4O2BB

Tubulin-colchicine complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
428
structure length
422
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title The Novel Microtubule-Destabilizing Drug BAL27862 Binds to the Colchicine Site of Tubulin with Distinct Effects on Microtubule Organization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle/inhibitor
total genus 168
structure length 422
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4o2bB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4o2bB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4o2bB01
3JARA 3WGLA 2R751 5IJ0B 4I4TA 4WBNA 3VOBA 3JALA 3RYCA 5LP6B 4IIJA 1JFFA 5C8YB 3WGMA 5EIBD 3JATB 3JAKA 4X1YB 1FSZA 3M8KA 4U3JA 1TUBA 3WGKA 5KMGB 1OFUA 3RYIA 4O4LB 3JASB 5IYZA 5GONB 4YJ2B 4X1KB 5IJ0A 3VOAA 3ZBQA 4O2BB 4U39A 1FFXB 3N2GA 4LNUA 5LA6A 5CA0B 3VO8A 3ZIDA 1SA0B 2RHOA 4ZI7B 4ZOLB 3JATA 1W581 1TVKB 5JH7B 5LXTB 4F6RB 4ZHQA 5IYZB 2VAMA 4O4LA 2RHHA 5GONA 4YJ2A 4DXDA 5EYPB 4X1KA 4O2BA 5JVDA 4TV8A 3E22A 5J2UA 3ZBPA 4I55B 1SA0A 5JQGB 2VAPA 4DRXB 4ZOLA 5JCOA 5LYJA 4FFBB 4ZI7A 5IJ9B 2VXYA 4KWEA 3R4VA 1TVKA 2BTQB 5MN6A 4EB6A 5CB4B 4F6RA 4EI8A 5KX5A 3HKEB 4O4JB 3N2KB 4HNAB 4TV9B 3RYHB 5ITZB 1RQ7A 1W5AA 4B46A 5LP6A 2RHLA 3JAWB 5FNVB 5JCOC 5C8YA 2R6R1 3WGNA 4E6EA 4I55A 1RLUA 3M89A 3HKCB 4X1YA 3RYFB 2VAWA 5IJ9A 1W5EA 4X1IB 5KMGA 3JASA 3HKEA 5LP6C 1W59A 4O4JA 4HNAA 4TV9A 3RYHA 5ITZA 4TUYB 4M8IA 5MN5A 5BMVB 3JARB 5MN4A 1FFXA 5CA0A 3VPAA 3C8LA 5CA1B 2XKBA 4IHJB 3VO9A 3HKDB 4WBNB 4B45A 3CB2A 3HKCA 3RYFA 4YJ3B 5JH7A 1JFFB 5LXTA 2Q1XA 4I50B 4X1IA 4EI9A 4XCQA 3JAKB 3HKBB 5EYPA 5M7EA 5EZYB 5LOVB 1Z5VA 4TUYA 4X20B 1Z5WA 2XKAA 3UT5B 5CA1A 4IHJA 5JQGA 3HKDA 2BTOA 4DRXA 5J2TB 4FFBA 3N2GB 4LNUB 2BTQA 4YJ3A 5LA6B 1W5BA 5CB4A 4I50A 3HKBA 3N2KA 4O2AB 4O4IB 4EI7A 4O4HB 4ZHQB 5EZYA 2GVIA 5LOVA 2Q1YA 3RB8A 3JAWA 4EB6B 5FNVA 4X20A 4I4TB 3UT5A 2RHJA 1RQ2A 3JALB 3RYCB 3WGJA 4IIJB 5J2TA 5JVDB 4TV8B 3E22B 5J2UB 5EIBC 5LYJB 4U3JB 1TUBB 4O2AA 1W5FA 4O4IA 3V3TA 3RYIB 4O4HA 5KX5B 5BMVA
chains in the Genus database with same CATH superfamily
2ZIOA 5IVHA 1QONA 3SFVA 3PFFA 3UKJA 3OT7A 1XZDA 4AY4A 1UP4A 1C3OB 2HHJA 4M9SA 1N5KA 1ST3A 2GZLA 4C4TA 5A4AA 4EO9A 1O87A 3IKLA 5IT9M 4WWHA 5AJWA 2ACKA 3BD9A 4DR4O 2LIVA 1KXJA 2QPOA 3RO7A 2BGTA 3IP9A 1GG9A 4H7PA 1RMYA 2QVBA 3DGEC 2A0UA 2ODMA 1PTJA 3D81A 4OJQA 4E13A 3O94A 1WDTA 4ICIA 5FAXA 2PVCA 5D86A 5JCXA 1U2RA 5DXJA 1BHQ1 3KBBA 1CE8A 1VBKA 1D1TA 4N4AA 4PYNA 2HHAA 1XHXA 3TSAA 3BHNA 4WF9V 5B3AA 3R3VA 4DLXA 5IDJA 5F5XA 4LOAA 3NKFA 1Q7YW 1CEQA 3NH9A 5KNDA 1ZVJA 4B71A 5LJIA 2Z4SA 4NTYA 2H1WA 3HYRA 3WB9A 2OHWA 5C52B 2FPMA 1EP9A 3I5AA 3MGKA 3PPXA 4CJXA 1TQ8A 1YHZA 1OBCA 2ZRCA 1I7LA 3HC7A 4C4RA 4TRNA 1QGZA 1OU0A 1FUKA 1KVRA 1RRPA 5IM5A 4Q1DA 1DUIA 4ARVA 3BWBA 3LBIA 4PYOA 1VQOV 4MGEA 2JI4A 5BSGA 3AEQB 2C2KA 5ESRA 3WNCA 3EYAA 2P5TB 3TIIA 4D92A 3ORRA 4MQFB 4RA9B 4UHHA 1M73E 5BWNA 3WWEA 3LBFA 2CCJA 4HB2A 3VH2A 3TNYA 5EYPA 4YMIA 3K53A 4RKEA 2V6JA 1D3AA 1JW9B 2NU6A 4ENRA 1PNRA 3KZKA 1ZGCA 2IUEA 4B76A 3M3DA 2WMDA 2VTBA 4DUPA 5K3EA 3P9XA 1V5EA 3E83A 2YY6A 3LXRA 5EIBC 4QJ3A 1JQDA 1XYVA 2FFBA 1C30A 1Z0KA 3UH1A 1O95C 4JVLA 2OCHA 1E3MA 2GUWA 2JI9A 4WQMA 4UV8A 2X4GA 3LDUA 4PHZA 4MINA 1IZ8A 3H8JA 4DCPA 4DDKA 2BP7A 2N75A 2O07A 2QIPA 4KXNA 2BSKA 1N4DA 5HZHA 2HRBA 3OLXA 4C7OB 3WRYC 4BLRA 3IYLW 3OJOA 4E7PA 4XOIA 5AHRA 2ZIAA 4RKWA 1JG6A 3VNBA 2CLEB 3T5CA 3VAAA 4EECA 3HYSA 3QIAA 4LOJA 1LI5A 3K0HA 4IQGA 4PLGA 4G5RA 1CUHA 4HWRA 3LK6A 3P30A 3HN2A 4N6NA 2LO1A 1Z0AA 2CXQA 1C9NA 4B17A 2RG1A 2Z08A 4N54A 4JB0A 3I9KA 2YEVB 5K45A 5LMUO 4CKWA 4A73A 1R9GA 2Z5GA 4P53A 5CX1A 1M9NA 2FOLA 2H1FA 3ZGZA 2OK7A 4AKEA 1RJGA 2RGRA 1OFVA 4AXBA 2GEUA 3VO8A 1EFLA 1FC0A 3DZIA 2P8JA 9LDTA 4GBMA 5CH8A 1JP7A 3FFXA 3ABZA 5HKLA 1KZ7B 5A9TA 1MPTA 1I24A 4RY8A 2Q8PA 1ZDMA 1DDIA 3TIGA 1E0SA 2W8BA 4XSVA 1HP8A 3W2EA 4PIPA 1K75A 5F9FA 1X2BA 5DT2A 4R71A 4BECA 4IIUA 3X1ZA 4BVSA 1UBMS 4BX9A 3H05A 4N48A 1OXBB 1HFJA 2F9MA 3FUXA 3H1EA 1HORA 1KNXA 4MO2A 5JFGA 2W98A 4YHBA 3CMEV 3DWEX 4R5HA 1B8NA 3ZK7A 2DPYA 1TO1E 1SXJA 2CLOB 4KO4S 4IOMA 3I45A 4EKEA 2RAFA 1QVGF 3GCGA 4M9ZA 2AJTA 1FNDA 1RLOA 2VGNA 5ESXA 3V33A 3DLAA 2H9YA 3QK7A 1DX4A 4ONEA 1FXUA 3NTOA 3F6BX 3U0BA 1XRMA 2R6AA 2EKLA 4GLJA 3UPDA 1UPXA 4OGWA 4FZ1A 3TMKA 1YVRA 1L8OA 4HDMA 1J0XO 3BH6A 5JZBA 4JBIA 3FCXA 2V9CA 4XB6B 4FNOA 2DPXA 1FX0A 1S02A 4NABA 4I5EA 4GXNA 4II2A 4MPJA 2XNCA 1NQVA 1ZA2A 1M90W 2H4JA 3MDOA 3QNMA 2P40A 5AKHA 5HY4A 2P3SA 2RONA 4NCHA 4I3HA 1GUAA 5FLYA 3F0TA 4BO0A 1E2IA 1JKJA 4L15A 2RKOA 2OG1A 4LJKA 1ABFA 1AGNA 1GSAA 1H9CA 3K0AA 1J21A 3KFXA 2O3TA 3WQQA 1K9VF 5CB8A 4OM8A 3ZV3A 1OLUB 4YUZA 3AJDA 1R7RA 4C01A 3GJ5A 5IVPA 1N33O 2ZXWC 5AR1A 2NO7A 3AESB 5AI6A 2EU8A 3QFRA 4CCWA 4US1R 2WU3A 1XP8A 1R3UA 4MA5A 1GNLA 1VJ0A 1H2NA 1BH2A 4RAQA 1U63A 3O8CA 4L76A 3O26A 1CR6A 1UK8A 2JGKA 4ZKDA 1NMYA 4MRAA 1E6LA 3GAAA 1IVYA 1GDDA 1Y6RA 2FMLA 4EFDA 4HYOA 4U6SA 5CPBA 3KJZA 1H2HA 1J1UA 1E5TA 4ZI7F 2EC5A 2QG6A 1Z29A 3WIDA 4CKEA 2ZKLA 2UYOA 1S7GA 1AQNA 1VKZA 5IH3A 5AVWA 4B83A 