4O2BB

Tubulin-colchicine complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
molecule keywords Tubulin alpha-1B chain
total genus 168
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2bB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2bB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2bB01
4ZHQB 4X1KA 2R751 3HKEA 3HKBB 2XKBA 2RHJA 4B46A 3N2GA 3N2GB 4KWEA 4HNAA 4EB6A 5CA1B 1TVKA 4O4IB 4F6RA 2BTOA 5C8YA 5JQGB 3RYFA 2RHLA 5CA0A 5IJ9B 4M8IA 4HNAB 4WBNB 5JH7B 3E22B 5LXTB 5J2TA 5MN6A 4O4HA 4FFBA 4TV9B 5MN4A 3HKCA 5EIBC 5J2UA 4X1IB 4YJ3A 4IIJA 3WGJA 1SA0A 3WGMA 3HKEB 3ZBQA 4O4JA 5MN5A 4I55B 3JARB 4X20A 5LA6A 4F6RB 3WGNA 4X1IA 4YJ3B 1W59A 3HKCB 5EYPA 1Z5WA 4IIJB 4ZOLA 5CB4A 1Z5VA 5FNVB 4O2BA 5IJ9A 5IJ0A 3RYCA 1RLUA 3JAWB 5JVDB 3WGLA 3JATB 4U3JB 4X20B 5LA6B 1W5AA 3VO8A 4TV8A 3ZBPA 4TV8B 2R6R1 3VOBA 5LOVA 5BMVB 5EZYA 2Q1YA 5KMGA 2Q1XA 3UT5B 4IHJB 4LNUA 4LNUB 1FSZA 4FFBB 4O2AB 3RYHA 4ZHQA 4ZI7A 4EI9A 3HKDB 4O4LB 5BMVA 5LOVB 5KX5B 4O4JB 3RYFB 4U39A 2BTQB 3JATA 1TUBB 4U3JA 1FFXA 4IHJA 4O4HB 4TV9A 4DRXB 4I50B 5J2UB 4DRXA 3N2KA 3V3TA 3JALA 5CA0B 5EZYB 5JQGA 1OFUA 1JFFB 4YJ2A 5JCOC 4YJ2B 2BTQA 5IYZB 1RQ7A 3VPAA 1TVKB 4O2AA 3RYHB 4O4LA 2VAMA 1RQ2A 3N2KB 3JALB 3JASA 5LP6A 3C8LA 5FNVA 3JASB 5LP6B 2XKAA 5M7EA 4I4TB 3E22A 1TUBA 3UT5A 5LXTA 4X1YB 5J2TB 5IYZA 4TUYB 4TUYA 2RHHA 5ITZA 2VXYA 3HKDA 4DXDA 5ITZB 3JAKA 5LYJB 5C8YB 2RHOA 1SA0B 4I4TA 4O2BB 5IJ0B 3CB2A 3RYCB 1W5FA 3M8KA 3ZIDA 4XCQA 4I50A 5LP6C 4ZOLB 4EI8A 4X1KB 1W581 3M89A 3JAKB 5LYJA 5JCOA 5KX5A 4B45A 3VO9A 1JFFA 3JARA 3RYIA 3JAWA 5JVDA 4X1YA 4EB6B 5CA1A 2GVIA 2VAPA 2VAWA 4O4IA 1W5EA 4ZI7B 3RB8A 5EYPB 5CB4B 1W5BA 3HKBA 5GONB 4EI7A 3R4VA 5GONA 4E6EA 5EIBD 5KMGB 1FFXB 3RYIB 4I55A 4WBNA 5JH7A 3VOAA 3WGKA
chains in the Genus database with same CATH superfamily
4DXHA 1UK7A 4F2PA 1C7JA 1TMOA 4QQNA 4DLZA 4DRZA 5LGNA 1U0OC 2C9YA 4HH3C 4P22A 3I56F 4UAVA 2F3RA 3B53X 3RU9A 3LLUA 1ODFA 2H0RA 4RD3A 3L18A 3G1UA 2R68A 2M32A 4DLUA 2H8EA 1RTKA 3TIIA 3UCFA 3GZ4A 3OM1A 4QU9A 3JCUZ 1GK9A 5K3FA 2XAFA 3T7EA 3G0OA 1NMUB 5J23A 4R1TA 2VOJA 2XCSB 3THWB 2C4HA 3IB3A 1UP6A 4LCUC 4UPDA 4F92B 2QN8A 1JKXA 3RV3A 1U97A 5FIUA 4X3MA 5JNUA 1LBQA 1ZH4A 1OB5A 4PAQA 1XIVA 4B2YA 1YSCA 5L3SB 3W7SA 1QH0A 3DFFA 1LA2A 1Q0UA 1DKQA 1I3CA 3IAXA 1X7DA 3MIZA 4HDMA 2QSUA 2YN4A 5LLTA 3FAVB 2I76A 1VYTA 4NMMA 5IAGA 3UXHA 3P2YA 3W4IA 3E7FA 4EH1A 5BV0A 3LIPA 2ILMA 5CB4A 4MVRA 1NIJA 1ZD9A 2MHCA 1Q7YH 2D8AA 2IYZA 3E8SA 4WLEA 2QJ1A 3AETB 2CDRA 4IDDA 4RLQA 4BO1A 4BC1A 3WIVA 3AVPA 3L93A 1ZN9A 4N6OA 3U39A 4J1TC 4F9EA 5KJFA 1NJ8A 4CMCA 2P9JA 3A1FA 2H1VA 2I4NA 1YCHA 2PJUA 3L6OO 3PEUA 4LHEA 1QGED 5TPZA 3VR2D 3WPWA 4C5AA 1ZWZA 1HYQA 1NTRA 4ZAFA 4EA9A 3ENWA 1GGEA 1XL4A 3R75A 2GS9A 2DZDA 3K0KA 5I45A 1LF5A 1XCMA 4W9NA 3LUGA 2AC4A 4GX0A 1XELA 4JCCA 4KAAA 2O8CA 3UKOA 1YRYE 3I3SR 1S2GA 5JD4A 2CE4A 5DLQC 1FQKA 1ZNWA 2UUAO 3EJ6A 1IY1A 3MFQA 1KEEA 2AX4A 2FXIA 4DLKA 2NAFA 1DBWA 2FKXA 5LL6P 1L7PA 1KC3A 2RD2A 5C31A 3DGEC 1FJXA 1D4FA 1OA0A 2JIOA 3FF4A 4L5YA 4CUZA 4E21A 2C95A 3T9CA 4JGIA 3O9OA 1GL6A 3KT6A 1CW2B 2HQRA 3BJIC 4DCPA 5CFNA 4BGUA 2CLOB 2F1KA 1E3DA 5A2QA 1P3DA 3K2QA 1TQDA 1EQAA 1TVEA 4FNGA 4DCOA 1N5KA 4BRZA 1UI9A 4MGZR 1C1YA 3BG5A 1XDBA 2RCYA 4WZAE 5AJXA 3TNFA 2BY4A 1KO8A 1NT2B 4F1KA 4FM2A 4XAQA 1U4SA 3DLHA 4MCAA 2R1UA 3EDQA 1QLHA 3LUJA 5EHIA 2H2GA 4JI5O 1I5EA 3QEKA 2DWOA 3R20A 3Q2OA 1X7XB 3CR3C 4ED9A 2I5PO 3P2KA 1VHTA 4F5YA 2XZDA 4YRKA 5FUMA 4WBXC 1K0UA 1TGYA 3KYDA 3D8NA 3OU2A 1AILA 2B6NA 4R3UC 4UOQA 4W4KA 4I6JA 4MQFA 1UM9A 4J16A 3E2IA 1L5GB 5LU8A 3HZHA 1KC8W 3V97A 5ALTA 4A6DA 3IIIA 3GFFA 4JYPA 2KLBA 1L8LA 3K35A 5EEHA 4I19A 2ZUTA 1G38A 1PN3A 1UP7A 1Z2PX 1VGVA 3UAXA 2OCGA 1SHLA 4DUZO 2Y68A 1YB1A 1NVWQ 1Z5ZA 1VPLA 2IEZA 3EISA 3R5FA 1XCJA 4FCVA 2YWCA 3VC1A 1CHDA 3AR7A 2FAXA 3PHBE 3PC8C 2HJDA 3K7EA 4P32A 2PGOA 2RHRA 5CCDA 1L5YA 4DSOA 1WD5A 2RBEA 4FB5A 2KQUA 1FLVA 1UF9A 3H2YA 4FB4A 1X25A 2IEGA 1FQWA 1G63A 1KR5A 4LRTB 2LGJA 5DXFA 3ZV6A 2BM1A 2IFTA 5AD1A 2OPHA 2QKYA 3L1IA 2GGSA 3AZOA 4KP7A 1KEEB 2IYUA 1ZOIA 2VTDA 3Q8LA 1M5RA 4ZA2A 4QODA 1PL8A 2H8PC 2IP2A 2PVCA 3G2JA 4ZO6A 4XUGB 3ZWNA 3MMXA 2ZNIA 2D7CA 3MWEA 3OKAA 1I24A 1P4SA 1UBOS 1YA8A 3GH1A 2GH1A 1RQPA 1H8EG 2WICA 1JLLA 1YI2F 2CBGA 1SKYE 2MTBA 3DE2X 1MVLA 3DHEA 1QHIA 3RA5A 1DEXA 4YREA 4CL2A 3EGDB 5C2JB 2NACA 2RI1A 2OSBA 2QLFA 5DNVA 1NUHA 1U3WA 2LUOA 4WCFB 1O6CA 9ABPA 3O8QA 3W7BA 3NWBA 3NG1A 5C52B 1QE5A 1H4SA 4D79A 2ZUEA 3U48A 3ZU3A 5B1SA 3RYCA 1DS6A 3SC2B 5J4KA 3PNKA 4CDGA 4XB6B 2FP4B 13PKA 1K8ZB 1BA2A 1O3YA 2ETVA 4IIHA 4G97A 4OTZA 4TMFA 3KR9A 4BFTA 4INPA 3VISA 4CG3A 9ATCA 5KJ1A 1Y1RA 1PDWA 2G17A 3KYDB 4CM4B 5IT9A 4D4MA 4WCFC 1U2SA 3HCFA 4JUAA 4FFKA 3QU5A 3VZDA 4ZBMA 5KCZA 1H1LB 3HP4A 2JEXA 1ZCZA 3FM9A 2C20A 2QYTA 3P9ZA 4JGSA 1PJAA 1VE6A 2R0QC 3G88A 1SXQA 2CBXA 3FCOA 3QKUA 2I1WA 4GBED 1MOPA 3UGKA 4ZI7F 4CIBA 5J4LA 4PANA 3QTTA 1NWCA 1JVNA 3HFRA 3KL2A 2DQ0A 3I5XA 4E4EA 3D4NA 1ZJ4A 4QSMA 4BUCA 1NMQA 4BKQA 1DSSG 4RVSA 3I64A 3C3TA 1VE3A 3FYUC 3RT7A 4CQLA 5K09A 