3IKFA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 717, imidazo[2,,1-b][1,3]thiazol-6-ylmethanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikfA00
1IV3A 3IKFA 1H48A 3F0EA 1YQNA 3T80A 2PMPA 2GZLA 3EORA 3P0ZA 5B8FA 1W57A 1VHAA 1U3PA 3FBAA 4C8IA 1JY8A 1KNKA 3RE3A 3JVHA 3IEQA 3K14A 3K2XA 3B6NA 4C82A 1T0AA 2UZHA 1W55A 1U40A 1GX1A 1VH8A 3FPIA 3F0GA 3KE1A 3MBMA 3F0DA 3IKEA 2AMTA 3Q8HA 4C81A 1JN1A 1KNJA 4C8EA 3ERNA 3F0FA 1IV4A 1H47A 1U3LA 4C8GA 1IV1A 3F6MA 1IV2A 3ELCA 3GHZA 3P10A 3QHDA 3ESJA 3IEWA 1U43A
chains in the Genus database with same CATH superfamily
5IYZB 3N2KA 5GIOC 5FNVB 1YQNA 5JH7B 3V7QA 1FNJA 4G88A 1KNKA 5EIBD 3RE3A 3HKCB 3JATB 2WALA 3CC4F 1XRGA 3J81M 1YJNF 4TV9B 3LYBA 4X1IB 2N48A 4WBNB 3F0GA 3RA5A 1X7OA 4C4WC 2OZBA 3CC7F 1KQSF 4C81A 1CK2A 2Z01A 5JQGB 5J2UA 4TUYB 5JVDA 1W5BA 1QU9A 2CSLA 3FD5A 2W8BC 5FNVA 5JH7A 2PMPA 3EORA 5GONB 2UYNA 1NQ3A 1FSZA 3HKCA 3S02A 3K2XA 3N4YA 1TUBA 4X1IA 4WBNA 4EB6B 2VGNA 1YI2F 3ZOPA 3CXCF 4O2BB 4EI7A 2LCAA 4ZHWA 2L26A 3S0HA 1Q82H 5JQGA 3RYCA 4TUYA 4ZK7A 1IV4A 3ZP4A 4ZI7B 3WGLA 2HVYD 1FFXB 5LP6A 3ESJA 2HRYA 3JAMM 3V3TA 3LFOA 4YJ3B 5GONA 5ITZB 3HJWC 1VQVA 2HS3A 3I7TA 4EI9A 3LWQC 5EAZA 2R751 2HX0A 2UYKA 4IIJA 4EB6A 2HS4A 2RB9A 3QUWA 4X20B 3CCQF 3E1YA 1YHQF 1YJ9F 5LXTB 1QVGF 3G6EF 2OTMA 5LYJB 3KJKA 2AIZP 2CW4A 1W2BF 3VYTC 3PAFA 1FFXA 5AVMA 5GINC 4YJ3A 1CLIA 2F9ZC 1XV2A 4BT5A 1VQKF 2Z1EA 5LA6A 2I6DA 3T80A 4I4TB 1VQ7F 5HY2A 3WJRA 2H8CA 3MDOA 1YGYA 3VMFB 1X25A 1ONIA 5CB4B 1ODEA 4G4VA 2ZOVA 3C9UA 1UI9A 1X52A 2I6RA 4X20A 5HY1A 4RHAA 2V9YA 5CA1B 2LBXA 5LYJA 5IJ0B 2AMTA 2CVLA 1CN7A 2FGYA 1Q86H 2H8EA 3VTIC 3ERNA 3UT5B 1VQLF 4TZZA 1K73H 4F6RB 1IV3A 2ZVYA 1RLGA 4I4TA 4BVSA 1M1KH 3NMUC 1W3EX 3MCAB 5GAPK 3S03A 1GO1A 3HAXD 3FBAA 5CB4A 1N8RH 5LOVA 2UZHA 3K12A 3HWUA 2VAWA 2VXYA 1X7PA 3RA6A 1FNKA 3MQWA 3C9RA 5GIPC 1Z5VA 1H47A 3CCVF 5J2UB 5JVDB 4DRXA 2VAPA 5HP8A 3NK7A 2QTPA 1VQ6F 5GANK 3CG6A 3I55F 3M1XA 4BVQA 1VHAA 1U3PA 2HQSC 3LWRC 2OTJF 1JY8A 1OFUA 4B46A 5FLXM 2UYNB 2HRUA 2ALEA 3AGKA 4M8IA 3VCZA 1VQOF 1VQ5F 5HXUA 2GVIA 1GZ0A 1TUBB 3FPIA 