0CA 3PVSA 2GEJA 4AILC 1I3KA 3VH2A 1BA2A 3LO5A 1ZM9A 2RGNA 3EQ2A 2ZDGA 3CNOA 2Y4UA 3I6ZA 4JLMA 3QV1A 4NOKA 5KOIA 1OYOA 3QF4A 4TKVB 3FAVA 5EZ6B 2FOXA 3UT6A 2J87A 2JFZA 4Y18A 3OTGA 3EVCA 1PD0A 2H63A 4ENVA 5E4TA 4EG6A 3GZJA 1K4CC 5F2KA 3QK7A 1V96A 4MRMB 2WZQA 3ZDBA 4I9UA 4IWXA 4GLBA 2H57A 3OT4A 5L3ZA 3RLFA 3JCZA 1FXUA 4F4JA 3O2SB 3VR3A 1UQRA 4G4SO 5E9WA 4YJGA 2ZXUA 3S2IA 3MTIA 2C99A 2Q0OC 3JQ7B 1LDYA 2EZPA 5FV7A 1FS6A 2YNMD 3SSNA 3HFSA 4BFVA 2QTVA 3BJIC 2E4XA 3CU5A 4QQFA 5AW4A 1ZWZA 3K1AB 5GONB 2ISSD 2O7RA 2WJHA 1G8HA 3SIUA 1Q21A 4FFDA 5GGYA 2JJMA 5B7GA 4OBWA 4PGGA 2YYEA 4BVGA 2V0NA 4CM4A 3LPDA 3L9DA 3G8DA 4N65A 1ESDA 1NBWB 1XPJA 3LXRA 4GX5A 4Y0NA 4B6JA 3PPWA 1UXGA 5EWMA 1YQWA 3L4EA 2I8LA 4TZ0A 1XILA 2H2FA 3KYCB 3N86A 1EGMB 2DC1A 4N4AA 3P9KA 3RQSA 3WWOA 4D0LB 3K58A 1TA0A 1UBNA 3K9BA 5EP3A 4QE7A 5FUMA 2FK8A 3LBFA 3UJAA 2QVGA 2GM4A 2IPOA 1AF4A 2XADA 1NRWA 4TMXA 1WUYA 2OOSA 3F0TA 2VJBA 1IBKO 1G291 2OV6A 3M8KA 5JDIA 3GH3A 4FK8A 1R9GA 3GH1A 4WNIA 4DV5O 3WWYA 3QNWA 4PWZA 4L22A 4WV3A 3IJ5A 3PWZA 2GJSA 2JBWA 4BBZA 1FVOA 2CN1A 1K7EB 1Y5LA 3TFOA 1RJGA 2AZMA 2O0LA 1SG0A 3G2OA 1RJDA 3TW0A 3UHPA 4UPDA 1BN7A 3LUJA 4NJOA 3UK6A 3I6IA 5AHKA 3DDCA 1DIAA 1Q0SA 3L0YA 4DNFA 4L5AA 4DLYA 4D8UA 1QH8B 4BFYA 3L82B 1PR6A 3HTNA 5L3SA 1XF9A 5FOVA 4IR7A 1YQXA 2Q8QA 1LXCA 5AYVA 2HJWA 2WIFA 3QYPA 4HR7A 1TC1A 3QSYA 2JGAA 4LCEA 3BK7A 5THXA 4LDJA 2P7IA 1VBNA 3TD4A 3MTEA 3VR1A 2C2OA 5KSZA 2JGKA 2Z95A 3IUYA 4WWHA 1EBOA 2HWKA 4DQ0A 1TAGA 5LQKA 3LDFA 1XMXA 3H5TA 3K0AA 3DCYA 4FCCA 1LV7A 1QJCA 4NFLA 3DOEA 3B53X 2NT4A 2A59A 2V6JA 3F4BA 3PQ8A 3JZFA 3L70H 3SK0A 5J43A 2D13A 1JL3A 1GO3F 1CJCA 2ERXA 1LI4A 1L4YA 1XLTC 3AGQA 4P3XA 1O97D 