4JZGA 2VJOA 1J49A 2IJGX 1KD1W 2J0EA 2C4NA 2JLCA 1AI7A 1E2HA 3II6X 4B6SA 4IFBA 4G8JA 4XGQA 1IBMB 1P9LA 1Q3HA 3CEIA 3OC6A 1DV1A 2FK8A 2J4DA 3ISTA 3M5WA 2BOCC 3N86A 4DM4A 3RVLA 3B1JA 4XR4A 5DDIP 5FX2A 3ORSA 5AUPB 5LQMA 1HT3A 3L77A 4MYTA 5ULLA 3OJCA 5HX7A 5L7YA 2Y6VA 1Z13A 1RAAA 4MUHA 2IUEA 1YZUA 5CU7A 1HTBA 1L1EA 1EFDN 4OHXA 2CJWA 3GR6A 2QGZA 1HE5A 1QIKA 1VJDA 3OIDA 4ZJYA 5C80A 3PLRA 1JPUA 3ZQJA 1XL1A 121PA 3QYFA 1U28C 1N0HA 3IX7A 4NYIR 2BKLA 2HR1A 2IL1A 3N8HA 4OMUA 4V3CA 2QV0A 2GT1A 4G1VA 5DX8A 5K8CA 4OKNA 1MMMA 4DA9A 4J2HA 1E1YA 4J49A 1RCFA 2Q99A 1DKMA 3LV8A 2Q67A 3P9YA 4C3UA 3GZNA 2XNSA 1M0SA 2XCOA 4CF4A 2I34A 4YMUA 2CE7A 4V0LA 4J9ZB 1WUIS 3PWZA 3RTDA 2ARKA 3I05A 3ITKA 2MSLA 3H3FA 4XDYA 1JAYA 1H6CA 2R6HA 2ZQYA 1BZYA 4FZ3A 3EMBA 4HNSA 4QHTA 4PTLA 2VO1A 2N04A 1KC1A 5F77A 7GPBA 3SIVA 4YCJA 4BMYA 1VP7A 3DXRB 3BMQB 1BE1A 5SYAA 1VIDA 4BZZA 3NVKI 4DY4A 4GMKA 5JXHA 1M2JA 4ND5A 4IIDA 5E3JA 5F1KA 1T9BA 1HORA 4XBFA 1UC5B 2W4MA 1OIXA 5I7UA 1Y42X 2EIMB 1JFSA 1F3LA 1CERA 2ZXWC 1P29A 1QM5A 2HNBA 4FLTA 3C3SA 2P65A 2B21A 1C7EA 3KVYA 3LWBA 4HVAA 4WNIA 2JCXA 2XDQA 4UXIA 5SV2A 4I36A 5TRTA 3T4XA 4P0QB 5DSZA 5MF6A 5DNCA 2H16A 4M98A 1RRMA 1YZQA 2PSHA 3LUFA 4JBYA 3HB1A 3JD3A 3TJZA 5JPDA 3B8HA 2OMEA 1YR6A 1E4OA 1QHSA 3J81N 1T2NA 4JLBA 2ONJA 4TLCA 2ZT6A 1IZYA 4EENA 3DDSA 1PF5A 1OREA 1ICEA 2W6JD 4LJ6A 1B1AA 4HB4A 3RRYA 4KIUA 3DF9A 1N4AA 1V7QA 2LO1A 2NW6A 3CS3A 2V45A 3B12A 2VXOA 3H0EA 3FUCA 2VA8A 1A5BB 1TQ8A 1QZ3A 3X2EA 1PSZA 2P9YA 5BSVA 1DG3A 1F8YA 4MVJP 1R6VA 2ERXA 3X1WA 3K0HA 2DY0A 4Y9SA 1NV9A 1I2CA 3GFPA 3DTVA 2VYQA 5LZ8A 2WLKA 4DDKA 4EUFA 4N8DA 1KU9A 2P91A 1PJ3A 2IBMA 1DDGA 2Q9BA 2V1DA 3LNCA 4V0OA 4WK2B 1IHOA 5KMGA 3MVEA 4CEJA 1YVPA 2OBBA 3FOZA 1SK9A 3NORA 2IP4A 3D8RA 1VZ2A 3PDHA 4JC0A 3DVRX 3A6LA 4NYJR 2DPHA 2BFFB 2BIFA 3CG0A 1T2UA 1MOQA 4QDJA 1X86B 1YWGO 4F7WA 2BTQB 1PL6A 2WVGA 4PRYA 4LJ8A 4PQRA 3RS4A 1VQ5V 1II9A 4F3YA 3N2KA 2CZGA 4CKWB 1T1JA 1G0NA 2ITDC 2CLSA 3ZVNA 2DHEA 4BB5A 3K9CA 4TZ0A 4LJ5A 2DYSB 3LVFO 2EFCB 4M1ZA 1R8JA 2CJYA 4C6HA 5FI3A 3EUWA 1DJOA 1HYGA 4FGZA 1QO0A 4HGRA 1KZGB 2IHKA 3TWOA 1PYDA 2XHZA 4PDVA 1GSHA 4EK9A 1RFGE 4Y2RA 2GPTA 4GLFA 2X2OA 4D6YA 4DV1B 3SHFA 1U98A 1UAAA 2HA4A 2HJFC 1FAFA 1D2AA 2BC9A 3F9CA 3HVHA 3ONWA 3VDMA 5JYCA 3QVGB 5I9TA 1D6MA 2XB2A 1XDWA 2NUTB 1ODEA 1C0EA 3MS4A 2F8TA 2EILB 4QGPA 2P1RA 3BFKA 3D5EA 3CS5A 3TSAA 5CDYA 4FLWA 1FDRA 1WUJS 4YJ3F 2FQ1A 2XITA 3M8KA 4K3AA 2GLZA 2PD4A 4TKLA 5CFLA 3X1YA 1F4MA 4PI2A 1TYCA 1ZH8A 2GM5A 5FLXM 4YO7A 5MHTA 2IITA 1VOTA 1YI2V 2YRXA 3KJQA 3PFHA 2A9JA 2DFKB 2JIPA 4RK6A 1EAMA 1JHXA 3BFPA 3MCVA 4M8LA 4U0KA 2AI1A 2C8VA 1NULA 3AEXA 4RVOA 4KWCA 3LWNA 1WUKS 4PSAA 1MH9A 1NXSA 3W1WA 3PIDA 3GW8A 3FTPA 3KJKA 4OOFA 5ALUA 4JU9A 1JE0A 2HK8A 3DBHA 4V24A 4B6FA 4R0VA 2FMIA 4ISBA 2C9BA 5J9FA 5ES4B 3VU3A 2ICAA 3M5PA 3G5MA 5IYCO 3LMEA 5ABPA 2BFBB 2YVKA 4KOAA 3UMFA 3LF1A 4JI1O 1PLLA 4Q02A 3H1BA 3V1LA 4GG1A 4RIFA 1ZDMA 1FSSA 1DAGA 3SCZA 2OTMA 4OHOA 1JHQA 1ZSYA 1NJ2A 3UB3A 5C37A 1OKKA 2W22A 5CLGA 1EM8A 2PNFA 1PWHA 3CSSA 3I5UA 3F2VA 1MQAA 2LKDA 2VBGA 4HADA 3JQFA 4OGGA 4RS4A 3MK31 5T41A 4DMKA 4ZYXA 3ITEA 3A31A 1RAIA 1F2TB 2W0MA 1U8ZA 4XQ9A 3UMCA 4Q6WA 1VF7A 4JHXA 3N74A 5BP7A 5JXWA 1TCUA 1Z62A 1B8VA 2AG6A 2X8AA 3AESB 3IKMB 5ALHA 1CUCA 1K9VF 2P06A 2C9ZA 2H2IA 2AT1A 1ZVMA 2HF2A 5FP0A 3ZOZA 3AVTA 2OCXA 3IIEA 4Q6GA 4DM7A 4RQFA 4M1WA 4J6FA 1ZAKA 4CQMD 2IS1A 3OZIA 6ABPA 1N1GA 3TTWA 1V5GA 4YCBA 1LDYA 1ZK0A 3PUVA 1ZNQO 3K0SA 1BDMA 4JYBA 1Z74A 4J7JA 2EIHA 1A5SB 4UVDA 2JGDA 1T2DA 1TF5A 3EWNA 3MS2A 3P9KA 4MVJI 3CCMF 3B82A 4RF3A 2X0EA 4MKFA 4KGZA 3UMYA 1E3WB 5IDQA 3AERA 2GZDA 4IINA 3LUPA 1M72A 1QIDA 5BQPA 2GAJA 1X70A 2E6KA 1SR8A 1PTKA 2XA2A 2P4KA 4BB6A 4RXTA 3RUAA 1R0KA 2IK8A 3EA5A 1G8YA 1O95A 1G8GA 4O4IF 1N6HA 4FSHA 4OMCA 3FD6A 3V7FA 4X8AA 3EG9B 4U39A 1R4NA 5EUQB 5EWJB 1LUVA 2KTUA 1W0KG 2BR5A 4AG6A 4M0EA 2LDBA 4QUIA 1BJRE 3IESA 2CL6X 4GLBA 4IIYA 4JEMA 1CTQA 3A9TA 1DHRA 1EB9A 2JEOA 2LIVA 2WDPA 2FRDA 4GPEA 4MR7A 2P7IA 3GEPA 4CFYA 4CLEA 3WC4A 3CE6A 1E9BA 2WU4A 1B6RA 3VCZA 2OXFA 2VHQA 3KB2A 3KRTA 4PPYA 3JWIA 4GI7A 4ETMA 2JFHA 2MU1A 4OQPA 4KV7A 5IBCA 3K9LA 1B2RA 2HL6A 4RMJA 3ZBHA 2DUUA 2P8SA 2R1TA 5AHWA 3IBCA 3KTOA 3DSRA 3EZ7A 4JGBA 2VBIA 3A0RA 5LVAA 3OLYA 2GD6A 1JRLA 1R8YA 1R0YA 5DIFA 3PC2A 4XIFA 5H68A 2EKBA 1H2LA 3DKPA 3NGMA 3QEMB 2Z5VA 3EGDA 3H1JH 2EXXA 5DTIA 1BXGB 4N39A 4RJKA 5FORA 5I4BA 1KVUA 5LPNA 2JAXA 3IAEA 4TT3G 2I6RA 2VSFA 4XCQA 1KZ9A 1XN1A 1SF9A 4KQHA 2EBUA 3HPQA 2OHWA 5G3YA 4M22A 5HDBB 3ZC3A 2HPZA 5D6NA 3TGLA 4BIMA 2AZ2A 1CRQA 1A4RA 1RAGA 4MKZA 1DF4A 1G0OA 3UM7A 1NI3A 1XZPA 2VK8A 1EUZA 3KDSE 1E5XA 3DQPA 5ALMA 4CLXA 1RWVA 2YNMC 5JRZA 3U17A 3AHFA 5LQKA 2WPDA 3QFFA 5BUQA 1HTTA 3PGMA 4JI0O 3KG2A 1W8IA 1VSBA 3QV1A 1SQ6A 5D84A 3QVNA 2IGBA 4X64O 3QY0A 5D5HA 3UY4A 3LY8A 1WB5A 1KP9A 3CMMA 1JAZA 3DP9A 4QBGB 1U2RA 1I4DD 3OX1A 4CL8A 3FJYA 4GPZA 3NUQA 3X2QB 4ZOEA 3H9EO 3H9JA 4GOLD 721PA 4DV0O 2RHJA 3Q0EA 4IX9A 3WGHA 5EC2C 2PS0A 5KYYA 2CXPA 2A92A 1DX9A 4UXHA 3QMPA 3EARA 2HRDA 1SD2A 1YIJF 1BW9A 