3IKFA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 717, imidazo[2,,1-b][1,3]thiazol-6-ylmethanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikfA00
3IEWA 3F0FA 3ERNA 1KNJA 1IV4A 1IV3A 3ELCA 3EORA 1YQNA 3P10A 3Q8HA 2GZLA 3RE3A 4C81A 5B8FA 4C8IA 1VHAA 1H47A 3GHZA 1U43A 4C8GA 3F0EA 1W57A 1KNKA 3F0DA 3F0GA 4C8EA 3MBMA 1H48A 1W55A 2PMPA 1U3LA 3P0ZA 1IV1A 1U3PA 1U40A 3T80A 3IKFA 1GX1A 2UZHA 3F6MA 3IEQA 4C82A 1JN1A 2AMTA 1IV2A 3FPIA 3B6NA 3K14A 3KE1A 3QHDA 1T0AA 3FBAA 3JVHA 3K2XA 1VH8A 3ESJA 3IKEA 1JY8A
chains in the Genus database with same CATH superfamily
1Q8RA 2CWJA 3QTYA 2GLZA 3FD6A 4WBNB 2OTMA 1YQNA 1TVKB 2UYPA 3E22B 3NK7A 3V3TA 5FLXM 1OAPA 4IHJB 4TV8A 4U3JB 3GHZA 3LWRC 5EB1B 3ZOPA 3C9TA 4O4JB 2PHNA 5DCVA 3CYPB 3ON1A 2VGNA 2R751 1TUBA 1U40A 5GIOC 1K73H 3M4SA 3RYIA 3N2GA 5LOVA 3CC2F 3FPIA 4X1IB 1ODEA 4O4LA 2IAFA 1X52A 5GANK 1SZQA 2R6R1 1XBIA 2HS3A 3D00A 2VGMA 3NMUC 2HX0A 2UYNB 3UT5B 4X20A 5HY2A 1NQ3A 2WALA 1XRGA 3JCMM 4LNUA 3LYBA 1VQ9F 3K12A 4C8EA 3F0DA 1PXWA 4E6EA 3GYQA 1W41A 2DT4A 1Q86H 1FFXA 4EB6B 5EO3A 3CCRF 1QVFF 3WGJA 3S06A 3VOAA 1X25A 3JATB 2I6DA 3CPWF 2QEXF 1VQKF 2V9YA 3JALB 1VH8A 3IKEA 4O2BB 1X7PA 1CK2A 2Z01A 4G4VA 1JFFA 2ZVZA 3CB2A 3VO8A 3LMEA 2RB9A 3MCQA 1GZ0A 4X3MA 3V7EA 1VQMF 5HY1A 2H8EA 4X1KA 1DBFA 1FSZA 2ZVYA 3RYCB 5LYJA 4TV9B 3SIUA 3WPXA 5LXTB 2QA4F 2KGWA 1XHOA 1YGYA 4RHAA 5JH7B 1T0AA 3NVKE 3FBAA 3OW2F 3C8LA 1YJNF 1VQOF 4DXDA 3IEWA 2F9ZC 2OHWA 1ZWZA 2HP0A 3ELCA 3J81M 1CN7A 1PF5A 3N2KB 5EYPA 4DRXA 2HP3A 2W8BC 3M1XA 1OFUA 2ZOVA 3V7QA 4EI7A 1COMA 5BMVA 4O4HA 2ZF8A 4IIJB 4B46A 5HP7A 5CB4A 2DYYA 4I50A 1IV1A 4X1YA 3VI6A 3VIUA 3FD5A 3CPQA 3JARA 1IV2A 2I6RA 4F6RA 2UYKA 5KX5A 1NMUB 1VK3A 4C81A 5EB0A 5HY4A 2QI2A 5LA6B 4WBNA 5JCOC 1VHAA 1TVKA 3E22A 1R1MA 3JASA 1YIJF 4BT6A 4M8IA 1W57A 3PLAC 5MN6A 3P4EA 3I56F 1W40A 4BT2A 3CC7F 1VQPF 3ZP7A 3I55F 2BTUA 1JN1A 3JAWA 3K14A 2NMUA 2LBWA 2CW4A 5GAPK 3ESJA 5LP6C 5EIBC 1IV3A 5G4VC 5ITZB 3Q8HA 3WJQA 3FFMA 2UYNA 1W59A 2AIZP 4FFBB 4X3LA 2QTPA 3HKCB 1H48A 3DC2A 2PMPA 4ZK7A 4XCQA 4EB6A 3C9SA 5G4UC 1GX1A 4BT7A 2HS0A 