4E12A 4Q4DA 5T6BA 3O8QB 3URKA 4ZBMA 4XYMA 1VXRA 1XRPA 5IFLA 4V3BA 3UCXA 4FS3A 1JY8A 4DREA 2C2YA 4ER7A 1QBZA 3IBCA 3OECA 3ABSB 3CJTA 5AXBA 4KXQA 1NBEA 2AC4A 4WN9B 1ATIA 1UDWA 3SBEA 3TFWA 3WG9A 2QMUA 4LBZA 3RSFA 2B37A 5BT8A 1YFKA 4IYJA 4KJXA 3JW8A 1S2MA 2XT9A 3T1HO 2R5FA 1FYXA 4PYIA 2YHBA 4AICA 1ZK0A 2QRJA 4GZLA 2DY1A 3JYCA 1AKUA 1Y4AE 2OUKA 1Z26A 5AQEA 1GL9B 1YQDA 4EJSC 2G67A 3QY9A 4QGBA 3VO9A 1Z4OA 3SM3A 2PM8A 1Q77A 2RIPA 1XCPA 2DY0A 3TLGA 2B4YA 2RB4A 1FP4B 4WCFB 2UU9B 1UPFA 2DPGA 3PR2B 2PT6A 3IAAA 4YDSA 3MFYA 1PT5A 3F4LA 3P0HA 3CZQA 5I01A 3VKWA 2H85A 3WLPA 4LJ5A 1FYVA 3RGGA 4WECA 3ZWVA 2AD1A 4RA6A 4XRRA 2UYPA 4UM8B 1WS6A 2P6PA 1K9SA 4ZZ0A 5DE3A 1SXGA 2HM7A 1ACJA 4XQCA 1OAKA 1KI4A 2I4MA 2XZLA 3L4EA 1NG1A 1MJGA 1I6LA 3OFNG 4OLAA 1UDBA 2LD4A 4Q4LA 2OENG 3AWIA 2OGUA 4L85A 1XPUA 2FPPA 4JJGA 3AZPA 2Q27A 5KUMA 4J1TA 1QIFA 3THXA 2BFFA 2PYDA 1BRTA 3A6LA 1NSYA 4ZFNA 3QKSB 1KJJA 2R72A 2VUIB 4RK0A 2Z2ZA 4FOLA 4QE7A 2ZNJA 3BMOA 3BX1A 3T1OA 5BSKA 2QEXV 1ZUNB 1DIGA 3T4DA 1V1MB 3I56F 1IBRA 1PUJA 1PHRA 3GWKC 1ISIA 3OM3B 1V55C 1RYBA 1VECA 4UU8A 1W1UA 1GFWA 2Z5VA 4XWAA 3VPBA 4B3CA 3VH3A 4CG3A 4GNRA 4EHAA 1ZIDA 3O1LA 1H2GA 2P06A 3JRNA 2VTEA 2WLTA 2DH6A 4U2EA 3CGWA 4IJKA 2A88A 1Z38A 3F3KA 3BSYA 4GGPA 3L5OA 1U6KA 3BXFA 2QLJA 1W41A 2XGGA 3NANA 1RBMA 5IN4A 2GCIA 3M2TA 3ONVA 4QFMA 4MWTA 1QG0A 3OM1A 3K8QA 5K3FB 2WJVA 3FMIA 3F5MA 4ALLA 1PSWA 4I6GA 3A6FA 4LRUA 3QXGA 1NOIA 3UEOA 5KHIA 1XRLA 1UQRA 1TD9A 3C7TA 4RSMA 3FGNA 3FOFC 1VI6A 3VV3A 4EVQA 5ESDA 1P1KA 1OCZC 1CZNA 4F3YA 3OF5A 1ZD1A 4HRVA 3W6NA 4I7EA 4BB6A 4G0NA 2W42A 3AUAA 5A4IS 1I4LD 1QFSA 1P9LA 1D2HA 1IHYA 5FL7A 4KWHA 2WPNA 4KUHA 2XGSA 3DKRA 4AZWA 2XRYA 3T4XA 3B6MA 4OQ4A 4E14A 1N6PA 3SYNA 2YUAA 3IAUA 3I76A 1CDEA 1WEKA 1HDIA 1NJ2A 2Q41A 2FAXA 2KWIA 1OGIA 2OCBA 5AJUA 1S8FA 3STUA 4TS4A 4HAWA 5KJ1A 3ELDA 2PD6A 4WKGA 2IGBA 4EO7A 4P4UA 4M0LA 1E4VA 3REQA 1WUJS 3H6GA 3BULA 3MAGA 5DH9A 1SHUX 3CLUC 3FNIA 5JJIA 1YQQA 2IP4A 3JQQA 1VMAA 5KVCA 1BGWA 4L8LA 5CXSA 3R5XA 1Z4MA 1HNXO 2Q5LA 3KEMA 2OKCA 3LTNC 3WFVA 2E3JA 1AR1B 3UNXA 3VI6A 2LTAA 3H1KH 2OZLA 5I45A 2ZT9B 2QW0X 4UMDA 3ITDA 4RPCA 2HWWA 3UAYA 4AX8A 2CBZA 1NPYA 1YGPA 3WGQA 3VKGA 3OJXA 3O3MB 2VUHB 4O3MA 1HZJA 3UF0A 4P1ZA 3QKTA 5KU7A 2FC3A 2H00A 4B40A 3TW4A 3TD6A 1CNEA 3EBOA 2H7YA 1K08A 1T4MA 4UARA 1AILA 1QR6A 5FL7G 3ZMSA 3ZHRA 1SVWA 4OHBA 3RU9A 1YQUA 3WIVA 5IVIA 2AJLI 4RJIA 4JOBA 2YV5A 2YXLA 4MHTA 3N8DA 1V3VA 1QHSA 4WUTA 5DNDA 3KDAA 1T1JA 2OGSA 4EI2A 3AKZA 3HG7A 3D0RA 4QTZA 3FWPA 3ZG6A 4E2YA 3VH1A 4CM1A 1OT3A 1ZGBA 2VHCA 4MA0A 4J0KA 5HVNA 3HPLC 2WF9A 1XZPA 4BPRA 1FQOA 2FEMA 2H2GA 1Y4SA 1O96A 5NULA 2Y8EA 1VARA 3E9EA 2R7AA 3ABQB 3WZLA 3BQMB 2BE7A 4ZVUA 3G6BA 3OLVA 5DEIA 5BSFA 3HXKA 3I28A 1B8PA 3DE3X 1PL6A 2RGUA 4JYZA 4B4KA 1CCWA 1VHDA 2PSHA 5J40A 3GF4A 2BFBA 1SELA 4Q9IA 3DFKA 3HCWA 5C9ZA 2HIAA 5DEDA 4DAOA 1GN8A 5CTJA 3CH7A 1T0AA 2C8VA 3I37X 1T0KB 4EZBA 3BWDD 2LP7A 1EP2B 3CUSA 1QHHA 4JOCA 1ZXBA 2XUFA 5FJJA 1DEAA 3ZNQA 1MC8A 4KXRA 3VPXA 4B43A 3PVSA 5UKDA 2VT6A 2EIJC 3M6UA 3NP9A 2A92A 2WIKA 5LBTA 2W6QA 3LMKA 1QDEA 2OD9A 2SCUA 1SC4A 1Y8RA 2IXEA 4XEUA 5JALA 1F0NA 3KXPA 1OBFO 5HYVA 3MBMA 4K35A 3VCZA 2XCLA 1O0SA 4P38A 1IEQA 1L5VA 1W2BF 2J7KA 5IVDA 2O8CA 2VKQA 5LBUA 2E1PA 2ID9A 3I4LA 1RSOB 5GQSA 1D4AA 1UBUS 4RNDB 2DYRB 2VVTA 3DF9A 5ALGA 2I6RA 1MD9A 3DJYA 4G9EA 1D5CA 2PH3A 3ZE9A 2IYYA 1T5OA 3DYVA 4G0VA 3DEAA 1MABA 2CXRA 4FK5C 3TPZA 1IHUA 3VPDA 4JEIA 2HR1A 4KNWA 3DB1A 3P2JA 2HW8A 2PQMA 1DT5A 3UAOA 1N1GA 1TYZA 4B3XA 5MGNA 3BF7A 1HL7A 2RNBA 3LPAA 3DLTA 1LPSA 1N5LA 1JIIA 4PNZA 1JKMA 5FFFA 4PZPA 1B2RA 1I6WA 4IV5A 4NJMA 1YVWA 1UOPA 4E2ZA 5LMNB 3P3NA 4MUEA 3P2KA 4X9XA 1Z33A 2WB2A 1KOJA 1OJLA 3EFOB 2D7CA 4GF5A 4RC9A 4P22A 2XDQB 3SSAA 4LXYA 3MJHA 1VHWA 4OGGA 2EZ8A 4K6KA 4IIEA 1JQ5A 4OX9B 1WCXA 2BEVA 5IEJA 2QYOA 3GD5A 2DWEC 4WFJA 1NUTA 4ISBA 3HPRA 3F9IA 5KNDD 3WICA 3DOUA 3AGQA 2M6YA 4L75A 3AUKA 3T1YB 3MMNA 2Z1TA 5TISZ 3UMMA 3K79A 2VF8A 2Y05A 4QJ4A 5FPOA 1MV5A 4YLGA 3FKJA 2OZPA 5CYOA 1K4KA 1OLXB 3FD6A 2BY4A 4X63A 2BELA 4QC2A 4DIFA 2ZR3A 1SWWA 4NESA 3K59A 1W25A 3NWBA 2VSFA 1T2EA 2ZM5A 3QMWA 4X6LA 2ZR7A 4PHGA 4BVFA 4M38A 3A26A 4HDCA 2C3YA 3GGCA 4LYJA 4ZCTA 3DVAA 2M32A 2Z5LA 1J49A 1FXVA 2ECOA 4MTGA 5H02A 5BSUA 1P0PA 1JLKA 1PR5A 1X1EA 2QRMA 4F2WA 1E2GA 4UCSA 2ZE6A 2GAJA 3ELCA 2IP2A 4TROA 5CYPA 1JILA 1KSFX 1NF9A 3UK0A 3SZMA 1ONPA 1JEOA 1L0BA 3HY4A 4XWTA 1ROPA 4NXMO 2F67A 1EFPB 5U1PA 4TLCA 3ZBQA 2QYSA 2G40A 3HBFA 4HYYA 4Z4EA 1MG1A 2QRHA 4NONA 2JPDA 3ZD8A 4RQAA 3AM3A 1WCYA 2YIMA 3R6DA 1TM5E 2PKQP 4GKJO 4I5GA 3EWIA 1UZUA 3LRPA 4M1SA 3ZDDA 2C9CA 4L95C 3CT4A 4FDUA 1P6XA 3OWHA 2G09A 3EPHA 2ZODA 4UE2A 5DCLA 2VTKA 2GJSA 4XOUA 5ECDA 4NJOA 2DUJA 4MUYA 2WTUA 4PC3A 3HCEA 1RE0A 2Y1XA 4MS4A 1LLUA 2A5LA 4YJ3A 3JTMA 3SR0A 2VP5A 3C9TA 2CV0A 1EG7A 4MUXA 4DV0O 5DI3B 3N2ZB 2ZYIA 3P4XA 3AL3A 3CO5A 1I4DD 3HADA 1QLEB 3FG9A 4JN6B 2PWBA 1TO2E 2I67A 4Z7NB 5B1AC 1JXMA 5L3VA 2FZ5A 3IUPA 1NM5A 5KC9A 3DBHA 3AEXA 4UDNA 4YBZA 4MW1A 3VQTA 2BF4A 3CMAF 3M5DA 1GGJA 4QRDA 2BGKA 3THSA 3OM0A 1RKXA 4URXR 4PA6A 4FDAA 3ZC3A 4DW0A 