3IKFA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 717, imidazo[2,,1-b][1,3]thiazol-6-ylmethanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikfA00
3ESJA 3F0GA 1H48A 3F0DA 3GHZA 2UZHA 1IV1A 4C8EA 5B8FA 3K2XA 3F0EA 3IKFA 1JN1A 4C81A 1U43A 1IV2A 3P0ZA 3FBAA 1W55A 3P10A 2PMPA 3Q8HA 3ELCA 3IEQA 3IEWA 1VHAA 4C82A 3IKEA 4C8IA 1KNJA 1JY8A 3EORA 3FPIA 1IV4A 2GZLA 1T0AA 2AMTA 1U3PA 3F0FA 1H47A 3QHDA 3T80A 1U3LA 1U40A 3JVHA 1IV3A 3ERNA 3F6MA 3RE3A 1VH8A 1W57A 3K14A 1GX1A 4C8GA 1YQNA 3MBMA 3KE1A 1KNKA 3B6NA
chains in the Genus database with same CATH superfamily
2QA4F 3NK6A 3BYQA 5C8YB 4ZI7A 1OFUA 3C8LA 4X1IA 4C81A 4I4TA 4EI7A 4I50A 4O4JA 2Z1TA 4U39A 3RYCB 3DDNA 1FFXB 3LYBA 4ZHYB 1COMA 2B33A 5GIOC 2BTQB 4I55A 4BT5A 2HQSC 3KJKA 5IT9M 5EO3A 3T80A 1JD1A 1W59A 4O4HA 2VGNA 3FFMA 5EWRA 2KTVA 3ERNA 3F6MA 1T0KB 1QU9A 4B46A 3M84A 4E6EA 2OTLF 3MCQA 4YJ3B 2ZAUA 3RYHA 5DCVA 1UFYA 2NMUA 4C8EA 1VQ4F 3VMFB 1TUBA 3K2XA 3WJPA 3WXMB 3WGLA 3L7QA 1W41A 1JN1A 4RHAA 5BMVA 4O4IA 1H7MA 1Z5VA 4ZHQA 3IKEA 4X1KB 4DRXA 5FNVA 3OBYA 1JY8A 1VQKF 1TVKA 2BTUA 2PHNA 3HKCA 5EYPA 3CMAF 4C4WC 3RE3A 3CCUF 5GAPK 2HS0A 1FNJA 2HP3A 1W3EX 3IR9A 4BT4A 2ZVYA 1VQ6F 1GZ0A 2HS3A 1JJ2F 2K1SA 3K12A 4YJ2A 4BVRA 5J2TA 3IEQA 1VHAA 4I4TB 1RLGA 4I50B 4EB6B 1X25A 2VAMA 2AIFA 4HNAB 4BW0B 5LP6A 3E22A 2WALA 3FD6A 1W2BF 4O4HB 4TZZA 2I6DA 5JCOA 1KNKA 5C8YA 4BVQA 3CCRF 2Z1FA 4X3LA 2HRUA 4EI9A 1XRGA 5ITZB 1Q81H 3CC4F 1Z5WA 2H8CA 1TUBB 1FFXA 2RHHA 2UYNB 2R6R1 4U3JA 3ZP4A 4O4IB 5AVMA 1YITF 1K9MH 4IHJB 1QVGF 5HY1A 4DRXB 2HX0A 3V7QA 2LCAA 1TVKB 3HKCB 5EZYA 4BVSA 5EYPB 2R751 5EIBD 4LNUB 3TD4A 5LXTA 1SDSA 3RA6A 4YJ3A 3RA5A 3B6NA 2CW4A 2F9ZC 3F0DA 1OAPA 3V3TA 2N48A 1FNKA 3MQWA 1R1MA 4F6RA 1NJIH 1U43A 2Z1EA 3VTIC 2RB9A 1W55A 4X1KA 3ELCA 5CA0B 3QTYA 5HP7A 1M1KH 3WPXA 5HY0A 3PLAC 1UI9A 1NQ3A 1W5BA 1Q7YH 3LWVC 1DBFA 1X7PA 1JFFB 1IPAA 1VH8A 2UYJA 5A2QM 5LP6B 3MCAB 2KGWA 3C9SA 3HJWC 3HKBA 4DXDA 3WGKA 3IKFA 1VQPF 5MN6A 3HWUA 3J7AR 4C82A 4EB6A 1FSZA 3N4YA 1KC8H 1SZQA 3R0PA 4U3JB 1W5AA 4HNAA 5LYJA 3D00A 2VXYA 3JVHA 3S02A 4M8IA 5EZYB 3AGKA 