3IKFA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 717, imidazo[2,,1-b][1,3]thiazol-6-ylmethanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ikfA00
1T0AA 1U3LA 4C8EA 2UZHA 5B8FA 4C81A 3K14A 1W57A 3K2XA 1KNKA 3IEWA 3ERNA 3Q8HA 1YQNA 1H48A 1VHAA 1JY8A 1IV1A 4C82A 3JVHA 4C8IA 1U40A 3F0DA 1KNJA 2PMPA 3IKFA 1IV3A 2AMTA 3RE3A 1IV2A 1H47A 3F0EA 3P0ZA 3P10A 2GZLA 3IKEA 3QHDA 3FPIA 4C8GA 1U3PA 1VH8A 3F0GA 3GHZA 1W55A 3ESJA 3EORA 3KE1A 3MBMA 3T80A 3IEQA 3ELCA 1IV4A 3F6MA 1U43A 1JN1A 3B6NA 1GX1A 3F0FA 3FBAA
chains in the Genus database with same CATH superfamily
3E1YA 5B8FA 5LP6B 3FFMA 5A2QM 4BT7A 3RYFA 5JCOA 3RYHA 5LYJA 1TVKB 3WJQA 3IR9A 3JVHA 2KTVA 4U39A 5EAZA 3VMFB 4YJ3A 2HP0B 3F0DA 3VCZA 2HVYD 2AMTA 5EZYA 3RYCA 3CC4F 3JAKB 1QD9A 2I6RA 5FNVB 1XRGA 4G4WA 3WGMA 4BT5A 3J80M 2R6R1 4BY9D 4ZHQB 3LWRC 4G4YA 1OFUA 3DDNA 1X7PA 1KQSF 2VAPA 3VYTC 2DT4A 3HKEB 5JVDA 5BMVB 5J2UA 2OTJF 2UYKA 1Q82H 1KNJA 3RYIA 5CB4B 4EB6A 3HKCA 1U3PA 2P6YA 2H6LA 5FLXM 4PWTA 3CCVF 3BYQA 1RA4A 1PF5A 3I56F 4ZHVA 1T0AA 3LWVC 4O2AB 2UZHA 5LP6A 3CCRF 4FFBA 1W5BA 3CCQF 5FNVA 1PXWA 2B33A 3P4EA 2ZOVA 1VHAA 3CPQA 1IPAA 4I55B 1DT9A 3CCEF 3CD6F 4G4VA 2V9YA 3N2GB 4ZHQA 1K9MH 3RYCB 3GHZA 1VQ7F 3S02A 1RLGA 4YJ2B 3IEQA 3E22B 5CA1A 4EB6B 1W5AA 5GIOC 5LA6A 2IAFA 2LBTA 3VO8A 3WGNA 3NK6A 1YITF 5JH7B 1RQ7A 3HKDA 1TUBB 4XCQA 3HJWC 1JY8A 1KD1H 2FGYA 4ZHYB 3N2KB 4O2AA 3RE3A 3TD3A 1FFXB 3N4YA 1VH8A 3CCSF 1R1MA 1SA0A 1Z5WA 2UYNB 5GONB 3CMEF 2CHSA 1JN1A 2OTLF 1QU9A 5G4UC 3LFOA 4BVRA 1U3LA 5ITZA 2AIFA 4WBNB 5MN4A 5LOVA 4TUYB 5JCOC 3ZOPA 1TVKA 1VQ8F 3JARB 3MCQA 3MDOA 1QVGF 2CW4A 4TZZA 1N8RH 4ZK7A 5LXTB 3ON1A 5HXUA 3NVIB 2BTOA 3P10A 3WGJA 2Q1YA 3S03A 3MBMA 1VQKF 3JALA 2HQSC 3F6MA 2VGMA 3WJRA 1QVFF 1JFFB 5HY2A 3F0FA 3FBAA 3CXCF 3V3TA 4TV9A 4BT4A 1W59A 3QTYA 3JATB 2ZVZA 2PHNA 3JAMM 1J7HA 1H48A 3JCMM 3M1XA 3WJPA 5HXZA 2OZBA 3DC2A 3HKBB 1Q81H 3CPWF 3S06A 4O4LA 4I4TA 2YYEA 3IKEA 3WXMB 2MQEA 2R751 5KMGA 3ESJA 3JAKA 2LBXA 3T80A 3K0TA 2Q1XA 5EIBD 3I3FA 5LXTA 5J2TA 5DCVA 2UYNA 5EO3A 2KGWA 5G4VC 2CWJA 4C81A 3K14A 1T0KB 1W5FA 3K2XA 