1EA7A 2HQ1A 3CR3C 3C3WA 1T3GA 4GI7A 1X7GA 1DFHA 1HURA 1SCKA 3VX3A 3G5UA 1TQ2A 1NP6A 4MTLA 3TBHA 3LWNA 2NACA 3GUCA 3WGIA 2O8DB 1P7WA 1EK5A 1AQLA 4WVFA 3ZWXA 5L6MB 1RQXA 5KWVA 2FNAA 3OE5A 3QPUA 4MHOA 3UW3A 5KYXB 4D7TA 3K9GA 4B2IA 2HTEA 3SJAA 3LVFO 1G41A 4WBSA 1JTEA 4FLVA 1MOZA 1C3JA 1FRZA 3R5HA 1NW4A 2CYBA 2AN9A 4DEYA 3ZE1B 1SXJD 4B3IA 3VMMA 1Y63A 2C5GA 3DTVB 2Q4TA 3BFXA 1U3VA 2NMUA 3D2LA 1GD1O 4MGIR 3TVDA 3TR0A 3VXKA 1N2CB 4GWGA 2DWPA 1PVOA 4DV1O 5T57A 1K7CA 3ADPA 3JYHA 1E18A 1QB8A 2CSXA 2HBZA 2YYAA 3Q4HA 5FWDA 5HIMA 2W9XA 2Q6VA 3PJRA 2HDOA 1CJVC 5D87A 1T9AA 1I5OA 4NRDA 3DFMA 3FTFA 2FMIA 2NU8B 3S1LA 1KDRA 1Q44A 3EPKA 4QFCA 1Q82W 2Z83A 4O4HB 2QU7A 1W6RA 3KE8A 4P0PB 1HDZA 4KQ2A 5GIOE 2AQHA 4RZUA 4MAAA 3H9BA 3LKVA 4EGCB 4X1YB 4G25A 3T5TA 4CM4B 3P94A 4GIBA 4NZNA 1NMXA 1JPXA 1F51E 4H4DA 4I8IA 4BKOA 1H0HA 1U40A 3RSHA 4ZHVA 1JA0A 4BATA 2N04A 5ALWA 4RAOA 2DWCA 1EVEA 3D7KA 1IG0A 1NVPD 1GWNA 1NVEA 1ZI9A 3CYQA 3BH7A 5EJEA 3ZIAA 5HKKA 1A9PA 1EKXA 4I4CA 3BIJA 1GN2A 1H4TA 2FDCA 5IBCA 1H42A 1J6UA 2C4UA 1PWEA 3QV2A 3RTAA 1OBVA 4LZZA 5FBLB 3LUCA 1BS9A 1BSMA 5KQGA 3P2IA 1F5NA 1N6LA 1Z8DA 2WAMA 2HA3A 5E6SB 3AUJB 4M46A 1NQOA 4FYIA 3SGIA 5SV2A 5JD3A 2JK5C 1SCUB 2CBXA 3LZ6A 3NC1C 4Z7QB 2YZ7A 1RXVA 4W6ZA 1VF7A 2IWHA 1QF9A 3VHXA 2IJGX 2WU4A 1ZI6A 3K1TA 3N2LA 3TTUA 4ZN6A 2Y1CA 3QVOA 3TL6A 1AR5A 3ETDA 3LPNA 4MS2A 1RU3A 2W58A 2Y1FA 5BQPA 3A2FA 2KKWA 1SETA 1D1PA 3QF4B 3K20A 3ZCTA 4DXHA 3JQ7B 2QA5A 2BUAA 1IE3A 3KQHA 1W87A 2ETNA 2WWVD 3A70A 1CUBA 4I5IA 3LWVC 1N2OA 2UXDB 1Z07A 1CULC 3BXHA 3ZIAG 3RVKA 4A9AA 4K05A 2CHFA 2ZIGA 2NSLA 4LDNA 4U2KA 3FAZA 1Q74A 3HB9A 3OZXA 2Q49A 4UHKA 2FYUH 3V7EA 2VJCA 4DR7O 4Q4AA 2EATA 3L8DA 3P9RA 1ETHA 2ZUCA 4OBWA 3HACA 1RAIA 3DZJA 2QKSA 4DG5A 4PCLA 5H9CA 2TYSB 4UM9B 1S5JA 2H06A 3P10A 4CMAA 1Z39A 4PV1B 4P2GA 4JT8A 3OKPA 1ZPDA 4EBBA 4QAJA 1G9TA 2AX4A 3P19A 4D4KA 4G67A 3DF7A 2DHEA 5JR3A 1V11A 4PIVA 2D2VA 2H5JA 3CCSV 1HT2E 2DX7A 5TQ0B 1YITV 3I2FA 1VMEA 1H4QA 4KN9S 2I4RA 1ZJZA 3T9BA 3D8CA 5BXYA 5JARA 1QU7A 5EIOA 4BBJA 3KCYA 3DL2A 4Q6WA 1TKRA 1Y5NA 1PJTA 4JOSA 3RFVA 2HMAA 2CLDX 4KUEA 2P30A 4P8RA 5TPWA 2H1IA 4X8AA 3L75H 5KWIA 2IF0A 2PBZA 1WDMA 3U17A 3ZU5A 3PQ8A 4BFUA 1WO8A 4JYAO 3TIXB 3ORHA 4UNQA 3TE7A 1UXGA 2GVDC 4A92A 2R48A 3TQOA 4Y6QA 1B1AA 4N3GA 4O3FA 1L5HB 3WAGA 1C0IA 1QPZA 3VU9A 3WB0A 1SU6A 3MT7A 3M49A 4WESB 3IP7A 1BE8A 4LGYA 1Y34E 2OUIA 3VUFA 4DR1O 2COKA 4MCIA 4N9WA 3K09C 1LPMA 1RXWA 2I5PO 3C70A 2EFHB 1T5IA 1XI1A 3OMXA 4R1MA 1N1MA 3IIJA 1US8A 1C3EA 4EHLA 2WP0A 1YK0A 5DT9A 1FFYA 2QZ4A 3NBQA 2BHTA 2UUAO 2A9PA 3MJ4A 1GRNA 3H8SA 4MUHA 3E0QA 5KYWA 5LP6F 3WK7A 1EFHA 1T26A 1L8DA 4EF4A 3WTCA 2NR5A 3QLUA 1GA4A 3SSOA 1U96A 4PYRA 4Q48A 3BHMA 2O5RA 4UHFA 4LBEC 1EVKA 2H1VA 4B6JA 1R6DA 1FLVA 4HC4A 4RHXA 1NDUA 1NTOA 1QS0B 1MX9A 1N25A 3NCHA 2P9EA 4KFUA 3JD3A 4DIDA 3FWYA 3D4LA 3JCMM 4YT2A 2G17A 4E03A 3HWRA 4LUCA 4WLVA 5HOEA 2GRAA 3A4TA 3BYQA 2IV3A 4HPXB 4R1UA 1H2KA 3T7IA 2VDUE 2YHIA 1PZHA 2J7PA 3GQBB 1M8GA 3SC3A 3PEYA 1QYVA 3HU1A 2R87A 5FL7D 4KX5A 3RADC 3OIVA 1WKVA 1LJUA 3UMSA 4DJDC 5EJMA 2CXXA 5HZKA 4RF2A 1X7YB 4PLTA 1F60A 5CEJA 2ZUUA 3ZYCA 2YRWA 1X38A 3NDPA 5JJEB 4CGYA 2OBNA 5DLDA 5E7QA 1RFGE 1CP3A 3QFHA 1T24A 5WRFA 4I8DA 3K14A 3RLFA 3MWDB 1BYIA 4JC5A 1CZLA 2H52A 4KQ9A 1FYDA 1AKMA 5TGZA 5JVDB 2Y92A 1IVSA 1NKDA 1WULS 4R40B 4TSFA 1ENPA 3GV0A 1USUA 3EXHB 4M6WB 3CJRA 4QTXA 1T15A 5CFLA 7ADHA 4ERHA 3WJ7A 1B0ZA 3SNKA 4R1PA 1ZGHA 3K4PA 4EYKA 1Z0FA 3MTEA 4C87A 4TT3A 1CG6A 2PH5A 2VJKA 4BFYA 2VQFB 4RABA 3QKIA 1MOFA 4C6RA 2QVGA 4MIKA 4M98A 2QP4A 3FYDA 3D59A 4HDRB 2NXWA 2OYQA 3N4ZA 2R8OA 1OYWA 1JT9A 4U7DA 4LN1A 1F23A 4D9GA 3ZV4A 4DV3B 2QY6A 4AW9A 4ZZ2A 1EZZA 1KEPA 1T4CB 3T99A 5DX8A 2Z8XA 1NNEA 3Q6IA 1QP8A 3ORSA 5JUWA 3L07A 4Y2PA 4DR5O 1IMJA 3ZBUA 3BTOA 3WLHA 2XB2A 2CZCA 1MAHA 1ZJYA 2W2NA 3SVLA 2MSDB 4YMSA 3FF4A 2Y9MB 1VQ5F 1J8FA 5CUQA 1FQKA 1C80A 3N7UA 1NXWA 2DPMA 2EHDA 2EINB 3Q7SA 4P0TA 5KJEA 1OX5A 1DBPA 1OXSC 4WA8A 3KKOA 1JR3E 1EUZA 3JASB 3IALA 3O93A 2PBRA 3UT0A 2C7GA 4D1YA 1G66A 3ZIDA 1Z12A 4FJCC 2F23A 3RKSA 4NCAA 2AN5A 4GMGA 4B6RA 4TT3G 1QHYA 2MYTA 4E5UA 1R6AA 3MS2A 1U8YA 2Y1KA 1K6MA 1ZL0A 1E1NA 3BVOA 1M72A 2LCIA 4GE3A 4L8YA 4LX8A 3ZJVA 2RGGA 3L2OB 1CLUA 3OE1A 4NBWA 3DE6X 1OJHA 1A1SA 4KIWA 4QTUB 2HJFC 1WPXA 4F1JA 5IG2A 1RWVA 3TK1A 4C2UA 1KAHA 3UXHA 2AXTZ 4W5NA 3W6OA 1L7DA 1NKTA 2OHVA 1MRSA 3KOWA 4X3CA 1U1FA 3UHJA 3R7LA 3WJQA 1JDNA 4LJRA 1CERA 3NFYA 2IPLA 3JATB 3KTFA 4F97A 3DFZA 5DSZA 1D09A 1XVTA 4ZYUA 4NFYA 2L17A 1IDSA 1XEXB 1NVWQ 1OYVA 3V4RA 5IMBA 1U28C 1Z63A 1SJ9A 3ENQA 4FKZA 1O4VA 3CRQA 1AR4A 5EPEA 4B6SA 4AYWA 3ELUA 3C3BA 4QVKA 5B1BB 1JR3A 1YU6A 3ZOZA 4ZOEA 2O8FB 4QO8A 3RSLA 3EUFA 1EHYA 3EJWA 4CYMA 4WNAA 2PWYA 2BM0A 2WOJA 1YF2A 1DAHA 1WZEA 3KT0A 3OZ7A 5HW0A 1KKDA 2W7TA 3ZW9A 4HN2A 4M53A 4OEHA 1Z6AA 1II8B 1TVCA 1HMYA 2IG8A 5AVMA 3AR9A 1Q57A 2AFIE 3NTUA 3TDKA 1JMKC 2HJDA 1II0A 4JEUA 1VQ7V 5DHFA 2CVHA 3C41J 3I2KA 1X8LA 3EGXA 1MNAA 4D3DA 4MWBA 2PHZA 1GPUA 4UATA 1XAHA 2JVKA 4AULA 2ILTA 1B16A 3LNMB 2ETXA 4MVJH 4LF4B 2I22A 3A4IA 3CPSA 2C57A 3P71T 2XVAA 