3K14A 3SIUA 1YQNA 3LWOC 5LXTB 1QD9A 3F0GA 3N2KA 5ITZA 3OW2F 1VQOF 3E1YA 3IMPA 5KMGB 3CYQA 2UYNA 5EB1B 5IJ9A 3N4ZA 3Q8HA 2QEXF 1RQ2A 4F6RB 2RHOA 4IHJA 5GINC 5EIBC 2RHJA 3GTZA 5LOVB 3G71F 2AMTA 4NWOB 1X7OA 3F0FA 2OHWA 4LNUA 3QHDA 3VIUA 4WBNA 4X1YB 2EWCA 3CB2A 2ZOVA 3OONA 3G4SF 1VQVA 3GHZA 5GANK 4B62A 4KWEA 3LWPC 2BTOA 2LBXA 3HKBB 3JALB 5CA0A 2QI2A 1VQMF 3IEWA 3ZP7A 1J7HA 4BT3A 3S06A 4ZOLB 1Q8RA 4B5CA 4B45A 1H47A 2P6YA 5LA6B 3C9RA 3CCEF 1PF5A 1KQSF 3CD6F 3SIVA 1JFFA 5LYJB 1K8AH 4TUYB 3ZOPA 3QUWA 1RQ7A 3CC7F 2Q1YA 4LCKA 5EB0A 1CN7A 3RYFB 3TD3A 3LWRC 3CCVF 2FC3A 4BT6A 3N2KB 3ZO8A 4FFBA 3VI6A 3P0ZA 1ZWZA 2QTPA 1YIJF 1VQ9F 2PMPA 3DC2A 1VQ7F 3UT5B 5IJ9B 5MN4A 3HTNA 3WJQA 3M4SA 1IV4A 1T0AA 5LP6C 1S72F 1YJWF 2IQQA 3S0WA 3WGJA 1CK2A 1U40A 5JCOC 5G4VC 4ZHWA 1RA4A 2FGYA 3V4DA 3S0HA 4O2AB 3M1XA 3S0YA 4WBNB 3ON1A 1QAHA 5J2UA 5KMGA 2HVYD 3OBWA 3HKEA 5G4UC 2GLZA 2HP0B 1NMUB 3I7TA 5LOVA 3VO8A 3I55F 3CCSF 2H6LA 2HRYA 3I3FA 2Z01A 2VAWA 3J80M 4X1YA 2KTUA 1IV3A 4G4YA 5CA1B 3G6EF 1CLIA 5GIPC 5IYZB 3RYIA 3JASB 2KG4A 1W5EA 1YJNF 5B8FA 1ONIA 4ZHVA 2H8EA 3JALA 3WPWA 3LWQC 4G4XA 2IAFA 3P4EA 1VQNF 4TV9A 2YYEA 3V7EA 4FFBB 4ZOLA 4EI8A 2DYYA 4NQ3A 3TD5A 5LA6A 4X20B 3KIZA 5CB4B 2AIZP 3J81M 4O2BA 1U3LA 4TUYA 5JVDA 3CPQA 5HY4A 1SA0A 4G4WA 1XHOA 4RQOA 2BO1A 3RYFA 1H48A 4TV8B 3F0EA 3C9UA 3FD5A 5J2UB 5IJ0A 5KX5B 3JAWB 3UT5A 3HKEB 3I56F 3HAXD 3WGNA 3JAKB 1YI2F 1KNJA 2CZWA 3O85A 2UYPA 2GZLA 1YGYA 2CHTA 4NUTA 3VOBA 3U0OA 5HXZA 4R40B 4O2AA 3PAFA 5GONB 3N2GA 3VOAA 5HY2A 3JAMM 2UZHA 2MQEA 3GYQA 2UYKA 3RYIB 1M90H 3KHNA 1KD1H 2HP0A 1YHQF 2CHSA 4BY9D 3NVIB 3FBAA 1GO0A 1E7KA 1RLUA 2GVIA 4ZK7A 3D01A 4TV9B 1VQ5F 5JQGB 4G4VA 2W8BC 3CCLF 2CVLA 1U3PA 3E20B 3NMUC 1QVFF 5CA1A 2OZBA 5FJ4C 4G4ZA 3CCQF 2DT4A 4O2BB 1W57A 4C8GA 5IYZA 5JVDB 3JASA 3LDTA 2I6RA 3WJRA 1YJ9F 1SA0B 2CWJA 3ESJA 2LBWA 1Q82H 3CYPB 3JARB 3WGMA 3VCZA 5MN5A 4ZI7B 1W40A 3CPWF 5EAZA 2IG8A 4X1IB 3MDOA 3LMEA 5IJ0B 1Q86H 1XBIA 4C8IA 4O4JB 4X20A 3JATA 3EORA 3D54A 5CB4A 2Q1XA 4IIJA 2ZVZA 3K0TA 1W581 4O4LA 5JH7A 5HWEA 3CC2F 3CG6A 4I55B 2JNBA 3HKDA 3KJJA 3NK7A 1ODEA 