4LNUB 4BT6A 3QUWA 2QA4F 3IEWA 3OBYA 3Q8HA 4HNAB 2VAWA 3LWQC 4C82A 4DRXA 4EI8A 5CB4A 2UYJA 1Q86H 3V4DA 2IQQA 3C9TA 5EZYB 3WGLA 3JATA 3K12A 1W55A 1VK3A 4ZOLB 2CHTA 3HTNA 5GIPC 3VOAA 1QAHA 3JAWA 1U43A 4IIJB 4EI7A 2QI2A 5EIBC 3FD6A 2RHLA 4KWEA 3LDTA 3N2GA 1X25A 4IHJA 1FNKA 5JH7A 1KNKA 3LMEA 4O4IA 1CN7A 3ERNA 4HNAA 2OHWA 1YJ9F 3V7QA 3M4SA 2ZAUA 3KHNA 2RHOA 1FNJA 3JASA 3PAFA 2CVLA 1VQ9F 2HS4A 1K73H 3F0EA 1SA0B 3P0ZA 2RHJA 3RA6A 3TD4A 1JD1A 5HP7A 4X20A 5EYPA 3C9SA 2BTUA 2LBWA 3GYQA 3C9RA 5GANK 3G71F 2Z1UA 1H7MA 4I50B 1NMUB 3CCUF 5GAPK 5MN6A 5IJ0B 5LYJB 1VQOF 1TUBA 5C8YB 1COMA 4YJ3B 3ZO8A 4I55A 5IYZA 1YIJF 3S0HA 3N2KA 3D00A 2I6DA 5GINC 3S0YA 2JNBA 3RYHB 3RYFB 3UT5A 5BMVA 1YI2F 5CA0B 1CK2A 2K1SA 4O4HA 2HP0A 3J81M 3RYIB 1DBFA 4U3JA 3R0PA 1XV2A 2EWCA 5MN5A 4O4JA 4BVSA 4G4ZA 1VQMF 2RHHA 2OTMA 2ZVYA 3CCJF 4ZI7B 4X3MA 1JFFA 2RB9A 2HS0A 3JASB 3CG6A 4C8GA 1ODEA 3VYSC 1CLIA 2Z1FA 1VQNF 2H8EA 3OBWA 3O85A 4G88A 3CYQA 2QTPA 3WGKA 1VQPF 3CCMF 2Z1EA 4O2BB 1Q7YH 5AVMA 4TV9B 2KTUA 3J7AR 4TV8A 4B62A 2BO1A 3PLAC 2BTQB 4RHAA 4X1IA 3HKDB 2HS3A 3KIZA 5CA0A 2UYPA 4BW0B 5IJ9A 4M8IA 1UFYA 3C9UA 1U40A 1OAPA 4NQ3A 1VQ6F 5FJ4C 4BT2A 2GLZA 4RQOA 4ZOLA 5EB1B 2ALEA 3G6EF 2DYYA 5J2TB 5IT9M 1GO0A 1X52A 4G4XA 3U0OA 1RLUA 1M90H 4IHJB 5KX5B 1W57A 2F9ZC 4R40B 1YHQF 2N48A 5GONA 2HRUA 2ZODA 3ZP4A 5CA1B 3CB2A 1K8AH 4C8IA 1SZQA 2VGNA 1FSZA 4ZI7A 2PMPA 4C4WC 1H47A 1VQ4F 3CMAF 3AGKA 1M1KH 1XHOA 1W41A 3TD5A 2Z1TA 3EORA 5KMGB 1GO1A 1VQVA 3LYBA 3G4SF 3NVKE 2W8BC 5LP6C 3B6NA 1W3EX 5IJ9B 5HWEA 1W581 2QEXF 5JQGB 4X1YB 1E7KA 3JALB 2IG8A 3I7TA 1SDSA 3I55F 3CYPB 3D01A 4LNUA 2KG4A 3NMUC 3WPWA 4DXDA 3N4ZA 2HP3A 1IV3A 1XBIA 2GZLA 4B45A 4WBNA 3FPIA 4ERHA 3F0GA 2H8CA 3C8LA 3L7QA 3MCAB 3JARA 3NK7A 2YXZA 1ONIA 1W42A 3VYUC 3KJKA 5HP8A 3IMPA 2NMUA 5J2UB 1GX1A 5EYPB 5HY1A 1Q8RA 4NUTA 3E20B 5C8YA 5IYZB 1RQ2A 2ZF8A 4O4JB 3M84A 3RA5A 3S0WA 1UI9A 4X3LA 5IJ0A 1NJIH 3HAXD 1IV1A 2G9IA 5HY0A 4X1KB 1NQ3A 4O4LB 1X7OA 3HKBA 5KX5A 2VAMA 4X1YA 2CZWA 5JQGA 4F6RA 4I4TB 4FFBB 3ZP7A 4BVTA 3E22A 2GVIA 2LCAA 1IV4A 1JJ2F 4B46A 4O2BA 1ZWZA 3VOBA 3LWPC 1YJWF 