3O85A

Giardia lamblia 15.5kd rna binding protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
IDPRAIPFANEELSLELLNLVKHGASLQAIKRGANEALKQVNRGKAELVIIAADADPIEIVLHLPLACEDKGVPYVFIGSKNALGRACNVSVPTIVASIGKHDALGNVVAEIVGKVEALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords Ribosomal protein L7Ae
publication title Comparative analysis of the 15.5kD box C/D snoRNP core protein in the primitive eukaryote Giardia lamblia reveals unique structural and functional features.
pubmed doi rcsb
source organism Giardia lamblia
total genus 35
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3o85A00
3CPQA 1NMUB 3OBWA 3CPWF 2QA4F 1X7OA 2VGNA 3N4YA 3FFMA 1VQ9F 2KG4A 4LCKA 3NK6A 3PLAC 2QEXF 3CCMF 2CZWA 1K73H 4X3LA 4C4WC 3N4ZA 1GO0A 3VI6A 1YIJF 5IT9M 3PAFA 1Q81H 1QVFF 1IPAA 3LWQC 1N8RH 2OTLF 3GYQA 5A2QM 3I56F 1CN7A 5G4VC 4NUTA 1KD1H 1W42A 3E1YA 2WALA 5GANK 3LWOC 1KC8H 1K8AH 3HJWC 2JNBA 2KTVA 1VQMF 3CC4F 3CCUF 1CK2A 3CMAF 3CCEF 2VGMA 2OHWA 1Q86H 1VQLF 3CCSF 3V7QA 3OBYA 1GO1A 3OW2F 3NVKE 3I55F 1YJWF 2FC3A 3J7AR 2KTUA 3LWRC 3RA5A 1X52A 5EWRA 2HVYD 3LWVC 1XBIA 2ALEA 3G71F 5GIOC 1VQOF 5EO3A 3IR9A 1VQPF 4BY9D 1K9MH 3ON1A 1QVGF 3WXMB 1RA4A 2OTJF 1YJ9F 1H7MA 3CCJF 5FLXM 5FJ4C 1Q7YH 1M1KH 3V7EA 2I6DA 5GAPK 1NJIH 3JAMM 3NVIB 1JJ2F 3NMUC 4TZZA 3NK7A 1VQ6F 3SIVA 3RA6A 3G4SF 1YI2F 2QI2A 1W3EX 3MCAB 1T0KB 2LBXA 3CCQF 1M90H 4BW0B 5GIPC 3CXCF 1ZWZA 3CC7F 1S72F 3CMEF 2BO1A 1Q82H 4X3MA 3J80M 3J81M 1YHQF 1RLGA 1W41A 1VQ5F 3CCLF 3CCVF 3LWPC 3O85A 3CG6A 3CD6F 5DCVA 1YJNF 1SDSA 3CCRF 2OZBA 1VQ4F 1W40A 3SIUA 3G6EF 3CC2F 1GZ0A 3HAXD 3LFOA 5GINC 2LBWA 1VQ8F 1VQNF 1KQSF 1VQKF 1YITF 1E7KA 3E20B 1PXWA 2AIFA 3VMFB 1DT9A 1VQ7F 1X7PA 3AGKA 3JCMM 1W2BF 5G4UC
chains in the Genus database with same CATH superfamily
3CPQA 1XRGA 3RE3A 4ZI7B 3HKCA 2UYPA 1COMA 4R40B 4WBNB 2KG4A 2GLZA 4LCKA 1UI9A 5JH7B 1W55A 4ZK7A 5KMGA 1GO0A 1KNKA 3VI6A 3VOAA 2CHTA 3ESJA 3KJKA 2ZODA 2BTOA 4TV9B 2R6R1 4YJ3A 5HY2A 3VYSC 4XCQA 1FNKA 1KNJA 3C9UA 3TD4A 2HX0A 5HY1A 1KC8H 5AVMA 2JNBA 3CC4F 3ZOPA 4EB6B 1CK2A 3I3FA 2VGMA 3JARB 1VQLF 2HS3A 3OW2F 3VYTC 3WGMA 3LWRC 2AMTA 