1FX1A 2WHPB 2FOXA 5DJ5A 4BT5A 5K3SA 1NRJB 4A0GA 3G1TA 3AHIA 5C1DA 3IVGA 1KKMA 1SCQA 3VR5A 3GLQA 1Q0SA 1SRYA 2D06A 5B3KA 3HKDB 1M1NA 1AMOA 1UKVY 2PH7A 4LMPA 4D0NA 4WLOA 3Q8KA 4EF6A 4TXJA 5KNCA 3OZGA 3EBLA 1QTIA 5ALPA 3D1VA 4F3NA 1HLFA 1F3LA 4XDHA 5EWMB 2A94A 4CS4A 1T34A 1YE8A 3IVMA 1YJNF 3D02A 4A5OA 5FA8A 2RBGA 1RYMA 5EJ2A 3UXEA 2BTUA 3JWHA 4FGWA 1M2VB 2HGZA 2R1TA 2MCFA 5LZ7A 5H9WA 2ZM6B 4PAGA 4PLVA 4WCDA 1ZU4A 2H0QA 2XYGA 2H51A 5EXXA 1E4OA 3OQOA 3NYWA 4UNIA 3PRHA 1XRRA 3ASUA 2WAAA 2D2CB 3AG4B 4UREA 4BJ1A 5JJNB 1OBOA 1AKQA 1JVBA 3DT9A 3PUYA 1HBJA 3DL7A 4DW1A 5JIBA 1XN1A 3WL4A 2VHYA 2H8PC 3A2KA 4MW2A 1BD4A 4GYKA 5EJ6A 4YV2A 2Z6QA 4MUJA 1ODSA 3VVBA 3QTYA 3M9LA 3NT5A 4P3OA 1GTMA 6REQA 1CUVA 4PANA 3KE9A 4TKMA 1FKAO 4IJQA 4H7JA 2VJQA 4X24A 2P7TC 1UBOS 4CQLA 3UUGA 1IMOA 2O2IA 1L5SA 2YC0A 2CLIB 1CQZA 5EUQB 1L5GB 3QPAA 1BX3A 1SVKA 1YVPA 3L8MA 2BHNA 1TZ2A 3K3PA 5A0FA 3WX0A 2F3TA 2NUAB 1KAQA 3DBOB 2ZINA 4AN0A 1ZM7A 3OCWA 3LPDA 1UXKA 3BEHA 1Z34A 3B60A 2YBDA 5TXGA 2HQSA 2BMFA 1CYEA 2OXEA 4JI4O 3G79A 1ZESA 1CC1S 3WHLA 1PZMA 2V7BA 5JWOA 2BR3A 2R66A 4MUNA 3W5VA 2GZAA 1NU8A 5EZYA 1T5BA 1CXZA 5H3CA 5DM2A 2BCGY 3P3PA 3UTCA 2XD4A 4GXTA 4B82A 2EIKB 4C0JA 4H16A 1TCUA 2OG2A 5DNVA 1UKEA 2XUIA 3SYCA 4BUZA 3UWMA 1E2MA 1G7TA 2P4SA 2R2GA 4FLTA 2F6RA 2QUBA 3ICQB 3WJRA 2B78A 3I9MA 4DBVO 3VRHA 3OQHA 4EDFA 4KWIA 1SK8A 3UO8B 4PWYA 5BQ3A 4QQKA 3ZJTA 4ID3A 4ZVQA 3J80M 4P2ZA 3PD7A 4HYQA 2F43A 3IB3A 2KSQA 4QICA 4P36A 2P4VA 5JW6A 3ETJA 3KYIB 1GZ5A 2P3OA 3NUZA 3TN7A 3BF8A 3RF7A 5A1JA 5BSWA 4Y3UA 1U2SA 5TIIA 4HBGA 4GZRB 1G5TA 2QVXX 2JNBA 3V2HA 1X1BA 3VHQA 4RFSA 2F95B 2EF1A 3BCHA 3KQSA 2ZWOA 1GTJ1 1JG7A 4CG2A 4LFCB 2EZPA 4B31A 1VEWA 2AF3C 1GV0A 3A3PA 2B25A 2I6QA 2ZBPA 4RACA 4KLCA 5ICCA 4KMOA 1ORWA 3BFJA 4UMVA 5LQRA 4B9AA 2VWHA 3H5OA 3KAJA 4NU5A 5ILGA 2I7TA 4DGSA 1FFXB 1NATA 4KO2S 4AY3A 2QAIA 2VQSA 1P73A 3OEHA 3CX4A 4YRJA 3HCOA 4YJKA 4HT3B 5TVGA 3VNAA 4M1YA 1LK7A 4B4VA 1LVUA 4RKFA 1QQ7A 4LY3A 2AKEA 3ZWKA 1X25A 3GYGA 3K0GA 2DYSB 5CIYA 3ROPA 1TE2A 5B58T 4G0OA 3I4FA 1CDDA 4BNMA 2YCLA 1NR7A 1WZIA 1XQ1A 4MV8A 3LF1A 3L72H 3OT1A 1OX4A 3QUBA 1VK3A 3R7WB 3ZIAD 5HKKD 3IVAA 3A6EA 1Y8QB 2GJ9A 2HYDA 3C39A 1FFSA 3SM9A 4BO6A 3QG5A 1Q7YH 3V4SA 3F8WA 4HFRA 1NLMA 4NMHA 2CFCA 4UTPA 3AOGA 4R83A 3WYFA 3F5DA 1AC5A 4ZOCA 1C2YA 1T6ZA 1A5BB 4FYJA 5GPBA 4BNFA 2HWYA 1Y3CE 2JARA 4L5BA 1U1DA 3GJXC 4FZ0A 4P33A 3U26A 1FL9A 4AB1A 4HGPA 1M7HA 3JZAA 2HA4A 4OQNA 2GKGA 2ZROA 9GPBA 2WLMA 4BWAA 3OEHG 4QGAA 1YT5A 3JCUZ 3ASNB 4FPPA 1WTCA 3FN4A 4NDAA 3R9KA 1UZAA 3TX2A 2SKDA 4WADA 4JFAA 1SOWA 1M5RA 1T8TA 1QB7A 3QGMA 4U7JA 5JAQA 4DUZO 4BZZA 2YQ4A 4QQ8A 3R75A 2R8PA 4ZODA 3MOGA 1MXHA 4GC5A 5K4AA 3QXJA 2JLQA 5LA6B 2P9HA 4U7TB 2NO4A 1RADA 2GVIA 3MSXA 3UXYA 1DELA 2OA0A 4N76A 3K6SB 1M6VB 3EG5A 3GHHA 1LB1B 4YX9A 2JLYA 3OZSA 3D36C 4KH1A 4FX2A 3T3OA 1AKRA 4TVOA 4L1KA 3CBQA 1Q22A 3CRNA 2GS9A 1UANA 4Q66C 4CL8A 1RAEA 4XASA 4OHXA 2W2LA 1APBA 4JAVC 3K0EA 4FR5A 4WDRA 3AIOA 1J56A 3CVXA 5EZSA 4DK0A 1ELOA 1T6BY 2VYVA 4J4HA 3GRKA 4Y2HA 3KWLA 4FLMA 3QOFA 2O52A 2A30A 2V6FA 3QFFA 1ZW1A 3V7NA 4LPSA 1PZNA 4KX3A 3D0QA 1ZKDA 2I3ZA 5DTJA 3D3JA 1Z5OA 3UT5B 3ETEA 4IZIA 4LAFA 4OUDB 4LECA 5KDDA 4O1HA 1W75A 3QMPA 1SVOA 2A4MA 2Q7EA 3FCYA 3UN1A 1JEQA 1GO0A 4L4ZA 2AOWA 3C6KA 1GV1A 5FPKA 1OZAA 3MB5A 3GLGE 2P77A 5C81A 2VT3A 2IS4A 2E89A 1PLLA 5F9HA 3R0XA 1XBIA 2C5BA 2BKUA 3ZXIA 4LK2A 1ZO8A 5HJ5A 3NVKE 1GEEA 1VG1A 2G1KA 3QFSA 4UJ3A 4K0KO 4ZGWA 1C7QA 2A3QA 1MO2A 3F6EX 4LVCA 2Q6LA 1JA8A 2VRZA 2PG3A 4I9FA 3FVRA 3PE4A 1R10A 3GNLA 4LDJA 3LBHA 5AI4A 1R6VA 3FF1A 1WHTB 1ZC3A 3WKAA 2R5WA 1E92A 1GSOA 3HYCA 2UXXA 3Q9UA 1YEWA 1CYDA 1CIVA 3A14A 2PS3A 3F2IA 2R8RA 4WERA 2ADMA 2DPLA 2VQDA 1BKSB 1OLSA 3GEGA 3OF3A 1DG1G 4TMFA 1BMFA 3HEBA 1GY8A 2R751 1JKXA 3CIFA 1U5BA 3ZWNA 4ZJZA 4AIIA 1Q50A 4WGGA 4Q3KA 4XQEA 1B6GA 2A57A 1UWVA 2GDSA 1NNUA 3ZHOA 3FCEA 4XLTA 5JT1A 1NQXA 2G70A 4YJ2A 4JZGA 5FWAA 3UJ7A 4F5EA 1AG9A 1SC9A 3OSZA 3I6YA 2B5VA 3F0EA 4BP9A 2NLOA 3D9QX 2HK9A 2P9YA 2EL9A 3DT6A 2ZJ8A 1TW2A 1DX6A 1NW5A 2GN6A 2J7PD 3GLGA 3QHPA 3HL0A 1E63A 1RWPA 1E7WA 2CE4A 5LD2B 3CD6F 2PMCA 4MVCA 5AXDA 5CEEA 4PD4F 1AS0A 2P62A 3OZEA 4KEAA 2JKVA 4E0BA 3PDWA 4HZGA 5EUCA 4ISCA 3AHEA 3CCFA 4RZSA 1J0BA 1K66A 1M90H 2R8XA 5A3RA 2QM3A 3CN7A 4RZXA 1KYTA 3L0BA 4OGQB 5JS2A 2A7WA 1YJWV 4EWLA 2J3JA 2GYYA 5I8WA 1PF7E 4KQXA 2JFUA 1IQPA 1SKBA 1B74A 2PRZA 1BMFG 3TUIC 4JOQA 1JHOA 1XHEA 2BJWA 4HMOA 4DR4B 5JJCA 4OYRA 2B9EA 2X1VA 4TSFD 1AD2A 2I0FA 1LLQA 2D0PB 3L46A 3VR4H 1JB9A 4KBYA 4R3NA 6AT1A 1CPYA 3ZJYA 1N1DA 3CLSD 4JBLA 4UEWA 4E4YA 1GR0A 3QVLA 3VKVA 4TT3D 2OQ2A 1ZINA 2V5UA 4PIMA 4IMJB 1WA8B 4K0RA 2QVYX 1U9YA 1EFRA 3PEUA 2JAXA 4HLCA 1GN6A 4AILC 2VSNA 2VLBA 3D3IA 3II6X 2WBLC 4AMZA 3S1AA 2HHLA 4IUBS 1L3CA 3KT3A 1AOXA 4OF4A 4GNKA 5GY7A 4B44A 3SYQA 3FNHA 3W7TA 2ZRNA 1XZFA 5HXUA 2OM2A 3NTRA 2QT1A 2FPGA 5KQRA 1TKAA 4LYEA 4Z1OA 3BDAA 3PYLA 4FIPC 1V7PC 3NEPX 5FEMA 3Q5EA 3UAVA 2XPCA 2F2TA 4G5GA 3PGMA 1BXGB 2OCKA 1NI4B 1U9JA 2QTTA 3B5IA 3CLVA 3B2NA 5K2OA 5A62A 3WG7B 5HMMA 3LHFA 4PW0A 2XUGA 3G9TA 2R5NA 4WIAA 3FKSA 