4C8EA 4TUYA 3SIUA 4U3JB 1FFXA 4BT3A 3VI6A 4YJ2A 3KJJA 1YQNA 3UT5B 3D54A 4X1KA 3CCLF 3GTZA 5EB0A 4DRXB 4BVQA 1Z5VA 1IV2A 1S72F 5LA6B 1VQ5F 3FD5A 1VQLF 2VXYA 4X1IB 4NWOB 1YJNF 4LCKA 5EWRA 5ITZB 4O4HB 2HRYA 2HX0A 5LOVB 3HKCB 1W5EA 4O4IB 2FC3A 3OONA 4F6RB 3WPXA 3VIUA 4EI9A 4TV8B 1YGYA 3HKEA 2CSLA 5JVDB 4X20B 3VTIC 1KC8H 1W40A 3SIVA 4IIJA 2Z01A 3JAWB 3MQWA 3IKFA 3LWOC 3QHDA 1GZ0A 1W2BF 4ZHWA 4I50A 3CC2F 3HWUA 3KE1A 2AIZP 3ELCA 4B5CA 4E6EA 5HY4A 3CC7F 3V7EA 2WALA 3OW2F 2L26A
chains in the Genus database with same CATH topology
1T0AA 1U3LA 4C8EA 2UZHA 5B8FA 4C81A 3K14A 1W57A 3K2XA 1KNKA 3IEWA 3ERNA 3Q8HA 1YQNA 1H48A 1VHAA 1JY8A 1IV1A 4C82A 3JVHA 4C8IA 1U40A 3F0DA 1KNJA 2PMPA 3IKFA 1IV3A 2AMTA 3RE3A 1IV2A 1H47A 3F0EA 3P0ZA 3P10A 2GZLA 3IKEA 3QHDA 3FPIA 4C8GA 1U3PA 1VH8A 3F0GA 3GHZA 1W55A 3ESJA 3EORA 3KE1A 3MBMA 3T80A 3IEQA 3ELCA 1IV4A 3F6MA 1U43A 1JN1A 3B6NA 1GX1A 3F0FA 3FBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0A A;  1U3L A;  4C8E A;  2UZH A;  5B8F A;  4C81 A;  3K14 A;  1W57 A;  3K2X A;  1KNK A;  3IEW A;  3ERN A;  3Q8H A;  1YQN A;  1H48 A;  1VHA A;  1JY8 A;  1IV1 A;  4C82 A;  3JVH A;  4C8I A;  1U40 A;  3F0D A;  1KNJ A;  2PMP A;  3IKF A;  1IV3 A;  2AMT A;  3RE3 A;  1IV2 A;  1H47 A;  3F0E A;  3P0Z A;  3P10 A;  2GZL A;  3IKE A;  3QHD A;  3FPI A;  4C8G A;  1U3P A;  1VH8 A;  3F0G A;  3GHZ A;  1W55 A;  3ESJ A;  3EOR A;  3KE1 A;  3MBM A;  3T80 A;  3IEQ A;  3ELC A;  1IV4 A;  3F6M A;  1U43 A;  1JN1 A;  3B6N A;  1GX1 A;  3F0F A;  3FBA A; 
#chains in the Genus database with same CATH topology
 3E1Y A;  5B8F A;  5LP6 B;  3FFM A;  5A2Q M;  4BT7 A;  3RYF A;  5JCO A;  3RYH A;  5LYJ A;  1TVK B;  3WJQ A;  3IR9 A;  3JVH A;  2KTV A;  4U39 A;  5EAZ A;  3VMF B;  4YJ3 A;  2HP0 B;  3F0D A;  3VCZ A;  2HVY D;  2AMT A;  5EZY A;  3RYC A;  3CC4 F;  3JAK B;  1QD9 A;  2I6R A;  5FNV B;  1XRG A;  4G4W A;  3WGM A;  4BT5 A;  3J80 M;  2R6R 1;  4BY9 D;  4ZHQ B;  3LWR C;  4G4Y A;  1OFU A;  3DDN A;  1X7P A;  1KQS F;  2VAP A;  3VYT C;  2DT4 A;  3HKE B;  5JVD A;  5BMV B;  5J2U A;  2OTJ F;  2UYK A;  