3O85A

Giardia lamblia 15.5kd rna binding protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
IDPRAIPFANEELSLELLNLVKHGASLQAIKRGANEALKQVNRGKAELVIIAADADPIEIVLHLPLACEDKGVPYVFIGSKNALGRACNVSVPTIVASIGKHDALGNVVAEIVGKVEALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L7Ae
publication title Comparative analysis of the 15.5kD box C/D snoRNP core protein in the primitive eukaryote Giardia lamblia reveals unique structural and functional features.
pubmed doi rcsb
source organism Giardia lamblia
molecule tags Ribosomal protein
total genus 35
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3o85A00
3N4ZA 1H7MA 1X52A 1VQ9F 1DT9A 3LWOC 2AIFA 1M1KH 1W41A 1Q81H 5A2QM 1VQ7F 1GZ0A 3CC7F 2OZBA 1VQ5F 5FJ4C 3I55F 3CCLF 1X7OA 3CCVF 3LFOA 4TZZA 1YJNF 3NMUC 2ALEA 3CCSF 3NVKE 3SIVA 1W2BF 5FLXM 3CD6F 3CG6A 2QA4F 1K73H 3CMEF 3PLAC 4C4WC 3LWPC 5G4UC 2KTVA 1VQ4F 3O85A 3NK7A 3J7AR 2OTLF 2I6DA 4LCKA 3HJWC 1SDSA 3GYQA 3HAXD 4X3LA 1KD1H 3RA5A 1Q86H 5EO3A 5DCVA 3AGKA 4NUTA 3J81M 1YI2F 5IT9M 2KTUA 1W42A 3E1YA 3RA6A 2VGMA 3G4SF 1VQPF 3CCQF 1Q7YH 1E7KA 2WALA 2QEXF 1CK2A 5GINC 1KQSF 3J80M 1VQ6F 1Q82H 3LWRC 1K9MH 5GIPC 1NMUB 1VQ8F 1RA4A 2OTJF 1QVFF 1VQKF 3ON1A 1VQOF 1YJ9F 3N4YA 3I56F 3VI6A 2LBXA 2FC3A 1IPAA 4BY9D 3CC4F 3FFMA 4BW0B 3G71F 3CCEF 3JAMM 1YIJF 2LBWA 1JJ2F 1VQNF 3IR9A 3CXCF 3VMFB 3OBWA 2JNBA 3MCAB 3CMAF 2BO1A 5EWRA 1NJIH 1PXWA 2CZWA 3CCMF 1VQLF 1VQMF 2KG4A 1ZWZA 3CC2F 3V7EA 3OBYA 2OHWA 1RLGA 3LWVC 3E20B 3PAFA 3SIUA 3CCJF 3CCRF 1X7PA 1W40A 1N8RH 1YITF 3NVIB 3JCMM 3CPWF 1K8AH 1GO1A 4X3MA 3LWQC 1YJWF 5GIOC 1QVGF 1GO0A 5GANK 2QI2A 2HVYD 1CN7A 5G4VC 2VGNA 3CCUF 1S72F 5GAPK 3OW2F 1M90H 1T0KB 3CPQA 1W3EX 1KC8H 1YHQF 3G6EF 3WXMB 1XBIA 3V7QA 3NK6A
chains in the Genus database with same CATH superfamily