1E6UA 5KUMA 3AEUB 3DOFA 3FIJA 3OTWA 5K3BA 1E7YA 5BOSA 1GRQA 3IOCA 4PF1A 5KQRA 1KQSU 2GLTA 5B2EA 4NCAA 2FGYA 5IMSA 3HVJA 5BUCA 1WXIA 1NVVR 3E53A 4WKBA 3R7DA 3IT3A 1OYVA 2Q3CA 3IOEA 2HIHA 2KLHA 4KNWA 1UWKA 1U94A 4NU0A 1II8A 4HL6A 4NESA 3DBIA 3V4OA 3GA0A 1ODJA 2ZE7A 1MR3F 4R9VA 4R50A 5JASA 1OYOA 1E58A 1THMA 2H29A 4UEKA 1FFSA 1I0IA 1Y0BA 3GWZA 3VZQA 4ABYA 1Y4MA 1V3VA 3A0BZ 1L1FA 4U7PB 2VZ9A 4DJFC 4KFCA 3N27A 2XBLA 3WA7A 1E6EA 3DFZA 3LXXA 3R5JA 4OGKA 4UMFA 3I5YA 1LFAA 5H9WA 5FB3A 5KNBD 2H1OA 1YS9A 2B7LA 3MOSA 5DRYA 2J0UB 5GTDA 2E5WA 4L7QA 5HM8A 4Q19A 4EG0A 2ZULA 3ZVLA 2IDZA 4PN3A 4JEIA 1L6IA 3FPGA 1DC5A 3DD1A 5DTEA 4GKJB 2I6FA 2VQ3A 3BMXA 2EINB 1WCWA 3X1JA 4CM3A 4ZEMA 4MS4B 4NWIA 1Q7YW 5HPYB 4OJKA 3QG5A 3V8BA 3RVOA 1REQB 1ZRSA 3D01A 2J32A 1XDUA 2AXPA 1BCSB 4ONEA 2W48A 2X7XA 4UBKA 4OPAA 1D04A 2GAOA 4C2TA 4NCIA 1HQDA 3GRUA 1HG0A 4IIXA 2F3QA 3JATA 2XF2A 5JSFA 2V6JA 4LZJA 4UASA 2VK1A 5HHTA 1D0SA 3G8BA 1WOYA 2G07A 4ZQCB 3RREA 2O19A 4CS3A 2OBFA 3AVQA 3PA8A 1RKQA 2L18A 5FPHA 4QELA 4XX1A 4AYTA 4FSXA 5BYBA 3U3RA 4COKA 2RKBA 1LPSA 3T15A 1DZ3A 4RGVA 2JFVA 1TO2E 1XWFA 221PA 4X60A 4D9MA 3C8LA 1JFLA 3QXSA 3S0HA 1KEUA 3B8MA 1JBKA 2GTHA 3ZH9B 4Z53A 2P9QA 2VI5A 4ND7A 2GO7A 2LPMA 4W7SA 5EZSA 2ZIWB 3SM3A 1QH1B 1BH2A 2C3PA 4JDPA 3H2SA 5REQB 1W4CA 3QE2A 1W1UA 3QUAA 1V5EA 2WZBA 4Z7OB 3QNEA 4OJQA 2YYYA 5K0TA 1YZVA 5C8XA 3QXCA 2POQX 2HWYA 4MV7A 1PGOA 1SUPA 2YFKA 4ZU1X 5IAOA 1ND6A 4XLTA 1RMQA 1LK7A 4PWYA 1L5HB 4UVIA 2SBTA 1EVZA 1W581 4NJMA 2XUGA 3FDFA 2BKVA 5PGMA 1DRWA 5LQNA 1X1DA 3LDFA 2C04A 1IXZA 4U0JA 3VC3A 1S1MA 1DIOB 1UEIA 1YS4A 1BQ3A 2QLBA 4H35A 4TV8F 4DCGA 3N8KA 4F9TA 2C29D 4CKXA 3UJ9A 3S2FA 1APBA 1D7OA 5A0VA 4G5YA 4Q1VA 5EIOA 1ZW1A 3E5NA 2OYRA 4YXFA 1UZAA 1P9NA 3K1YA 4IIJF 4UPVA 1KC8H 3BMQA 4V0ME 2CHQA 4F85A 4H6XA 1K7DA 4AQDA 2VDRB 2V7XA 2ZCVA 1HMPA 5AVTA 1QV6A 3U19A 4HAZA 5H59A 3IUNA 3TM5A 4A4DA 3QVLA 3T4PA 2BEKA 1JXAA 3L4BC 4DKJA 3HJBA 2DMXA 1HGXA 3PXAA 2YBDA 1EN5A 3T3DA 1U43A 4YLEA 4ARVA 3ETEA 2H1IA 5EXPA 1QRAA 3KKOA 5EE0A 4TQAA 1C3LA 2JLWA 1A7JA 3G9UA 4IDBA 1NBMG 3KXIA 2UXCO 1IDSA 5C8YF 3TTVA 1VG0B 1M6VA 3AHIA 3CLRD 4Q9HA 2N1MA 5B37A 3UWPA 4N21A 5TSDA 3C8UA 3ZVRA 1BU5A 1E4YA 2XMBA 1JFRA 2HLDG 4WBNF 3WGJA 4CM8B 3JQAB 1TLLA 3IJ5A 3O2JA 3PJRA 1PT7A 1BS3A 3GNLA 4JJ7A 1KERA 4NENB 3AUAA 1CBUA 1QV9A 3OTOB 2ZWAA 4P0PB 4X8OA 2JLYA 4FLFA 4K2AA 2QP4A 5CEEA 2VTKA 3A1VA 1JIUA 3EFOB 3H6KA 2P30A 3B8EA 2VSYA 4MJ3A 4NFHA 3PVZA 1XRLA 3PXDA 3EULA 4TLDA 5DO9A 3C6ZA 3N5KA 1SCUB 4NBVA 1BMQA 5K3OA 1W5AA 4C6SA 1NJ5A 4IWYA 2UU9B 1R16A 2JDIA 3HG7A 3L8EA 4B32A 1VQ8F 2HUNA 4CMIB 1QOZA 1JY8A 2YS7A 4YJ2F 1XF9A 2C7BA 1KO5A 1Z33A 2X5KO 1H2RS 2YMMA 3DAYA 4J07A 2YS8A 2II6A 3VZRA 3W8RA 4A91A 1YTFB 1UK8A 2Q7DA 3ZDAA 1P1FA 1U0RA 4AF8A 4WVFA 5DW0A 3HCEA 2W2NA 3DLAA 4TWZA 1I7DA 1RDFA 5FWYB 3IHKA 1ZIOA 3LGXA 4CIWA 5ESRA 1JDBC 2RC6A 3NNDA 4N8EA 3WNCA 4BB9A 3K5OA 5SY4A 1MB2A 1DGQA 3ADKA 3I55F 5D6OA 1CY2A 4X66O 4BIZA 2JI8A 3TEFA 4C21A 2FPLA 1QBKC 2IOFK 1UDRA 2QRNA 3N0WA 1BQZA 1WKVA 4AKEA 3CR8A 4Z1MG 5IZ4A 3T3OA 2DYRC 3E9EA 5KHLB 1NQOA 3FD8A 4F46A 5AVMA 2DTDA 2VT6A 2F8LA 4PQGA 1KZYC 4GECA 2W2QA 1H2MA 1MT0A 3PXBA 1FB5A 2NUPA 1QIEA 1VCMA 3KAPA 1TGOA 2DYYA 1ZOSA 1TM5E 2AUNA 2ZJOA 4MVJF 4U2EA 3EVZA 3N28A 1ODSA 2RHHA 3NV7A 2FX5A 3PR1A 3BL5A 2LJ2A 1L4MA 2GBFA 2I2FA 3L7MA 3NH9A 4MTOA 4ND3A 4V0SA 4ALMA 1NSYA 2YV4A 3K16A 5IKXA 1JWLA 2VDWB 2JCYA 1VC2A 4GOOD 3O26A 3DMTA 1WNTA 3OOHA 4DLSA 2P75A 1W19A 1VDZA 1ZONA 2XX3A 4IDOA 4IH4A 2M98A 2RDMA 3M1YA 5DGCA 1NDUA 2UUOA 5GGXA 3U4CA 3QIVA 1JFFA 1IL0A 3C7CB 4OYYA 3SQOA 2XYPA 4B79A 2WLLB 4JF3A 3NALA 4R2HA 3VVMA 1QRTA 3S70A 4EY8A 1SRYA 1GN9A 4DJEC 1VSUA 2WAMA 1G5IA 3CU5A 5T4FA 4Z3OA 1YXBA 2UXBO 1A9ZA 2FPPB 1ZLYA 2PT9A 3H84A 3L0IB 3OZWA 2TRSB 5ESDA 1CZNA 1HZZC 4AJEA 2F9FA 7REQB 3EVCA 3S2SA 3TYXA 3SJ7A 3GLFE 1MHTA 1R6TA 2WJ4A 4GEGA 4QEZA 3B7WA 2EL7A 4P1ZA 4X8MA 5F2NA 1Z6PA 1QBGA 1GUDA 3K4HA 4HDOB 5I5GA 4BMZA 3H9BA 3HU1A 1KMHA 5U1PA 1F4LA 1MRSA 4WGFA 4B43A 1K3EA 3LNTA 4LF8B 4FLMA 3BUSA 1GL3A 1GCIA 1T0BA 1C41A 2ZCUA 2MT9A 2RHLA 5CT9A 3CURA 3GIDA 4LZLA 1A2BA 1UPCA 1PNOA 3JZMA 3OMNB 4YY3B 3N9IA 1RC0A 3QVSA 1WF6A 1QHHA 1CK2A 1UFYA 1FTGA 1SHTX 1XTSA 3PLAC 4BQRA 3CE2A 2B6HA 2C9CA 2I66A 1SUBA 4MINA 4QFCA 3RJZA 5JH7F 3WGMA 1IPFA 5BWNA 2HVYD 4M0CA 5ALYA 5HBRA 3B2EE 1GU0A 1Q17A 4XQGA 3J81k 1XZFA 2IM9A 1Q50A 3L6UA 1E79G 1Z8FA 2Z83A 4MRVA 4H13B 4MV1A 4A26A 4YT8A 5A2GA 1I4EB 2GB4A 3EFEA 3GT4A 5HIAA 3E8FA 1J0EA 4IYJA 4TXHA 1Q6UA 3OUFA 2JK1A 3G5LA 1TYDE 2QD1A 5KWVA 2WHQA 4A8JB 4A36A 4ZT3A 1NQUA 2ZDIA 1U7ZA 2YQZA 3JATB 4DV3B 4MYSA 1W88B 4NP6A 3IFSA 2R6ZA 1Q7TA 4HLQB 5C9ZA 1GT6A 3ZDXB 4ZDJA 4MYRA 1QVVA 3H6GA 2PGDA 2TSYB 4JV5O 1IN5A 1XEQA 3AMVA 3GP5A 4HYQA 3VU0A 2I6QA 1YFJA 2YXYA 2CDYA 3BTUA 2OFPA 1NUSA 4G4IA 3OJEA 4I0WB 5LZ9A 2IT1A 1G5PA 2A5FA 3QTLA 2VTBA 2ZVYA 4LHXA 4KXUA 4EY4A 3MCAB 1FLNA 4RHAA 1CJBA 2PYDA 3TXSA 1SOWA 1U2GA 2CHUA 4KQ6A 3WRWA 4NENA 2GO1A 3KFVA 2GTIA 1N8RH 4LFCO 1XAGA 3CA8A 3SNKA 4NABA 4W8GA 1TLTA 1ZGBA 5HRAA 1NXQA 3DZKA 1FLAA 