1Q82 H;  1KNJ A;  3RYI A;  5CB4 B;  4EB6 A;  3HKC A;  1U3P A;  2P6Y A;  2H6L A;  5FLX M;  4PWT A;  3CCV F;  3BYQ A;  1RA4 A;  1PF5 A;  3I56 F;  4ZHV A;  1T0A A;  3LWV C;  4O2A B;  2UZH A;  5LP6 A;  3CCR F;  4FFB A;  1W5B A;  3CCQ F;  5FNV A;  1PXW A;  2B33 A;  3P4E A;  2ZOV A;  1VHA A;  3CPQ A;  1IPA A;  4I55 B;  1DT9 A;  3CCE F;  3CD6 F;  4G4V A;  2V9Y A;  3N2G B;  4ZHQ A;  1K9M H;  3RYC B;  3GHZ A;  1VQ7 F;  3S02 A;  1RLG A;  4YJ2 B;  3IEQ A;  3E22 B;  5CA1 A;  4EB6 B;  1W5A A;  5GIO C;  5LA6 A;  2IAF A;  2LBT A;  3VO8 A;  3WGN A;  3NK6 A;  1YIT F;  5JH7 B;  1RQ7 A;  3HKD A;  1TUB B;  4XCQ A;  3HJW C;  1JY8 A;  1KD1 H;  2FGY A;  4ZHY B;  3N2K B;  4O2A A;  3RE3 A;  3TD3 A;  1FFX B;  3N4Y A;  1VH8 A;  3CCS F;  1R1M A;  1SA0 A;  1Z5W A;  2UYN B;  5GON B;  3CME F;  2CHS A;  1JN1 A;  2OTL F;  1QU9 A;  5G4U C;  3LFO A;  4BVR A;  1U3L A;  5ITZ A;  2AIF A;  4WBN B;  5MN4 A;  5LOV A;  4TUY B;  5JCO C;  3ZOP A;  1TVK A;  1VQ8 F;  3JAR B;  3MCQ A;  3MDO A;  1QVG F;  2CW4 A;  4TZZ A;  1N8R H;  4ZK7 A;  5LXT B;  3ON1 A;  5HXU A;  3NVI B;  2BTO A;  3P10 A;  3WGJ A;  2Q1Y A;  3S03 A;  3MBM A;  1VQK F;  3JAL A;  2HQS C;  3F6M A;  2VGM A;  3WJR A;  1QVF F;  1JFF B;  5HY2 A;  3F0F A;  3FBA A;  3CXC F;  3V3T A;  4TV9 A;  4BT4 A;  1W59 A;  3QTY A;  3JAT B;  2ZVZ A;  2PHN A;  3JAM M;  1J7H A;  1H48 A;  3JCM M;  3M1X A;  3WJP A;  5HXZ A;  2OZB A;  3DC2 A;  3HKB B;  1Q81 H;  3CPW F;  3S06 A;  4O4L A;  4I4T A;  2YYE A;  3IKE A;  3WXM B;  2MQE A;  2R75 1;  5KMG A;  3ESJ A;  3JAK A;  2LBX A;  3T80 A;  3K0T A;  2Q1X A;  5EIB D;  3I3F A;  5LXT A;  5J2T A;  5DCV A;  2UYN A;  5EO3 A;  2KGW A;  5G4V C;  2CWJ A;  4C81 A;  3K14 A;  1T0K B;  1W5F A;  3K2X A;  4LNU B;  4BT6 A;  3QUW A;  2QA4 F;  3IEW A;  3OBY A;  3Q8H A;  4HNA B;  2VAW A;  3LWQ C;  4C82 A;  4DRX A;  4EI8 A;  5CB4 A;  2UYJ A;  1Q86 H;  3V4D A;  2IQQ A;  3C9T A;  5EZY B;  3WGL A;  3JAT A;  3K12 A;  1W55 A;  1VK3 A;  4ZOL B;  2CHT A;  3HTN A;  5GIP C;  3VOA A;  1QAH A;  3JAW A;  1U43 A;  4IIJ B;  4EI7 A;  2QI2 A;  5EIB C;  3FD6 A;  2RHL