3T5MA 3QXJA 3RROA 1QRDA 2EHJA 1YV9A 1TCUA 1Z2DA 4OXSA 2YFKA 1AI4A 4WGGA 3G7UA 4OA5A 9MHTA 4DY6A 3AI7A 5CLGA 2O0JA 2C8JA 1OQAA 3PENA 2XGSA 2J1LA 4K0KB 4Q4HA 2LV8A 4CTMA 2RIPA 1NFFA 2VJQA 3ZD6A 4XGKA 3BPZA 1U9IC 2HBRA 5D7BA 1N0VC 4K28A 2IHYA 1B14A 1JT2A 1I1OA 3BGIA 3FWHA 1UEXC 2WVGA 3P2KA 2GBCA 3IIMA 5CTAA 2HI0A 4PFQA 4M99A 5EK0A 2RGXA 3K5IA 3GC6A 4I19A 2R6R1 1MJGA 4I5EA 1FW8A 1BHBA 1L7DA 4RE6A 1TD1A 5EXDA 4F4FA 2NXJA 4UXNA 4GWLA 4I1SA 1VDZA 5JAHA 1CIJA 4RF2A 3A58B 2WHEA 4INJA 1PJZA 5DF1A 2W6PA 3Q6IA 1RWMA 3W5VA 1QR8A 4Y7CA 1ECCA 2R9RB 4N39A 5BURA 4EEQA 4CIBA 3PQ7A 4EJSC 5KAPA 1KY3A 2QPOA 1CP9A 4OQZA 3CZRA 1PN3A 1Z4IA 2J3HA 3ZXYA 1RTTA 2QRGA 2I7XA 3QKSB 2EW2A 3S4YA 1IPEA 2AN1A 2F4NA 1IXKA 1PVVA 1D2AA 3EIXA 3MT0A 4E5NA 1YS4A 2FTKA 4AJ4A 1NI4A 1YRQA 2B94A 1I2MA 3HR7A 1D2CA 4NWIA 2VTDA 1NLFA 3LC7O 4FR0A 5FUXA 2IH5A 2XVXA 1XDBA 4DLRA 1XJ0A 3R0PA 1JDZA 3F6RA 2A7QA 3ROKA 1M1KH 2W00A 5K3FA 1P75A 5BVGA 5AMXA 3QMMA 5K0GA 3AWDA 4B3FX 3K8YA 1AJEA 1HFJA 4PJ0Z 2HA4A 4AC9A 3APQA 3BK2A 1D2RA 3FIJA 3WR5A 4NUTA 5EQDA 4M98A 4F2HA 4MB0A 5F9HA 1XTQA 1XOIA 5DKFA 2YH2A 3C6YA 1E2DA 1D4AA 1AO0A 1K5HA 3V1YA 4PGAA 3U7JA 1G4AE 3L6RA 2GNOA 4NCHA 1VJCA 2X9LA 5B53A 3HA3A 3OQBA 4MRAA 5IDWA 1OAAA 4C4PA 2VC2B 1LSJA 3BRWD 4C8GA 5JEDA 3JRNA 1EJ2A 4RMIA 2CDRA 3PQ6A 2C2ZA 2BFPA 3D36C 2Z01A 1XHLA 4XOIA 3T2MA 1DADA 4OHVA 4ZD6A 4F46A 4HLCA 4YCSA 3FUUA 4PPQA 2R66A 1UJ5A 3OETA 3KLMX 1ACMA 3NPAA 3QE9Y 1AROP 2A0UA 3R6WA 5KVVA 4KWHA 3W9YA 2YXDA 3QUQA 4LIPD 4H77A 4Q3LA 3EXG1 5LXTB 4M9SA 1CJTC 3R0QA 2HNKA 4X3CA 3PJDA 1U2EA 4WKCA 1GNRA 5EGSA 4BLQA 3SJBA 2Y8EA 3GEIA 4ZVMA 4X8OA 3PUVA 4FM0A 2M6SA 2EV9A 3ZGYA 1QIDA 3T1YO 4DR5O 1I13A 