1Q0PA 4HB3A 5LUAA 4DBLE 4GO1A 4G2TA 5K3DA 1QFMA 4PGAA 2NTYC 4RZXA 4UTVA 4QHSA 2HBQA 4XKJA 3A28A 4CQJA 4DG9A 3INGA 4K46A 2YJNA 4BU0A 1WY7A 1K2WA 4P38A 1Z6QA 2C57A 3DAOA 5A4MS 1M90H 1T5SA 4FX5A 3HB9A 4LRWA 1USUA 1W46A 4UCFA 3RTAA 3RAEC 4C9BA 1MX5A 2FWNA 5L7TA 1DAHA 1PZFA 4GZMA 4UVHA 3T4UA 5CFZA 1SU7A 2YXZA 3X1DA 1KMIZ 4ZGGA 3KETA 1RWOA 1KR2A 2CKDA 2VYCA 3QKSA 3BKXA 1PVVA 4IILA 2R4UA 4DDTA 4RH1A 3L5OA 3AYXB 1Y1LA 1PZEA 3ERCA 2ZS8A 3CGWA 3N2EA 5AWFC 4H7HA 1HK7A 3OU6A 2DBYA 1EUCA 1FXKB 2WNSA 2G9UA 2XECA 1WETA 1WN7A 4DIFA 1SBIA 1WABA 1MPTA 3M6WA 5IJ0B 4PZCA 3KQVA 3AK3A 1JPXA 4UAUA 4XA8A 5DXJA 4G0VA 1P7GA 1M74A 3M6MD 3EVNA 3FTQA 3KKQA 2XUJA 2VEOA 4J2OA 1S96A 1HYBA 4NOKA 2CTRA 2ZBDA 4U02A 5JC1A 4RPIA 4ZI5A 5JVDA 4RMNA 8ABPA 3B89A 4Q1AA 5EWMB 4LF5O 4KGXA 4ZV4A 3FF1A 1VKZA 4MR8A 4UCUA 2PTHA 2QVLA 5BSFA 4D0SA 1JIJA 4AI6A 4EB3A 1AVMA 3RV4A 4WL0A 1FFXB 1BL8A 4B31A 4ZMBA 1JKIA 5ERYA 5DXAA 3FB7C 2R62A 3WGKA 1T4DA 4RXMA 2AMTA 2ZR0A 4TS4A 4QAQA 4DHEA 4BO5A 5B7NA 1ZQ1A 1UZNA 1T5HX 3GP3A 5ARCA 3QFSA 2G4VA 5FBRB 1COWA 1IBKO 1Z0KA 4WZBE 1EFPA 1Y9AA 1M57B 2QZSA 3O3OB 4DOMA 3AVVA 3SJZA 4LZPA 1JSLA 2EWCA 2JFOA 1Z0ZA 3UNXA 1H2NA 2JGDB 2O3TA 3MFYA 1Z83A 1VF6C 1Y3CE 3EIEA 3ONNA 4PCAA 1U1CA 2OHIA 2GKOA 3CRAA 3A3YA 3F2IA 4BAYA 2AMVA 3ABTA 3KOYA 5AKLA 1FX1A 2ADQB 2RNBA 3W5VA 2NLJC 1AHHA 1S9DA 3MJSA 1ICIA 1U7WA 1UC4B 2FZCA 3OY2A 4GW3A 4OB8A 3LNNA 1L7NA 1C7IA 2CL5A 3JQGB 1XLUA 3I55V 3C8DA 2GCPA 3DTVB 3ILHA 5EGNA 5HUHA 3P9RA 3Q2IA 1PG2A 4NEQA 2OK8A 2R8OA 3A6KA 3AF3A 3OE7G 4K05A 4WN3A 3ZZ0A 2MOKA 2QPLA 3FMOB 3LAWA 4KYIB 5FNVB 3FHLA 5F4BA 3UV3A 4BHTA 1F0NA 1BX1A 1CSEE 1XGKA 1YIAA 2J0SA 3EOBI 4JT9A 1U90A 1LWOA 2B92A 1EESA 1K7XB 2HSDA 4DV1O 4LGVA 2UYNA 1FDUA 1O9HA 2G25A 2IZ6A 3A1CA 2QI9C 1XO1A 3D0QA 3LA8A 2BMAA 5EJAA 3WKAA 4CT0A 1EX1A 4HSEA 2X23A 1S4QA 1NR5A 1THGA 3HRHA 3HU2A 4ZAYA 4PBRA 3HM9A 2COUA 4JVOA 2H2DA 3IR9A 1SHUX 2OVBA 1GAQA 2GAAA 3MJTA 3QM1A 4XE5A 5EZ6B 3S7ZA 4URUR 4LQ4A 4UZFA 5EMJA 3FBWA 3CZAA 4KJXA 4ZU3A 3L7QA 2GCEA 2B3DA 1S3FA 1XDZA 3GNSA 4L9RA 4DR3O 3MJEA 2WLHA 2QQFA 3VR6H 4MQEA 1D2CA 5B58T 1WM1A 2H3HA 2H4WA 3OZUA 1NYQA 3Q12A 1W4AA 3CWQA 4ZKEA 1FP6A 3WXMB 1O96A 2RH4A 3QEOA 4JB2A 2BFEB 5AW5A 5JQGA 3H86A 1H0SA 4YLYA 4XVCA 4UM7A 1SH7A 1GZ7A 1TJ4A 3H4IA 3MELA 4J4BA 4D82A 3SICE 4ZHQF 1RQ7A 4ER3A 1BN7A 1N36B 1DKRA 2H1HA 1CFJA 3BC1A 3L0PA 3QX9A 4V1CB 2ZRPA 3I2FA 1V8ZA 3DZFA 3ZKWB 5M7EA 3P9IA 3HDJA 5CVVA 5KYNA 1R66A 2NV2B 2YDYA 4G9EA 5DLPA 2RI0A 4W5TA 2XDYA 3QVWA 2HPVA 2AKYA 3ASNC 2GOYA 3H1FA 4GSKA 4CKZA 5FUXA 1P72A 2Z3YA 1RQXA 2D1TA 2HJWA 5ETJA 5FR2A 5HP4A 3DMGA 4U2FA 3BBLA 1GN2A 1VQ9V 5JUWA 3D2CA 2DLCX 1XZQA 1QHYA 5IDWA 1K9MH 1E64A 2J5QA 2ZYUX 1N7IA 4JR2A 5IT9M 3ENQA 4MO2A 1V55B 2PKWA 3REGA 3VYUB 3OCWA 2FSSA 4ZOQI 4A15A 1P18A 3VU9A 4NAHA 1J95A 5DFAA 2AX3A 1Y6JA 4I50F 4IZOA 2DH6A 3S2UA 2HJVA 3GFGA 4IOKA 3RRMA 5HS4A 1DC8A 2A8YA 1UQTA 3FDZB 1EVYA 2CXRA 2V8BA 3LIIA 1YZFA 1R5OA 1XZAA 2Q6VA 4I99A 3GC6A 5A06A 5JPCA 5TIIA 4MQLA 1D5NA 1L7DA 1KQ3A 4H1TA 1F38A 3IP8A 4CR8A 1JJ2F 3M49A 1J7JA 3GD5A 3HKBA 3P4YA 4PGMA 4QTTB 4RD6A 1SIWA 4RK1A 4TSFA 4CETA 4Z4IA 1RWNA 2PPLA 4DFDA 5DECA 3O31A 2Z6QA 5HIKA 4GL4A 1GUBA 2R2GA 4IM7A 1EJ0A 3OBYA 3BYZA 4H08A 2LRHA 5ICFA 3U62A 4DUYO 2ZBQA 4Y9RA 3USES 3U7EB 3TLKA 3LDEA 3I8XA 2A7QA 2EJVA 2WE7A 5HKBA 2IDMA 1T26A 1EBUA 1FFAA 1QQ5A 2QT9A 3LVBA 4IMRA 2D0IA 1HH4A 5DM6V 4DLXA 5IWCA 1R18A 1Z07A 4BUZA 2XTAA 1L4LA 2Z08A 1XEWY 1YD7A 4PSVA 4PSKA 3B60A 4A2WA 2ZD9A 4YV2A 1AGPA 1N2GA 1NF8A 3SC2A 4R2LA 1W2BU 1QVGU 3H5RA 2C97A 3WWPA 3TGUH 1NUQA 1KJQA 2YXBA 3HDHA 2ZODA 1B6GA 2PVPA 2HVKC 3IUJA 4DHWA 5JZBA 1ZA2A 4LF5B 2QTWB 2H3OA 2OCHA 3F5DA 4LS3A 4UBMA 3N2IA 1VQMF 3NKFA 4AL4A 5KHKA 1VQ1A 1W2GA 3IQXA 3K3PA 4ZVQA 3FKQA 4BMDA 5HYVA 1UOOA 4WZAB 5E1MA 2A9PA 3QBJA 5HY0A 1QAMA 2OP0A 1Z7YA 1R4MA 2FY8A 3OQBA 3PPYA 1PJ8A 1E3WA 3AKCA 3RBXA 3T1YB 4L8LA 5AK4A 1US8B 2PY6A 3I04A 4GYKA 1U2PA 2BLLA 1N0JA 2CH7A 1TA0A 2H4XA 4PLCA 4RQAA 5DNEA 2BSKA 3ANXA 3UHOA 3IT1A 1EK0A 1USGA 1VQLV 2G70A 2ZFUA 3BWVA 1JQEA 1Q95A 2WIJA 3AR6A 4KDFA 2FPPA 4FGUA 4OQ4A 2AHOA 4RD2A 2A4MA 3EWAA 5BXYA 5KDDA 1MXHA 3D4PA 3OZGA 5THXA 3GLQA 4CDMA 5C4MA 9MHTA 1JEOA 1V55C 2XQIA 2Y1CA 1G8MA 4H3SA 3ZZNA 3R77A 1QH8A 4M49A 1KI6A 1YCFA 4XSGA 2CFTA 1K8AW 3ZZ1A 2NO1A 2E89A 2WTMA 2A58A 3ZY2A 1OJLA 2VJCA 5AK5A 4A1FA 5L3VA 1CQIB 1N3LA 1U8AA 4LJSA 4U6NA 4LSWA 4E70A 5BR1A 4LFBB 3SF8B 1E6MA 3FCEA 3WIOA 1A4UA 4AW9A 4YV0A 2ATKC 4HNUA 4B3SB 2CHGA 1S3JA 2J46A 1E3LA 4YUAA 2YXDA 5LKRA 3ZZTA 1UBKS 2HMAA 4P80A 3TPFA 1I08A 3ABUA 3RYHB 1M1ZA 4P2BA 4P7JA 2XMPA 2Q07A 3M99B 1PLKA 2OFOA 4RE6A 4JI5B 4FSDA 2BHRA 1OCRB 1XZ8A 1STOA 3ABMB 1P3JA 3GNTA 4FLEA 4JIGA 3UA4A 5LNK6 1D2DA 5K2MA 1R37A 1RYEA 3HHEA 1C0LA 3WKBA 5L51A 2E1RA 3ZMTA 2R60A 1RSOA 1G21A 3MQWA 1KI4A 2O2EA 2ZJFA 2EX4A 4HXFB 1KYXA 4LNHA 3UQ8A 4OH7A 4P81A 4PTZA 4UEJA 1CX9B 3J7AR 2OVFA 5U9CA 2IZ5A 4IW3B 1B3BA 4KVGA 1BWQA 1E4EB 4M7RA 5JDIC 3JCZA 1Q1AA 4EFLA 1FSPA 3VPFA 3JQ9A 1Z0SA 1NQAO 2VR1A 4Q3KA 3GJSA 3AWDA 4ZOLB 1XP8A 1JLMA 1DBIA 2ANBA 