A;  4KWE A;  3LDT A;  3N2G A;  1X25 A;  4IHJ A;  1FNK A;  5JH7 A;  1KNK A;  3LME A;  4O4I A;  1CN7 A;  3ERN A;  4HNA A;  2OHW A;  1YJ9 F;  3V7Q A;  3M4S A;  2ZAU A;  3KHN A;  2RHO A;  1FNJ A;  3JAS A;  3PAF A;  2CVL A;  1VQ9 F;  2HS4 A;  1K73 H;  3F0E A;  1SA0 B;  3P0Z A;  2RHJ A;  3RA6 A;  3TD4 A;  1JD1 A;  5HP7 A;  4X20 A;  5EYP A;  3C9S A;  2BTU A;  2LBW A;  3GYQ A;  3C9R A;  5GAN K;  3G71 F;  2Z1U A;  1H7M A;  4I50 B;  1NMU B;  3CCU F;  5GAP K;  5MN6 A;  5IJ0 B;  5LYJ B;  1VQO F;  1TUB A;  5C8Y B;  1COM A;  4YJ3 B;  3ZO8 A;  4I55 A;  5IYZ A;  1YIJ F;  3S0H A;  3N2K A;  3D00 A;  2I6D A;  5GIN C;  3S0Y A;  2JNB A;  3RYH B;  3RYF B;  3UT5 A;  5BMV A;  1YI2 F;  5CA0 B;  1CK2 A;  2K1S A;  4O4H A;  2HP0 A;  3J81 M;  3RYI B;  1DBF A;  4U3J A;  3R0P A;  1XV2 A;  2EWC A;  5MN5 A;  4O4J A;  4BVS A;  4G4Z A;  1VQM F;  2RHH A;  2OTM A;  2ZVY A;  3CCJ F;  4ZI7 B;  4X3M A;  1JFF A;  2RB9 A;  2HS0 A;  3JAS B;  3CG6 A;  4C8G A;  1ODE A;  3VYS C;  1CLI A;  2Z1F A;  1VQN F;  2H8E A;  3OBW A;  3O85 A;  4G88 A;  3CYQ A;  2QTP A;  3WGK A;  1VQP F;  3CCM F;  2Z1E A;  4O2B B;  1Q7Y H;  5AVM A;  4TV9 B;  2KTU A;  3J7A R;  4TV8 A;  4B62 A;  2BO1 A;  3PLA C;  2BTQ B;  4RHA A;  4X1I A;  3HKD B;  2HS3 A;  3KIZ A;  5CA0 A;  2UYP A;  4BW0 B;  5IJ9 A;  4M8I A;  1UFY A;  3C9U A;  1U40 A;  1OAP A;  4NQ3 A;  1VQ6 F;  5FJ4 C;  4BT2 A;  2GLZ A;  4RQO A;  4ZOL A;  5EB1 B;  2ALE A;  3G6E F;  2DYY A;  5J2T B;  5IT9 M;  1GO0 A;  1X52 A;  4G4X A;  3U0O A;  1RLU A;  1M90 H;  4IHJ B;  5KX5 B;  1W57 A;  2F9Z C;  4R40 B;  1YHQ F;  2N48 A;  5GON A;  2HRU A;  2ZOD A;  3ZP4 A;  5CA1 B;  3CB2 A;  1K8A H;  4C8I A;  1SZQ A;  2VGN A;  1FSZ A;  4ZI7 A;  2PMP A;  4C4W C;  1H47 A;  1VQ4 F;  3CMA F;  3AGK A;  1M1K H;  1XHO A;  1W41 A;  3TD5 A;  2Z1T A;  3EOR A;  5KMG B;  1GO1 A;  1VQV A;  3LYB A;  3G4S F;  3NVK E;  2W8B C;  5LP6 C;  3B6N A;  1W3E X;  5IJ9 B;  5HWE A;  1W58 1;  2QEX F;  5JQG B;  4X1Y B;  1E7K A;  3JAL B;  2IG8 A;  3I7T A;  1SDS A;  3I55 F;  3CYP B;  3D01 A;  4LNU A;  2KG4 A;  3NMU C;  3WPW A;  4DXD A;  