3IKFA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 717, imidazo[2,,1-b][1,3]thiazol-6-ylmethanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikfA00
3F0DA 3JVHA 1H47A 2UZHA 3F0EA 3F0GA 3ESJA 2AMTA 3IEWA 3RE3A 3F0FA 1W55A 4C8IA 3K14A 1IV1A 1H48A 3KE1A 3T80A 1VH8A 5B8FA 3IKEA 1IV4A 1KNJA 1U3LA 2GZLA 3F6MA 3P10A 4C82A 1YQNA 3K2XA 1JN1A 1W57A 2PMPA 3B6NA 1IV3A 3IKFA 4C81A 1KNKA 3ERNA 3Q8HA 3QHDA 3IEQA 1GX1A 3EORA 3MBMA 3P0ZA 1U40A 1VHAA 3FBAA 3FPIA 3ELCA 1U3PA 1U43A 1IV2A 1JY8A 1T0AA 4C8EA 4C8GA 3GHZA
chains in the Genus database with same CATH superfamily
3CYPB 4IIJB 5ITZB 1JFFA 2HQSC 3DC2A 3VIUA 3V7EA 3WXMB 5EYPA 4ERHA 1TUBB 2BTOA 3JAWA 2VGNA 1U3LA 5KX5A 1Q82H 1YQNA 3C9RA 3E20B 5EIBC 1SA0A 1QVGF 4BW0B 5GONA 4IHJA 5CA1A 4NUTA 1GO0A 4U3JA 3FPIA 3WJQA 1U3PA 3R0PA 4DRXB 4G4XA 1VQ5F 4LNUA 3G71F 4U39A 2KTUA 3L7QA 1W2BF 3ESJA 3KIZA 5JH7A 3RYFA 3JASB 3N4YA 3VYTC 5LP6C 5IJ0B 3N2KB 1XBIA 4ZHQA 2HRUA 2RHOA 1UFYA 3RYHA 5JCOC 3LWVC 4X1IB 4X3LA 1VQ9F 4ZHVA 1QD9A 1JN1A 3OBYA 2RB9A 3ERNA 3LMEA 2CHSA 3D54A 1W41A 5IJ9A 3TD5A 1U40A 3OONA 1IV2A 2HP0A 2V9YA 3GHZA 5LA6A 3IMPA 3C9TA 4M8IA 5HXUA 3FD5A 2LBXA 5B8FA 1VH8A 5J2TA 2EWCA 5FNVA 1S72F 1FNJA 3ON1A 3N2GA 3NK6A 2RHJA 3KJKA 5HY4A 1M1KH 3S0YA 3JATB 3ELCA 4IIJA 4NQ3A 2JNBA 3HWUA 3HJWC 4G4ZA 3CC7F 3F0DA 5LYJB 3JALB 2AMTA 3RE3A 3RYIB 5KMGA 2CWJA 3V7QA 1W55A 4C8IA 5HWEA 3LWOC 4ZI7A 3TD4A 1XRGA 1QAHA 4O4LA 4KWEA 1ZWZA 4BT7A 1YJWF 1H7MA 3CXCF 3NVIB 3CCJF 4F6RB 1W57A 3G4SF 4YJ3B 4X1KA 1Z5WA 4ZHWA 1W42A 3O85A 3JASA 4E6EA 4I4TB 1IPAA 3CMEF 3N2KA 3JAMM 3HKBA 1XHOA 4EI9A 4X1IA 3HKCB 2Z01A 2VXYA 1M90H 5CB4B 1N8RH 2P6YA 4PWTA 4X3MA 3CCUF 2DYYA 1COMA 2QA4F 3CPQA 4O4HB 5LP6B 1VQ4F 1GX1A 2KTVA 3FBAA 3WPWA 4ZK7A 1VQVA 1U43A 5GIPC 3VI6A 3TD3A 4C8GA 3MQWA 3SIVA 3JCMM 3CD6F 4ZHYB 3CPWF 3V4DA 2I6RA 5EWRA 3CMAF 1ONIA 3UT5B 5FLXM 3AGKA 1GO1A 1KC8H 1YJNF 3IKEA 3S0WA 3LYBA 2CHTA 1KNJA 4B5CA 4O4IB 5G4VC 3JATA 4TV8A 5LXTA 3CCVF 2LCAA 4I55B 2Z1UA 1YJ9F 2Q1XA 4G88A 2NMUA 2F9ZC 3EORA 5J2UB 3P0ZA 1YI2F 2Z1EA 4FFBA 3RYIA 2VAWA 1T0AA 1W5AA 3CYQA 3I3FA 3K0TA 