2K1SA 2LBTA 3RA5A 4FFBA 5EWRA 3S0YA 5FNVB 3G71F 5GIOC 2Z1UA 3JAWB 1NQ3A 4BY9D 2DT4A 2Q1XA 5J2TB 1H7MA 3CCJF 5FLXM 2UYJA 1M1KH 3HKEB 4F6RB 1Z5VA 3RYHA 5HP7A 4I50A 4G4WA 3JAMM 3S02A 2AIZP 2Z1TA 2ZAUA 2G9IA 3U0OA 4TZZA 1QAHA 3N2GA 3NK7A 4EI8A 1VQ6F 3SIVA 3MDOA 4BT7A 4O2AB 4X20A 2HP0B 2ZVZA 3G4SF 1IV4A 1GX1A 5IJ0A 2UYKA 4O2BA 4KWEA 3CXCF 1JN1A 1W5EA 3D01A 3OONA 3J80M 1JD1A 1JFFB 1YHQF 3L7QA 2Z1EA 3DDNA 3M1XA 3CCVF 3CG6A 4C81A 5DCVA 3N2KB 3JALB 3ZP7A 2OZBA 4EI7A 5JQGA 3CC2F 2CVLA 4IIJB 5BMVA 5GINC 1RQ2A 1VQ8F 5EB1B 3E22A 3QHDA 3DC2A 1KQSF 2H8CA 5C8YA 4PWTA 1YITF 5HY0A 1E7KA 3LYBA 3VMFB 2AIFA 2L26A 4C8EA 3AGKA 1W57A 2RB9A 1QU9A 5KX5A 4M8IA 1U3PA 2HS4A 2P6YA 2N48A 4TUYA 2CHSA 3C9RA 1YQNA 4G4XA 3OBWA 3CPWF 3T80A 3CYQA 3WJRA 2QA4F 1X7OA 1H48A 1XV2A 4U39A 5IYZA 3F6MA 5KMGB 3C9TA 4O4LA 3NK6A 2QEXF 1UFYA 2CZWA 4X3LA 3N4ZA 3K12A 3KJJA 2HP3A 2IQQA 3P0ZA 1YIJF 5IT9M 3JATA 1YGYA 3PAFA 4YJ3B 1Q81H 3LWQC 1N8RH 3F0GA 2OTLF 5A2QM 5CB4A 1CN7A 3IKEA 1KD1H 2GVIA 3P10A 3E1YA 5GANK 4O4JA 4HNAA 4ERHA 3QUWA 4U3JA 3GTZA 1VQMF 2R751 4NQ3A 4TV8B 3RYFA 3CCEF 2F9ZC 2CW4A 5HXZA 2OHWA 4B46A 3S0HA 1GO1A 1VK3A 5EZYB 3NVKE 1VQVA 1TUBA 3WGJA 2HS0A 2CSLA 5EB0A 1FNJA 5LP6A 4I50B 5EO3A 4B45A 3IR9A 4ZHVA 2I6RA 1Q7YH 2I6DA 1ODEA 4O4HA 5GAPK 3N2GB 3D00A 2ZVYA 4LNUA 5HWEA 4BVTA 1JJ2F 2DYYA 2HQSC 5HP8A 5EYPA 5IJ0B 4O2BB 2UYNA 5GONA 1W3EX 3WGKA 2LBXA 5LYJA 1M90H 3ELCA 5HXUA 1ZWZA 1SZQA 1S72F 2BO1A 3S06A 5CA1A 1OFUA 5CA0A 4YJ2A 5LA6A 3S03A 4NWOB 1RLGA 3CCLF 3LWPC 4G4ZA 5J2UA 5BMVB 4X1KB 1VQ4F 3E22B 1W40A 2B33A 3SIUA 4ZI7A 5C8YB 4I55A 3HAXD 5HY4A 4I4TB 4DRXA 2CWJA 2OTMA 2LCAA 2RHJA 1VQNF 2RHHA 5KX5B 1VQKF 3WPWA 3LMEA 3ZP4A 2Q1YA 4TUYB 1X7PA 3FBAA 3D54A 3HKBB 1H47A 2BTUA 1QD9A 4BT3A 4O4LB 4BT2A 1VH8A 4IHJA 2VGNA 3Q8HA 4E6EA 3ERNA 2RHLA 5MN6A 4ZOLA 3FFMA 1VQ9F 3CYPB 3R0PA 3PLAC 3JATB 3HTNA 3V3TA 3BYQA 4EB6A 3M4SA 5LXTA 3KHNA 5LP6C 4C4WC 4RHAA 5CB4B 4X1YA 1QVFF 4ZHQA 2YXZA 4O4JB 4HNAB 3JASA 4U3JB 3HKCB 5G4VC 3RYFB 3MCQA 2Z1FA 2WALA 3LWOC 1ONIA 1FSZA 1K8AH 5J2TA 3WGNA 1TUBB 3V7QA 3JAKA 2IAFA 2FC3A 3J7AR 2KTUA 4ZHYB 1TVKA 2ALEA 1VQOF 4O4HB 3HWUA 