3KE1A 2G9IA 3VYTC 4TV8A 2YXZA 3RYHB 3N2GB 5KX5A 2ALEA 4XCQA 3JAWA 3CCJF 1PXWA 3RYCA 1DT9A 3NVKE 3JAKA 4ERHA 5BMVB 2Z1UA 4X3MA 2HS4A 4ZHQB 5HP8A 4PWTA 2OTJF 5FNVB 3CCMF 5FLXM 1K73H 1VQ8F 3VYSC 2VAPA 3VYUC 4BT7A 5GONA 1X52A 1GX1A 3JCMM 1W5FA 1GO1A 1N8RH 1XV2A 2VGMA 1IV1A 1VQLF 1VK3A 1W42A 2CSLA 1IV2A 4BT2A 3P10A 3C9TA 5JQGA 4YJ2B 5J2TB 4G88A 5HXUA 3FPIA 2RHLA 2V9YA 2L26A 3JATB 4BVTA 2LBTA 4IIJB 2ZF8A 5JH7B 4O4LB 3S03A 3E22B 3HKDB 3CXCF 2ZODA 3CMEF 3MBMA 3LFOA 2OTMA 3JARA
chains in the Genus database with same CATH topology
3ESJA 3F0GA 1H48A 3F0DA 3GHZA 2UZHA 1IV1A 4C8EA 5B8FA 3K2XA 3F0EA 3IKFA 1JN1A 4C81A 1U43A 1IV2A 3P0ZA 3FBAA 1W55A 3P10A 2PMPA 3Q8HA 3ELCA 3IEQA 3IEWA 1VHAA 4C82A 3IKEA 4C8IA 1KNJA 1JY8A 3EORA 3FPIA 1IV4A 2GZLA 1T0AA 2AMTA 1U3PA 3F0FA 1H47A 3QHDA 3T80A 1U3LA 1U40A 3JVHA 1IV3A 3ERNA 3F6MA 3RE3A 1VH8A 1W57A 3K14A 1GX1A 4C8GA 1YQNA 3MBMA 3KE1A 1KNKA 3B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESJ A;  3F0G A;  1H48 A;  3F0D A;  3GHZ A;  2UZH A;  1IV1 A;  4C8E A;  5B8F A;  3K2X A;  3F0E A;  3IKF A;  1JN1 A;  4C81 A;  1U43 A;  1IV2 A;  3P0Z A;  3FBA A;  1W55 A;  3P10 A;  2PMP A;  3Q8H A;  3ELC A;  3IEQ A;  3IEW A;  1VHA A;  4C82 A;  3IKE A;  4C8I A;  1KNJ A;  1JY8 A;  3EOR A;  3FPI A;  1IV4 A;  2GZL A;  1T0A A;  2AMT A;  1U3P A;  3F0F A;  1H47 A;  3QHD A;  3T80 A;  1U3L A;  1U40 A;  3JVH A;  1IV3 A;  3ERN A;  3F6M A;  3RE3 A;  1VH8 A;  1W57 A;  3K14 A;  1GX1 A;  4C8G A;  1YQN A;  3MBM A;  3KE1 A;  1KNK A;  3B6N A; 
#chains in the Genus database with same CATH topology
 2QA4 F;  3NK6 A;  3BYQ A;  5C8Y B;  4ZI7 A;  1OFU A;  3C8L A;  4X1I A;  4C81 A;  4I4T A;  4EI7 A;  4I50 A;  4O4J A;  2Z1T A;  4U39 A;  3RYC B;  3DDN A;  1FFX B;  3LYB A;  4ZHY B;  1COM A;  2B33 A;  5GIO C;  2BTQ B;  4I55 A;  4BT5 A;  2HQS C;  3KJK A;  5IT9 M;  5EO3 A;  3T80 A;  1JD1 A;  1W59 A;  4O4H A;  2VGN A;  3FFM A;  5EWR A;  2KTV A;  3ERN A;  3F6M A;  1T0K B;  1QU9 A;  4B46 A;  3M84 A;  4E6E A;  2OTL F;  3MCQ A;  4YJ3 B;  2ZAU A;  3RYH A;  5DCV A;  1UFY A;  2NMU A;  4C8E A;  