2DT4A 3KE1A 4BT6A 5A2QM 5BMVA 3C8LA 3IKEA 1JJ2F 2VGMA 5G4VC 3JASA 3WGNA 3LWVC 4ZHVA 3WPXA 3RYCB 1Q8RA 3KJJA 2FC3A 5LP6B 4YJ2A 3P0ZA 1W57A 3K0TA 3JALA 4X1KB 1K8AH 1VQNF 2B33A 3LWPC 2Z1UA 4IIJB 2CHSA 3SIVA 1KNJA 3VI6A 2H6LA 4BT2A 3S0WA 3NK6A 3C9SA 3OONA 2Z1FA 1Z5WA 4B5CA 1H48A 1GO0A 3WGJA 1DBFA 3V4DA 2KGWA 4X3LA 5HWEA 2Q1YA 1QAHA 5LA6B 3VYSC 5LP6C 1Q81H 4X1KA 2HP3A 3IEQA 2HP0A 2R6R1 1T0AA 5JCOA 3E22B 3QTYA 4O2AB 1VQPF 2K1SA 3LWOC 4E6EA 3CCUF 4I50B 2CZWA 4EI8A 2DYYA 5IJ9A 2JNBA 5MN5A 2UYJA 3CYPB 1YJWF 3CCSF 3VYUC 1ZWZA 4NWOB 3VIUA 3WGMA 2GZLA 3ZO8A 3RYFA 4XCQA 2KG4A 2BO1A 4KWEA 5KX5B 4G4YA 3RYHA 5LOVB 3E22A 1U40A 4O2AA 2OTLF 3SIUA 4X3MA 3HKDA 5EWRA 4I50A 5J2TB 2AIFA 2QA4F 2EWCA 4C8EA 1SA0B 2MQEA 4DXDA 3GTZA 1IV1A 2QEXF 2G9IA 3JARA 4HNAB 1QD9A 4BVRA 4DRXB 1W5AA 3IKFA 3BYQA 3F0EA 3G4SF 4BT3A 2VAMA 5KX5A 3V7EA 1H7MA 5EZYA 1T0KB 2Q1XA 3CB2A 3KHNA 1W5FA 4B45A 5C8YA 5HY0A 4PWTA 1PXWA 1VH8A 1NMUB 4NUTA 1PF5A 4ZHQB 5J2TA 3KIZA 1SA0A 3U0OA 3HKEB 1VQMF 5BMVB 1YITF 3N2GB 3D01A 3JASB 5EB1B 3P10A 4HNAA 1Q7YH 2RHHA 1UFYA 1U43A 3JAWB 2NMUA 2KTUA 4YJ2B 1JFFB 4BW0B 3L7QA 1W581 1W41A 3NVKE 4O4JA 1XBIA 4C82A 5CA0B 3JALB 4O4LB 3HKBB 4NQ3A 3FFMA 4ZHQA 5DCVA 3I56F 3MBMA 3HKEA 3CMAF 1JN1A 1COMA 3N2GA 4IHJB 2BTUA 2ZVZA 1QVFF 2KTVA 1KC8H 2RHOA 4BY9D 5EO3A 2PHNA 3VO8A 4U3JA 3JAWA 2YYEA 4LNUA 5EB0A 3CCRF 1JFFA 3P4EA 3CMEF 3CCEF 3S06A 3JVHA 5EYPA 1S72F 5CA0A 3PLAC 3B6NA 4O4LA 4X1YB 3HKBA 3C9TA 4LCKA 1YIJF 2HP0B 3CPQA 3CCJF 1IPAA 3D54A 1J7HA 3F0DA 3LDTA 3Q8HA 4IHJA 3CCMF 3R0PA 5MN6A 1TVKB 3CYQA 5KMGB 3CPWF 2ZF8A 3GHZA 1IV2A 5IYZA 1SDSA 5IJ9B 3OBYA 3TD4A 3VOBA 2QI2A 4FFBB 3JATA 2BTOA 5G4UC 5HXZA 3RYFB 4BT7A 4TV9A 4X1YA 2LBTA 2LBWA 3JAKB 3RYIB 1E7KA 1JD1A 1RQ7A 1W55A 3RYHB 2IAFA 1GX1A 3VOAA 2RHLA 3TD3A 3MCQA 1TVKA 3HKDB 4ZOLB 5KMGA 4O4HB 3ZP7A 5JCOC 3F0FA 1XHOA 3ELCA 2RHJA 4ZHYB 3OW2F 3J80M 3JARB 2ZODA 4FFBA 3WGKA 3OBWA 3CC2F 3G71F 2Z1TA 3GYQA 4U39A 4B62A 3JAKA 3RYIA 2P6YA 3E20B 3HTNA 4G4XA 5EZYB 2CHTA 3O85A 4O2BA 1RA4A 5MN4A 5C8YB 4ZOLA 3DDNA 3CCLF 4O4HA 4ZI7A 2IG8A 3WPWA 2HS0A 2YXZA 1VQ8F 3S0YA 1W42A 