1W5FA 3MQWA 1VQPF 4LNUB 3ON1A 1QVGF 1RA4A 3TD5A 3WXMB 1YJ9F 2OTJF 2ZOVA 3KE1A 5FJ4C 4B62A 5EYPB 5JCOA 3KIZA 1FFXA 3RYIA 2UYNB 5GONB 2VXYA 3NMUC 1RQ7A 5LYJB 3VTIC 3JALA 4FFBB 1J7HA 2W8BC 5ITZA 2QI2A 1T0KB 3VO8A 1X25A 3CCQF 5CA1B 5CA0B 2FGYA 4YJ2B 4G88A 5LA6B 4BW0B 3RYCA 4O4IA 3IKFA 3RYHB 1Q82H 4X1IA 5J2UB 2IG8A 3J81M 3HKDA 1W41A 3C9SA 3O85A 3CD6F 1DBFA 1JY8A 2V9YA 4I55B 3S0WA 1SDSA 2PMPA 3UT5A 3K0TA 4DRXB 4X20B 3G6EF 1W59A 1GZ0A 2ZF8A 4BT5A 5JVDA 3LFOA 1W5AA 2QTPA 2LBWA 1Z5WA 2YYEA 2H6LA 3IEWA 5IJ9A 1U3LA 3VCZA 5MN4A 3K14A 3JVHA 3M84A 3V4DA 4C8IA 4IHJB 3JCMM 1SA0A 4BT6A 4G4VA 4B5CA 1W2BF 4BT4A 1W581 4ZOLB 5MN5A 1NMUB 5JQGB 2VAMA 3FD5A 5LOVA 3N4YA 3TD3A 5LXTB 1OAPA 4X1YB 3WJPA 3CCMF 1T0AA 1IV3A 1K73H 4ZHQB 4TV8A 2MQEA 2GZLA 3CB2A 4WBNA 1U40A 2BTQB 3JASB 3VOBA 1PF5A 2UZHA 5EZYA 5JH7A 1IPAA 3F0DA 5JCOC 3GYQA 3I56F 4G4YA 4NUTA 3VYUC 4BVQA 1W42A 2PHNA 4BVSA 5IYZB 4EI9A 4DXDA 3MBMA 3HJWC 4TV9A 3C8LA 3ZO8A 3JAKB 2KTVA 2Z01A 2HRUA 3CCUF 3IMPA 3F0FA 3CMAF 1U43A 3LDTA 1Q86H 3CCSF 3OBYA 3F0EA 1TVKB 3GHZA 3I55F 1YJWF 3WPXA 3FPIA 3JARA 1CLIA 1X52A 1R1MA 2HVYD 3LWVC 3I7TA 1XBIA 5B8FA 1FFXB 3RYIB 1K9MH 5FNVA 3WGLA 3V7EA 1NJIH 3JAWA 3NVIB 2KGWA 2RHOA 5ITZB 3HKEA 4F6RA 3VIUA 3RA6A 4X1KA 3RYCB 4O4IB 2VAWA 1YI2F 4ZHWA 3MCAB 5LP6B 4X1IB 4I4TA 3K2XA 3HKDB 4O2AA 5GIPC 2HP0A 5EIBC 3P4EA 1Q8RA 3CC7F 4C8GA 3CMEF 4X3MA 1VHAA 3IEQA 3UT5B 1VQ5F 2NMUA 1IV2A 1XHOA 3WJQA 4C82A 3FD6A 3HKBA 1YJNF 5EAZA 5JVDB 3CCRF 1JFFA 3QTYA 2H8EA 1RLUA 1W5BA 4RQOA 5IJ9B 3EORA 3N2KA 1IV1A 3B6NA 1SA0B 2EWCA 3E20B 1PXWA 1DT9A 4IIJA 4BVRA 1VQ7F 2HRYA 5LOVB 5G4UC 5EIBD 2VAPA
chains in the Genus database with same CATH topology
3CPQA 1NMUB 3OBWA 3CPWF 2QA4F 1X7OA 2VGNA 3N4YA 3FFMA 1VQ9F 2KG4A 2GLZA 4LCKA 3NK6A 3PLAC 2QEXF 3CCMF 2CZWA 1K73H 4X3LA 3V3TA 4C4WC 3N4ZA 1GO0A 3VI6A 1YIJF 5IT9M 3PAFA 1Q81H 1QVFF 1IPAA 3LWQC 1N8RH 2OTLF 3GYQA 5A2QM 3I56F 1CN7A 4BVSA 4NUTA 5HY2A 4BVQA 1W42A 5G4VC 4XCQA 1KD1H 3E1YA 4EI9A 2WALA 5GANK 5HY1A 3LWOC 1KC8H 1K8AH 3HJWC 2JNBA 2KTVA 1VQMF 3CC4F 3CCUF 4NQ3A 1CK2A 3CMAF 3CCEF 2F9ZC 2VGMA 5HXZA 2OHWA 1Q86H 1VQLF 3CCSF 