3O1HB 1IV4A 4M99A 5LP6C 3QELA 4H37A 4O4JA 3PYMA 3VHRA 3GI1A 2R1VB 1A98A 3VISA 1X7DA 1FYEA 1XG5A 2JJQA 4IUYA 2ZR0A 1EFRG 4HVCA 3NO4A 3FWHA 1OI7A 1X6VA 3U60B 1KPIA 3H7AA 1HOTA 4EHNA 3TWOA 2PT7A 3MTGA 4O4IA 2A1UB 4JLVA 3PLAC 1POXA 1MOPA 4BMZA 3A1TA 1CRQA 4GRIA 3LWRC 1YCGA 4CV0A 2Q62A 2HPVA 4XIIA 3I73A 4K9SA 1ZN9A 1PV2A 1M56C 2EERA 4UDYX 1RLGA 1IIBA 3WGYA 3B70A 3N75A 5A2QN 1ZH0A 4O0LA 3K57A 1NP3A 5KCMA 4PGFA 3SLRA 1RCUA 4YP1A 3B2EE 3FDZA 4O2BF 1L0NH 2WD7B 3UAWA 4RVDA 2YX1A 4BAZA 3A06A 4C03A 4FM9A 3UJNA 2QAGC 1M5TA 4NKRA 4OLHA 1JR3D 1C81A 4U8HA 5LMUB 2ECPA 1KI6B 3BMQA 3GC6A 3L0YA 3OX4A 4MQFA 3S3XA 2JS5A 4N82A 2P6NA 3BEOA 4L9RA 3EEYA 1KKUA 3N58A 2MW2B 1VQMV 4S0ZA 4TWJA 1RPAA 5IDVA 1XTSA 5E1BA 3T12A 3KT8A 5TMEA 5ADVA 2IZOA 4DLUA 4E32A 2H57A 4QYIB 3S2YA 2OB2A 4O4LA 4RPHA 4C5AA 1UJ5A 5LYJF 4QVGA 3HXPA 4TV9B 1DI0A 2W6IA 2JEOA 5BXQC 1CV2A 3LCVB 4BNDA 1ZAYA 2B6HA 4ZIRB 5IE9A 2O59A 5KU1A 2FL4A 4IO1A 4BKRA 4F86A 3H84A 2HIGA 3PN1A 4Z99A 1WAMA 3GDWA 5JDIC 4F4CA 5GAPK 3D1LA 3VR5D 1YBFA 2AEFA 1RXSA 2FUG6 5ALKA 4C7OA 4J16C 4JGSA 3BZUA 3G17A 4Q21A 4V1CI 1UMKA 3B2EA 2ZGVA 1K4MA 2OOSA 1GUFA 4IHAA 4TPKA 1NRXA 5KNCD 1YDFA 3CCVF 2C9OA 2C8JA 3S2UA 1U7TA 1T1IA 4MB0A 4JJAA 4W6QA 5CIQA 1U3FA 1ZOSA 2GPAA 1TRKA 3D6TB 4X85A 5LGUA 4EKDA 1XMIA 1JVMA 1GDHA 1UBLS 4F4IA 1FLDA 4BNJA 2QTFA 1Q1QA 4MWZA 4D46A 2YWGA 2OXRA 3PGKA 5L95A 5KPDA 2X2EA 1XXHB 3IDQA 4US0R 2C4NA 4UCOA 2VWQA 1GITA 2AR0A 2FPRA 1P0IA 5LUBA 1UBRS 3QVKA 1Y9ZA 2VH1A 2O54A 1XZCA 1HZZC 3AF2A 4Z1VA 1IC6A 3K0TA 3A6KA 2O48X 4Q7QA 2GXUA 2G0TA 1N33B 1JE1A 3FI9A 1CT9A 4FBGA 2LE0A 2YUTA 3Q0TA 3OPXA 1UOQA 3ZZNA 1LDGA 3LCCA 3X2QB 4V0ME 5AM2A 1ORTA 3BEDA 4HNUA 3T9AA 2FW1A 3HJGA 5CH3A 4CIWA 2FEOA 1JQAA 4HATA 4D97A 2VH2A 2GN1A 1NH2D 4YRPA 5LXTB 2OBBA 3ZVLA 4ESOA 4G65A 3G67A 2VAPA 3ZHXA 4UBNA 4QXPA 1MXFA 2IY9A 1GU7A 4HUTA 3GG2A 1U3LA 4OJYA 1G6OA 3RTDA 2VNSA 1GZVA 5BV0A 1DAPA 3KLMX 1RNLA 2LQTA 4BB9A 1SM4A 4PAQA 5BQ5A 4GPTA 2O1WA 2AYXA 2I55A 2ORYA 2K7ZA 3C1AA 1KZ9A 3ANLA 1QQTA 1BHSA 1Y6QA 5JADA 3GH3A 2ZTSA 5HQ3A 3AT1A 4ZREA 4CRWB 1AJEA 2Y68A 3U5ZB 3SQXA 4Z2AA 1NFFA 4KWCA 1BXRB 1Y7TA 1QQAA 1BU8A 4H3KB 5JFTA 2FPIB 1MABG 3E8HA 2GPWA 4DLAA 5HEKA 3D2BA 4MQEB 2R00A 3FPJA 4XB1A 2PGLA 2I65A 2Y0DA 2QYTA 2JGDB 5EB1B 1WHSA 3FUTA 4WK2B 5G4LA 2E5LO 2CVPA 2JFQA 3O4JA 1O54A 1HTBA 5JPCA 5CDSA 3IKFA 2YSUB 3T1HB 4D8UA 1R66A 1KIFA 1CVIA 3QWFA 4RSHA 2AIFA 1Z7YA 4NENA 3R5KA 4LG1A 1AU9A 3HCDA 4EI8A 3AB7A 4M9XA 1RZUA 1OH8A 5JECA 2XE7A 4R69A 2JZNA 3W2TA 1JAXA 3NPMA 4LNAA 4PONA 1XTZA 4IW3B 4RPJA 1S2GA 2FR8C 5KWEA 3U4GA 4FYVA 3AG3B 2HLDA 3NFRA 1BMDA 1M2OA 2UVPA 3PCXA 4J7KA 1FDVA 5EC8A 1T25A 4WXRA 1XQXA 4IGAA 3AHJA 4JA0A 3O7MA 1KH1A 3ETCA 1VLQA 1RWKA 1Q3EA 2HQOA 4Q3AA 3A36A 5EOVA 1O1YA 1HT0A 3IULA 1YHQF 1JN0A 3OG9A 2IL1A 1NY5A 2PYIA 5FUXA 2D5LA 3B1VA 2OXFA 5B2EA 3AVUA 5EAZA 4CM7A 3VPCA 1EZJA 3DPIA 2PUSA 1OXKB 2HBRA 4CL0A 2GZ1A 3QPDA 4KLNA 4KR3A 4EMSA 1CRLA 4DLSA 1PJ3A 1N9GB 2XXBA 3F5QA 4JP5A 4N7MA 2B83A 1I14A 2EX1A 2FG5A 3EE6A 3OEHD 3T61A 1QFXA 2PQ0A 3VUEA 5KC8A 3AVVA 1SKMA 3ZE2B 5DNAA 3JAMM 1YI2F 2JEZA 2I4NA 4L8WB 1A7UA 3EQ7A 2XKKA 1NN5A 1GO2A 2JCGA 3ZLBA 4GSLA 4J1SA 3QWIA 4IZHA 4DDHA 3IB6A 3ETLA 2QRKA 3H3FA 3VYRB 2ZVDA 5IXYA 2ZBGA 4GEKA 5HFMA 1V16B 4IX9A 3QI7A 4FYXA 3RNLA 3ADBA 1MQAA 1QRTA 3PRYA 1ZBQA 3BIFA 1K5PA 4DT1B 2BM8A 1Y4UA 4F9TA 4DLBA 1KTVA 5C32A 3UGKA 2VWKA 3RW9A 1MJGM 2E4AA 3TFQA 3G0CA 5JC1A 2X6BA 1Z6ZA 3CRVA 3ER8A 5MFZA 3AFIA 3N7TA 3WRVA 3CEPB 2GAIA 4HS9A 1Q92A 4GI5A 1JOYA 3BDIA 2HQRA 3PA6A 3GJ6A 3TM5A 2QD1A 4GLLA 3PGA1 4FS8A 1NXOA 1S3GA 1Y9JA 2I54A 3SQOA 4M0EA 1WUIS 3NEYA 2PUWA 3VDMA 2F4NA 5CFPA 2NQ8A 1WCWA 5I7FA 3VOTA 3UT6A 4ZHYB 3SHFA 4PI2A 4UC0A 4EEZA 1DC6A 2R62A 1DTWB 1HYHA 2XCUA 3CEAA 4WKCA 1ODIA 2FRDC 4B7UA 1H6DA 3QBJA 3DE7X 4FHFA 4F4LA 2C04A 3P2OA 1H38A 2VK8A 1R4NA 2XXAA 1P75A 4BQSA 3JQ8A 3VYTC 2A6PA 2FSGA 2XCOA 3MUOA 2JEYA 2WSMA 1U7WA 2YTZA 1HQKA 4TWZA 3QEAZ 1SQ6A 4F8JA 4YECA 5L3SB 1GZ4A 7ABPA 3WJ2A 1H2XA 3KJHA 1FTGA 1JV2B 2I66A 3H83A 5IYZF 4GKVA 2CCGA 3RREA 4NOJA 2LV8A 1AS3A 3VO2A 5K0CA 2DMRA 2O2YA 4MYSA 1HNXB 4Z86A 2W2LD 4XCXA 3NTXA 1DDOA 4RS3A 1C7RA 4ACAA 4QOJA 4YXFA 4WOKA 5A6SA 3B36A 2VYVD 3RE3A 1U7HA 2AEEA 2XE4A 4I4TB 3AEYA 5AOCA 1F6BA 3LTEA 5FO1A 2JJMA 3KDPA 1K92A 3JU3A 1ZWKA 2Y69B 3EVCA 5FA6A 1SUCA 1MA3A 4Q1BA 3JQ9C 1E20A 5EB0A 2C3PA 1IWBB 4K9RA 2VDQB 3T0IA 1S2LA 2OP1A 1D4OA 4G0XA 1IUPA 5LQJA 1T6XA 4F2PA 3K2QA 2VHJA 4TMYA 5BV8A 5HIJA 5JRDS 3RU3A 3HVIA 3NHKA 2X0LA 4AZ3B 2C5HA 1G3RA 5JPDA 3KQOA 3E1GA 4OJNA 3AGKA 4PU0A 4AF6A 2CTWA 4JT4A 1E8MA 4CMIA 3VSAA 4LDPA 1D0VA 3HJNA 1Z68A 1QIEA 4EUKA 1VB5A 3AEKB 3ZLTA 3OHSX 1AKTA 1EE1A 1TLLA 2CFTA 2A59A 3GHYA 4JJ8A 3ECSA 4KQCA 4N5HX 1BJRE 1KQ3A 3FNRA 6PFKA 3ABIA 3MJDA 5CA1B 4NYKA 5IAGA 3WXBA 4KO1S 4EAAA 4N8SA 1P60A 3HCAA 1DEHA 4E70A 3M4JA 2QKYA 1TJ5A 2QX7A 2YC4C 3ZN0A 2QD2A 2QWQB 2DXIA 4J90A 1OTXA 4G4XA 4NB5A 3WGLA 2ZOSA 3WLOA 4I50F 3I0NA 5DMXA 2FEKA 3CLRD 3IFSA 1V8OA 3G5AA 1CJMA 3ZW8A 1BMFD 3UO2A 1ADJA 3R41A 3A1NA 3EEBA 3ZDFA 4P9OA 3ROMA 4C4YA 5DM70 1VP3A 3PFWO 3RTEA 2CXUA 