2GPWA 1AX9A 3OKAA 4UMFA 3IQDB 4PNPA 3O9OA 3FBTA 2PAFA 3ASUA 4G5SA 5TF0A 1D6JA 1MIOB 3I9MA 3K35A 5IT9N 4RK5A 2INGX 3F71A 5AH0A 4WMLA 2C54A 2P0YA 3SR4A 5ECGC 2ZUCA 1JRLA 3SZGA 4DWJA 1DI0A 1KYQA 3U56A 4EHBA 1A8HA 3CCSV 3UJ6A 4FM9A 5AJHA 1NKVA 4DR6B 3AM5A 1QQ7A 2QVYX 1M2OB 4FGZA 4WLFA 1TUBB 1E1CB 3F47A 2ZOSA 3RRXA 4CMAA 5ITWA 4NCKA 2AD5A 1QJ4A 5FBZA 1NMXA 3JWIA 3EPLA 3E9DA 1NTZH 3HB4X 3TSAA 1G2QA 2P2GA 2QSUA 4Q18A 5LPNA 4NVPA 3SJQC 1XP5A 2IPLA 5TVKA 1PTKA 4L95C 2JI6A 1D7OA 4UM9B 2WM9B 4X9XA 5AW0A 5DGCA 2A5GA 2FWPA 5TGDA 1I3MA 2VYCA 1XO1A 3ULKA 5KS2A 5DTJA 4IL6Z 3I9V6 1U0NA 1SQ6A 3EC1A 3NNDA 1EZ1A 4X20A 3BRQA 1W0KA 2RHJA 2XMQA 3DE6X 1XPOA 3KTAA 4BTVA 1EVYA 1ZGHA 1QGAA 1F5NA 2ZSEA 3MUOA 1BXZA 4XD7A 2PGNA 4DR7B 4EMSA 4HYYA 4NENA 1EDZA 3FDZA 3DA8A 5DEIA 1Q90D 2O2EA 1WKVA 3QW2A 2J0QA 3OZWA 3NVAA 3OMNB 4MQFA 5HRAA 3IX7A 3QENA 2V7UA 3EGDA 3DCNA 3FCOA 3COSA 5GVSA 2E5LB 2QLFA 4H59A 2GBLC 1UKAA 4P58A 3T1CA 1NULA 1EJBA 1XDGA 2X8LA 5LZ2A 2VRWA 3LYHA 3QQ5A 2ZYDA 4C6TB 4HUQB 3KVYA 3AYZB 5LLTA 2E75B 1U7DA 2O2JA 1T2DA 4N5HX 4ZGBA 4B2PA 3KTOA 3MHSC 2NVUB 2VRZA 3C90A 3QOXA 3GZNA 4PYOA 3SJAC 3WDLA 2H31A 4E3WA 5DGIA 3PVCA 4DDWA 2HXSA 4G86A 1Q7EA 1FJGO 3SY8A 1JQ5A 3JR3A 1K06A 2R8ZA 1Y4AE 2WU0A 2C9YA 1YCFA 4FE7A 2GK6A 3JU3A 4L5YA 4P3PA 5HMLA 4E2ZA 3GA7A 4D0NA 4OPMA 4EB8A 2GASA 3QMVA 4TXMA 3S0WA 5CVVA 5I01A 1JSXA 1WXWA 2YOFA 5JI2E 3JCUZ 3EQ6A 1BMTA 5DRTA 2VG8A 2I1QA 3EZ9A 3AUAA 3ZZUA 1QLJA 1AUPA 3TD6A 2H4HA 4TXJA 4KYUA 3PDHA 2ZRQA 2PZSA 1D4ZA 1NW5A 3RGWS 2DMRA 2X77A 3WNDA 4AJPA 2XNHA 1F9EA 3NIGB 4N7BA 3GFQA 4XB6B 3FZGA 4DBZA 1RLMA 1A8SA 1V7CA 3UN1A 3TKYA 3W1WA 1PLJA 3I5AA 2QV7A 1SOUA 1W42A 5KPJA 4RENA 2H54A 3T7TA 