1DT9A 1RLUA 5ITZA 3NVIB 4BVTA 3WJPA 1W5EA 4I55B 1SZQA 3CD6F 5EIBC 2BTQB 4G4WA 4O4JB 3TD5A 4ERHA 5LXTA 5IT9M 3ON1A 3N4ZA 3M84A 3WXMB 2ZAUA 1W59A 1NJIH 3FD6A 1U3LA 4C8GA 3I3FA 3F6MA 3QHDA 4RQOA 4O4IB 3IMPA 3IEWA 3IR9A 4TV8B 3J7AR 2GLZA 5HY4A 3LMEA 4U3JB 3N2KB 4LNUB 1KD1H 5B8FA 2OHWA 5HP7A 4I55A 4C8IA 1K9MH 1OAPA 3K14A 3M4SA 2IQQA 3JCMM 4BT4A 1M90H 5EYPB 1W40A 3DC2A 5CA1A 5IJ0A 1RQ2A 1VQ9F 2CWJA 1VK3A 3UT5A 1VQ4F 4G4ZA 4R40B 4O4IA 3D00A 4F6RA 1R1MA 4TV8A 3WJQA 5FJ4C 2UYPA
chains in the Genus database with same CATH topology
1IV3A 3IKFA 1H48A 3F0EA 1YQNA 3T80A 2PMPA 2GZLA 3EORA 3P0ZA 5B8FA 1W57A 1VHAA 1U3PA 3FBAA 4C8IA 1JY8A 1KNKA 3RE3A 3JVHA 3IEQA 3K14A 3K2XA 3B6NA 4C82A 1T0AA 2UZHA 1W55A 1U40A 1GX1A 1VH8A 3FPIA 3F0GA 3KE1A 3MBMA 3F0DA 3IKEA 2AMTA 3Q8HA 4C81A 1JN1A 1KNJA 4C8EA 3ERNA 3F0FA 1IV4A 1H47A 1U3LA 4C8GA 1IV1A 3F6MA 1IV2A 3ELCA 3GHZA 3P10A 3QHDA 3ESJA 3IEWA 1U43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV3 A;  3IKF A;  1H48 A;  3F0E A;  1YQN A;  3T80 A;  2PMP A;  2GZL A;  3EOR A;  3P0Z A;  5B8F A;  1W57 A;  1VHA A;  1U3P A;  3FBA A;  4C8I A;  1JY8 A;  1KNK A;  3RE3 A;  3JVH A;  3IEQ A;  3K14 A;  3K2X A;  3B6N A;  4C82 A;  1T0A A;  2UZH A;  1W55 A;  1U40 A;  1GX1 A;  1VH8 A;  3FPI A;  3F0G A;  3KE1 A;  3MBM A;  3F0D A;  3IKE A;  2AMT A;  3Q8H A;  4C81 A;  1JN1 A;  1KNJ A;  4C8E A;  3ERN A;  3F0F A;  1IV4 A;  1H47 A;  1U3L A;  4C8G A;  1IV1 A;  3F6M A;  1IV2 A;  3ELC A;  3GHZ A;  3P10 A;  3QHD A;  3ESJ A;  3IEW A;  1U43 A; 
#chains in the Genus database with same CATH topology
 5IYZ B;  3N2K A;  5GIO C;  5FNV B;  1YQN A;  5JH7 B;  3V7Q A;  1FNJ A;  4G88 A;  1KNK A;  5EIB D;  3RE3 A;  3HKC B;  3JAT B;  2WAL A;  3CC4 F;  1XRG A;  3J81 M;  1YJN F;  4TV9 B;  3LYB A;  4X1I B;  2N48 A;  4WBN B;  3F0G A;  3RA5 A;  1X7O A;  4C4W C;  2OZB A;  3CC7 F;  1KQS F;  4C81 A;  1CK2 A;  2Z01 A;  5JQG B;  5J2U A;  4TUY B;  5JVD A;  1W5B A;  1QU9 A;  2CSL A;  3FD5 A;  2W8B C;  5FNV A;  5JH7 A;  2PMP A;  3EOR A;  5GON B;  2UYN A;  1NQ3 A;  1FSZ A;  3HKC A;  3S02 A;  3K2X A;  