1F51A 3LVRE 3KU1A 4QTYA 4KGVA 1H93A 1MAWA 4X00A 2EULA 5LQNA 1XR3A 2BIFA 2YJGA 3H5RA 4QOGA 1VSUA 1EXVA 4ZQBA 1GPLA 1E2HA 2BE3A 5FWXA 5BOSB 4CLRB 1RKVA 1SHJA 4EHIA 1TF2A 3MJCA 3D5QA 2AHZA 3O9ZA 4PGHA 5BSTA 3Q85A 3OUFA 3JZDA 3PA8A 2IH4A 4YAFA 4C4AA 1CJBA 2V6GA 1Q82H 2IHJA 5AYVA 5JXHA 1RHUA 2OFWA 1KO7A 2YWJA 1KO8A 5DPMA 1FNKA 1JEYB 3L7QA 1MV8A 1NR1A 1A88A 2XMCA 3STHA 5JHGB 3DEHA 4FLYA 4X6XA 1N2EA 4AS2A 1U6IA 1EVIA 5KSZA 1V54B 2B9VA 4R2JA 1U3GA 1BQEA 4DANA 3PQDA 1FW6A 2VHVA 4RK4A 4RF3A 3EHDA 4N49A 1N4CA 3AXTA 1IXKA 3R7AA 3HDHA 3SI7A 5B3LA 3GLHB 4FHCA 2B4QA 3AWDA 4BNIA 4MQUA 5IWCA 5LIRA 2XWPA 2E4WA 3S02A 1N9ZA 2FWIA 4C6TB 2WJIA 1RIIA 1F5SA 2DWQA 4S1PA 2FW6A 4PHHA 3U4DA 5IZCA 4X7RA 2RDCA 3LUBA 5IAKA 5EZQA 1CUXA 2B2NA 2ZXFA 4J0JA 3VSDA 1OIVA 2KG7B 4S05A 2O3QA 2VUTA 5JNRA 1EFRD 4JDPA 1D2AA 2B1JA 4H0FA 4M54A 2XAAA 4AD8A 1R3KC 2BD0A 1PR3A 2FSPA 3LNNA 3L0CA 1M2GA 2Q3HA 3H3XA 4PM4A 4U7NA 1RSOA 3Q8WA 4ER0A 1W581 4Q16A 1JPVA 1UPAA 2ZWPA 1RA4A 4KQMA 3F6SA 2WA1A 5K1PA 1I2ZA 4TYNA 4G8DA 4LHYA 3A1VA 1OPXA 4DV2O 2OSBA 5IJXA 2JD0A 3C3MA 5BPHA 3E86A 5EP3A 3IMPA 2OAQ1 1JPJA 1K3FA 3JSAA 4GYJA 2W2QA 1V43A 4NCIA 1V7CA 3GFBA 3N53A 1CR2A 4IF6A 1S0VA 5A4JA 3RC8A 2AZTA 3ZEAA 3EW7A 3RSSA 1TGVA 4EG1A 4G01B 3FKSD 3AG7A 5EMNA 1CEXA 3I6IA 3UENA 4HRYA 3ETHA 4XARA 3LS2A 4HNSA 3FDJA 3K70D 3DDNA 3ET4A 4BLOA 3IAFA 1KEUA 4N0DA 5EG5A 2YHSA 5GJBA 4RPIA 4NXMB 3AB8A 4Y9UA 3W2HA 1YQWA 1UJCA 4URZR 4GXQA 1MSDA 4GO1A 2F3SA 3G8DA 4MWOA 5JDCC 1CLEA 3MUNA 2BGLA 4GKJB 1VP9A 2YASA 3FLBA 3JWGA 1YWGO 2R85A 2P4UA 1TRHA 5JCOC 3KCNA 2YVQA 3VYUB 3DZCA 5GJCA 4R9UC 2B8NA 1KU6A 1VQ9V 3HVKA 4R8KA 2HK7A 4FYKA 2YYSA 2ISSD 5D00A 3FR8A 2QX9A 3D43A 3KQPA 5BQFA 1EEXB 4FQ8A 5PGMA 2I03A 4JU9A 4IZOA 3UJCA 2J3KA 3PR1A 2WIAA 4DV0B 3GRPA 3OZRA 1Y9EA 5FTJA 2WFMA 1J2UA 1HRDA 1WB7A 1JSCA 5E1MA 3EN0A 1IL0A 3TOCA 3N39C 2MJLA 3SX4A 5AVOA 3WIBA 3RSOA 3C97A 1EFVA 5EKDA 5I9SA 4J9UE 4O59O 2HPAA 4X92A 2AMLA 2ACWA 5FIUA 4HRAA 2XDAA 4M7PA 1WP4A 3KOXA 4HFMA 5AW9A 3B9RA 1V8ZA 3BHPA 4FFBB 4P4GA 3U19A 4PLFA 3HZOA 4R0VA 4RIGA 4LF8O 2WF7A 3BS4A 2APJA 2PNJA 2I3BA 1QNLA 3BXPA 1HLDA 1YZLA 2I6UA 1FLAA 1C9YA 4TS9A 2W6ID 4L07A 3V42A 4BRZA 4E5MA 3TZQA 2NX2A 4UPVA 1F8UA 3UMCA 4TSFG 3RJMA 7REQB 2Q3DA 2PYZA 3HMQA 3HB0A 1KERA 4M0DA 4XSHA 2CL0X 5EHXA 4I14A 4K46A 5DSTA 5TSDA 1VKHA 1QRUA 3U4CA 2YV1A 5HM8A 1I1QB 4BC0A 4FTWA 4BVJA 4EPYA 4DV1B 4YRKA 1QFMA 1N2CE 2OK8A 2W8ZA 1LC3A 1NVUQ 1Z4LA 2LDBA 5DI3A 4ZEXA 3G0HA 2LW7A 5ITZB 1Q5OA 4I1UA 5KI6A 4FMDF 1RI5A 3L0ZA 4UNNA 1L4LA 5EHQA 4X3OA 3PNMA 5K05A 3TLJA 1GR1A 3FA2A 3AYZB 4PEVA 5U4XA 3G88A 3C0KA 2QRQA 4AF7A 1DO2A 2GSMB 4BBZA 2D2FA 4GUAA 2CTQA 2ZI6A 5JY6A 3L8ZA 3LLVA 1HYBA 5GM2A 3DXRA 3I9V1 4Y18A 3UAZA 4J4TA 1L1QA 1M10A 2FUG1 1LNSA 2JIPA 4XWOA 1DKNA 3R3JA 5AIAA 2JH3A 1GSHA 3O8OA 4HAYA 1VLZA 1NT2B 4G5QA 4YP0A 4AMVA 3E8GA 1N4AA 1K86A 5TF4A 8ABPA 3BWYA 1ECGA 4I9HA 5JH7B 3O85A 4G1BA 2Z01A 4FEGA 4ZCLA 5KYXA 2ZFUA 1LBSA 3FFTA 1PFQA 1JR9A 3QKWA 1QYXA 3V97A 3UV6A 1J9ZA 5FPTA 5I7OA 2OVBA 2GEVA 2ODNA 2RH5A 2ZSEA 3CNQS 3EQ2A 5AJYA 3IVXA 3U7JA 5IDWA 2DB3A 1FD9A 1LDNA 4A8JB 4Z1MA 2GV9A 4FDTA 5DBIA 3KR0A 3IAXA 4XJVA 2H5EA 5JNTA 1PQYA 5C7YA 1NUHA 3LP6A 2GEDA 4QHSA 1TYAE 2WYUA 1G8AA 4C4XA 3WDSA 2NU8A 1Q3HA 3UFXA 2PMKA 3K0FB 1FNNA 4GX5A 4E46A 5KAFZ 4HH1A 2Z1EA 2AI3A 3KTAA 4J29A 3W7BA 2CFSA 1EJ6A 4EY8A 4RCYA 5U9CA 2Q0XA 4PZAA 3IEMA 4P4SA 2W2MA 2FR1A 1W35A 3ZWBA 4ENSA 1Q7CA 1WDWB 1GNQA 4O29A 2Q7OE 1Q0RA 4X1YA 2XNSA 1K7EB 4J0EA 1AHHA 1T2UA 2DHCA 4MARA 4HDKA 2BGIA 2AR9A 4DR7B 1BOFA 4PG6A 3ROKA 4R81A 1N2HA 4B4WA 2QVCA 3D6FA 3GEEA 1GPMA 4HWGA 1Z2NX 2F3QA 4ND4A 1G8KA 3M4XA 2AQKA 4US2R 3AVPA 1VKRA 2HLDD 1BQ0A 4IGGA 3CPHA 1UT5A 3VZQA 4Z1MG 3CXRA 2CMKA 1VSBA 2X8AA 2C2XA 3BZBA 3AG1B 2NUTA 2EKPA 3JD2A 2AFIA 2XQJA 3GPCA 2G9VA 1MSWD 2GBCA 4QXOA 1M54A 4TM8A 3MS7A 5J5CA 3RJTA 4X1KB 4MMZB 5E6SA 3PD0A 4DA4A 4PDMA 1YQNA 2PR7A 3GLRA 3RVBA 2IGTA 3W8FA 4U7OA 3R0PA 1G64A 1SCUA 3C7KA 4H18A 4F96A 4RK6A 4ZVTA 4GH5A 4PX3A 5HCUA 3ZI0A 3D8RA 4DBZA 3NCTA 4MMYB 2JCXA 3K9SA 1RAGA 2FPUA 1ZCAA 5K8CA 4NOLA 1K5QA 2GILA 5SYNA 1IVNA 5A9GA 1W3EX 1OA0A 4QRIA 1WL8A 5EQDA 2HNBA 3JZFA 3NXSA 4JYAB 3TNLA 1VQVA 3ESJA 5BNIA 1UPBA 2HA0A 1ENZA 4R01A 3RC9A 1YL7A 3JQ7A 3KKQA 3UMBA 3Q5DA 4IM7A 3VKUA 4ZCMA 3AR3A 2B61A 5AI0A 3T4ZA 4G27B 4KXXA 1OD6A 3FPGA 1U9IC 4J03A 3ANYB 3H9JA 5JYDA 4LBWA 4E5SA 4DQUA 4ZDWA 4DR1B 2AZ4A 3GMTA 3O82A 4M83A 3SWWA 1WPGA 4MLDA 1T0UA 4JKOA 1UDCA 2DBVO 4MJ7A 4EJSB 4LOIA 1Z2CA 5ENVA 2FW0A 3PS9A 3OAAA 3A9WA 4XYGA 1RRGA 4DM3A 2HN9A 2UUAB 5KNBH 1BVRA 1C1HA 4CN9A 1IAVA 2GF2A 2O0HA 3QMMA 4TUYB 4ENWA 3KOYA 4R8SA 3NBZC 1L4NA 2A0FA 1Y5RA 3RRYA 3AY3A 2FWBA 4U2BA 1XEWY 3WGJA 4UMFA 4RVOA 4L0DA 1Z0JA 3JQFA 1MC4A 4UVIA 1IUKA 1SOVA 4KNVA 4QZVA 3K5LA 4LQLA 1JQKA 1NSFA 1SESA 2AZ2A 2PD3A 3I56V 3OOYA 2LNDA 2PF4E 4HK4A 1E2JA 3HR0A 3I3OA 3Q6MA 4J3JA 1R0SA 1FTQA 2DZDA 5BSMA 1WLYA 5KTSA 4HVAA 1OUMA 1N92A 2OIEA 2FFRA 3ZHZA 1P2GA 3OAAG 3TBKA 3ZY5A 2YXZA 4GLXA 4WESA 1O89A 1V26A 4KMRA 5BMOA 2CUGA 1RMQA 5FPYA 2ZSJA 4IPTA 1ZL8B 1QDUA 1EGQA 3PUJA 3AU8A 2H4WA 5CLLA 