4G24A 3WTBA 4YMSA 5D00A 2IZ7A 4H3KB 5BW5A 3AF6A 4NV1A 1YHQF 5AM5A 3CLVA 2YHUA 5FJIA 4FYWA 1XU9A 4HGQA 1EH5A 2XIQA 3PQ5A 1R5NA 3VQTA 3NUGA 1NQ3A 2X1VA 3MCWA 5C7IO 4AS3A 1QPZA 2WJGA 2Z6UA 1MB3A 1RIFA 3RT1A 2C7RA 3RTGA 1BDIA 4NFLA 3RS0A 4GC9A 4G4SP 2CZCA 2VK4A 1J8QA 3EEQA 3U4AA 2R66A 2YW9A 3PEWA 1P7WA 4J43A 1JT2A 1QS0B 4DG8A 4FNOA 1PJSA 1IK6A 2J9RA 1GQQA 3CPWU 3GBSA 4OATA 3SDLA 1MO5A 2JW5A 4WK4B 4XH9B 4LMRA 3W6ZA 4R0MA 4O1IA 4CCYB 4JHLA 2EVWX 2XNJA 2AW3A 5GM1A 4A92A 1YASA 4MRMA 2OHVA 5D3ZA 2X4GA 1MBZA 2CDCA 5EP2A 4P5DA 3CVXA 4WINA 3NHUA 5FH9A 5J1SB 1QF7A 1ZNYA 2QW1A 3AIOA 4WESA 1UT5A 4DG5A 2FPGB 2UDPA 4JP3A 4EQ6B 4QSHA 3KUUA 1UBNA 2WKWA 2NUAA 4BFWA 1UBSB 4JBHA 4M9SA 3T38A 1A8QA 2TMGA 3O3CA 2BM9A 2OGWA 1TM1E 2WY2D 3BA9A 4KL1A 3NYQA 3OPQA 4OD0A 1SKBA 2ZRKA 4YGYA 1RWKA 3OBWA 2RGAA 3OQVA 2R8BA 4JLAA 3VPDA 2FSFA 1VHDA 4BUJA 4RUKA 5L4NA 3O4RA 1MJ5A 4LMBA 1MSWD 3QPCA 4MS4A 2QQ5A 3TQCA 2ECQA 1GQRA 2WU3A 2C83A 2R72A 4D5EA 4JEUA 3KO8A 1O5TA 3LQ2A 4R1SA 5EHNA 7YASA 3CIOA 2EJUA 3KEQA 1I7QB 1NXOA 5D3QA 1ADGA 1MEEA 1XRJA 1CLUA 2JH8A 2W2MA 2TMYA 1MO2A 3EPRA 1H3NA 3MCTA 3RVNA 4I2VA 3KZVA 1YE5A 1BWSA 3H9GA 3Q6IA 4YJGA 2H2AA 4NYJQ 3TEMA 5L3EA 3X44A 4BXOA 4HB0A 3TNJA 4JN6B 1GX1A 1O77A 2BONA 2JGIA 4WOCA 1ECGA 4B0PA 1MG1A 2GBPA 1G3UA 1FFXA 2HO5A 1S0UA 1YKGA 2FN7A 1Z2NX 3A2FA 3ZGOA 2PH1A 1XBLA 1GVHA 3LYLA 4KPFC 3L01A 5IWAO 3G0DA 1TM3E 4Y0VA 4V0RA 3TS1A 3DH0A 3MB5A 4FE4A 1Z7WA 3GBPA 3RLFA 3CRRA 4A0FA 1JFFB 2FEKA 3DYBA 3SX0A 4GRIA 3TLCA 1H4QA 2A0LA 1UBCA 3DBRB 4Y2XA 5J58A 1G64A 1JFTA 1JTVA 3HN6A 2ILVA 1UODA 4HDRB 4P7FA 2JIMA 1OT5A 1RADA 4A10A 2OM2A 1SBQA 2OXEA 1TT5A 1A5TA 4OHZA 5AJZA 5AIAA 3S5JA 5F5LA 5KTRA 5IW8A 1KO4A 4EFMA 3OZDA 4H1HA 2UZHA 3JX9A 1WP8A 3H9QA 3PKZA 1XHLA 3AJDA 2GHIA 4G8DA 4JP8A 2RHTA 7ABPA 3LTNC 5LA6F 3O2QB 3JY6A 1EUCB 4MMZB 3O4FA 3OMAB 3HVKA 5HRCA 2BCEA 1ORHA 4JCOA 1CEXA 5HUQA 3KD2A 2J6IA 1Q22A 2BF7A 1GIAA 4P5EA 3DW3X 3WL3A 1CY6A 1I14A 3RWBA 2DULA 1P0QA 5H70A 3WL4A 4ZAWA 5IH7A 1UBEA 1E0DA 5JMTA 3MPOA 4MVOA 3PFWO 3EGWA 4J76A 4RHXA 4PU0A 3UW1A 2KKWA 1NI8A 2Y0CA 3KKKA 3W6PA 4MPTA 1OXSC 4BAGA 2PMFA 4BC0A 1IMOA 1WMFA 4N47A 3FB4A 2BEVB 2VAWA 3QF4B 3ZMVA 4O4IA 3EVEA 1Q16A 3EBPA 3E9YA 4OQLA 4QQFA 4EMSA 4ZTBA 5L4SA 3D7SA 2YOHA 3GJ7A 4J0KA 2WG1A 2FMTA 2GFHA 4XJSA 3F1LA 3G5TA 4AJKA 2W2OA 1L7MA 4D02A 2F7SA 3I6QA 5D8DA 2IYNA 2V7UA 2I9PA 1JP7A 3AK2A 3KPVA 2Q7EA 4WF9V 1NKVA 3CH4B 4Y30A 4UUNA 2ZINA 3TCUA 1WQ3A 1JG2A 2Y27A 3OCXA 3P7MA 1RC1A 3LWPC 2R751 4G0XA 2RGNC 5FULA 3WQQA 1QP7A 4R84A 5JALA 2PUWA 5K6RA 3F7YC 1WW3A 3EA0A 4XX0B 3H4TA 1NJ6A 4OKIA 2OXTA 3HH8A 5IYBO 3V7EA 4GKBA 3T7RA 1RNLA 1KARA 3KUDA 1IHDA 1O0SA 2J7PA 1QG2A 1GZUA 1LSUA 4MULA 1T9KA 3UJPA 1XNQB 3U37A 1YR9A 1WTCA 2NN3C 4L0CA 4N9QA 3Q7TA 1E2EA 4UE6A 5AESA 5KWJA 1IDN1 2ZOVA 2VL7A 2Z5LA 1JKFA 1VLHA 4KX3A 1ADJA 4OQMA 4MHSA 3B77A 5TQ2B 3CJTA 5GQSA 4GOKA 3ZRXA 3S40A 1NKTA 1E8DA 1OAOC 1SA0A 5KAPA 4KOEC 3EOZA 2O7QA 4PX2A 3RWRD 1Y8QA 5CUQA 4AG5A 5BQXA 2YV3A 1TPYA 4TQGA 5IKOA 3D3WB 4INAA 1CNEA 1WXFA 3ZK8A 3RS5A 5F73A 2WTUA 1W5TA 4LE1A 3JAMA 3MBIA 1BFKA 3AG3C 5G4UC 1Z5VA 2X8JB 4XEHA 3S1AB 2FQWA 3CO5A 3VMFB 3K0FB 4U7WA 4YRLA 4YS6A 4ZIRA 1FW6A 1A95A 1Z0JA 4ZRDA 2G80A 4HYOA 1FS6A 3RUFA 1ZIYA 4EPYA 2HD4A 2C59A 3G1TA 5AKZA 2IV2X 4AK9A 5K7SA 4MWBA 2YWBA 3F5MA 1LB1B 4KXQA 4W7IA 1Q82W 2H4FA 3IVXA 3OM0A 4MQ6A 1IHXA 2XYHA 4D9BA 3JCMM 1C4WA 1Z4LA 2C5LA 3AEKA 4TTRA 4Y2PA 4PG8A 3CJHB 1IOWA 2QMYA 2OBNA 3RTBA 1V8PA 4XWKA 2C9MA 4WCVA 2A94A 1O5OA 2C0QA 5FQOA 4JQOA 3ZU4A 4FOPA 2EIJC 2AG1A 4CMKA 1WHSA 4MGKR 2IZOA 1QCYA 4DR7B 4LX8A 5FLEX 5T6BA 4UVAA 3KQHA 3DOOA 5A7HA 2FSVA 3PRJA 2IKQA 1Z6TA 1LC0A 2G5TA 4JJ4A 3CFYA 5HP8A 1OWMA 3WZMA 4GCZA 1EWKA 2ID4A 5F9HA 5H9VA 5DTQA 3T3HA 1I1HA 1FTQA 5HQTA 3EW9A 1W30A 4YJ2B 2BTQA 1MMFB 1X8LA 4UREA 1ELOA 3QUCA 4WFKA 2P6YA 5FRDA 1KDVA 3DLTA 5IT9N 3DYIA 3HMQA 4BFLA 3B20A 3FPLA 4XM2A 1C30A 4D9CA 2B4QA 3QI7A 3HJAA 3IYLW 1DX6A 4Q18A 1EK2A 3RJTA 3CC8A 3U81A 4OHPA 1EJBA 1R74A 2O2GA 3BT7A 2ZJ2A 3BGWA 3H05A 5ALVA 2LE0A 2EKPA 3OURA 4K8RB 1W48A 5TJHA 2EFEB 2AG8A 4G89A 1JG6A 4DMRA 5HP7A 4CIAA 2K1EA 1T5EA 1JKMA 2PX2A 5KTSA 1QQAA 4G1MB 4RW0A 3F49S 3SJUA 2WJ3A 4LYGA 2X1MA 1DE0A 1DOHA 2ATVA 2GMWA 1XI1A 2CW4A 1NDQA 1CE8B 4TWAA 3FPSA 4TXNA 3O2NA 1Q19A 1DIAA 3FB6C 1K8XB 3B3AA 2QM0A 1WSDA 3DAGA 4PBSA 2FPXA 4RF5A 3E15A 4BKMA 3PKIA 2W90A 5DBHX 2QTVA 3NHFA 2EWVA 4WLNA 2NYVA 1OKKD 1JEQB 3R4VA 1RIIA 2Y93A 1AP5A 2UUBO 4V0MA 2HSEA 4AIIA 2FV8A 1HR0O 1ZK4A 4JI7O 4G4GA 3T41A 5G02A 5FXMA 2ZB7A 4D4IA 1E77A 3U7QA 2IEDA 4RELA 1XQ8A 2XCQA 1G6OA 2NSHA 2X2PA 4DQXA 2WUVA 3A0UA 1OI3A 3GCDA 3L0YA 4RMHA 3ZD9A 2BTOA 3U7RA 5BQ5A 4RKRA 2FCRA 1T24A 4IHJF 1E9AA 1QORA 1PNTA 3AV0B 3N7UA 2NO9A 4PWTA 2DPLA 1SKUA 1U1EA 2JGKA 3DOUA 5H3HA 4BO9A 4O4HA 4Q4AA 3HXQA 1E79A 3MJFA 3CPSA 3KWMA 1PSWA 3OCJA 3OOWA 4OG2A 3HCDA 5G1PA 1DLBA 3IOYA 1M2GA 4HMOA 1V16B 1KFKB 3MTGA 4P4TA 4ZVTA 3ZN0A 2OM6A 1WXEA 1K34A 2Q8PA 4R1PA 3RRBA 4E7OA 3W8DA 3L0OA 1AX9A 4IV0A 2Y76A 4MUGA 1M34E 2QROA 3CUEF 3RJMA 2W6OA 2VF4X 2PHNA 3INTA 