1GPBA 4F3YA 3SVZA 3C97A 5JMPA 2MR6A 1C1DA 4ETIA 1F4PA 2IHBA 3ZDFA 3QV2A 3AEUA 5SV2A 1TZBA 2ZAMA 3OQVA 4G81A 3B60A 1L7NA 3ZD7A 1GZUA 2JJ2D 4FYVA 2CB9A 4ER6A 2Q0XA 4ZI5A 3M6XA 2ADFA 4K9RA 4IYIA 5HA5A 4RJTA 2WP0A 5GV7A 2GN9A 1Z0FA 3L7OA 2GVZC 1NP7A 1J8VA 1I5XA 3OEEG 2ZJ8A 3VR6A 1TIKA 1H69A 3OMXA 4CZZA 2H16A 4JKIA 2C2WA 2H1IA 3U7QA 1VC2A 1XTSA 4JZYA 2Q9AA 4PR0A 5AKEA 1XOUA 4Y8VA 3QLEA 4FHGA 1O2DA 2AFIA 1Q3HA 1WUHS 1PIWA 4C0AC 2AHOA 4PA9A 4M1YA 4YUXA 3DV0B 3C1UA 2P6NA 4R2KA 3BOSA 4H0CA 1BNCA 3HGQA 3L75H 3KCQA 2NGRA 1F8FA 3HV2A 5CT9A 3ZHOA 4BVLA 1L5LA 4LR3A 5EJEA 3LE8A 3ZY2A 3E3OA 4XQGA 3QH4A 1ABBA 4FFMA 7AT1A 1DAIA 5AW1A 2A0KA 3HE3A 4PZZA 3BB1A 2ZYIA 4QFDA 1AKMA 3BWMA 5DIZA 3HI4A 5FOTA 3BA8A 1ZDMA 3LQKA 1Y4UA 1K2VN 2V6IA 4LJYA 3U0VA 3M1IA 3JQ8A 1P91A 4H16A 2IOFK 3VOBA 3QHQA 3Q9SA 2YJTD 4A8TA 3W7SA 5A5GA 3WK5A 1UWVA 3RWBA 2JFHA 2OXFA 2O4UX 3S68A 1C1XA 2BOVA 1D5CA 3KOWA 2IHVA 1OLOA 4NS1A 2C8VA 4IRXA 1F3OA 5JATA 5MGNA 3GLSA 4BRUA 2R87A 4N6NA 4XW2A 4KFUA 4DR1B 1WB7A 4F6CA 5L6LB 2NTEA 1PWHA 2XRMA 1MMMA 2IOHA 2VSFA 4KXUA 1RWKA 1H0SA 4G41A 4Q6BA 5FO1A 2C31A 2QGFA 1GA1A 1JJ2U 3NI2A 3ZWYA 4R1SA 1MW8X 1Q91A 3SZOA 5AVUA 3G0DA 1M6YA 1BVUA 3MWDA 3LPMA 4HN4B 1YVPA 2YIVX 4WFKA 3BMCA 2W7TA 4TV8F 4ALJA 1OA0A 1V1MB 3EAGA 3LUFA 1G3RA 2DBRA 3OZIA 2QN1A 1AJQA 1U8ZA 1ZSYA 1XRNA 3EXHA 1W73A 4QWMA 2W0MA 3K9QO 4DAOA 2HMUA 2PD3A 2Y1CA 4MV6A 1VLMA 1C30A 1PKEA 4NLLA 1BCSA 1HDOA 3RRMA 5A3QA 1SXIA 1GTZA 5LMCA 1LDBA 1NJGA 3R1IA 3AIOA 1B7GO 1GQ2A 4FIPC 1AXEA 3CLTC 3H1BA 2MSDB 1UBCA 4F4UA 4ZI7A 4ZREA 3U80A 1DLBA 2DT4A 5B1EA 2YZNA 2WVAA 1YR1A 5FYQA 3NCTA 3LUCA 2RJNA 2YWXA 4Q6GA 2VQ6A 3TR5A 1RM1C 1WJGA 3RTBA 3B8EA 3SIRA 5D1NA 