4GI3A 4WLFA 4RPGA 4U8GA 4LRQA 2WA2A 3QLJA 3ABUA 1NBME 2DQZA 1V55B 5C4GB 4K03A 4HGYA 9MHTA 3BMNB 5FV7A 2WNIA 1NVGA 4Q47A 3QNUA 3K04A 3VU1A 1EXNA 5I7AA 3ZI7A 3CXHF 4CWAA 1ZLXA 1A9TA 4DNQA 1Y4DE 2WK1A 4UUAA 3T5DA 4EPVA 1X77A 4UBKA 1XDGA 2F43G 1X1CA 3EVEA 1DAMA 4TMKA 4URWR 3P27A 3SF0A 1SIWA 4IL6Z 1ULTA 3BH0A 2IYXA 2AIRA 5H6QA 3FAKA 1ZOPA 5FCDA 1ORDA 2GDZA 3KFLA 3UGQA 4PCVA 1H7MA 3PD1A 1VKOA 1U94A 3WBKA 5CYGA 1ZVKA 4JP1A 4DLVA 2GK7A 3A4MA 2QNIA 4MROA 1BVYF 4H77A 2UVDA 5BQXA 1G2OA 4DR5B 3D0KA 1OCZB 3LSYA 2Z04A 3E48A 2I2CA 3B3JA 4XWWA 2FW8A 5KQLA 2P9ZA 4PS1A 1DX9A 1QOPB 3SXUA 1YC2A 1KJWA 3S5JA 1G17A 3LGAA 1MO6A 2FZEA 2X8LA 1X7YA 5BSVA 5J58A 3JZMA 3NBFA 3EDQA 3QYAA 1ZHFA 3OONA 4PTYA 5GZ3A 2XT0A 3NG1A 1GO3F 3FYSA 3SBOA 3BD8A 3GRCA 3KK0A 5FPQA 4OIFA 2YINC 2IHUA 3WV4A 1OVMA 3P45A 1Z4IA 4CFYA 1NP7A 3DOIA 5JVDA 5EGNA 3CCMF 3T9CA 1IXRC 4M8KA 4UFPA 4R40A 4FPXA 5AI9A 2Q8VA 2ZJOA 2ZTHA 3GVHA 3EXHA 4M6WA 3RYTC 1G5IA 1RQRA 4L57A 4G0PA 5DCUA 1OWPA 1C8BA 1DKUA 3K9HA 4U63A 3A1SA 4L6IA 4RW0A 3LC0A 2XMSA 4HJRA 3A6PC 4LJ8A 1EFUA 2D2XA 5FOXA 3EA5A 5DISB 2C77A 4RIHA 4TWRA 3GA5A 3HZRA 1LR1A 4H1TA 5F3WB 2F3PA 3IURA 3CY6A 4BCDA 3GNTA 3Q11A 3BBLA 4AKHA 3EIOA 4BIUA 3TZLA 4JYCA 2ZTUA 3KYJB 1E7SA 4FLFA 2WJYA 3IVRA 4BWGA 2WICA 4GHWA 3JALA 2HVKC 3U44B 1T4CA 1DEKA 2NXNA 1A8PA 4CLEA 4QDUA 2C9ZA 1A72A 3BK1A 2QV0A 1NN3A 3N3AC 1NY6A 4ND5A 2ZB8A 1R5NA 4G6ZA 3A4LA 3KBOA 1K7SN 1TVEA 3ON5A 3SC4A 2BM1A 3L7AA 2W93A 3MEQA 2AXNA 3JASA 2YN2A 3S28A 2BBTA 1PWXA 3AERA 3HM2A 2JH9A 1D2RA 4DM7A 3BQ9A 3DUFA 1Z9BA 1T1GA 1DIBA 3MTJA 4TLDA 3PDIA 3SPGA 3OLYA 1MCZA 3IPRA 1DMSA 1NX9A 3CVYA 2ZJ1A 1NHGA 1NKSA 1Y1PA 1GK9A 4DGQA 4UDXX 4JJ7A 1YTUA 2VK1A 2ID4A 2NU9B 2J5BA 2GHTA 2ZRBA 3KJXA 1CEZA 2FPXA 1OIWA 1N8SA 3GTZA 4J6FA 4F4UA 2HO5A 4DEVA 1Z0ZA 3K4HA 4NCXA 1G8JA 4Z2YA 1H2LA 4UUPA 3T95A 1PX2A 4CC5A 4PNPA 2GNOA 2Y27A 4D25A 3ICOA 1NL3A 1L7RA 3QO7A 5B2FA 6GPBA 3HKCB 3DKKA 5P21A 3W5AA 1BE3H 1XCOA 4KACA 2AIZP 4ZAWA 1QFJA 1BN6A 3G1WA 1V5FA 5ALSA 3IEKA 3OU7A 5JYBA 4LZPA 3ZYZA 3EZGA 4R84A 1E77A 1N0UA 3ZIUA 5JZ9A 1ILWA 3IP6A 1DMRA 1YRLA 1KDYA 3IUJA 5F7ZA 4C43A 3RSCA 3KXDA 2OOKA 3EW9A 3I0ZA 4XYBA 3U7EB 4R2XA 3WGGA 1XF9A 3MVEA 3E9MA 4Q12A 3L06A 3K5IA 3UG6A 2QJRA 2O8FA 2RG7A 2AT1A 3G71F 2HCJB 2J3MA 2FPKA 1J8VA 4YV7A 1KEEB 4AC9A 4DWVA 4EVRA 3KSMA 4KQKA 4EJ6A 2XDYA 1MZFA 1VQ1A 3ZX5A 3D5EA 2FI1A 4Q1VA 4EITA 5LWHA 2X86A 5IFKA 4AN1A 4X44A 1S5LZ 4TZZA 1BROA 2C1XA 2CXHA 3A11A 4LKRA 4FLEA 4EMBA 7YASA 1TVKA 3FRHA 4X5OA 4M1ZA 2BRUC 4XM0A 4UVGA 2CCKA 5BR8O 5AVJA 2BJHA 5ALRA 1KBOA 3SSNA 3SJUA 4MPTA 1R6BX 5D3QA 1Q7EA 1ADFA 4JEHA 4FZ3A 2H94A 1ZC4A 3WLIA 1J70A 2C4KA 5E2IA 1B3QA 1P2VA 4BQIA 1MW9X 1UOEA 4RVFA 2WHPA 3N4YA 5B7NA 1XA0A 3MCTA 2NP7A 1E2FA 2NYRA 3BQNB 5AM4A 1NN1A 1SOAA 2R7KA 4OP1A 3JQDA 1Z7BA 2EJRA 1PNQA 3S8MA 1HKUA 3B3GA 1A2BA 3ACDA 1XJ0A 1SGWA 1PD0A 1HF3A 3DEZA 3MMSA 4H35A 3AEZA 1XAIA 4XZ3A 1RJDA 2Q4BA 5EIHA 3P0FA 3N07A 1JJFA 1JIVA 2P7HA 2PZ8A 1IUNA 1C7IA 1AUQA 2RCNA 4OREX 4HG2A 1BJKA 3VGJA 2AVDA 3SQLA 3FX7A 2V7UA 3SPXA 2R9AA 1MQSA 4ZT2A 2VPZA 4JQOA 1N2IA 3RS7A 1Q2UA 4IKPA 4PCUA 2QTGA 4P83A 3RFCA 1M2VA 3HWWA 2GASA 4JI4B 2W6PA 4GICA 2YMPA 1FMCA 3ZQUA 1MDBA 3ADCA 4MTCA 3GNSA 2ZG6A 3VZCA 1IFXA 3GGSA 1AMUA 3BMCB 1ZMXA 3Q40A 4K2HA 3PHBE 2FEWB 2MSKA 3H5VA 5TMPA 1MJHA 1HG1A 1HE8B 5BN4B 4UTNA 3FHLA 2R4TA 3K92A 4H27A 1QV7A 1R0YA 2X41A 5FX2A 2IOFA 5BW8A 3A6GA 2WE8A 1B3BA 3AR7A 2I6FA 4BEJA 2NV6A 3HRHA 1C3OA 1F20A 1RP3B 1ULUA 4NX2A 1ZICA 3CPJB 4JI7O 2YWXA 3OX2A 1GNSA 3TGPA 2YZNA 1Z5UA 1V5WA 5CLHA 4A91A 1V7QA 2KHZA 2D62A 3CMAV 3HO6A 2B4AA 4CKYA 1YU9A 4MVSA 3MLEA 4WDQA 1UK7A 3OCVA 4XKJA 1QU3A 2IQIA 3CCLF 5IKPA 3P2MA 2BTOA 1URFA 4KR0A 3R3HA 3DV9A 1HK7A 4BNGA 3AG2C 3DWIA 4ANFA 1MX3A 2DJ5A 2R8ZA 2NUAA 3KDSE 1XALA 3ROFA 1JHZA 3L7MA 1T9DA 4P9NA 4MICA 3EDRA 1XK6A 1M6YA 2KB0A 2CD7A 3BA6A 1SC5B 2FWNA 3EPRA 4UHJA 2QL9A 1Q7GA 1QUEA 1DGSA 5FRDA 2OLEA 3UW1A 4PPQA 2O4UX 3I1FA 4LS3A 1P2DA 4ENVA 3FKSG 3L7LA 4LRWA 5GJWC 1O0BA 5HGXA 3A3OA 3OURA 4C7MA 3UM7A 3TMAA 3PWTA 4BNKA 4FKBA 1LFDB 3N2YA 3AEQA 4ER5A 4I1SA 3AUXA 2X4LA 4KGDA 4QUIA 4HGNA 3CB2A 2Z8YA 3KOUA 2CSUA 2N42A 4RA9A 4TYYA 3TD4A 3GFSA 5AQ1A 5EMMA 3I12A 2D5AA 5CXXA 4EKGA 1H94A 3NAGA 3GELA 3IQIX 2D0OB 3DONA 4EI7A 3OC0A 3T3HA 3ETGA 3MIZA 2ATKC 2F93B 1A4UA 2A0YA 5LN1A 4IOLA 4XX0B 5FXMA 2BFEB 3ABLB 1XMQO 2FKNA 3I52A 5B53A 3QRWA 3GVMA 2JDIA 4RMJA 4Z1MD 1YNOA 3FOZA 1KU0A 4YO7A 3LQFA 1QIGA 3D8TA 4KSBA 3KOMA 1SBHA 3WWCA 1AQUA 1CUUA 2RGXA 3KJNA 5JQGB 4IF4A 1COMA 3AH8A 4CXMA 4OG2A 1R5OA 1THZA 3I9V6 4MVJF 3TSZA 1XMOO 8ADHA 1LZKA 2XUOA 2QTLA 2I1WA 3HSSA 1KNJA 4D4MA 4DUZB 4S3MA 5E8JA 2OY0A 3GJ4A 3M4YA 1FFXA 3JS5A 5EWLB 4EZEA 5FTKA 4EFLA 1C9MA 5ALZA 2ZI3A 3ZTWA 1JA9A 2OTCA 1NDHA 5CDYA 4IJMA 4YNBA 1GAXA 4MMXB 3STYA 3T2MA 2GHIA 5AVYA 2QI2A 1DWQA 1M93A 1CF2O 4LSMA 3B8NA 2GSDA 4QPDA 2PV0A 1NZ6A 1ZX3A 5A06A 3ETNA 2IY7A 4BNNA 5LMZA 2YEVA 3QUSA 4KVFA 2ZJYA 4HQLA 1P81A 4YGYA 1F8YA 2FQYA 3NHRA 2JDIG 1SHZA 1RR6A 2YIVX 3I9OA 3AF1A 2W6IG 5AOBA 3DVSX 4ENPA 1PK9A 4YAUA 4R4JA 3AV0B 4AJ2A 1TM3E 3L01A 2X4IA 