3V7QA 3OBYA 1GO1A 3OW2F 3NVKE 3I55F 1YJWF 2FC3A 3J7AR 2KTUA 3LWRC 3RA5A 1X52A 5EWRA 2HVYD 3LWVC 1XBIA 2ALEA 3G71F 5GIOC 1VQOF 5EO3A 3IR9A 1VQPF 4BY9D 1K9MH 3ON1A 1QVGF 3WXMB 1RA4A 2OTJF 1YJ9F 1H7MA 3CCJF 5FLXM 5FJ4C 1Q7YH 1M1KH 3V7EA 2I6DA 5GAPK 1NJIH 3D00A 3JAMM 3NVIB 5HWEA 4BVTA 1JJ2F 3NMUC 4TZZA 3NK7A 4EI8A 1VQ6F 3RA6A 3SIVA 3G4SF 1YI2F 2QI2A 1W3EX 3MCAB 1T0KB 2LBXA 3CCQF 1M90H 2FGYA 4BW0B 5GIPC 3CXCF 5HXUA 1ZWZA 3CC7F 1S72F 3CMEF 2BO1A 1Q82H 4X3MA 3J80M 3J81M 1YHQF 1RLGA 1W41A 1VQ5F 3CCLF 3CCVF 3LWPC 3O85A 3CG6A 3CD6F 5DCVA 1YJNF 1SDSA 3CCRF 2OZBA 4EI7A 1VQ4F 1W40A 3SIUA 3G6EF 3CC2F 1GZ0A 3HAXD 3LFOA 5HY4A 5GINC 2LBWA 1VQ8F 1VQNF 1KQSF 1VQKF 1YITF 1E7KA 5HY0A 3E20B 1PXWA 2AIFA 3VMFB 1DT9A 4BVRA 1VQ7F 1X7PA 3AGKA 3JCMM 1W2BF 5G4UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPQ A;  1NMU B;  3OBW A;  3CPW F;  2QA4 F;  1X7O A;  2VGN A;  3N4Y A;  3FFM A;  1VQ9 F;  2KG4 A;  4LCK A;  3NK6 A;  3PLA C;  2QEX F;  3CCM F;  2CZW A;  1K73 H;  4X3L A;  4C4W C;  3N4Z A;  1GO0 A;  3VI6 A;  1YIJ F;  5IT9 M;  3PAF A;  1Q81 H;  1QVF F;  1IPA A;  3LWQ C;  1N8R H;  2OTL F;  3GYQ A;  5A2Q M;  3I56 F;  1CN7 A;  5G4V C;  4NUT A;  1KD1 H;  1W42 A;  3E1Y A;  2WAL A;  5GAN K;  3LWO C;  1KC8 H;  1K8A H;  3HJW C;  2JNB A;  2KTV A;  1VQM F;  3CC4 F;  3CCU F;  1CK2 A;  3CMA F;  3CCE F;  2VGM A;  2OHW A;  1Q86 H;  1VQL F;  3CCS F;  3V7Q A;  3OBY A;  1GO1 A;  3OW2 F;  3NVK E;  3I55 F;  1YJW F;  2FC3 A;  3J7A R;  2KTU A;  3LWR C;  3RA5 A;  1X52 A;  5EWR A;  2HVY D;  3LWV C;  1XBI A;  2ALE A;  3G71 F;  5GIO C;  1VQO F;  5EO3 A;  3IR9 A;  1VQP F;  4BY9 D;  1K9M H;  3ON1 A;  1QVG F;  3WXM B;  1RA4 A;  2OTJ F;  1YJ9 F;  1H7M A;  3CCJ F;  5FLX M;  5FJ4 C;  1Q7Y H;  1M1K H;  3V7E A;  2I6D A;  5GAP K;  1NJI H;  3JAM M;  3NVI B;  1JJ2 F;  3NMU C;  4TZZ A;  3NK7 A;  1VQ6 F;  3SIV A;  3RA6 A;  3G4S F;  1YI2 F;  2QI2 A;  1W3E X;  3MCA B;  1T0K B;  2LBX A;  3CCQ F;  1M90 H;  4BW0 B;  5GIP C;  3CXC F;  1ZWZ A;  3CC7 F;  1S72 F;  3CME F;  2BO1 A;  1Q82 H;  4X3M A;  3J80 M;  3J81 M;  1YHQ F;  1RLG A;  1W41 A;  1VQ5 F;  3CCL F;  