3N4Y A;  1TUB A;  4X1I A;  4WBN A;  4EB6 B;  2VGN A;  1YI2 F;  3ZOP A;  3CXC F;  4O2B B;  4EI7 A;  2LCA A;  4ZHW A;  2L26 A;  3S0H A;  1Q82 H;  5JQG A;  3RYC A;  4TUY A;  4ZK7 A;  1IV4 A;  3ZP4 A;  4ZI7 B;  3WGL A;  2HVY D;  1FFX B;  5LP6 A;  3ESJ A;  2HRY A;  3JAM M;  3V3T A;  3LFO A;  4YJ3 B;  5GON A;  5ITZ B;  3HJW C;  1VQV A;  2HS3 A;  3I7T A;  4EI9 A;  3LWQ C;  5EAZ A;  2R75 1;  2HX0 A;  2UYK A;  4IIJ A;  4EB6 A;  2HS4 A;  2RB9 A;  3QUW A;  4X20 B;  3CCQ F;  3E1Y A;  1YHQ F;  1YJ9 F;  5LXT B;  1QVG F;  3G6E F;  2OTM A;  5LYJ B;  3KJK A;  2AIZ P;  2CW4 A;  1W2B F;  3VYT C;  3PAF A;  1FFX A;  5AVM A;  5GIN C;  4YJ3 A;  1CLI A;  2F9Z C;  1XV2 A;  4BT5 A;  1VQK F;  2Z1E A;  5LA6 A;  2I6D A;  3T80 A;  4I4T B;  1VQ7 F;  5HY2 A;  3WJR A;  2H8C A;  3MDO A;  1YGY A;  3VMF B;  1X25 A;  1ONI A;  5CB4 B;  1ODE A;  4G4V A;  2ZOV A;  3C9U A;  1UI9 A;  1X52 A;  2I6R A;  4X20 A;  5HY1 A;  4RHA A;  2V9Y A;  5CA1 B;  2LBX A;  5LYJ A;  5IJ0 B;  2AMT A;  2CVL A;  1CN7 A;  2FGY A;  1Q86 H;  2H8E A;  3VTI C;  3ERN A;  3UT5 B;  1VQL F;  4TZZ A;  1K73 H;  4F6R B;  1IV3 A;  2ZVY A;  1RLG A;  4I4T A;  4BVS A;  1M1K H;  3NMU C;  1W3E X;  3MCA B;  5GAP K;  3S03 A;  1GO1 A;  3HAX D;  3FBA A;  5CB4 A;  1N8R H;  5LOV A;  2UZH A;  3K12 A;  3HWU A;  2VAW A;  2VXY A;  1X7P A;  3RA6 A;  1FNK A;  3MQW A;  3C9R A;  5GIP C;  1Z5V A;  1H47 A;  3CCV F;  5J2U B;  5JVD B;  4DRX A;  2VAP A;  5HP8 A;  3NK7 A;  2QTP A;  1VQ6 F;  5GAN K;  3CG6 A;  3I55 F;  3M1X A;  4BVQ A;  1VHA A;  1U3P A;  2HQS C;  3LWR C;  2OTJ F;  1JY8 A;  1OFU A;  4B46 A;  5FLX M;  2UYN B;  2HRU A;  2ALE A;  3AGK A;  4M8I A;  3VCZ A;  1VQO F;  1VQ5 F;  5HXU A;  2GVI A;  1GZ0 A;  1TUB B;  3FPI A;  2DT4 A;  3KE1 A;  4BT6 A;  5A2Q M;  5BMV A;  3C8L A;  3IKE A;  1JJ2 F;  2VGM A;  5G4V C;  3JAS A;  3WGN A;  3LWV C;  4ZHV A;  3WPX A;  3RYC B;  1Q8R A;  3KJJ A;  2FC3 A;  5LP6 B;  4YJ2 A;  3P0Z A;  1W57 A;  3K0T A;  3JAL A;  4X1K B;  1K8A H;  1VQN F;  2B33 A;  3LWP C;  2Z1U A;  4IIJ B;  2CHS A;  3SIV A;  1KNJ A;  3VI6 A;  2H6L A;  4BT2 A;  3S0W