4A8JB 1S2DA 2R1VB 2IF2A 4P4LA 4H4DA 3WLSA 4MV4A 1YI8A 1N1DA 2LGJA 4S12A 5CCBA 1GZ4A 2H9YA 1EX1A 1H2NA 1B3RA 1OGJA 2B1RA 2C88A 4ZZ3A 4CGZA 3A1DA 1E2JA 1EP1B 1YOBA 3P20A 2FNAA 3VYTC 3W5IA 4OKSA 3ZK7A 2IYZA 2CMKA 4DQLA 1E89A 3H86A 1DU4A 1RMQA 1J0XO 2CD7A 3EZXA 4ZI3A 3CURA 3ZZMA 4YP1A 1L9KA 4JGGA 1ECPA 4XOUA 3U4MA 3FKJA 4BFLA 1M90W 3GN2A 2XGMA 3HUEA 3UYLA 2D2FA 1RAAA 3SHFA 1MRZA 5JISA 2G40A 4V3BA 2YEVA 2EZTA 2WFLA 2HQBA 2C7GA 4DZRA 2DY0A 1JDTA 4LV6A 2H48A 3CC2V 1D1PA 1L4EA 3G82C 3DE0X 1ITZA 5ADUS 5C46F 3S7TA 2XXJA 4II2A 1CP2A 4G5GA 3RF6A 4TZZA 4BT5A 3OE5A 3I45A 5AHXA 3NFRA 3BIJA 1WA5A 4E51A 1O9BA 1RQRA 2Y69B 3MMXA 4LRWA 2WC1A 2ZJ1A 2OVBA 5C5CA 1I36A 1BJTA 4JS0A 4B8ZA 4RHCA 4BNJA 4B3HA 4M2LA 5LMNB 2HNBA 3OR7C 1QHSA 4MW4A 3CBGA 4BO5A 3OUFA 3MXOA 5EIXA 3X1XA 5G0VA 3GAFA 4M6WB 2W93A 1JU4A 2B9EA 1YKFA 3I4FA 1NF2A 3RS2A 4Z1MG 3CWZA 5I7VA 1E62A 5CA1B 2OCDA 5EVCA 3OU7A 2PHNA 2C1ZA 1QHFA 1HNXB 1KIAA 3PU6A 1H5UA 1C3EA 3KKEA 4GICA 4Z9FA 4BGEA 2CGNA 4MA4A 1A3CA 2PT9A 2DVMA 4NFSA 5B3SB 2WHRA 3TG8A 2FE4A 4GLOA 1C9KA 3B5IA 2QE6A 3ETGA 5HCNA 4QX6A 1DJNA 1U3DA 1D09A 2BCGY 2XHEA 3SIXA 2WUVA 3ZKWB 5K6AC 3QY0A 1X7OA 3QLTA 2NPFA 2MOKA 4K6OA 1CZUA 4L0DA 2WWTA 3R5JA 2HH9A 3OBBA 4K9NA 3TUZC 2C58A 1IC6A 3CCLF 5AW3A 1NMYA 4GX1A 3CVOA 4FLUA 1SVSA 1OCOC 4I5SA 5GJCA 3NJ4A 2IUEA 4UCTA 3Q11A 3KZXA 5EC1C 3GLGA 1YRBA 3D54A 4C0LA 2HADA 1UMCA 4PCAA 4ZC1A 2COUA 2X1MA 4U02A 4MVWA 1AGNA 3L4KA 1XU9A 1SBIA 1AHNA 1WMFA 4UMVA 4L07A 3K53A 1O94D 2FSIA 2VTEA 4FZ5A 3GWZA 5AKXA 1EXDA 2I2CA 4C4YA 3AGKA 4KOAA 1T9GS 4M76B 2FLKA 4GS5A 1UBUS 2FFBA 4NZMA 1Z4JA 1P4HA 3ZHSA 4XPIA 5LBIA 1B1AA 2WVJA 3MINA 4QXQA 1VSTA 2JS5A 1CQZA 3C3PA 3S2EA 