1VQ4 F;  3VMF B;  1TUB A;  3K2X A;  3WJP A;  3WXM B;  3WGL A;  3L7Q A;  1W41 A;  1JN1 A;  4RHA A;  5BMV A;  4O4I A;  1H7M A;  1Z5V A;  4ZHQ A;  3IKE A;  4X1K B;  4DRX A;  5FNV A;  3OBY A;  1JY8 A;  1VQK F;  1TVK A;  2BTU A;  2PHN A;  3HKC A;  5EYP A;  3CMA F;  4C4W C;  3RE3 A;  3CCU F;  5GAP K;  2HS0 A;  1FNJ A;  2HP3 A;  1W3E X;  3IR9 A;  4BT4 A;  2ZVY A;  1VQ6 F;  1GZ0 A;  2HS3 A;  1JJ2 F;  2K1S A;  3K12 A;  4YJ2 A;  4BVR A;  5J2T A;  3IEQ A;  1VHA A;  4I4T B;  1RLG A;  4I50 B;  4EB6 B;  1X25 A;  2VAM A;  2AIF A;  4HNA B;  4BW0 B;  5LP6 A;  3E22 A;  2WAL A;  3FD6 A;  1W2B F;  4O4H B;  4TZZ A;  2I6D A;  5JCO A;  1KNK A;  5C8Y A;  4BVQ A;  3CCR F;  2Z1F A;  4X3L A;  2HRU A;  4EI9 A;  1XRG A;  5ITZ B;  1Q81 H;  3CC4 F;  1Z5W A;  2H8C A;  1TUB B;  1FFX A;  2RHH A;  2UYN B;  2R6R 1;  4U3J A;  3ZP4 A;  4O4I B;  5AVM A;  1YIT F;  1K9M H;  4IHJ B;  1QVG F;  5HY1 A;  4DRX B;  2HX0 A;  3V7Q A;  2LCA A;  1TVK B;  3HKC B;  5EZY A;  4BVS A;  5EYP B;  2R75 1;  5EIB D;  4LNU B;  3TD4 A;  5LXT A;  1SDS A;  3RA6 A;  4YJ3 A;  3RA5 A;  3B6N A;  2CW4 A;  2F9Z C;  3F0D A;  1OAP A;  3V3T A;  2N48 A;  1FNK A;  3MQW A;  1R1M A;  4F6R A;  1NJI H;  1U43 A;  2Z1E A;  3VTI C;  2RB9 A;  1W55 A;  4X1K A;  3ELC A;  5CA0 B;  3QTY A;  5HP7 A;  1M1K H;  3WPX A;  5HY0 A;  3PLA C;  1UI9 A;  1NQ3 A;  1W5B A;  1Q7Y H;  3LWV C;  1DBF A;  1X7P A;  1JFF B;  1IPA A;  1VH8 A;  2UYJ A;  5A2Q M;  5LP6 B;  3MCA B;  2KGW A;  3C9S A;  3HJW C;  3HKB A;  4DXD A;  3WGK A;  3IKF A;  1VQP F;  5MN6 A;  3HWU A;  3J7A R;  4C82 A;  4EB6 A;  1FSZ A;  3N4Y A;  1KC8 H;  1SZQ A;  3R0P A;  4U3J B;  1W5A A;  4HNA A;  5LYJ A;  3D00 A;  2VXY A;  3JVH A;  3S02 A;  4M8I A;  5EZY B;  3AGK A;  3K14 A;  3SIU A;  1YQN A;  3LWO C;  5LXT B;  1QD9 A;  3F0G A;  3N2K A;  5ITZ A;  3OW2 F;  1VQO F;  3E1Y A;  3IMP A;  5KMG B;  3CYQ A;  2UYN A;  5EB1 B;  5IJ9 A;  3N4Z A;  3Q8H A;  2QEX F;  1RQ2 A;  4F6R B;  2RHO A;  4IHJ A;  5GIN C;  5EIB C;  2RHJ A;  3GTZ A;  5LOV B;  3G71 F;  2AMT A;  4NWO B;  1X7O A;  3F0F A;  2OHW A;  4LNU A;  3QHD A;  3VIU