3N4Z A;  2HP3 A;  1IV3 A;  1XBI A;  2GZL A;  4B45 A;  4WBN A;  3FPI A;  4ERH A;  3F0G A;  2H8C A;  3C8L A;  3L7Q A;  3MCA B;  3JAR A;  3NK7 A;  2YXZ A;  1ONI A;  1W42 A;  3VYU C;  3KJK A;  5HP8 A;  3IMP A;  2NMU A;  5J2U B;  1GX1 A;  5EYP B;  5HY1 A;  1Q8R A;  4NUT A;  3E20 B;  5C8Y A;  5IYZ B;  1RQ2 A;  2ZF8 A;  4O4J B;  3M84 A;  3RA5 A;  3S0W A;  1UI9 A;  4X3L A;  5IJ0 A;  1NJI H;  3HAX D;  1IV1 A;  2G9I A;  5HY0 A;  4X1K B;  1NQ3 A;  4O4L B;  1X7O A;  3HKB A;  5KX5 A;  2VAM A;  4X1Y A;  2CZW A;  5JQG A;  4F6R A;  4I4T B;  4FFB B;  3ZP7 A;  4BVT A;  3E22 A;  2GVI A;  2LCA A;  1IV4 A;  1JJ2 F;  4B46 A;  4O2B A;  1ZWZ A;  3VOB A;  3LWP C;  1YJW F;  4C8E A;  4TUY A;  3SIU A;  4U3J B;  1FFX A;  4BT3 A;  3VI6 A;  4YJ2 A;  3KJJ A;  1YQN A;  3UT5 B;  3D54 A;  4X1K A;  3CCL F;  3GTZ A;  5EB0 A;  4DRX B;  4BVQ A;  1Z5V A;  1IV2 A;  1S72 F;  5LA6 B;  1VQ5 F;  3FD5 A;  1VQL F;  2VXY A;  4X1I B;  4NWO B;  1YJN F;  4LCK A;  5EWR A;  5ITZ B;  4O4H B;  2HRY A;  2HX0 A;  5LOV B;  3HKC B;  1W5E A;  4O4I B;  2FC3 A;  3OON A;  4F6R B;  3WPX A;  3VIU A;  4EI9 A;  4TV8 B;  1YGY A;  3HKE A;  2CSL A;  5JVD B;  4X20 B;  3VTI C;  1KC8 H;  1W40 A;  3SIV A;  4IIJ A;  2Z01 A;  3JAW B;  3MQW A;  3IKF A;  3LWO C;  3QHD A;  1GZ0 A;  1W2B F;  4ZHW A;  4I50 A;  3CC2 F;  3HWU A;  3KE1 A;  2AIZ P;  3ELC A;  4B5C A;  4E6E A;  5HY4 A;  3CC7 F;  3V7E A;  2WAL A;  3OW2 F;  2L26 A; 
#chains in the Genus database with same CATH homology
 1T0A A;  1U3L A;  4C8E A;  2UZH A;  5B8F A;  4C81 A;  3K14 A;  1W57 A;  3K2X A;  1KNK A;  3IEW A;  3ERN A;  3Q8H A;  1YQN A;  1H48 A;  1VHA A;  1JY8 A;  1IV1 A;  4C82 A;  3JVH A;  4C8I A;  1U40 A;  3F0D A;  1KNJ A;  2PMP A;  3IKF A;  1IV3 A;  2AMT A;  3RE3 A;  1IV2 A;  1H47 A;  3F0E A;  3P0Z A;  3P10 A;  2GZL A;  3IKE A;  3QHD A;  3FPI A;  4C8G A;  1U3P A;  1VH8 A;  3F0G A;  3GHZ A;  1W55 A;  3ESJ A;  3EOR A;  3KE1 A;  3MBM A;  3T80 A;  3IEQ A;  3ELC A;  1IV4 A;  3F6M A;  1U43 A;  1JN1 A;  3B6N A;  1GX1 A;  3F0F A;  3FBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...