4MAMA 1R64A 3EFHA 2HCTA 3PSAA 1U7WA 4PZ0A 2RHDA 4JP5A 1M10A 2IQ5A 3K6RA 1NI8A 5KVQA 3U81A 1G5HA 4GZ5A 2Z1UA 4AN4A 2XRYA 1K7CA 5AFSA 2AIFA 4LA4A 1I3NA 4GOLD 4FJ0A 1OLSA 1QE0A 3RIHA 3DBLA 5I4IA 3W8NA 2PV0A 3USES 2DFKB 4XCVA 2LGWA 2GZLA 4J4TA 1YC5A 4K6CA 4KIWA 1UBHS 3ICPA 3AX6A 3V1UA 4GKVA 2ZI4A 3P10A 4GKAA 5KHIA 1E6CA 1RPAA 4FWTA 4M1OA 1JIVA 4P1ZA 4RQBA 4N7JA 5F5NA 1NDQA 1L7MA 3F78A 1NDHA 3OFND 3N1UA 3U6BA 1J2EA 1V47A 2WUGA 1O54A 8LDHA 1L8DA 4LVOA 3LPNA 3GARA 2EJVA 2BGUA 3WBBA 1JFTA 3NP9A 4FKMA 2NADA 3ZJUA 1XNQO 4BNVA 1RYBA 1F7VA 3BYQA 4FX2A 2I54A 1YL5A 4AJ9A 3ZYCA 1CUAA 3LQFA 2B8WA 5LKRA 3RYHB 2WICA 4RZXA 3D8SA 4P08A 2I4IA 1SBHA 2WSYB 4QVIA 2GETA 4TTTS 1YRAA 4FNAA 5U4XA 4D99A 4J10A 3H5AA 2UYGA 4N5MA 3BWEA 4NCXA 2ZATA 3AOGA 2Q9UA 4FLEA 1CQPA 1YXMA 3NWPA 1MH1A 3NLLA 4QQRA 5FEMA 2PVSA 1EFRA 1VSQA 3EZFA 3CH5A 2WLJA 1L1QA 3AV3A 5TJHA 1QIFA 1O94C 4XARA 5DK6A 4BL5A 3G8BA 3SG0A 4PN3A 1YF3A 5KNLA 3U7GA 2GPSA 3T34A 3HH8A 2CEAA 4OSEA 4E13A 4Y6GB 1JQ0A 4P34A 1W5SA 3RD5A 1F6DA 4B4VA 1R37A 4YGYA 1PR5A 1AQIA 1M2VA 1YMVA 3BCRA 3V8RA 5DHPA 2ODBA 1I2AA 3IS3A 1D5AA 2QTRA 1UQTA 3OQNA 1XTRA 1G8KA 1H1LB 2OWDA 4FYWA 4H08A 2P5TB 5G4KA 3SEAA 2X42A 4Z4GA 3TAHA 1EVQA 3QELA 4OHZA 4EQ6B 3KSBC 2PSDA 1S02A 3PIRA 3QUCA 3QGMA 3ZNOA 1T6XA 4KLZA 4TGLA 4NATA 3N8NA 2BEVA 2I5PO 1ZAUA 1IX9A 1TEHA 3WQHA 2JW5A 4G8CA 5HTKA 3UMFA 3B7GA 3OIVA 3UHJA 2RGUA 2QTFA 3DNPA 1Z0KA 3LCMA 2OWEA 3L7YA 1JDBC 4ZOLB 3OZUA 2IUUA 1L1RA 1SO8A 1OXBB 2AV6A 4X0EA 4R1QA 3KSZO 2XAJA 4MWBA 3WRXA 2Q1SA 1PV0A 1OHHG 4RUKA 2O59A 4L7QA 1GFIA 4X1KB 2ZUUA 3B1JA 2RAUA 2MINB 3IALA 2HP0A 2N1MA 2ZSBA 2FF5A 2PLWA 3SIWA 4EAAA 3AB8A 2P0EA 2WJIA 4Q15A 5IKXA 1AT1A 5HW0A