3S0WA 3HKBB 3WJPA 3JVHA 3K2XA 1VQVA 1KD1H 2VAWA 3CCMF 1DT9A 4EI8A 4ZHVA 3BYQA 5C8YB 1SA0B 1GO0A 4G4ZA 3VTIC 4B62A 3RYFB 3WXMB 2KTVA 4BY9D 3CC4F 4ZOLB 3LFOA 1QVGF 1W55A 1QU9A 1NJIH 3GTZA 1VQ5F 1U3PA 1N8RH 5JVDA 1YI2F 3HKEB 3JAKB 4BW0B 3RYCA 1W3EX 5GONB 1E7KA 1ONIA 5LXTA 5EZYB 2VAPA 5J2UB 1QD9A 1XV2A 4G88A 3ERNA 4TV8B 3AGKA 3R0PA 4I55A 1RLGA 3K0TA 4R40B 3TD4A 4YJ2B 5EWRA 3N2KA 3TD5A 1TUBB 3CCQF 3L7QA 2LBXA 2MQEA 3DDNA 4IIJA 3N2GB 3PAFA 1Q81H 3T80A 5HXUA 5HP8A 2OZBA 5EIBD 3LWOC 3KJJA 3CCUF 2B33A 1H7MA 4ZHQB 3P0ZA 1FNKA 1FNJA 3IR9A 3KHNA 4LNUB 3U0OA 2LCAA 3J7AR 1X7OA 1RQ7A 4BT4A 1W5FA 2CHTA 4O4IB 2RHJA 4C8IA 3SIVA 2UYJA 3CYQA 5LA6A 3G71F 1FFXB 2ZODA 3ZP4A 5KMGB 1VQ7F 3MBMA 4HNAB 4ZI7B 2CVLA 2UZHA 5IJ9A 1W42A 5CA1B 4BVTA 2YYEA 3VOBA 3F0FA 3EORA 5AVMA 2CSLA 2OTLF 4YJ3B 1RLUA 2N48A 3F0EA 4IHJA 3CCJF 4U3JA 3S02A 4FFBA 2RHOA 3E1YA 4I4TB 4O4JA 3LWVC 3O85A 5LYJB 1U3LA 4O2AB 1JD1A 2Q1YA 3RA5A 1VQ6F 1RQ2A 3VMFB 5FNVB 5LP6B 1VQ4F 4RQOA 4BVSA 3QHDA 2HVYD 3HKBA 3VYSC 3HKDB 3M84A 2CHSA 4X1IA 2AIFA 3D54A 4ERHA 5MN5A 2VAMA 3CXCF 3WJRA 4TUYB 3LWPC 3UT5A 5IYZB 1SA0A 1YJ9F 3NVIB 1M90H 1VQLF 4I50B 3RYFA 2Z1EA 3JARB 5CA0B 1K9MH 5EAZA 1UFYA 3F6MA 2BO1A 3HKEA 1M1KH 3JATA 3CG6A 5EZYA 5J2UA 5GIPC 3JALA 4O2BA 3JASB 3RE3A 4BVRA 3I3FA 2LBTA 1H47A 3V4DA 3HAXD 4C8GA 5IJ0B 2Q1XA 5J2TB 3OONA 4TZZA 4BT5A 4YJ2A 2H8CA 4BVQA 1Q82H 3F0GA 2FC3A 2HQSC 4G4WA 4LCKA 3RYHB 4NUTA 3KIZA 1KC8H 2HRYA 3JAWB 4NWOB 2RHLA 3LWQC 2KG4A 2JNBA 3VYUC 5JQGB 5MN4A 4TV9A 3CMAF 3KE1A 3MCAB 3VYTC 1Z5VA 3HTNA 5JH7A 1JY8A 4ZHQA 1VQNF 4ZHWA 2HRUA 1KQSF 2L26A 5IT9M 3N4ZA 4O4IA 3WGNA 3QUWA 2H6LA 3HJWC 2Z1UA 5KMGA 1J7HA 4HNAA 3RYIB 2K1SA 3IKFA 4ZI7A 5LOVB 1CLIA 2HS4A 3MDOA 3S0HA 4O4LB 3C9RA 1Q7YH 5GINC 1IPAA 5CA1A 4EI9A 4X20B 1KNJA 5JCOA 3P10A 3MQWA 2GZLA 1VQ8F 1W5EA 3WGMA 3E20B 2IG8A 3VCZA 1W581 4YJ3A 1KNKA 4G4YA 3WGLA 3HWUA 5JVDB 3CCVF 3CD6F 1QAHA 4I4TA 1RA4A 4O2AA 5A2QM 3J80M 3NK6A 1YHQF 2FGYA 3CCLF 3WPWA 3CMEF 2ALEA 2RHHA 3D01A 5FNVA 4I55B 4U39A 5HXZA 5LP6A 1JFFB 3HKDA 1W5AA 4G4XA 3OBWA 3S0YA 5FJ4C 1S72F 5B8FA 4B5CA 1GO1A 3G6EF 4KWEA 