3KJJA 3S03A 1YHQF 3WJPA 2OTLF 3JAKB 1RA4A 1VQ6F 5EO3A 2ZVYA 3WGLA 3HAXD 5HY2A 3CC4F 1H48A 3RYCA 4F6RA 1K73H 2FC3A 1IV4A 3WGMA 4YJ3A 4ZOLA 1ODEA 3E22A 2HS0A 5A2QM 4B45A 2GVIA 1DT9A 3N4ZA 1IV3A 3VCZA 1VQ8F 4BVTA 3Q8HA 4DXDA 4I50B 4BT5A 4I4TA 5GANK 2AIZP 1VHAA 4O2BB 1DBFA 2KG4A 2BO1A 1Z5VA 1CN7A 2MQEA 3GTZA 4TUYB 3HKCA 5MN5A 3FD6A 5CB4A 1QVFF 3CCSF 4EB6A 5GAPK 1NMUB 5EZYB 4TZZA 5BMVA 2H8EA 2OHWA 4O4JB 3KHNA 3NMUC 4G4YA 4O4HA 5LP6A 1YITF 4EI8A 2WALA 1TVKB 1X52A 5GINC 3I56F 4C81A 1RLUA 1VQOF 2HS4A 1SDSA 5C8YB 5ITZA 1NJIH 3UT5A 4HNAB 1UI9A 3F0GA 1TUBA 4O4IA 1Q81H 1JFFB 2R6R1 3BYQA 3LFOA 4I55A 5EYPB 3WPXA 2ZODA 1X7PA 2FGYA 2BTQB 1VK3A 3K12A 2GLZA 3C8LA 1KNKA 1SA0B 4DRXA 4TV9B 3JAKA 2YXZA 5LOVB 1W3EX 3OBWA 4C8EA 1KD1H 1NQ3A 2VAMA 5IJ0A 1E7KA 1KQSF 3CCQF 3SIUA 3RYFB 5AVMA 3FFMA 4RQOA 3P10A 1VQPF 1CLIA 3MCQA 3RYHB 5IYZB 1RQ2A 5EAZA 2G9IA 4O2BA 5HP8A 3G6EF 3QHDA 3IEQA 1W59A 5EIBD 5EB0A 3U0OA 4R40B 1CK2A 2BTUA 4WBNB 3WGJA 4O4JA 1R1MA 2ZVZA 3LWQC 3QUWA 2QI2A 4X1YB 2CVLA 3HKEB 3T80A 3JARB 4XCQA 4B46A 2UYKA 2GZLA 5MN6A 5EB1B 2CSLA 4EI7A 3NK7A 3M4SA 2UYPA 3IKFA 4BT2A 2B33A 5C8YA 1RQ7A 3C9SA 3CC2F 3N2GB 1FFXB 3WGKA 4HNAA 2R751 3VOAA 1JY8A 1X7OA 2KGWA 3JALA 5LYJA 1GZ0A 4O2AB 4RHAA 1H47A 3F0EA 3LWPC 3CB2A 2AIFA 5KMGB 2IQQA 4B62A 1YIJF 2YYEA 3D01A 1VQMF 3F6MA 3E1YA 3VYSC 4ZI7B 3CCLF 2ZAUA 4C82A 4TV9A 4YJ2B 1QU9A 4O4LB 2PMPA 3VTIC 5LOVA 1W581 2IG8A 2CW4A 4G4VA 5MN4A 5JVDB 2LBTA 3VYUC 4X1KB 3VOBA 2H6LA 2RHLA 3ZO8A 3GYQA 3CG6A 3JVHA 2W8BC 1X25A 3ZP4A 3F0FA 4BY9D 2HP3A 4BT6A 2UYNB 3HKBB 5HY1A 4X20B 1T0KB 5IYZA 5JQGB 2QEXF 3WJRA 5CA0B 3HTNA 3K2XA 3C9UA 2UYJA 3HKDB 3MDOA 1JJ2F 2H8CA 5JCOA 1J7HA 3CCEF 1OFUA 2LBWA 4WBNA 4BVSA 3VMFB 5HXZA 2UZHA 1VQ7F 4X1YA 3HKEA 3PLAC 3JARA 3P4EA 2HVYD 3RA6A 1PXWA 2OZBA 3K14A 1W40A 5HY0A 1Q86H 2N48A 5HP7A 3I7TA 1FFXA 2IAFA 3JAWB 3RA5A 5J2UA 2ZF8A 2L26A 3VO8A 2HX0A 2VAPA 5KX5B 4TV8B 5LXTB 4O2AA 2VGMA 3DDNA 5GONB 3ZP7A 3J7AR 4IHJB 4NWOB 3J81M 5CA1B 2ALEA 4FFBB 4U3JB 5DCVA 3IEWA 3S02A 1OAPA 1XV2A 3IR9A 1W5FA 4LNUB 5IT9M 3MCAB 4BVQA 1IV1A 3S0HA 3V3TA 3LDTA 4YJ2A 5JH7B 