A;  3NK6 A;  3C9S A;  3OON A;  2Z1F A;  1Z5W A;  4B5C A;  1H48 A;  1GO0 A;  3WGJ A;  1DBF A;  3V4D A;  2KGW A;  4X3L A;  5HWE A;  2Q1Y A;  1QAH A;  5LA6 B;  3VYS C;  5LP6 C;  1Q81 H;  4X1K A;  2HP3 A;  3IEQ A;  2HP0 A;  2R6R 1;  1T0A A;  5JCO A;  3E22 B;  3QTY A;  4O2A B;  1VQP F;  2K1S A;  3LWO C;  4E6E A;  3CCU F;  4I50 B;  2CZW A;  4EI8 A;  2DYY A;  5IJ9 A;  2JNB A;  5MN5 A;  2UYJ A;  3CYP B;  1YJW F;  3CCS F;  3VYU C;  1ZWZ A;  4NWO B;  3VIU A;  3WGM A;  2GZL A;  3ZO8 A;  3RYF A;  4XCQ A;  2KG4 A;  2BO1 A;  4KWE A;  5KX5 B;  4G4Y A;  3RYH A;  5LOV B;  3E22 A;  1U40 A;  4O2A A;  2OTL F;  3SIU A;  4X3M A;  3HKD A;  5EWR A;  4I50 A;  5J2T B;  2AIF A;  2QA4 F;  2EWC A;  4C8E A;  1SA0 B;  2MQE A;  4DXD A;  3GTZ A;  1IV1 A;  2QEX F;  2G9I A;  3JAR A;  4HNA B;  1QD9 A;  4BVR A;  4DRX B;  1W5A A;  3IKF A;  3BYQ A;  3F0E A;  3G4S F;  4BT3 A;  2VAM A;  5KX5 A;  3V7E A;  1H7M A;  5EZY A;  1T0K B;  2Q1X A;  3CB2 A;  3KHN A;  1W5F A;  4B45 A;  5C8Y A;  5HY0 A;  4PWT A;  1PXW A;  1VH8 A;  1NMU B;  4NUT A;  1PF5 A;  4ZHQ B;  5J2T A;  3KIZ A;  1SA0 A;  3U0O A;  3HKE B;  1VQM F;  5BMV B;  1YIT F;  3N2G B;  3D01 A;  3JAS B;  5EB1 B;  3P10 A;  4HNA A;  1Q7Y H;  2RHH A;  1UFY A;  1U43 A;  3JAW B;  2NMU A;  2KTU A;  4YJ2 B;  1JFF B;  4BW0 B;  3L7Q A;  1W58 1;  1W41 A;  3NVK E;  4O4J A;  1XBI A;  4C82 A;  5CA0 B;  3JAL B;  4O4L B;  3HKB B;  4NQ3 A;  3FFM A;  4ZHQ A;  5DCV A;  3I56 F;  3MBM A;  3HKE A;  3CMA F;  1JN1 A;  1COM A;  3N2G A;  4IHJ B;  2BTU A;  2ZVZ A;  1QVF F;  2KTV A;  1KC8 H;  2RHO A;  4BY9 D;  5EO3 A;  2PHN A;  3VO8 A;  4U3J A;  3JAW A;  2YYE A;  4LNU A;  5EB0 A;  3CCR F;  1JFF A;  3P4E A;  3CME F;  3CCE F;  3S06 A;  3JVH A;  5EYP A;  1S72 F;  5CA0 A;  3PLA C;  3B6N A;  4O4L A;  4X1Y B;  3HKB A;  3C9T A;  4LCK A;  1YIJ F;  2HP0 B;  3CPQ A;  3CCJ F;  1IPA A;  3D54 A;  1J7H A;  3F0D A;  3LDT A;  3Q8H A;  4IHJ A;  3CCM F;  3R0P A;  5MN6 A;  1TVK B;  3CYQ A;  5KMG B;  3CPW F;  2ZF8 A;  3GHZ A;  1IV2 A;  5IYZ A;  1SDS A;  5IJ9 B;  3OBY A;  3TD4 A;  3VOB A;  2QI2 A;  4FFB B;  