2YXZA 5ITZA 3JAMM 3N4YA 4TUYA 4BT3A 2IQQA 1W5BA 5IYZA 4X1KB 1YITF 3OBYA 4PWTA 3TD3A 1SDSA 4NQ3A 3HKCA 3C9UA 5HY0A 3CCEF 3KJKA 5CA0A 4B45A 4C82A 2AMTA 3B6NA 1Z5WA 2EWCA 1K8AH 3I7TA 1UI9A 2HP0B 5EYPB 4DRXB 2ZAUA 2P6YA 1IV4A 2VXYA 1YJWF 1JJ2F 2GVIA 3IMPA 3ZO8A 1U43A 5BMVB 4O4HB 3G4SF 2BTOA 3LDTA 2Z1FA 5C8YA 5IJ0A 5J2TA 5CB4B 2Z1TA 3S03A 2OTJF 4C4WC 4X1YB 5IJ9B 4ZOLA 3RYHA 2G9IA 4ZHYB 1W2BF 3IEQA 3CCSF 2CZWA 3RA6A 3WGKA 2KTUA 4F6RB 5KX5B 5HWEA 1T0KB 3JAKA 5JQGA 5GONA 2BTQB
chains in the Genus database with same CATH topology
3IEWA 3F0FA 3ERNA 1KNJA 1IV4A 1IV3A 3ELCA 3EORA 1YQNA 3P10A 3Q8HA 2GZLA 3RE3A 4C81A 5B8FA 4C8IA 1VHAA 1H47A 3GHZA 1U43A 4C8GA 3F0EA 1W57A 1KNKA 3F0DA 3F0GA 4C8EA 3MBMA 1H48A 1W55A 2PMPA 1U3LA 3P0ZA 1IV1A 1U3PA 1U40A 3T80A 3IKFA 1GX1A 2UZHA 3F6MA 3IEQA 4C82A 1JN1A 2AMTA 1IV2A 3FPIA 3B6NA 3K14A 3KE1A 3QHDA 1T0AA 3FBAA 3JVHA 3K2XA 1VH8A 3ESJA 3IKEA 1JY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEW A;  3F0F A;  3ERN A;  1KNJ A;  1IV4 A;  1IV3 A;  3ELC A;  3EOR A;  1YQN A;  3P10 A;  3Q8H A;  2GZL A;  3RE3 A;  4C81 A;  5B8F A;  4C8I A;  1VHA A;  1H47 A;  3GHZ A;  1U43 A;  4C8G A;  3F0E A;  1W57 A;  1KNK A;  3F0D A;  3F0G A;  4C8E A;  3MBM A;  1H48 A;  1W55 A;  2PMP A;  1U3L A;  3P0Z A;  1IV1 A;  1U3P A;  1U40 A;  3T80 A;  3IKF A;  1GX1 A;  2UZH A;  3F6M A;  3IEQ A;  4C82 A;  1JN1 A;  2AMT A;  1IV2 A;  3FPI A;  3B6N A;  3K14 A;  3KE1 A;  3QHD A;  1T0A A;  3FBA A;  3JVH A;  3K2X A;  1VH8 A;  3ESJ A;  3IKE A;  1JY8 A; 
#chains in the Genus database with same CATH topology
 1Q8R A;  2CWJ A;  3QTY A;  2GLZ A;  3FD6 A;  4WBN B;  2OTM A;  1YQN A;  1TVK B;  2UYP A;  3E22 B;  3NK7 A;  3V3T A;  5FLX M;  1OAP A;  4IHJ B;  4TV8 A;  4U3J B;  3GHZ A;  3LWR C;  5EB1 B;  3ZOP A;  3C9T A;  4O4J B;  2PHN A;  5DCV A;  3CYP B;  3ON1 A;  2VGN A;  2R75 1;  1TUB A;  1U40 A;  5GIO C;  1K73 H;  3M4S A;  3RYI A;  3N2G A;  5LOV A;  3CC2 F;  3FPI A;  4X1I B;  1ODE A;  4O4L A;  2IAF A;  1X52 A;  5GAN K;  1SZQ A;  2R6R 1;  1XBI A;  2HS3 A;  3D00 A;  2VGM A;  3NMU C;  2HX0 A;  