4UPEA 1O9GA 1SCNE 3LF2A 1JDZA 4PR3A 1I1OA 4EHFA 3UM9A 3NS7A 2HP8A 1BG6A 4QPZA 3GYQA 3FOCA 1EM8B 2RBEA 3EXEB 2JHPA 4XGIA 1PU2A 3P9CA 3ZMUA 4MT8A 2CNOA 4YRMA 1JJ2U 2CJYA 3M2PA 1JYFA 3D6MA 3RV3A 4MAMA 1T1RA 3AFOA 3GUYA 1E58A 4QO7A 5EL0A 1ODFA 3IHLA 2G3YA 4XWYA 2X22A 3AFHA 1TQ6A 3VKHA 5JHHB 4MWGA 5KVVA 3R0ZA 4TYPA 4AVYA 1EEHA 1TAHA 3I2HA 3LDGA 3SCZA 1Q21A 4PSKA 4KN8A 1XYYA 3QW4B 5LA6A 3CUKA 1PZEA 4K0KB 4XVQA 3V4VB 4TYQA 4HR7A 1XRGA 1H2WA 1WNFA 1KKCA 2BI8A 2VSYA 4PZZA 5J5AA 3DEIA 3WK4A 2VWJA 4B33A 3ZHSA 3A0BZ 3OAAD 3X3HA 3NAMA 3MMZA 3K0BA 4LJAA 4AZ0B 1RKUA 2ZJ4A 4TM7A 3UOGA 3L1UA 2GPNA 4ZOAA 3DC5A 4BN5A 3E5RA 3QIVA 1WUHS 4TS1A 3E6AA 4RCZA 1P1RA 1TIBA 1QMGA 3ET5A 1JPNA 1CUFA 1NLUA 3H13A 3HA7A 1AT1A 4QHTA 2FG6C 1BHO1 2J41A 3CPQA 1GTSA 1V5IA 3PQ4A 2V6BA 1L4UA 2KB1A 4NTWA 4JFRA 4NUTA 3A6HA 4QT0A 1OLUA 4KPUB 1D03A 1BEEA 1ZLYA 3BGVA 5DLQC 1SERA 1JIKA 4P3YA 5IUKC 2ENWA 1RP7A 4V0MA 3IJ4A 3AESA 3KWMA 1TNDA 3U4AA 4P84A 3Q8LA 3JVUA 3D6AA 1NQTA 4LSWA 2VOEA 3ONNA 2EEZA 1SU8A 2FVXA 4ITUA 1H1TA 3GAFA 3OTFA 3I8OA 2H7XA 3O8DA 2ONZA 3EF3A 1AKEA 1T5HX 3FW1A 3O21A 1ZCBA 2D1FA 3H42B 4EKNB 1P7YA 3A3YA 4REQB 3BJZA 1EG2A 3S7ZA 1I4OA 3I5XA 2ZTVA 3CNBA 2OAEA 1RRKA 1IQUA 5I3ZA 2DWUA 4WNIA 2AS0A 2A0LA 4DSUA 1CFZA 1F6DA 3BUSA 2J0SA 3O8QA 4BZXA 4KFRA 3ICWA 4R2LA 1G2IA 3MAAC 3P0ZA 3MYRA 1WHTA 1P4GA 3P9IA 5EA2A 3HEMA 5BO5A 3B6KA 3MXTA 3BDVA 2IS6A 2YXDA 4K9OA 4C7KA 3QVWA 4L72A 5JXIA 4MGYR 1E6MA 4ZI7B 1UXJA 1Q7TA 1QAHA 3QXXA 1XK7A 1JSRA 4WN9A 3NP7A 3HN7A 4XCVA 2KBFA 5K0TA 4M1EA 3DO6A 3TSCA 4MV9A 2FP4B 1GFSA 3JYNA 1FXKC 1KC1A 2HLDG 1W4ZA 1C2TA 4HB4A 4E2WA 2HDWA 1Z82A 3D6JA 1AHPA 4ZQGA 2I2WA 1N7GA 1RABA 2JZOA 4Z4GA 2ZYAA 3FSEA 4BO8A 4H4EA 2DM6A 2FZGA 3IPAA 4J7UA 4LK3A 4TZ0A 1PK8A 3L4BC 2YMQA 4CUJA 5F4BA 4BEBA 3ILSA 1GUDA 5GW7A 2HRQA 1RLTA 4DPKA 1DO0A 5DYIA 1FP4A 4WCFA 3U49A 1JWAB 2QN8A 3RLIA 3FPHA 3H2HA 2YXPX 4CZZA 2FDXA 1YJAA 2JLRA 4UUJC 2FUNB 2FQXA 1R8JA 2X9NA 1JQ0A 3CC7F 4PA3A 1IATA 2NQTA 3GDGA 4CIVA 2ZAOA 4XJXA 4AQYO 1OREA 2LBXA 3DDSA 5B55A 4O2AF 3C3SA 1A5AB 2GD6A 4DWWA 1NVVQ 2JFYA 4BNVA 2XQKA 5L7TA 3E89A 4PDLA 1SU7A 3FWZA 2PMPA 1ZS9A 1ZIXA 4MV7A 2WAYA 3Q3EA 5BR4A 2VBFA 1L6RA 4MI9A 1YZBA 2X9VA 1JJAA 4WT7A 2XOKA 2RHWA 3AJ8A 1FF9A 4UUOA 2RI0A 3M3HA 4GZ5A 2C5LA 1XELA 2R7NA 4QPJC 2GD1O 1LW7A 5A05A 1X80B 4XGQA 3A1CA 2N9UA 4HX5A 3QKSA 2W70A 3VTIC 3BE8A 3KPYA 3DTUB 4F06A 3JVVA 3V6LA 3EXG1 3O74A 4EG5A 5A2QA 3RG8A 3O3CA 1UFRA 4H2DA 1QYDA 4TQAA 1XUOA 5BQOA 1ZUNA 1WA8A 1V1MA 5FWYB 3DD5A 1NGSA 3ROXA 5JOQA 1GX1A 2P4HX 4ZCSA 3TEMA 2GUGA 4RUKA 1YXMA 2PXHA 2IOFK 2GUZB 2BGGA 3M82A 3LVQE 4B75A 2C4VA 5AOVA 3ZEIA 3SZUA 4TWAA 3KQUA 1TA8A 5HY1A 2W6ZA 4KRYA 2X3FA 3MUFA 4XXHA 1MG0A 4KPYA 1FP1D 4MVJI 3B6EA 1T3SA 4ETMA 4WSOA 4E1AA 3V8BA 1JHVA 3R7BA 5K3FA 3ZRSA 3FDIA 4MRMB 3LYHA 4D3SA 2EILC 3R3XA 4JNKA 4OXNA 3CZMA 4B5LA 2VA8A 3FMFA 2QN1A 2HS4A 4H44B 4EHKA 2O9JA 2GTIA 3B1YA 5HY2A 1VBMA 1MBZA 3GT7A 1VJRA 3QHQA 4Z5XA 4DHEA 4UE6A 3M6VA 1FMTA 2XNJA 5AUPB 3PC7A 5ELMA 4JYBA 3C9UA 4IL5A 2HEPA 3VNVA 3E1KA 3CFYA 4FW9A 3MCQA 821PA 3HKEB 2CMFA 4PICA 3GWOA 1E2QA 3L9WA 2KYRA 3TAUA 2H1LA 4HP8A 2QMHA 2YC2C 1L7PA 3ABMC 4AJIA 3RJ9A 3J81N 2K9PA 3ZWCA 5CEFA 4H7KA 4MW8A 2Y93A 4BWFB 4YUXA 2EZOA 2AHRA 3L18A 1XRQA 3HNPA 4Q7MB 3H75A 2JF0A 4IS2A 3THWB 3RVLA 1ESCA 1TUGA 1KEZA 3LDDA 3V8QA 2X14A 1XRSB 2WD7A 1H6CA 2C94A 4JY7A 4PLHA 5B5EZ 4NZOA 4F60A 5TPZA 3G6EF 4B9EA 3NVDA 2UZ4A 5EVJA 1E62A 2IYTA 2IFTA 4IUCS 3SR4A 2OYCA 3TR5A 1NNLA 4RGBA 1EFCA 1LU9A 1KI6A 4PSCA 4B2PA 1YJ9F 5J4HA 2QUKA 1D7OA 1P4AA 2YZKA 1XD8A 1WIWA 1JEJA 5HA5A 1RQ7A 3EMVA 3U81A 4LY6A 3LWDA 1XXHE 3LKBA 1X4TA 3C3PA 4BNUA 4IGEA 4F4JA 4R9SA 1X3SA 4ZOLF 5DBEX 5AVZA 4CV3A 4PG8A 1P1IA 5JBQA 1I2CA 2ORVA 2EJBA 2G7ZA 5TRTA 4ZMSA 1KBHA 1GKYA 3L6RA 1KYIA 4FNGA 2WKWA 5IM4A 2J4FA 1JE0A 2BFDB 4N21A 1D2GA 4Z0PA 4G0WA 4EY4A 1QJCA 4ZIRA 4RY0A 4WXPA 4P5EA 1L5QA 3IR5A 4YPVA 2OV2A 4TT8A 3D8HA 3BA8A 4FUTA 2C2AA 2ILVA 4JD5A 1E0DA 4EG7A 1XV5A 2HWUA 4M4SA 5EJ8A 1YVDA 2PY5A 3FVWA 4JJZA 2IUFA 3GBSA 3WL6A 5I6DA 1U7XA 1QO9A 2ZTLA 1XZMA 2VGMA 3ASVA 2LKCA 1PDWA 2ZUBA 3AG6A 2GN8A 1Z5PA 4YMTA 2WG1A 3DHNA 4D4GA 5JAPA 3OZVA 1YL5A 2ZIUB 4EY7A 3KJEA 5BMVB 1W55A 3PIIA 2XTJA 1SXPA 3WGZA 2MR5A 3GRYA 4P0QB 2HA6A 4OI0A 4DMLA 1NE7A 1E59A 2EP7A 3N8IA 3Q6NA 2ZIMA 1XAGA 3OZFA 3I6ZA 3GEHA 2HR3A 3TNJA 2NO9A 2BN4A 3G82C 1PQ4A 1XXHA 2C5AA 4OHFA 1MKYA 1C8KA 2PRJA 4QUDA 2HA7A 2E5LB 1OFGA 4FGKA 1X42A 3FZGA 3B6IA 4R8CA 2WTEA 4G2NA 1H85A 1X7ZB 5HBRA 4G9BA 4DSZA 2IHTA 3FPIA 1B6TA 5AKXA 1KB9F 2VCYA 3K5OA 1N3BA 4QFDA 2AOTB 4BUJA 4HUQB 3HXLA 3AM5A 3TF5A 4FQ5A 4BP3A 3GAZA 1D5WA 1O58A 4ROSA 1AQYA 4OK3A 2PEYA 1WSAA 3A7EA 3RFUA 3MWLA 4RX1A 5LXTA 3M7IA 3AW9A 3IBTA 4J10A 2IYNA 3E27A 1EGVB 3BKXA 2ERYA 4FHEA 3EFOA 3T41A 2PZEA 2GAOA 2XDQA 3EEIA 3LRXA 3AJEA 1O8BA 2L82A 4RPKA 3S03A 3CLHA 4RLHA 3RTBA 3HUDA 1YRBA 4WFHA 5DTEA 2WVHA 1BW9B 1ZMBA 3CLTD 2XMZA 3WNBA 2DBRA 2ZJ2A 4ZJUA 1BXRA 3PI7A 4CF6A 4ZVMA 1M2JA 3GO4A 2XA1A 2ZWVA 4Y6LA 4MQEA 2NWQA 3SX2A 1XNQO 4DLWA 2JGDA 3Q3HA 1OLXA 3QUTA 1P1BA 5IK2A 1B0UA 3R65A 2BFCB 3VDQA 1BHAA