2DT4A 2OTJF 3RYCB 2Q1YA 3S06A 4ZHQB 4I50A 4ZOLB 4BT4A 4LCKA 3E22B 5JVDA 1Q8RA 2CZWA 1W5BA 1VQLF 4TUYA 2HS3A 3LWRC 5GIOC 5FJ4C 2HRYA 1VQNF 4C4WC 5IJ9B 2UYNA 5EZYA 3CCRF 2Z1FA 4X20A 5JQGA 1W5EA 3CCMF 1FSZA 2HP0B 1VQKF 2RHHA 5CA0A 5G4UC 1PF5A 3KE1A 2ZOVA 5LA6B 4EB6B 4BT3A 1SZQA 3HKDA 1TVKA 3J80M 1JD1A 3M1XA 5BMVB 3D00A 1RLGA 3I55F 2I6DA 1YGYA 5J2TB 3M84A 3B6NA 2QTPA 3OW2F 3WGNA 2OTMA 3ZOPA 5FNVB 1K9MH 3MBMA 3PAFA 1K8AH 3NVKE 2K1SA 1Q7YH 1FNKA 2PHNA 3QTYA 4BVRA 2Z1TA 4G4WA
chains in the Genus database with same CATH topology
3F0DA 3JVHA 1H47A 2UZHA 3F0EA 3F0GA 3ESJA 2AMTA 3IEWA 3RE3A 3F0FA 1W55A 4C8IA 3K14A 1IV1A 1H48A 3KE1A 3T80A 1VH8A 5B8FA 3IKEA 1IV4A 1KNJA 1U3LA 2GZLA 3F6MA 3P10A 4C82A 1YQNA 3K2XA 1JN1A 1W57A 2PMPA 3B6NA 1IV3A 3IKFA 4C81A 1KNKA 3ERNA 3Q8HA 3QHDA 3IEQA 1GX1A 3EORA 3MBMA 3P0ZA 1U40A 1VHAA 3FBAA 3FPIA 3ELCA 1U3PA 1U43A 1IV2A 1JY8A 1T0AA 4C8EA 4C8GA 3GHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0D A;  3JVH A;  1H47 A;  2UZH A;  3F0E A;  3F0G A;  3ESJ A;  2AMT A;  3IEW A;  3RE3 A;  3F0F A;  1W55 A;  4C8I A;  3K14 A;  1IV1 A;  1H48 A;  3KE1 A;  3T80 A;  1VH8 A;  5B8F A;  3IKE A;  1IV4 A;  1KNJ A;  1U3L A;  2GZL A;  3F6M A;  3P10 A;  4C82 A;  1YQN A;  3K2X A;  1JN1 A;  1W57 A;  2PMP A;  3B6N A;  1IV3 A;  3IKF A;  4C81 A;  1KNK A;  3ERN A;  3Q8H A;  3QHD A;  3IEQ A;  1GX1 A;  3EOR A;  3MBM A;  3P0Z A;  1U40 A;  1VHA A;  3FBA A;  3FPI A;  3ELC A;  1U3P A;  1U43 A;  1IV2 A;  1JY8 A;  1T0A A;  4C8E A;  4C8G A;  3GHZ A; 
#chains in the Genus database with same CATH topology
 3CYP B;  4IIJ B;  5ITZ B;  1JFF A;  2HQS C;  3DC2 A;  3VIU A;  3V7E A;  3WXM B;  5EYP A;  4ERH A;  1TUB B;  2BTO A;  3JAW A;  2VGN A;  1U3L A;  5KX5 A;  1Q82 H;  1YQN A;  3C9R A;  3E20 B;  5EIB C;  1SA0 A;  1QVG F;  4BW0 B;  5GON A;  4IHJ A;  5CA1 A;  4NUT A;  1GO0 A;  4U3J A;  3FPI A;  3WJQ A;  1U3P A;  3R0P A;  4DRX B;  4G4X A;  1VQ5 F;  4LNU A;  3G71 F;  4U39 A;  2KTU A;  3L7Q A;  1W2B F;  3ESJ A;  3KIZ A;  5JH7 A;  3RYF A;  3JAS B;  3N4Y A;  3VYT C;  5LP6 C;  5IJ0 B;  3N2K B;  