2UYN B;  3UT5 B;  4X20 A;  5HY2 A;  1NQ3 A;  2WAL A;  1XRG A;  3JCM M;  4LNU A;  3LYB A;  1VQ9 F;  3K12 A;  4C8E A;  3F0D A;  1PXW A;  4E6E A;  3GYQ A;  1W41 A;  2DT4 A;  1Q86 H;  1FFX A;  4EB6 B;  5EO3 A;  3CCR F;  1QVF F;  3WGJ A;  3S06 A;  3VOA A;  1X25 A;  3JAT B;  2I6D A;  3CPW F;  2QEX F;  1VQK F;  2V9Y A;  3JAL B;  1VH8 A;  3IKE A;  4O2B B;  1X7P A;  1CK2 A;  2Z01 A;  4G4V A;  1JFF A;  2ZVZ A;  3CB2 A;  3VO8 A;  3LME A;  2RB9 A;  3MCQ A;  1GZ0 A;  4X3M A;  3V7E A;  1VQM F;  5HY1 A;  2H8E A;  4X1K A;  1DBF A;  1FSZ A;  2ZVY A;  3RYC B;  5LYJ A;  4TV9 B;  3SIU A;  3WPX A;  5LXT B;  2QA4 F;  2KGW A;  1XHO A;  1YGY A;  4RHA A;  5JH7 B;  1T0A A;  3NVK E;  3FBA A;  3OW2 F;  3C8L A;  1YJN F;  1VQO F;  4DXD A;  3IEW A;  2F9Z C;  2OHW A;  1ZWZ A;  2HP0 A;  3ELC A;  3J81 M;  1CN7 A;  1PF5 A;  3N2K B;  5EYP A;  4DRX A;  2HP3 A;  2W8B C;  3M1X A;  1OFU A;  2ZOV A;  3V7Q A;  4EI7 A;  1COM A;  5BMV A;  4O4H A;  2ZF8 A;  4IIJ B;  4B46 A;  5HP7 A;  5CB4 A;  2DYY A;  4I50 A;  1IV1 A;  4X1Y A;  3VI6 A;  3VIU A;  3FD5 A;  3CPQ A;  3JAR A;  1IV2 A;  2I6R A;  4F6R A;  2UYK A;  5KX5 A;  1NMU B;  1VK3 A;  4C81 A;  5EB0 A;  5HY4 A;  2QI2 A;  5LA6 B;  4WBN A;  5JCO C;  1VHA A;  1TVK A;  3E22 A;  1R1M A;  3JAS A;  1YIJ F;  4BT6 A;  4M8I A;  1W57 A;  3PLA C;  5MN6 A;  3P4E A;  3I56 F;  1W40 A;  4BT2 A;  3CC7 F;  1VQP F;  3ZP7 A;  3I55 F;  2BTU A;  1JN1 A;  3JAW A;  3K14 A;  2NMU A;  2LBW A;  2CW4 A;  5GAP K;  3ESJ A;  5LP6 C;  5EIB C;  1IV3 A;  5G4V C;  5ITZ B;  3Q8H A;  3WJQ A;  3FFM A;  2UYN A;  1W59 A;  2AIZ P;  4FFB B;  4X3L A;  2QTP A;  3HKC B;  1H48 A;  3DC2 A;  2PMP A;  4ZK7 A;  4XCQ A;  4EB6 A;  3C9S A;  5G4U C;  1GX1 A;  4BT7 A;  2HS0 A;  3S0W A;  3HKB B;  3WJP A;  3JVH A;  3K2X A;  1VQV A;  1KD1 H;  2VAW A;  3CCM F;  1DT9 A;  4EI8 A;  4ZHV A;  3BYQ A;  5C8Y B;  1SA0 B;  1GO0 A;  4G4Z A;  3VTI C;  4B62 A;  3RYF B;  3WXM B;  2KTV A;  4BY9 D;  3CC4 F;  4ZOL B;  3LFO A;  1QVG F;  1W55 A;  1QU9 A;  1NJI H;  3GTZ A;  1VQ5 F;  1U3P A;  1N8R H;  5JVD A;  1YI2 F;  3HKE B;  3JAK B;  4BW0 