A;  4WBN A;  4X1Y B;  2EWC A;  3CB2 A;  2ZOV A;  3OON A;  3G4S F;  1VQV A;  3GHZ A;  5GAN K;  4B62 A;  4KWE A;  3LWP C;  2BTO A;  2LBX A;  3HKB B;  3JAL B;  5CA0 A;  2QI2 A;  1VQM F;  3IEW A;  3ZP7 A;  1J7H A;  4BT3 A;  3S06 A;  4ZOL B;  1Q8R A;  4B5C A;  4B45 A;  1H47 A;  2P6Y A;  5LA6 B;  3C9R A;  3CCE F;  1PF5 A;  1KQS F;  3CD6 F;  3SIV A;  1JFF A;  5LYJ B;  1K8A H;  4TUY B;  3ZOP A;  3QUW A;  1RQ7 A;  3CC7 F;  2Q1Y A;  4LCK A;  5EB0 A;  1CN7 A;  3RYF B;  3TD3 A;  3LWR C;  3CCV F;  2FC3 A;  4BT6 A;  3N2K B;  3ZO8 A;  4FFB A;  3VI6 A;  3P0Z A;  1ZWZ A;  2QTP A;  1YIJ F;  1VQ9 F;  2PMP A;  3DC2 A;  1VQ7 F;  3UT5 B;  5IJ9 B;  5MN4 A;  3HTN A;  3WJQ A;  3M4S A;  1IV4 A;  1T0A A;  5LP6 C;  1S72 F;  1YJW F;  2IQQ A;  3S0W A;  3WGJ A;  1CK2 A;  1U40 A;  5JCO C;  5G4V C;  4ZHW A;  1RA4 A;  2FGY A;  3V4D A;  3S0H A;  4O2A B;  3M1X A;  3S0Y A;  4WBN B;  3ON1 A;  1QAH A;  5J2U A;  5KMG A;  2HVY D;  3OBW A;  3HKE A;  5G4U C;  2GLZ A;  2HP0 B;  1NMU B;  3I7T A;  5LOV A;  3VO8 A;  3I55 F;  3CCS F;  2H6L A;  2HRY A;  3I3F A;  2Z01 A;  2VAW A;  3J80 M;  4X1Y A;  2KTU A;  1IV3 A;  4G4Y A;  5CA1 B;  3G6E F;  1CLI A;  5GIP C;  5IYZ B;  3RYI A;  3JAS B;  2KG4 A;  1W5E A;  1YJN F;  5B8F A;  1ONI A;  4ZHV A;  2H8E A;  3JAL A;  3WPW A;  3LWQ C;  4G4X A;  2IAF A;  3P4E A;  1VQN F;  4TV9 A;  2YYE A;  3V7E A;  4FFB B;  4ZOL A;  4EI8 A;  2DYY A;  4NQ3 A;  3TD5 A;  5LA6 A;  4X20 B;  3KIZ A;  5CB4 B;  2AIZ P;  3J81 M;  4O2B A;  1U3L A;  4TUY A;  5JVD A;  3CPQ A;  5HY4 A;  1SA0 A;  4G4W A;  1XHO A;  4RQO A;  2BO1 A;  3RYF A;  1H48 A;  4TV8 B;  3F0E A;  3C9U A;  3FD5 A;  5J2U B;  5IJ0 A;  5KX5 B;  3JAW B;  3UT5 A;  3HKE B;  3I56 F;  3HAX D;  3WGN A;  3JAK B;  1YI2 F;  1KNJ A;  2CZW A;  3O85 A;  2UYP A;  2GZL A;  1YGY A;  2CHT A;  4NUT A;  3VOB A;  3U0O A;  5HXZ A;  4R40 B;  4O2A A;  3PAF A;  5GON B;  3N2G A;  3VOA A;  5HY2 A;  3JAM M;  2UZH A;  2MQE A;  3GYQ A;  2UYK A;  3RYI B;  1M90 H;  3KHN A;  1KD1 H;  2HP0 A;  1YHQ F;  2CHS A;  4BY9 D;  3NVI B;  3FBA A;  1GO0 A;  1E7K A;  1RLU A;  2GVI A;  