2IXGA 2R79A 4JSRA 4BFYA 2NO5A 3VV3A 3J7AU 3BXGA 4P2ZA 4EP1A 4Q47A 1LPOA 4FGSA 1Y4ZA 2WD7A 3B6JA 4WCDA 1YHZA 3MWYW 5AKJA 1P2BA 2ZRLA 2Q9CA 4ZYVA 3OECA 2H48A 1CUAA 3NHZA 4O5OA 4D9KA 2YWXA 1PV1A 3V4LA 4EY7A 2EBFX 3NEPX 2JHGA 4B7ZA 4EMBA 4HR7A 1XMJA 2FF5A 1GCAA 1YI8A 3WMWA 5KNCD 3LT0A 2XR1A 421PA 2HVJC 2O2HA 4REOA 4TMTA 5KQLA 2CK3G 2CEKA 3J81A 3SMQA 3WHIA 1N8NA 1AA9A 2GBLC 5FTLA 4LTMA 4I08A 1Y1KE 2BCJQ 4YGXB 4BGIA 5JBQA 1R4AA 2KB1A 3A1EA 1P4RA 4LBZA 3CCMV 1G66A 3DLIA 4FI3C 3I56V 3KZMA 1CHNA 1X39A 5CA0F 2O0MA 1GYRA 2O7RA 1RRVA 3DMPA 3ITDA 3OIVA 3CX6A 3LFUA 2YFHA 3ZZUA 2CZWA 4GKVA 5KVAA 1VJRA 3L70H 3A36A 3K2BA 4KQ2A 4M46A 3CH5A 5KC8A 2PZFA 1BHJA 5IN4A 3GJXC 4R31A 3H7AA 5A9TA 4W5WA 5FO0A 1TJYA 4B48A 4BLVA 3ON5A 4NEHB 5CX1A 3THYA 3E6AA 4H17A 1O9GA 3HI6A 4CKCB 1HURA 1V41E 1FFWA 2X5NA 4M89A 4TM7A 3SJAA 2GPBA 3SS7X 4MVJA 5J47A 2VNJA 4K9MA 3SKYA 5BV2P 4X1YB 1E2GA 3GFQA 4PLFA 3BWCA 5DHRA 1DCMA 2K7ZA 4TRRA 3ZK7A 5ADUS 1Y4DE 1YFLA 1ONOA 2WG0A 3KOOA 1R6AA 2OBMA 2I91A 1CUZA 1SQPH 1DQRA 2FP4A 4Y1EA 4L73A 1U2TA 2A9VA 3CQ9A 4Z1MA 1GFSA 3QFRA 2XXBA 3NR7A 3DF7A 4KMMA 3DPIA 3MTBA 3VVCA 4PW0A 4RM2A 2ZLBA 4H16A 4C04A 1E7KA 3WB1A 3DB2A 4BNYA 2QE7G 3F46A 4QATA 3SC4A 5K8VA 1JYEA 2KYRA 2XGGA 2ZM5A 2F8SA 3NFRA 4ZZIA 3BWXA 4ZI7B 1M6HA 1IY2A 3RCBA 3IGFA 4JB0A 4ZAGA 4EI7A 3DC5A 3KPWA 3KYJB 3WGOA 2R7AA 4F91B 2J67A 2X6TA 3M84A 1H2HA 1LUAA 2BFDA 2DWPA 2M6KA 2PS9A 2RCVA 2JATA 2QXUA 5JIBA 1H5UA 1T0PA 4JQZA 5AICA 2HXSA 3RIHA 3PEVA 4JLKA 4BO0A 2WEKA 3KHTA 3NNNA 3BD7A 2DOKA 2RB9A 4DC9A 1TT7A 2FVYA 2Y4NA 3ETJA 1GM8A 3VI3B 1SZJG 4G2NA 2ZATA 4UCRA 1CEZA 3GYBA 3ZHZA 2XADA 4BBZA 4IYHA 2OCAA 2WVJA 4MS3A 4GGOA 5EMKA 4D2IA 4MP8A 4PYLA 3K71B 4PGHA 3W5CA 1ZC4A 4MPRA 1DTEA 3A7DA 2NZVG 2JKZA 2JAPA 2YHIB 3G9TA 5I4CA 4M7PA 2PT5A 1QF6A 5F9FA 4LDJA 1Q3KA 2INGX 4S1NA 4Q4CA 5AW9A 2MYNA 3DVSX 3WLNA 2YICA 4S2UA 1U65A 3HKCA 1VARA 3WK8A 4AO8A 4YJ3A 3L05A 2KWIA 2Z8ZA 1XZLA 2ZR8A 2OO5A 4K28A 4DW1A 5D5QA 4CTKA 2AH5A 2WTEA 2B2XA 3FGOA 2H5JA 2GEJA 5DHUA 2NU9B 1JQ5A 1NP6A 1RKBA 1H23A 1SOMA 1TO6A 1HE1C 1Z8DA 2YXPX 3KJGA 1XBIA 4ZQHA 4ZRMA 3SPXA 4AN0A 3GTZA 2QMEA 5JW6A 2DEUA 1AHIA 4UHEA 1IEQA 2OWDA 2RGEA 3ZNNA 1FBNA 5B3SB 4C6RA 4R0NA 3G6WA 5MFZA 2J48A 4LZNA 4IDCA 4HDNB 4OI1A 2HHHO 5FDFA 5JY1A 1LTKA 1OBVA 4ZI3A 3FYDA 4BY9E 3FB5C 5MFPA 1NU1H 2IW3A 4HWSA 4C30A 2D13A 3T9DA 2IVFA 3CMCO 3PUIA 4JLSA 1TM7E 1U2QA 4UTNA 4NYMR 3QF4A 1OSNA 1XYVA 4NDZA 4XB2A 4XWAA 5ECDA 1N6OA 2HA6A 3N59A 1XDDA 4PELA 3QLEA 2FETA 2OHXA 1EEXB 2QMUA 4G8CA 3ENKA 2IW1A 3HXOA 1EDEA 4KQJA 2F9ZC 3JYLA 4M9XA 4D3XA 2QZJA 1CUXA 3IVAA 3I76A 4ID3A 5CD9A 3NHJA 4OP1A 1KY5A 2XYVA 4M88A 2VP2A 1SURA 1NRWA 4OLBA 4A8TA 1Y3IA 2PZKA 4GLOA 4IQ8A 1NRXA 2OXIA 1RBZA 1RLOA 3ZEDA 5DHAA 3B5JA 3ONEA 4AYXA 3PQEA 4Q9NA 3ZGNA 3ULKA 4UTXA 4FPPA 3QGMA 5HKKD 6ADHA 1CR1A 1CT9A 2BSQA 4FWBA 4KQEA 2QX4A 3TD4A 3RS7A 1G60A 3ROEA 3TJMA 5DHFA 3EGIA 1QLWA 1AV6A 2DAPA 5I9SA 3C90A 5H82A 3HC7A 4DUYB 1ZM3A 3ER6A 3I2JA 3HXMA 2DETA 3PUWA 5AOVA 3DFUA 1C5KA 5E2IA 1T5OA 1GPAA 3EC2A 2ZVPX 2Q0SA 3C16C 4KO1S 2O8EB 2IH2A 5DASA 3W4KA 5F7JA 1DO2A 4LTDA 2PNJA 4D0NA 2GD1O 3CXUA 4MXDA 1EP1B 2VNAA 2FP3A 4RETA 4BO6A 2OTJV 1DBSA 1T2FA 5JR3A 1YVEI 5JWOA 3MMSA 1CIPA 4LHWA 3E35A 1P2SA 3ZCRA 1GA4A 6PFKA 1VQ5F 3QVTA 3MTAA 1TK9A 5I9IA 4AKGA 5HJ7A 4GF5A 1AJNA 4LVUA 1KMHB 3PAFA 3BHMA 3KVNA 1U0JA 3WWOA 2OCKA 2NN4A 4DCTA 4CTMA 3K70D 3M1XA 1Z36A 2DJVA 4EBFA 1U3PA 2C2YA 2ZCEA 3RG2A 4DL9A 2VP4A 1WHTA 3C2QA 3RU7A 4ENPA 1ITZA 1JA9A 1L5WA 4KPUA 4MAMA 4MVJM 5I6DA 5B55A 1B2LA 1P62B 1V96A 1HL3A 1YVDA 2HMSA 3I6ZA 5D51S 5A4KA 4BNZA 1LW7A 3G0IA 4IR7A 2PX3A 4CLOA 3ESRA 1XJWA 2LFRA 1AU9A 1N2CA 1QR6A 2OGSA 3WQHA 5JEEA 1RYMA 1RABA 3P9PA 1QX3A 2J0VA 4WPGA 1HT2E 4U2BA 2PMWB 4F6RA 1X59A 1GKYA 5F52A 2Q8VA 1OXXK 3L8HA 3CNEA 4L2IA 1KS2A 2Q62A 1PFQA 2PYJA 3F5FA 3KQWA 3ND8A 4JL8A 4CH5A 3DPSA 4AMZA 4F4HA 5IKMA 4D4HA 5GGYA 3FLAA 3FZNA 3TRIA 3FNQA 4QGFA 5CFPA 1XX6A 1C3OB 2ZSAA 4IMJB 3KQTA 4WZAA 1NNUA 3ZS8C 3SOZA 4FXOA 3EEYA 2VKTA 4FYIA 2WVAA 4A6PA 5K8IA 5G41A 2V6BA 3WICA 1UXGA 3DDZX 1QXSA 3IP3A 2MR6A 2UZ1B 5AVKA 5CVEA 1PS9A 4LFBO 2GPAA 3IEPA 4WJKB 1VL6A 4QT4A 5EIEA 3VU8A 2SKCA 4ARCA 1RRGA 3GI1A 3KSZO 5LXTF 3S1AA 3T1NA 2F64A 2H31A 1Z2OX 4UHKA 3TE6A 3DFKA 4AF7A 4P8RA 3C9UA 2ZEJA 3CPHA 2NG1A 4J9YB 1BFUA 2IGTA 3CW9A 1A1SA 1XQXA 2Q41A 3M6LA 1POXA 3NOQA 3FBAA 2CJWB 2JBHA 3PK0A 4HKTA 5I3CA 2YKGA 1G2PA 2WAXA 2A35A 1ZL8B 2QQEA 4K9NA 3W0LB 5AW8A 1OLUA 1RJEA 2YASA 4F38A 1XQYA 2GA9A 2BUCA 3OZBA 4RA6B 1LUWA 1YDHA 2DCUA 2J3LA 1KZ7B 2MQEA 4RIIA 4LNUB 3LW7A 5A9SB 2ARHA 3U3DA 1KVRA 3QBTA 3GHYA 2C2MA 5CX1B 2I80A 2F43A 1PEAA 3X1XA 2BFWA 1IHYA 1ZUIA 4QHYA 4QQKA 4CPDA 4CS4A 3RM3A 4AUNA 2G8NA 1QAHA 3HJTA 1K08A 4KFMA 2PMEA 3ZV5A 2K87A 3CEMA 1FX0A 1RRCA 3K0AA 4HFJA 4W1SA 3SFVA 2ZVJA 4OAPA 4QPJC 1WSAA 2JK0A 1GO0A 1C0PA 3DCIA 3CZPA 1ULSA 3FGNA 1KJZA 1ZL2A 2Q5EA 3MGAA 3T7JA 3TD2A 2I6TA 2VJQA 2ZI9A 4IJWA 1E1QA 2ZE6A 1O97C 1Q0QA 5ARDA 1YULA 1YMUA 3AR9A 3DE5X 5KNBH 1BCRA 1C4OA 1E7MA 1RQ2A 3RSQA 3WDKA 1XLTA 5A4JA 3HZRA 4MR9A 