B;  3RYC A;  1W3E X;  5GON B;  1E7K A;  1ONI A;  5LXT A;  5EZY B;  2VAP A;  5J2U B;  1QD9 A;  1XV2 A;  4G88 A;  3ERN A;  4TV8 B;  3AGK A;  3R0P A;  4I55 A;  1RLG A;  3K0T A;  4R40 B;  3TD4 A;  4YJ2 B;  5EWR A;  3N2K A;  3TD5 A;  1TUB B;  3CCQ F;  3L7Q A;  2LBX A;  2MQE A;  3DDN A;  4IIJ A;  3N2G B;  3PAF A;  1Q81 H;  3T80 A;  5HXU A;  5HP8 A;  2OZB A;  5EIB D;  3LWO C;  3KJJ A;  3CCU F;  2B33 A;  1H7M A;  4ZHQ B;  3P0Z A;  1FNK A;  1FNJ A;  3IR9 A;  3KHN A;  4LNU B;  3U0O A;  2LCA A;  3J7A R;  1X7O A;  1RQ7 A;  4BT4 A;  1W5F A;  2CHT A;  4O4I B;  2RHJ A;  4C8I A;  3SIV A;  2UYJ A;  3CYQ A;  5LA6 A;  3G71 F;  1FFX B;  2ZOD A;  3ZP4 A;  5KMG B;  1VQ7 F;  3MBM A;  4HNA B;  4ZI7 B;  2CVL A;  2UZH A;  5IJ9 A;  1W42 A;  5CA1 B;  4BVT A;  2YYE A;  3VOB A;  3F0F A;  3EOR A;  5AVM A;  2CSL A;  2OTL F;  4YJ3 B;  1RLU A;  2N48 A;  3F0E A;  4IHJ A;  3CCJ F;  4U3J A;  3S02 A;  4FFB A;  2RHO A;  3E1Y A;  4I4T B;  4O4J A;  3LWV C;  3O85 A;  5LYJ B;  1U3L A;  4O2A B;  1JD1 A;  2Q1Y A;  3RA5 A;  1VQ6 F;  1RQ2 A;  3VMF B;  5FNV B;  5LP6 B;  1VQ4 F;  4RQO A;  4BVS A;  3QHD A;  2HVY D;  3HKB A;  3VYS C;  3HKD B;  3M84 A;  2CHS A;  4X1I A;  2AIF A;  3D54 A;  4ERH A;  5MN5 A;  2VAM A;  3CXC F;  3WJR A;  4TUY B;  3LWP C;  3UT5 A;  5IYZ B;  1SA0 A;  1YJ9 F;  3NVI B;  1M90 H;  1VQL F;  4I50 B;  3RYF A;  2Z1E A;  3JAR B;  5CA0 B;  1K9M H;  5EAZ A;  1UFY A;  3F6M A;  2BO1 A;  3HKE A;  1M1K H;  3JAT A;  3CG6 A;  5EZY A;  5J2U A;  5GIP C;  3JAL A;  4O2B A;  3JAS B;  3RE3 A;  4BVR A;  3I3F A;  2LBT A;  1H47 A;  3V4D A;  3HAX D;  4C8G A;  5IJ0 B;  2Q1X A;  5J2T B;  3OON A;  4TZZ A;  4BT5 A;  4YJ2 A;  2H8C A;  4BVQ A;  1Q82 H;  3F0G A;  2FC3 A;  2HQS C;  4G4W A;  4LCK A;  3RYH B;  4NUT A;  3KIZ A;  1KC8 H;  2HRY A;  3JAW B;  4NWO B;  2RHL A;  3LWQ C;  2KG4 A;  2JNB A;  3VYU C;  5JQG B;  5MN4 A;  4TV9 A;  3CMA F;  3KE1 A;  3MCA B;  3VYT C;  1Z5V A;  3HTN A;  5JH7 A;  1JY8 A;  4ZHQ A;  1VQN F;  4ZHW A;  2HRU A;  1KQS F;  2L26 A;  5IT9 M;  3N4Z A;  4O4I A;  3WGN A;  3QUW A;  2H6L A;  3HJW C;  2Z1U A;  