3CCV F;  3LWP C;  3O85 A;  3CG6 A;  3CD6 F;  5DCV A;  1YJN F;  1SDS A;  3CCR F;  2OZB A;  1VQ4 F;  1W40 A;  3SIU A;  3G6E F;  3CC2 F;  1GZ0 A;  3HAX D;  3LFO A;  5GIN C;  2LBW A;  1VQ8 F;  1VQN F;  1KQS F;  1VQK F;  1YIT F;  1E7K A;  3E20 B;  1PXW A;  2AIF A;  3VMF B;  1DT9 A;  1VQ7 F;  1X7P A;  3AGK A;  3JCM M;  1W2B F;  5G4U C; 
#chains in the Genus database with same CATH topology
 3CPQ A;  1XRG A;  3RE3 A;  4ZI7 B;  3HKC A;  2UYP A;  1COM A;  4R40 B;  4WBN B;  2KG4 A;  2GLZ A;  4LCK A;  1UI9 A;  5JH7 B;  1W55 A;  4ZK7 A;  5KMG A;  1GO0 A;  1KNK A;  3VI6 A;  3VOA A;  2CHT A;  3ESJ A;  3KJK A;  2ZOD A;  2BTO A;  4TV9 B;  2R6R 1;  4YJ3 A;  5HY2 A;  3VYS C;  4XCQ A;  1FNK A;  1KNJ A;  3C9U A;  3TD4 A;  2HX0 A;  5HY1 A;  1KC8 H;  5AVM A;  2JNB A;  3CC4 F;  3ZOP A;  4EB6 B;  1CK2 A;  3I3F A;  2VGM A;  3JAR B;  1VQL F;  2HS3 A;  3OW2 F;  3VYT C;  3WGM A;  3LWR C;  2AMT A;  2K1S A;  2LBT A;  3RA5 A;  4FFB A;  5EWR A;  3S0Y A;  5FNV B;  3G71 F;  5GIO C;  2Z1U A;  3JAW B;  1NQ3 A;  4BY9 D;  2DT4 A;  2Q1X A;  5J2T B;  1H7M A;  3CCJ F;  5FLX M;  2UYJ A;  1M1K H;  3HKE B;  4F6R B;  1Z5V A;  3RYH A;  5HP7 A;  4I50 A;  4G4W A;  3JAM M;  3S02 A;  2AIZ P;  2Z1T A;  2ZAU A;  2G9I A;  3U0O A;  4TZZ A;  1QAH A;  3N2G A;  3NK7 A;  4EI8 A;  1VQ6 F;  3SIV A;  3MDO A;  4BT7 A;  4O2A B;  4X20 A;  2HP0 B;  2ZVZ A;  3G4S F;  1IV4 A;  1GX1 A;  5IJ0 A;  2UYK A;  4O2B A;  4KWE A;  3CXC F;  1JN1 A;  1W5E A;  3D01 A;  3OON A;  3J80 M;  1JD1 A;  1JFF B;  1YHQ F;  3L7Q A;  2Z1E A;  3DDN A;  3M1X A;  3CCV F;  3CG6 A;  4C81 A;  5DCV A;  3N2K B;  3JAL B;  3ZP7 A;  2OZB A;  4EI7 A;  5JQG A;  3CC2 F;  2CVL A;  4IIJ B;  5BMV A;  5GIN C;  1RQ2 A;  1VQ8 F;  5EB1 B;  3E22 A;  3QHD A;  3DC2 A;  1KQS F;  2H8C A;  5C8Y A;  4PWT A;  1YIT F;  5HY0 A;  1E7K A;  3LYB A;  3VMF B;  2AIF A;  2L26 A;  4C8E A;  3AGK A;  1W57 A;  2RB9 A;  1QU9 A;  5KX5 A;  4M8I A;  1U3P A;  2HS4 A;  2P6Y A;  2N48 A;  4TUY A;  2CHS A;  3C9R A;  1YQN A;  4G4X A;  3OBW A;  3CPW F;  3T80 A;  3CYQ A;  3WJR A;  2QA4 F;  1X7O A;  1H48 A;  1XV2 A;  4U39 A;  5IYZ A;  