4ZK7 A;  3D01 A;  4TV9 B;  1VQ5 F;  5JQG B;  4G4V A;  2W8B C;  3CCL F;  2CVL A;  1U3P A;  3E20 B;  3NMU C;  1QVF F;  5CA1 A;  2OZB A;  5FJ4 C;  4G4Z A;  3CCQ F;  2DT4 A;  4O2B B;  1W57 A;  4C8G A;  5IYZ A;  5JVD B;  3JAS A;  3LDT A;  2I6R A;  3WJR A;  1YJ9 F;  1SA0 B;  2CWJ A;  3ESJ A;  2LBW A;  1Q82 H;  3CYP B;  3JAR B;  3WGM A;  3VCZ A;  5MN5 A;  4ZI7 B;  1W40 A;  3CPW F;  5EAZ A;  2IG8 A;  4X1I B;  3MDO A;  3LME A;  5IJ0 B;  1Q86 H;  1XBI A;  4C8I A;  4O4J B;  4X20 A;  3JAT A;  3EOR A;  3D54 A;  5CB4 A;  2Q1X A;  4IIJ A;  2ZVZ A;  3K0T A;  1W58 1;  4O4L A;  5JH7 A;  5HWE A;  3CC2 F;  3CG6 A;  4I55 B;  2JNB A;  3HKD A;  3KJJ A;  3NK7 A;  1ODE A;  3KE1 A;  2G9I A;  3VYT C;  4TV8 A;  2YXZ A;  3RYH B;  3N2G B;  5KX5 A;  2ALE A;  4XCQ A;  3JAW A;  3CCJ F;  1PXW A;  3RYC A;  1DT9 A;  3NVK E;  3JAK A;  4ERH A;  5BMV B;  2Z1U A;  4X3M A;  2HS4 A;  4ZHQ B;  5HP8 A;  4PWT A;  2OTJ F;  5FNV B;  3CCM F;  5FLX M;  1K73 H;  1VQ8 F;  3VYS C;  2VAP A;  3VYU C;  4BT7 A;  5GON A;  1X52 A;  1GX1 A;  3JCM M;  1W5F A;  1GO1 A;  1N8R H;  1XV2 A;  2VGM A;  1IV1 A;  1VQL F;  1VK3 A;  1W42 A;  2CSL A;  1IV2 A;  4BT2 A;  3P10 A;  3C9T A;  5JQG A;  4YJ2 B;  5J2T B;  4G88 A;  5HXU A;  3FPI A;  2RHL A;  2V9Y A;  2L26 A;  3JAT B;  4BVT A;  2LBT A;  4IIJ B;  2ZF8 A;  5JH7 B;  4O4L B;  3S03 A;  3E22 B;  3HKD B;  3CXC F;  2ZOD A;  3CME F;  3MBM A;  3LFO A;  2OTM A;  3JAR A; 
#chains in the Genus database with same CATH homology
 3ESJ A;  3F0G A;  1H48 A;  3F0D A;  3GHZ A;  2UZH A;  1IV1 A;  4C8E A;  5B8F A;  3K2X A;  3F0E A;  3IKF A;  1JN1 A;  4C81 A;  1U43 A;  1IV2 A;  3P0Z A;  3FBA A;  1W55 A;  3P10 A;  2PMP A;  3Q8H A;  3ELC A;  3IEQ A;  3IEW A;  1VHA A;  4C82 A;  3IKE A;  4C8I A;  1KNJ A;  1JY8 A;  3EOR A;  3FPI A;  1IV4 A;  2GZL A;  1T0A A;  2AMT A;  1U3P A;  3F0F A;  1H47 A;  3QHD A;  3T80 A;  1U3L A;  1U40 A;  3JVH A;  1IV3 A;  3ERN A;  3F6M A;  3RE3 A;  1VH8 A;  1W57 A;  3K14 A;  1GX1 A;  4C8G A;  1YQN A;  3MBM A;  3KE1 A;  1KNK A;  3B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...