5KMG A;  1J7H A;  4HNA A;  3RYI B;  2K1S A;  3IKF A;  4ZI7 A;  5LOV B;  1CLI A;  2HS4 A;  3MDO A;  3S0H A;  4O4L B;  3C9R A;  1Q7Y H;  5GIN C;  1IPA A;  5CA1 A;  4EI9 A;  4X20 B;  1KNJ A;  5JCO A;  3P10 A;  3MQW A;  2GZL A;  1VQ8 F;  1W5E A;  3WGM A;  3E20 B;  2IG8 A;  3VCZ A;  1W58 1;  4YJ3 A;  1KNK A;  4G4Y A;  3WGL A;  3HWU A;  5JVD B;  3CCV F;  3CD6 F;  1QAH A;  4I4T A;  1RA4 A;  4O2A A;  5A2Q M;  3J80 M;  3NK6 A;  1YHQ F;  2FGY A;  3CCL F;  3WPW A;  3CME F;  2ALE A;  2RHH A;  3D01 A;  5FNV A;  4I55 B;  4U39 A;  5HXZ A;  5LP6 A;  1JFF B;  3HKD A;  1W5A A;  4G4X A;  3OBW A;  3S0Y A;  5FJ4 C;  1S72 F;  5B8F A;  4B5C A;  1GO1 A;  3G6E F;  4KWE A;  2YXZ A;  5ITZ A;  3JAM M;  3N4Y A;  4TUY A;  4BT3 A;  2IQQ A;  1W5B A;  5IYZ A;  4X1K B;  1YIT F;  3OBY A;  4PWT A;  3TD3 A;  1SDS A;  4NQ3 A;  3HKC A;  3C9U A;  5HY0 A;  3CCE F;  3KJK A;  5CA0 A;  4B45 A;  4C82 A;  2AMT A;  3B6N A;  1Z5W A;  2EWC A;  1K8A H;  3I7T A;  1UI9 A;  2HP0 B;  5EYP B;  4DRX B;  2ZAU A;  2P6Y A;  1IV4 A;  2VXY A;  1YJW F;  1JJ2 F;  2GVI A;  3IMP A;  3ZO8 A;  1U43 A;  5BMV B;  4O4H B;  3G4S F;  2BTO A;  3LDT A;  2Z1F A;  5C8Y A;  5IJ0 A;  5J2T A;  5CB4 B;  2Z1T A;  3S03 A;  2OTJ F;  4C4W C;  4X1Y B;  5IJ9 B;  4ZOL A;  3RYH A;  2G9I A;  4ZHY B;  1W2B F;  3IEQ A;  3CCS F;  2CZW A;  3RA6 A;  3WGK A;  2KTU A;  4F6R B;  5KX5 B;  5HWE A;  1T0K B;  3JAK A;  5JQG A;  5GON A;  2BTQ B; 
#chains in the Genus database with same CATH homology
 3IEW A;  3F0F A;  3ERN A;  1KNJ A;  1IV4 A;  1IV3 A;  3ELC A;  3EOR A;  1YQN A;  3P10 A;  3Q8H A;  2GZL A;  3RE3 A;  4C81 A;  5B8F A;  4C8I A;  1VHA A;  1H47 A;  3GHZ A;  1U43 A;  4C8G A;  3F0E A;  1W57 A;  1KNK A;  3F0D A;  3F0G A;  4C8E A;  3MBM A;  1H48 A;  1W55 A;  2PMP A;  1U3L A;  3P0Z A;  1IV1 A;  1U3P A;  1U40 A;  3T80 A;  3IKF A;  1GX1 A;  2UZH A;  3F6M A;  3IEQ A;  4C82 A;  1JN1 A;  2AMT A;  1IV2 A;  3FPI A;  3B6N A;  3K14 A;  3KE1 A;  3QHD A;  1T0A A;  3FBA A;  3JVH A;  3K2X A;  1VH8 A;  3ESJ A;  3IKE A;  1JY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...