3F6M A;  5KMG B;  3C9T A;  4O4L A;  3NK6 A;  2QEX F;  1UFY A;  2CZW A;  4X3L A;  3N4Z A;  3K12 A;  3KJJ A;  2HP3 A;  2IQQ A;  3P0Z A;  1YIJ F;  5IT9 M;  3JAT A;  1YGY A;  3PAF A;  4YJ3 B;  1Q81 H;  3LWQ C;  1N8R H;  3F0G A;  2OTL F;  5A2Q M;  5CB4 A;  1CN7 A;  3IKE A;  1KD1 H;  2GVI A;  3P10 A;  3E1Y A;  5GAN K;  4O4J A;  4HNA A;  4ERH A;  3QUW A;  4U3J A;  3GTZ A;  1VQM F;  2R75 1;  4NQ3 A;  4TV8 B;  3RYF A;  3CCE F;  2F9Z C;  2CW4 A;  5HXZ A;  2OHW A;  4B46 A;  3S0H A;  1GO1 A;  1VK3 A;  5EZY B;  3NVK E;  1VQV A;  1TUB A;  3WGJ A;  2HS0 A;  2CSL A;  5EB0 A;  1FNJ A;  5LP6 A;  4I50 B;  5EO3 A;  4B45 A;  3IR9 A;  4ZHV A;  2I6R A;  1Q7Y H;  2I6D A;  1ODE A;  4O4H A;  5GAP K;  3N2G B;  3D00 A;  2ZVY A;  4LNU A;  5HWE A;  4BVT A;  1JJ2 F;  2DYY A;  2HQS C;  5HP8 A;  5EYP A;  5IJ0 B;  4O2B B;  2UYN A;  5GON A;  1W3E X;  3WGK A;  2LBX A;  5LYJ A;  1M90 H;  3ELC A;  5HXU A;  1ZWZ A;  1SZQ A;  1S72 F;  2BO1 A;  3S06 A;  5CA1 A;  1OFU A;  5CA0 A;  4YJ2 A;  5LA6 A;  3S03 A;  4NWO B;  1RLG A;  3CCL F;  3LWP C;  4G4Z A;  5J2U A;  5BMV B;  4X1K B;  1VQ4 F;  3E22 B;  1W40 A;  2B33 A;  3SIU A;  4ZI7 A;  5C8Y B;  4I55 A;  3HAX D;  5HY4 A;  4I4T B;  4DRX A;  2CWJ A;  2OTM A;  2LCA A;  2RHJ A;  1VQN F;  2RHH A;  5KX5 B;  1VQK F;  3WPW A;  3LME A;  3ZP4 A;  2Q1Y A;  4TUY B;  1X7P A;  3FBA A;  3D54 A;  3HKB B;  1H47 A;  2BTU A;  1QD9 A;  4BT3 A;  4O4L B;  4BT2 A;  1VH8 A;  4IHJ A;  2VGN A;  3Q8H A;  4E6E A;  3ERN A;  2RHL A;  5MN6 A;  4ZOL A;  3FFM A;  1VQ9 F;  3CYP B;  3R0P A;  3PLA C;  3JAT B;  3HTN A;  3V3T A;  3BYQ A;  4EB6 A;  3M4S A;  5LXT A;  3KHN A;  5LP6 C;  4C4W C;  4RHA A;  5CB4 B;  4X1Y A;  1QVF F;  4ZHQ A;  2YXZ A;  4O4J B;  4HNA B;  3JAS A;  4U3J B;  3HKC B;  5G4V C;  3RYF B;  3MCQ A;  2Z1F A;  2WAL A;  3LWO C;  1ONI A;  1FSZ A;  1K8A H;  5J2T A;  3WGN A;  1TUB B;  3V7Q A;  3JAK A;  2IAF A;  2FC3 A;  3J7A R;  2KTU A;  4ZHY B;  1TVK A;  2ALE A;  1VQO F;  4O4H B;  3HWU A;  1W5F A;  3MQW A;  1VQP F;  4LNU B;  3ON1 A;  1QVG F;  1RA4 A;  3TD5 A;  3WXM B;  1YJ9 F;  2OTJ F;  2ZOV A;  3KE1 A;  5FJ4 C;  