4QFMA 1YRQA 5H16A 3ICPA 1HLGA 2XV1A 3TXAA 2AC7A 3KZOA 2P3SA 4LBWA 3VX4A 2XVMA 3MT9A 4LXGA 1JG7A 1IONA 5LBQA 4EW6A 2QS9A 2GCOB 2OYSA 5EK0A 1M1KW 3FVRA 4HZUB 4BKOA 1QHEA 5FWDA 2Z1FA 1LI7A 1CDEA 2H8CA 3WSVA 2CVZA 4DF3A 3C1AA 4CH3A 1TYEB 3VDQA 3UPUA 1HE2A 5BRJA 2YZMA 4GVLA 3S4YA 3GMIA 2C84A 3MOIA 4FKZA 3JQ6A 3TLGB 1WMEA 2QUJA 3OFKA 3BHPA 5C1DA 4N41A 1D09A 1NW4A 3VR0A 3V4ZA 3EFOA 3GAZA 1DKUA 1VXOA 2HIGA 2Y67A 3VYRB 1Y34E 4LF6B 2AUMA 4E5DA 5FNZA 3CRZA 1TRKA 1OVMA 1BE8A 3GGJA 1NVPB 4Z1MD 4JI6O 2JD2A 4YN3A 4UKDA 5BN4B 1GN8A 1RZVA 1QZTA 2ZSIA 3U0ZA 4FOLA 3RR2A 2DMRA 4GZ3A 4KAJA 1O94C 1XCOA 3DB1A 4YCSA 1GNSA 3CLSD 2VZLA 4QDZA 1Q84A 2ZM6B 1T5LA 1X92A 3EJWA 4AD8A 2CDNA 4AKIA 1ODCA 3K2EA 1C1DA 4Y2JA 3D4OA 4RNDB 2AN5A 4C0WA 3EIHA 2ZJ8A 2WAAA 1OFVA 5LIPA 1KH2A 4ASUG 2D5BA 1GCGA 3LRPA 2OXCA 4J16C 5E7JA 3UK2A 1P7CA 2IUYA 2CWJA 3L8DA 3EDCA 3EIFA 3FCAA 2WJYA 4OXNA 2XUDA 2CHTA 5B12A 2CUGA 3ADBA 1PKEA 2V59A 3TN7A 1XV2A 1IJBA 3OESA 1SO8A 2AN3A 2FSUA 2D5IA 3ROPA 2V0CA 3V1KA 2V0NA 3VYSB 1D6SA 3B1YA 4MCIA 3VYTC 3L8FA 4DR2B 1RD4A 4Q00A 3EPJA 4QXRA 1GM7A 2RBGA 2IDKA 3RD5A 3GBVA 2YWGA 2ZBGA 4Y2TA 3A0RB 2CTWA 3W9YA 2UV8A 3EQ2A 3M6UA 3ZDRA 4JUBA 2YJ4A 1R4ZA 4EVIA 5BQOA 2F55A 1M0EA 2V96A 2W71A 4GYYA 1PFGA 2JAWA 2IOHA 4I9HA 4QOFA 4TT3A 1BCCH 2KMLA 2ID9A 3OW2F 3JQCA 5KNCA 1L4NA 3Q72A 1H69A 3THRA 1XNJA 3ND7A 1XLWA 3DE6X 4BVHA 4EHAA 2FSVC 1IVSA 2FFQA 3CINA 4URHA 2HR3A 2P0YA 1HSOA 2DR0A 3A32A 3F6CA 3OG9A 3REQA 4CGYA 2R85A 4BVKA 3AL3A 3G8DA 1ONSA 2FZKA 3LMKA 3LZCA 1Z3CA 3LNMB 3WJRA 1Y3FE 4WA7A 3T9AA 3UJBA 1GTJ1 3RODA 2OCCC 1SC4A 4DDUA 4Y18A 2WYWA 4HEQA 2XBMA 4K6HA 3QFCA 2HADA 4IJKA 5BV7A 3BTSA 4TL7A 1H4TA 3KKMA 2ZTUA 2ZSFA 4S3MA 5A4DA 2VIIA 4RYDA 4EO4A 3TLGA 5JISA 2JJ8A 16PKA 4DV5O 1N8SA 5BN4A 5AM4A 1B0UA 2QG9A 5B1OA 1QTQA 4ZI7A 1L5FA 3FSJX 4ZMSA 3HMKA 2R48A 3BIWA 1F20A 5FOUA 3CZRA 4N0DA 2O0LA 5DBEX 4OSOA 4JLUA 4B4OA 4DCSA 4HD8A 5DM1A 2FTKA 3I39X 1NPYA 1F3OA 1RWMA 4INZA 5HG0A 1ZM7A 1Q3EA 2GTAA 2BCCH 1VQOF 1E9FA 1T8WA 4U6QA 5CG1A 2PX0A 5FBHA 4OFWA 3ZQ4A 1DQPA 4NMWA 2A33A 4LG1A 3ANMA 2AIZP 1NFRA 1RXIA 2ORYA 5KPJA 3HO8A 2PGLA 2X15A 3MLBA 3QUQA 3QVKA 4G36A 4TWIA 1HMYA 3P96A 1LDEA 1FOEB 2CFOA 4RL4A 2XHEA 3A11A 4AS1A 1KAEA 4OHWA 1WU7A 4K3VA 2ZU6A 3SYQA 1YUMA 1Y81A 1HY3A 3PD0A 1A0OA 3WA6A 4BMSA 5LHIA 5HWSA 4AFNA 4ZJUA 3VV2A 2ZUWA 3GUYA 3B40A 3H1EA 4RAOA 2J0UA 2VWJA 2OIGA 2NPFA 4RDHA 2L17A 1UZLA 3F6RA 3RUEA 4B2LA 3H1IH 1PJTA 5CAEB 4F1JA 4LE0A 5ENZA 2ZJAA 1AJPA 2AGAA 1ZXXA 2EG9A 2PFKA 1VYVA 2QF7A 1AD2A 3D7KA 5GV7A 5K0SA 1PK8A 1QU7A 3UC5A 2JBWA 5JCOA 2EGUA 4JAAA 3UXMA 4LI0A 4ZVKA 1TC2A 3STXA 2WUGA 4QA9A 5IAEA 4R69A 3OBBA 3OETA 4RQTA 4PLYA 1E1CB 5FEUA 4TZ6A 3FKJA 4FDAA 3GRKA 4IXNA 1XVLA 4FZ1A 3SPJA 4DV4O 4NQ3A 3NHLA 2QW8A 2ZTVA 3CIFA 3AUYA 1SC3A 3FPAA 4E14A 5F7XA 1P5FA 1DCKA 2YIAA 2H11A 3G2OA 1PK7A 1FJHA 4X41A 3OD4A 2EP7A 2H7CA 3F4BA 3KR2A 3AC0A 1MA1A 2XWJI 3D2BA 1QZUA 2QW0X 3EVGA 4YAJA 3F73A 1C1HA 3GX1A 4RADA 5CP8A 4EL0A 3O8LA 5IVPA 1ID8A 3F6BX 1EWRA 1SG0A 4GZRB 4HWOA 1R5JA 5EB0A 1NHWA 3AJRA 1BHAA 3GN1A 4YRSA 2WLLA 1EFLA 2LNDA 2XRYA 3CX7A 4C22A 3STLC 3WI7A 2WFLA 1ZN7A 4NC9A 3IERA 3QENA 1KNKA 2A1UB 4Y67A 4DLBA 1X8JA 1XP5A 3D5QA 2HFEC 1VJGA 5EQFA 2FDXA 3H3XA 1Y89A 1BYUA 3PZRA 4OA5A 5JH7B 4GMGA 2JJMA 4LXIA 2JIZA 1MCZA 3D8SA 4FHDA 4BEWA 3AG2B 4RX1A 3DGFC 4X1IB 3C7AA 3LKDA 1Q81W 1YQTA 1EWQA 1SG6A 4BWYA 5FTWA 2CE2X 3X43A 4KQKA 1LFDB 1GRVA 4WDRA 3GCXA 4BRWA 1D1SA 2BP7B 4JLJA 3WGNA 4ESVA 2F3PA 5SZHB 4EEZA 2ERYA 2FZGA 3AOGA 3DQZA 2CNKA 3HJRA 3PE4A 1ORIA 2VAXA 3NDJA 1X1QA 2Q28A 1ML4A 2WHPA 4NXNB 1ZUNB 3BSWA 3HY3A 4TLMB 3AEQB 4DQLA 2PTGA 2VZ0A 4GXRA 1T8SA 4AZ0A 1XTVA 4AN4A 3QLJA 4D9FA 3QVMA 4QPDA 1K7SN 3T8YA 3ZNPA 3R6WA 1P6QA 2WLTA 2HFJA 1O58A 5EZYA 1RKUA 2CLCX 3AR8A 3SR3A 5JAPA 1OMOA 3B9QA 3GNQA 1DAKA 4I7EA 5EWMA 3BDVA 1Q3TA 2WJJA 3GLIB 3JQ7B 1BRMA 2CFSA 4DLLA 3V00A 5ILQA 2WALA 3BK7A 5LM3A 5BMVA 1FY2A 1N5IA 2PZMA 4BZXA 5GADl 1SS3A 3IKVA 3TFWA 1WVGA 3G1WA 2YY5A 2O4UX 1PZNA 2FX2A 2MSKA 4CEHB 4YJGB 1E3IA 3GY0A 2AXTZ 1T0JB 1NVDA 1F23A 4M60A 3WSWA 4DQVA 4RHUA 3R0QA 1Z0UA 4BEBA 4KRFA 5BYJA 1ENYA 2QE7D 4C7OB 3WBKA 1P33A 2Y1XA 1DWQA 4ZKDA 1X8XA 1BVHA 4RVHA 1NQVA 4RF2A 5JJEB 1OLXB 5IJAA 3RHTA 4V0QA 1Q92A 1JX6A 2PYZA 3KUXA 1DKLA 2UYOA 3DR5A 4ADSG 4F3RA 3OHMA 3EXAA 1UUFA 4UOEA 4YAKA 2OYQA 5BNIA 5K0JA 4EEKA 4ND1A 1P81A 1MNGA 2CUNA 3VHXA 4G25A 5F78A 3DWFA 3W3AH 4R54A 4Z9AA 1P7ZA 1SOUA 1U0LA 3DOEA 2VPZA 2GXUA 4A2PA 2R8XA 2Q5JA 4UEWA 3RG8A 2VAVA 4NU6A 2O05A 1SHKA 2SNIE 1M33A 4FFWA 1Y74A 3H4VA 2JL1A 3HGQA 3PSHA 3GXOA 4Q3LA 4CCAA 3DXZA 5DN6D 4X89A 5FOSA 4OSPA 1JDUA 4ZCSA 1NVMB 3IDSA 2ZYIA 3T1OA 1TX4B 3LM8A 2UXXA 1NONA 2PZEA 4V03A 3VQYA 1DRKA 3HQ4O 3DC2A 4UU1A 5ENDA 2ZF8A 3OKFA 3RS3A 4YRNA 4Q1CA 4FYPA 4ZAXA 1ZW6A 2BN4A 4X0EA 4JT2A 3U7QB 1JHPA 5TQ0B 5AQ1A 4DV2O 2I8CA 2WWYA 5BVGB 2Y1LA 5CYGA 2AQKA 1HKHA 1VJCA 3CNHA 3EASA 3FBTA 4PIVA 2WNIA 4HZGA 5TPZD 1TQHA 2GILA 1SPXA 1MW9X 1ZOLA 1NOKA 1G3IA 2Y0DA 1IWBB 3KKEA 2RE8A 1J09A 4Q7JB 4FONA 2XUIA 3QLTA 4TWRA 3C6XA 1JDVA 3V4PB 