1XBI A;  4ZHQ A;  2HRU A;  2RHO A;  1UFY A;  3RYH A;  5JCO C;  3LWV C;  4X1I B;  4X3L A;  1VQ9 F;  4ZHV A;  1QD9 A;  1JN1 A;  3OBY A;  2RB9 A;  3ERN A;  3LME A;  2CHS A;  3D54 A;  1W41 A;  5IJ9 A;  3TD5 A;  1U40 A;  3OON A;  1IV2 A;  2HP0 A;  2V9Y A;  3GHZ A;  5LA6 A;  3IMP A;  3C9T A;  4M8I A;  5HXU A;  3FD5 A;  2LBX A;  5B8F A;  1VH8 A;  5J2T A;  2EWC A;  5FNV A;  1S72 F;  1FNJ A;  3ON1 A;  3N2G A;  3NK6 A;  2RHJ A;  3KJK A;  5HY4 A;  1M1K H;  3S0Y A;  3JAT B;  3ELC A;  4IIJ A;  4NQ3 A;  2JNB A;  3HWU A;  3HJW C;  4G4Z A;  3CC7 F;  3F0D A;  5LYJ B;  3JAL B;  2AMT A;  3RE3 A;  3RYI B;  5KMG A;  2CWJ A;  3V7Q A;  1W55 A;  4C8I A;  5HWE A;  3LWO C;  4ZI7 A;  3TD4 A;  1XRG A;  1QAH A;  4O4L A;  4KWE A;  1ZWZ A;  4BT7 A;  1YJW F;  1H7M A;  3CXC F;  3NVI B;  3CCJ F;  4F6R B;  1W57 A;  3G4S F;  4YJ3 B;  4X1K A;  1Z5W A;  4ZHW A;  1W42 A;  3O85 A;  3JAS A;  4E6E A;  4I4T B;  1IPA A;  3CME F;  3N2K A;  3JAM M;  3HKB A;  1XHO A;  4EI9 A;  4X1I A;  3HKC B;  2Z01 A;  2VXY A;  1M90 H;  5CB4 B;  1N8R H;  2P6Y A;  4PWT A;  4X3M A;  3CCU F;  2DYY A;  1COM A;  2QA4 F;  3CPQ A;  4O4H B;  5LP6 B;  1VQ4 F;  1GX1 A;  2KTV A;  3FBA A;  3WPW A;  4ZK7 A;  1VQV A;  1U43 A;  5GIP C;  3VI6 A;  3TD3 A;  4C8G A;  3MQW A;  3SIV A;  3JCM M;  3CD6 F;  4ZHY B;  3CPW F;  3V4D A;  2I6R A;  5EWR A;  3CMA F;  1ONI A;  3UT5 B;  5FLX M;  3AGK A;  1GO1 A;  1KC8 H;  1YJN F;  3IKE A;  3S0W A;  3LYB A;  2CHT A;  1KNJ A;  4B5C A;  4O4I B;  5G4V C;  3JAT A;  4TV8 A;  5LXT A;  3CCV F;  2LCA A;  4I55 B;  2Z1U A;  1YJ9 F;  2Q1X A;  4G88 A;  2NMU A;  2F9Z C;  3EOR A;  5J2U B;  3P0Z A;  1YI2 F;  2Z1E A;  4FFB A;  3RYI A;  2VAW A;  1T0A A;  1W5A A;  3CYQ A;  3I3F A;  3K0T A;  3KJJ A;  3S03 A;  1YHQ F;  3WJP A;  2OTL F;  3JAK B;  1RA4 A;  1VQ6 F;  5EO3 A;  2ZVY A;  3WGL A;  3HAX D;  5HY2 A;  3CC4 F;  1H48 A;  3RYC A;  4F6R A;  1K73 H;  2FC3 A;  1IV4 A;  3WGM A;  4YJ3 A;  4ZOL A;  1ODE A;  3E22 A;  2HS0 A;  5A2Q M;  4B45 A;  2GVI A;  1DT9 A;  3N4Z A;  1IV3 A;  3VCZ A;  1VQ8 F;  4BVT A;  3Q8H A;  4DXD A;  4I50 B;  4BT5 