4B62 A;  5EYP B;  5JCO A;  3KIZ A;  1FFX A;  3RYI A;  2UYN B;  5GON B;  2VXY A;  3NMU C;  1RQ7 A;  5LYJ B;  3VTI C;  3JAL A;  4FFB B;  1J7H A;  2W8B C;  5ITZ A;  2QI2 A;  1T0K B;  3VO8 A;  1X25 A;  3CCQ F;  5CA1 B;  5CA0 B;  2FGY A;  4YJ2 B;  4G88 A;  5LA6 B;  4BW0 B;  3RYC A;  4O4I A;  3IKF A;  3RYH B;  1Q82 H;  4X1I A;  5J2U B;  2IG8 A;  3J81 M;  3HKD A;  1W41 A;  3C9S A;  3O85 A;  3CD6 F;  1DBF A;  1JY8 A;  2V9Y A;  4I55 B;  3S0W A;  1SDS A;  2PMP A;  3UT5 A;  3K0T A;  4DRX B;  4X20 B;  3G6E F;  1W59 A;  1GZ0 A;  2ZF8 A;  4BT5 A;  5JVD A;  3LFO A;  1W5A A;  2QTP A;  2LBW A;  1Z5W A;  2YYE A;  2H6L A;  3IEW A;  5IJ9 A;  1U3L A;  3VCZ A;  5MN4 A;  3K14 A;  3JVH A;  3M84 A;  3V4D A;  4C8I A;  4IHJ B;  3JCM M;  1SA0 A;  4BT6 A;  4G4V A;  4B5C A;  1W2B F;  4BT4 A;  1W58 1;  4ZOL B;  5MN5 A;  1NMU B;  5JQG B;  2VAM A;  3FD5 A;  5LOV A;  3N4Y A;  3TD3 A;  5LXT B;  1OAP A;  4X1Y B;  3WJP A;  3CCM F;  1T0A A;  1IV3 A;  1K73 H;  4ZHQ B;  4TV8 A;  2MQE A;  2GZL A;  3CB2 A;  4WBN A;  1U40 A;  2BTQ B;  3JAS B;  3VOB A;  1PF5 A;  2UZH A;  5EZY A;  5JH7 A;  1IPA A;  3F0D A;  5JCO C;  3GYQ A;  3I56 F;  4G4Y A;  4NUT A;  3VYU C;  4BVQ A;  1W42 A;  2PHN A;  4BVS A;  5IYZ B;  4EI9 A;  4DXD A;  3MBM A;  3HJW C;  4TV9 A;  3C8L A;  3ZO8 A;  3JAK B;  2KTV A;  2Z01 A;  2HRU A;  3CCU F;  3IMP A;  3F0F A;  3CMA F;  1U43 A;  3LDT A;  1Q86 H;  3CCS F;  3OBY A;  3F0E A;  1TVK B;  3GHZ A;  3I55 F;  1YJW F;  3WPX A;  3FPI A;  3JAR A;  1CLI A;  1X52 A;  1R1M A;  2HVY D;  3LWV C;  3I7T A;  1XBI A;  5B8F A;  1FFX B;  3RYI B;  1K9M H;  5FNV A;  3WGL A;  3V7E A;  1NJI H;  3JAW A;  3NVI B;  2KGW A;  2RHO A;  5ITZ B;  3HKE A;  4F6R A;  3VIU A;  3RA6 A;  4X1K A;  3RYC B;  4O4I B;  2VAW A;  1YI2 F;  4ZHW A;  3MCA B;  5LP6 B;  4X1I B;  4I4T A;  3K2X A;  3HKD B;  4O2A A;  5GIP C;  2HP0 A;  5EIB C;  3P4E A;  1Q8R A;  3CC7 F;  4C8G A;  3CME F;  4X3M A;  1VHA A;  3IEQ A;  3UT5 B;  1VQ5 F;  2NMU A;  1IV2 A;  1XHO A;  3WJQ A;  4C82 A;  3FD6 A;  3HKB A;  1YJN F;  5EAZ A;  5JVD B;  3CCR F;  1JFF A;  3QTY A;  2H8E A;  1RLU A;  1W5B A;  4RQO A;  5IJ9 B;  3EOR A;  3N2K A;  1IV1 A;  3B6N A;  1SA0 B;  2EWC A;  3E20 B;  1PXW A;  1DT9 A;  4IIJ A;  4BVR A;  1VQ7 F;  2HRY A;  5LOV B;  5G4U C;  5EIB D;  2VAP A; 