2ETNA 1H9BA 2E5LB 1X38A 6AT1A 4B08A 1KBHA 4R9RA 4GR9A 3HB4X 3ICCA 2VWGA 4PZYA 1XTJA 3UGQA 1RWXA 2BR3A 2PWPA 2IODA 1OJ7A 2PX6A 2YX1A 2ZK7A 4Q3EA 3F90A 1Z16A 5BN5B 3RFXA 2PKYX 5HZHA 5LMUO 1Z2EA 3GPCA 1BQEA 1CJCA 4FMCB 4I7ZB 1L5MA 3OA2A 4BO4A 5B3JC 4RU1A 3PJGA 1FSGA 1GNTA 4BVBA 1H6DA 4Z86A 1S6YA 2XB8A 4P08A 4AU1A 2XE7A 4CKEA 4D4JA 4ZOCA 1OC4A 3Q5GA 1W87A 2VQSA 3JWGA 4HAOA 3QVUA 2EIXA 4NE2A 7ADHA 1ORRA 3D8HA 4PBTA 4K8XA 1WQ4A 4JLVA 1JHVA 3WRXA 4D6XA 1VE5A 1O6ZA 1Q14A 3JTMA 1N78A 3M2PA 2WF9A 3G9XA 2ISSD 1U0EA 1UANA 1VQ7V 3SZGA 1ZM9A 5IJ9A 2ADMA 3HP7A 1RJGA 4M53A 4PFSA 5JAQA 4HDQB 5LA6B 2GN2A 5JJBA 1CB0A 4LZAA 5E6UB 1VDMA 4ZT2A 1SC5B 4EHNA 2Q4TA 1YL6A 2E4UA 4WLFA 3TW6A 5G1OA 2ATEA 1L8DA 1N5OX 1CXZB 4NCXA 2TYSB 1T3ZA 1Z4KA 3ABIA 2OO5C 1E5DA 2BKXA 4LJ7A 1SERA 1TQ4A 1DEHA 4JMLA 1V5IA 3N39C 2IW5A 1MOSA 5EJFA 4J03A 2VHVA 2ZBPA 2W6IG 2JEZA 4JDUA 3L3BA 1UK9A 1DIRA 1KE1A 2I03A 3KQUA 1L7QA 5HQ3B 4MV9A 1VQLF 4TT8A 1PD1A 2COKA 3QTCA 3JAMN 3MUEA 1RQNA 2NT3A 1Q2XA 1E61A 2W8BB 3THYB 2HI0A 3OSZA 3VU1A 4F6LA 1ZGZA 3BZUA 3TM4A 2QL5A 1IV1A 5K5EA 1V9PA 2FEWB 1JVBA 2Q5OA 3BPSA 3E9QA 2PBLA 1G59A 1H66A 1F4PA 1C9KA 3D1JA 3WMFA 3I2HA 4XDKA 3WVNA 5A3QA 3UOAB 3LUCA 2P1DA 3BMOB 4AT1A 2P1ZA 2QPAA 3D54D 5JLJA 2JH3A 4RJLA 3ODPA 5TMPA 2BGMA 4Y9TA 3PBKA 3LVQE 3L1JA 3E70C 1HYEA 3UH1A 1GA1A 3RVZA 3GQVA 4JI4B 1WBDA 5ITZA 3FB8C 1IDOA 3KR0A 4ZYLA 1P1KA 3VPBA 4CI0B 3E7WA 1BGWA 4XD7A 1Z35A 4WZZA 4YQZA 3SJAC 5CDFA 3STWA 2NQTA 4P0TA 4Q01A 2J6HA 3WYBA 3O65A 4JI8B 1GUYA 2AFVA 4DPMA 1X15A 4NECA 4EARA 5KEIA 1OWNA 4MARA 4XTRA 3ZXYA 3PQFA 2W6CX 4V0KA 1SQXH 1KMIY 5I8PA 3LA6A 4NS4A 5I8ZA 4LQDA 5D3KA 3S7TA 1PI3A 2BISA 3BB1A 4P30A 5EYPB 1G17A 2X58A 2DH5A 3H7IA 3MRSA 3LC1O 2ZROA 1I2DA 6NULA 2X4IA 4TQDA 3VYSC 2WK1A 1U0FA 3KZNA 1N0WA 1Q0LA 3BS4A 3BY6A 3QXGA 2AV6A 2GFQA 4CG1A 2Z01A 3WZLA 1H3FA 3SQXA 3G4SV 4AAYA 2ZYDA 1JZQA 3SXJA 1PGQA 4D99A 3V8RA 4BNHA 4TMKA 4PNHA 4P4GA 4BT5A 2OENG 1BHO1 2YJ3A 1RM3A 2NTNA 4JJEA 4TMWA 3UAVA 4TL8A 4LECA 5EKDA 3ZV4A 4DNOA 1NJGA 2K7FA 4UCWA 4B83A 1LLQA 3AHCA 4B7UA 3IELA 4B3SO 4Q21A 2QTPA 5IYDO 4JJ6A 4AJJA 1J1UA 1YQNA 3ZE0B 2H2WA 3KSMA 5FR1A 1JIKA 5AKGA 3CNQS 2Q6LA 2Y92A 3K5IA 3PC4A 4XIJA 5E9AA 3WFZA 1TO1E 4JYCA 3PDJA 1E2DA 3A9UA 3IQHX 4E5PA 3K9NA 4MUKA 5JCXA 4WESB 4WT7A 4N3NA 3PNSA 5TLSA 1OVGA 2EHJA 5KQSA 1SD1A 3B5IA 4QO8A 1CF2O 2ZKIA 2NVBA 4XIIA 1RM1C 3HBNA 3ZGVA 2R47A 3H2GA 3G2HA 1T43A 3UMBA 3ZHOA 5ICMA 4DTCA 5CLIA 4JVNA 3UTCA 1O94D 3MWDA 2BKUA 3H99A 3QMMA 2GM3A 2NU8A 3RNOA 3V8VA 1NSTA 2RAPA 2WM9B 3A6JA 4HO1X 1BXGA 2B1IA 1WV0A 2O2JA 1QU9A 2OV8A 2X22A 3GFRA 2UXNA 4JQCA 3FBGA 4S1OA 2PX5A 5GZ3A 4BCBA 2JZCA 2YMQA 2V7GA 4ZZ1A 1FUYB 3L9DA 3HJWC 3A6DA 2E87A 3FNHA 4YCMA 2IH5A 3LGAA 1JHMA 1XTRA 4BRSA 3TIFA 1OF1A 2BI8A 2P2DA 3UICA 4LI3X 5KQPA 1TU4A 3CZCA 3FXAA 3O3NB 1TECE 3PYXA 3V8MA 2QWNB 2FEAA 1G8KA 1A32A 4PO9A 3N4YA 1YMQA 4OOEA 4QGHA 1YJWV 7AT1A 3ASOB 1KPGA 3AILA 1VQ6V 4JEHA 5JNTA 1X0XA 2HT6A 4HMQA 1LRJA 4BAZA 5F2EA 1AK2A 2H00A 1XCPA 2YXLA 4CQLB 1WB7A 3HZZA 3NHAA 3C43A 5C35A 2H57A 2NO4A 3GAAA 4BX9A 5BWOA 4RK5A 5CTAA 2PXXA 3AF1A 1RKVA 2FWAA 2PKQP 4GT1A 2IXEA 3ORYA 4PZZA 2GN4A 1TKBA 5AM0A 4ZK7A 3R0XA 4HGZA 4YUVA 1YJCA 4KLZA 4PS1A 4DIOA 1MTZA 1E1QG 4AWBA 5LR6A 2V3VA 2QR5A 4KK3A 3CRW1 4X3OA 1ZI8A 3R3HA 3C9TA 1V45E 4MVJG 3G2QA 1GZ0A 1F2UB 1VQNV 3MJCA 4IUBS 4TKMA 2E85A 2B35A 1SVOA 2DT5A 3DNFA 3DVAB 3E18A 2RGYA 1JEAA 4IAOA 1W35A 1S2DA 2FEMA 3PHGA 4QXAA 4H7PA 5E6RB 3MDSA 1B8UA 5GANK 3NIWA 2MJLA 4PXYA 5LBUA 5LSAA 4PG7A 2Z5UA 5LLSA 3ZEIA 1XNRO 2M1ZA 3AX6A 1NOJA 1AKWA 2Q46A 4FVTA 1EM8B 3S28A 2Z1UA 4ROTA 1OH7A 4UNSA 4BT2A 1DOZA 1YJBA 1WHTB 5HQJA 4D9NA 3G59A 2D5LA 1HNZO 4CFSA 1XEFA 2GTPA 1OA1A 1YE3A 1Z22A 1Z82A 2WYUA 5IX8A 2LW1A 1WZCA 2VPWA 4HEA1 1N2CB 4IVRA 3JQPA 1ODKA 1SULA 4XOIA 1ZR2A 4XGKA 4NV0A 1KI8A 3FWZA 4F3TA 4EFEA 2PLAA 3FLMA 2XE8A 3SC3A 4W4TA 5J2TF 5C5EA 2VDLB 2PH3A 1T2CA 3LT5A 2C1XA 5KPDA 2F1IA 5E4TA 3E8HA 1XZKA 3L72H 2YJ5A 3Q10A 2XAGA 2G0AA 3T4ZA 1VQPV 2IYOA 1QCCA 4AIRA 5KS2A 3AEYA 1RZ3A 1GG5A 3TVYA 4CIVA 1RKXA 1WLSA 2QMOA 1G16A 4LSGA 3ET4A 4BNXA 4NPAA 1KUQA 4GQAA 1ISJA 5C8YA 1S72F 2J9FA 3PYMA 4UD2A 3H1KH 3NIBA 3AONB 3W7WA 3DDCA 3IQWA 3BSSA 1VLLA 3IRUA 5MN6A 2DC1A 3L4SO 4DYDA 2VJDA 4W5JA 3PN1A 1CUUA 1YA4A 3H9CA 3KSDO 1EHCA 1QQCA 1GXSB 1FFTB 2J3QA 5B6JA 3I01M 2ZYSA 2CVLA 2OLJA 4BNVA 4EG8A 1P1JA 4EL5A 4YIKA 3KPUA 1SRQA 1U7DA 3ZGLA 4CM1A 5KTPA 4B62A 1C2YA 2AD5A 3ILXA 4D45A 1DXHA 4K0KB 1F12A 2OHGA 4ZHWA 1JHUA 3ETCA 5TE9A 5JVDF 2O8BB 1VPVA 2W8ZA 3MERA 2JCSA 4D8XA 4OXKA 4P9OA 1A72A 3LC0A 3RC3A 3HCCA 3QLVC 3ZXSA 1VBMA 1VBNA 2B1JA 3O73A 5KB3A 1SOAA 3VHRA 5J5AA 3K70B 2NVUA 3O9VA 4R1MA 5B3JA 3ZWDA 5CBKA 4F97A 2ZUFA 1YJNV 2N42A 4XIGS 4PM4A 2QRMA 4GICA 4QT0A 3T5MA 3GUZA 2HQSA 2QJOA 3W3AD 5T8KA 5BVGA 3UV7A 2RGWA 2GEFA 2UZIR 1COZA 3L06A 1N33B 4YYZA 3CCJF 2MMGA 4WCFA 3D5TA 2PJRA 2G72A 4MO9A 2FPOA 2FSGA 1Q6ZA 4J1TA 4X64B 4G88A 3FPIA 1OI7A 2NVUB 3RSSA 1Q57A 3E3LA 2VNSA 4XJXA 5ADVA 3U44B 1H93A 2PYLA 3OAAG 1CP9A 5JJKA 3ASZA 2WJHA 1QTNA 3CN9A 2A4KA