A;  4I4T A;  5GAN K;  2AIZ P;  1VHA A;  4O2B B;  1DBF A;  2KG4 A;  2BO1 A;  1Z5V A;  1CN7 A;  2MQE A;  3GTZ A;  4TUY B;  3HKC A;  5MN5 A;  3FD6 A;  5CB4 A;  1QVF F;  3CCS F;  4EB6 A;  5GAP K;  1NMU B;  5EZY B;  4TZZ A;  5BMV A;  2H8E A;  2OHW A;  4O4J B;  3KHN A;  3NMU C;  4G4Y A;  4O4H A;  5LP6 A;  1YIT F;  4EI8 A;  2WAL A;  1TVK B;  1X52 A;  5GIN C;  3I56 F;  4C81 A;  1RLU A;  1VQO F;  2HS4 A;  1SDS A;  5C8Y B;  5ITZ A;  1NJI H;  3UT5 A;  4HNA B;  1UI9 A;  3F0G A;  1TUB A;  4O4I A;  1Q81 H;  1JFF B;  2R6R 1;  3BYQ A;  3LFO A;  4I55 A;  5EYP B;  3WPX A;  2ZOD A;  1X7P A;  2FGY A;  2BTQ B;  1VK3 A;  3K12 A;  2GLZ A;  3C8L A;  1KNK A;  1SA0 B;  4DRX A;  4TV9 B;  3JAK A;  2YXZ A;  5LOV B;  1W3E X;  3OBW A;  4C8E A;  1KD1 H;  1NQ3 A;  2VAM A;  5IJ0 A;  1E7K A;  1KQS F;  3CCQ F;  3SIU A;  3RYF B;  5AVM A;  3FFM A;  4RQO A;  3P10 A;  1VQP F;  1CLI A;  3MCQ A;  3RYH B;  5IYZ B;  1RQ2 A;  5EAZ A;  2G9I A;  4O2B A;  5HP8 A;  3G6E F;  3QHD A;  3IEQ A;  1W59 A;  5EIB D;  5EB0 A;  3U0O A;  4R40 B;  1CK2 A;  2BTU A;  4WBN B;  3WGJ A;  4O4J A;  1R1M A;  2ZVZ A;  3LWQ C;  3QUW A;  2QI2 A;  4X1Y B;  2CVL A;  3HKE B;  3T80 A;  3JAR B;  4XCQ A;  4B46 A;  2UYK A;  2GZL A;  5MN6 A;  5EB1 B;  2CSL A;  4EI7 A;  3NK7 A;  3M4S A;  2UYP A;  3IKF A;  4BT2 A;  2B33 A;  5C8Y A;  1RQ7 A;  3C9S A;  3CC2 F;  3N2G B;  1FFX B;  3WGK A;  4HNA A;  2R75 1;  3VOA A;  1JY8 A;  1X7O A;  2KGW A;  3JAL A;  5LYJ A;  1GZ0 A;  4O2A B;  4RHA A;  1H47 A;  3F0E A;  3LWP C;  3CB2 A;  2AIF A;  5KMG B;  2IQQ A;  4B62 A;  1YIJ F;  2YYE A;  3D01 A;  1VQM F;  3F6M A;  3E1Y A;  3VYS C;  4ZI7 B;  3CCL F;  2ZAU A;  4C82 A;  4TV9 A;  4YJ2 B;  1QU9 A;  4O4L B;  2PMP A;  3VTI C;  5LOV A;  1W58 1;  2IG8 A;  2CW4 A;  4G4V A;  5MN4 A;  5JVD B;  2LBT A;  3VYU C;  4X1K B;  3VOB A;  2H6L A;  2RHL A;  3ZO8 A;  3GYQ A;  3CG6 A;  3JVH A;  2W8B C;  1X25 A;  3ZP4 A;  3F0F A;  4BY9 D;  2HP3 A;  4BT6 A;  2UYN B;  3HKB B;  5HY1 A;  4X20 B;  1T0K B;  5IYZ A;  5JQG B;  2QEX F;  3WJR A;  5CA0 B;  3HTN A;  3K2X A;  3C9U A;  2UYJ A;  3HKD B;  