#chains in the Genus database with same CATH homology
 3CPQ A;  1NMU B;  3OBW A;  3CPW F;  2QA4 F;  1X7O A;  2VGN A;  3N4Y A;  3FFM A;  1VQ9 F;  2KG4 A;  2GLZ A;  4LCK A;  3NK6 A;  3PLA C;  2QEX F;  3CCM F;  2CZW A;  1K73 H;  4X3L A;  3V3T A;  4C4W C;  3N4Z A;  1GO0 A;  3VI6 A;  1YIJ F;  5IT9 M;  3PAF A;  1Q81 H;  1QVF F;  1IPA A;  3LWQ C;  1N8R H;  2OTL F;  3GYQ A;  5A2Q M;  3I56 F;  1CN7 A;  4BVS A;  4NUT A;  5HY2 A;  4BVQ A;  1W42 A;  5G4V C;  4XCQ A;  1KD1 H;  3E1Y A;  4EI9 A;  2WAL A;  5GAN K;  5HY1 A;  3LWO C;  1KC8 H;  1K8A H;  3HJW C;  2JNB A;  2KTV A;  1VQM F;  3CC4 F;  3CCU F;  4NQ3 A;  1CK2 A;  3CMA F;  3CCE F;  2F9Z C;  2VGM A;  5HXZ A;  2OHW A;  1Q86 H;  1VQL F;  3CCS F;  3V7Q A;  3OBY A;  1GO1 A;  3OW2 F;  3NVK E;  3I55 F;  1YJW F;  2FC3 A;  3J7A R;  2KTU A;  3LWR C;  3RA5 A;  1X52 A;  5EWR A;  2HVY D;  3LWV C;  1XBI A;  2ALE A;  3G71 F;  5GIO C;  1VQO F;  5EO3 A;  3IR9 A;  1VQP F;  4BY9 D;  1K9M H;  3ON1 A;  1QVG F;  3WXM B;  1RA4 A;  2OTJ F;  1YJ9 F;  1H7M A;  3CCJ F;  5FLX M;  5FJ4 C;  1Q7Y H;  1M1K H;  3V7E A;  2I6D A;  5GAP K;  1NJI H;  3D00 A;  3JAM M;  3NVI B;  5HWE A;  4BVT A;  1JJ2 F;  3NMU C;  4TZZ A;  3NK7 A;  4EI8 A;  1VQ6 F;  3RA6 A;  3SIV A;  3G4S F;  1YI2 F;  2QI2 A;  1W3E X;  3MCA B;  1T0K B;  2LBX A;  3CCQ F;  1M90 H;  2FGY A;  4BW0 B;  5GIP C;  3CXC F;  5HXU A;  1ZWZ A;  3CC7 F;  1S72 F;  3CME F;  2BO1 A;  1Q82 H;  4X3M A;  3J80 M;  3J81 M;  1YHQ F;  1RLG A;  1W41 A;  1VQ5 F;  3CCL F;  3CCV F;  3LWP C;  3O85 A;  3CG6 A;  3CD6 F;  5DCV A;  1YJN F;  1SDS A;  3CCR F;  2OZB A;  4EI7 A;  1VQ4 F;  1W40 A;  3SIU A;  3G6E F;  3CC2 F;  1GZ0 A;  3HAX D;  3LFO A;  5HY4 A;  5GIN C;  2LBW A;  1VQ8 F;  1VQN F;  1KQS F;  1VQK F;  1YIT F;  1E7K A;  5HY0 A;  3E20 B;  1PXW A;  2AIF A;  3VMF B;  1DT9 A;  4BVR A;  1VQ7 F;  1X7P A;  3AGK A;  3JCM M;  1W2B F;  5G4U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...