3JAT A;  2BTO A;  5G4U C;  5HXZ A;  3RYF B;  4BT7 A;  4TV9 A;  4X1Y A;  2LBT A;  2LBW A;  3JAK B;  3RYI B;  1E7K A;  1JD1 A;  1RQ7 A;  1W55 A;  3RYH B;  2IAF A;  1GX1 A;  3VOA A;  2RHL A;  3TD3 A;  3MCQ A;  1TVK A;  3HKD B;  4ZOL B;  5KMG A;  4O4H B;  3ZP7 A;  5JCO C;  3F0F A;  1XHO A;  3ELC A;  2RHJ A;  4ZHY B;  3OW2 F;  3J80 M;  3JAR B;  2ZOD A;  4FFB A;  3WGK A;  3OBW A;  3CC2 F;  3G71 F;  2Z1T A;  3GYQ A;  4U39 A;  4B62 A;  3JAK A;  3RYI A;  2P6Y A;  3E20 B;  3HTN A;  4G4X A;  5EZY B;  2CHT A;  3O85 A;  4O2B A;  1RA4 A;  5MN4 A;  5C8Y B;  4ZOL A;  3DDN A;  3CCL F;  4O4H A;  4ZI7 A;  2IG8 A;  3WPW A;  2HS0 A;  2YXZ A;  1VQ8 F;  3S0Y A;  1W42 A;  1DT9 A;  1RLU A;  5ITZ A;  3NVI B;  4BVT A;  3WJP A;  1W5E A;  4I55 B;  1SZQ A;  3CD6 F;  5EIB C;  2BTQ B;  4G4W A;  4O4J B;  3TD5 A;  4ERH A;  5LXT A;  5IT9 M;  3ON1 A;  3N4Z A;  3M84 A;  3WXM B;  2ZAU A;  1W59 A;  1NJI H;  3FD6 A;  1U3L A;  4C8G A;  3I3F A;  3F6M A;  3QHD A;  4RQO A;  4O4I B;  3IMP A;  3IEW A;  3IR9 A;  4TV8 B;  3J7A R;  2GLZ A;  5HY4 A;  3LME A;  4U3J B;  3N2K B;  4LNU B;  1KD1 H;  5B8F A;  2OHW A;  5HP7 A;  4I55 A;  4C8I A;  1K9M H;  1OAP A;  3K14 A;  3M4S A;  2IQQ A;  3JCM M;  4BT4 A;  1M90 H;  5EYP B;  1W40 A;  3DC2 A;  5CA1 A;  5IJ0 A;  1RQ2 A;  1VQ9 F;  2CWJ A;  1VK3 A;  3UT5 A;  1VQ4 F;  4G4Z A;  4R40 B;  4O4I A;  3D00 A;  4F6R A;  1R1M A;  4TV8 A;  3WJQ A;  5FJ4 C;  2UYP A; 
#chains in the Genus database with same CATH homology
 1IV3 A;  3IKF A;  1H48 A;  3F0E A;  1YQN A;  3T80 A;  2PMP A;  2GZL A;  3EOR A;  3P0Z A;  5B8F A;  1W57 A;  1VHA A;  1U3P A;  3FBA A;  4C8I A;  1JY8 A;  1KNK A;  3RE3 A;  3JVH A;  3IEQ A;  3K14 A;  3K2X A;  3B6N A;  4C82 A;  1T0A A;  2UZH A;  1W55 A;  1U40 A;  1GX1 A;  1VH8 A;  3FPI A;  3F0G A;  3KE1 A;  3MBM A;  3F0D A;  3IKE A;  2AMT A;  3Q8H A;  4C81 A;  1JN1 A;  1KNJ A;  4C8E A;  3ERN A;  3F0F A;  1IV4 A;  1H47 A;  1U3L A;  4C8G A;  1IV1 A;  3F6M A;  1IV2 A;  3ELC A;  3GHZ A;  3P10 A;  3QHD A;  3ESJ A;  3IEW A;  1U43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...