3MDO A;  1JJ2 F;  2H8C A;  5JCO A;  1J7H A;  3CCE F;  1OFU A;  2LBW A;  4WBN A;  4BVS A;  3VMF B;  5HXZ A;  2UZH A;  1VQ7 F;  4X1Y A;  3HKE A;  3PLA C;  3JAR A;  3P4E A;  2HVY D;  3RA6 A;  1PXW A;  2OZB A;  3K14 A;  1W40 A;  5HY0 A;  1Q86 H;  2N48 A;  5HP7 A;  3I7T A;  1FFX A;  2IAF A;  3JAW B;  3RA5 A;  5J2U A;  2ZF8 A;  2L26 A;  3VO8 A;  2HX0 A;  2VAP A;  5KX5 B;  4TV8 B;  5LXT B;  4O2A A;  2VGM A;  3DDN A;  5GON B;  3ZP7 A;  3J7A R;  4IHJ B;  4NWO B;  3J81 M;  5CA1 B;  2ALE A;  4FFB B;  4U3J B;  5DCV A;  3IEW A;  3S02 A;  1OAP A;  1XV2 A;  3IR9 A;  1W5F A;  4LNU B;  5IT9 M;  3MCA B;  4BVQ A;  1IV1 A;  3S0H A;  3V3T A;  3LDT A;  4YJ2 A;  5JH7 B;  2DT4 A;  2OTJ F;  3RYC B;  2Q1Y A;  3S06 A;  4ZHQ B;  4I50 A;  4ZOL B;  4BT4 A;  4LCK A;  3E22 B;  5JVD A;  1Q8R A;  2CZW A;  1W5B A;  1VQL F;  4TUY A;  2HS3 A;  3LWR C;  5GIO C;  5FJ4 C;  2HRY A;  1VQN F;  4C4W C;  5IJ9 B;  2UYN A;  5EZY A;  3CCR F;  2Z1F A;  4X20 A;  5JQG A;  1W5E A;  3CCM F;  1FSZ A;  2HP0 B;  1VQK F;  2RHH A;  5CA0 A;  5G4U C;  1PF5 A;  3KE1 A;  2ZOV A;  5LA6 B;  4EB6 B;  4BT3 A;  1SZQ A;  3HKD A;  1TVK A;  3J80 M;  1JD1 A;  3M1X A;  5BMV B;  3D00 A;  1RLG A;  3I55 F;  2I6D A;  1YGY A;  5J2T B;  3M84 A;  3B6N A;  2QTP A;  3OW2 F;  3WGN A;  2OTM A;  3ZOP A;  5FNV B;  1K9M H;  3MBM A;  3PAF A;  1K8A H;  3NVK E;  2K1S A;  1Q7Y H;  1FNK A;  2PHN A;  3QTY A;  4BVR A;  2Z1T A;  4G4W A; 
#chains in the Genus database with same CATH homology
 3F0D A;  3JVH A;  1H47 A;  2UZH A;  3F0E A;  3F0G A;  3ESJ A;  2AMT A;  3IEW A;  3RE3 A;  3F0F A;  1W55 A;  4C8I A;  3K14 A;  1IV1 A;  1H48 A;  3KE1 A;  3T80 A;  1VH8 A;  5B8F A;  3IKE A;  1IV4 A;  1KNJ A;  1U3L A;  2GZL A;  3F6M A;  3P10 A;  4C82 A;  1YQN A;  3K2X A;  1JN1 A;  1W57 A;  2PMP A;  3B6N A;  1IV3 A;  3IKF A;  4C81 A;  1KNK A;  3ERN A;  3Q8H A;  3QHD A;  3IEQ A;  1GX1 A;  3EOR A;  3MBM A;  3P0Z A;  1U40 A;  1VHA A;  3FBA A;  3FPI A;  3ELC A;  1U3P A;  1U43 A;  1IV2 A;  1JY8 A;  1T0A A;  4C8E A;  4C8G A;  3GHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...