4LNUA 2ZODA 5IYZB 2EWCA 1M1KH 1W41A 1KNJA 1VQ7F 3N2KB 1TUBA 5HXUA 5LOVB 2HRUA 4G88A 5FJ4C 4X1KA 3QUWA 1X7OA 3F0GA 4TZZA 2Z1TA 3ZP4A 2ALEA 1IV2A 4G4WA 5FLXM 1Z5VA 3VOAA 5G4UC 4BT4A 1VQ4F 3O85A 3NK7A 4BT3A 3JAKA 3MQWA 2I6DA 1SDSA 2CVLA 5GONB 3RA5A 5EO3A 5DCVA 5HY0A 5CA1A 3HKEB 1W5AA 1W5BA 2GLZA 4IHJB 2KTUA 3KJKA 3D01A 3FD6A 4X20A 2VGMA 1VQPF 1Q7YH 2WALA 4DRXA 1JFFB 1W59A 4G4XA 5MN4A 1Q8RA 3RYCB 4U3JA 2IQQA 3TD3A 3VYSC 1Q82H 5JQGA 1NMUB 4WBNA 5LYJA 1RA4A 2HRYA 3L7QA 4I55B 4BT6A 3V3TA 1VQKF 1QVFF 4O2BB 3I56F 1QD9A 3VI6A 4B62A 4C8IA 2LBXA 4ZI7A 3CC4F 3JARA 3LYBA 3C9SA 3JAMM 1YIJF 3S06A 1VQNF 5LA6A 5CA0B 3CXCF 1JD1A 5EIBD 3S0WA 2ZOVA 3RYHB 4R40B 3LDTA 4IIJB 3CYPB 5EWRA 3VTIC 1YQNA 5EYPA 1JN1A 3E22A 4O4IB 5LP6B 3CC2F 3V7EA 3OBYA 4TUYA 1XRGA 1RLGA 4YJ2A 1VQVA 3E20B 1CLIA 1X7PA 4C81A 3N2GB 4TV9A 1FSZA 4C82A 1YITF 3OONA 3HKCA 4LNUB 1IV4A 1YJWF 1GX1A 5MN6A 2FGYA 3P0ZA 1OAPA 4PWTA 2HVYD 4ZHYB 1TUBB 3C8LA 5CB4A 4O4HA 5HY2A 4BT2A 3VOBA 4I4TA 3HKBA 1SA0A 4X1KB 2DYYA 3S0YA 2HS3A 3JASB 3WJRA 3S03A 3CPQA 4F6RA 3Q8HA 1YHQF 3G6EF 1XBIA 1X52A 5HXZA 1VQ9F 1FFXA 1U3PA 1UFYA 2RHOA 5EZYB 4ZHQA 1J7HA 5A2QM 1GZ0A 2CHSA 3M1XA 3JAKB 2UYNA 3WGKA 5B8FA 5CA1B 3LFOA 2B33A 3NMUC 5ITZA 1W2BF 3F0DA 2F9ZC 5C8YA 2ZF8A 3PLAC 3JAWA 2QTPA 2DT4A 4U3JB 2PHNA 3GYQA 3VYUC 3HAXD 2UYPA 4X1IA 1KD1H 1TVKA 1IV1A 4WBNB 4NUTA 5LYJB 5MN5A 3WJQA 5FNVA 3QTYA 5IT9M 5BMVA 1W55A 3JATA 4FFBA 4ZI7B 1U40A 2RHHA 3CCQF 4BVSA 3JARB 1COMA 1KQSF 2BTQB 1Z5WA 4B46A 3J80M 2YXZA 1VQ6F 5LA6B 3LWRC 3MCQA 2HS4A 3TD5A 2Q1XA 2OTJF 5KMGA 3D54A 3ON1A 4O4LA 3C9TA 3E22B 3N4YA 1VQOF 4O4JA 3VO8A 4YJ2B 1W57A 3WJPA 4DXDA 4YJ3A 3RYIA 5IJ0A 4TV9B 5JVDA 1JJ2F 3IR9A 3FBAA 3HKCB 3WGMA 2RB9A 4TV8A 2H8EA 2ZVZA 1VQLF 5JH7B 2BTOA 2KG4A 5HY4A 3K0TA 3TD4A 5CB4B 5IJ9B 2VAWA 2LBTA 5HWEA 1XHOA 4I4TB 3HKBB 1SA0B 4RHAA 1XV2A 3PAFA 3SIUA 3CCJF 1W40A 3ZP7A 1N8RH 3K14A 1VHAA 3NVIB 4I50B 3KIZA 3CPWF 1K8AH 1FFXB 4X3MA 4ZHQB 2R6R1 3UT5A 1QVGF 5EB0A 3WGNA 2UYNB 3CCUF 4KWEA 3WGJA 1S72F 1W581 3OW2F 2VAMA 1W3EX 2Z1UA 1KC8H 3T80A 3ZO8A 3N2KA 3V7QA 1QU9A 3N4ZA 1H7MA 2Z01A 4B45A 1DT9A 1Q81H 1QAHA 2Z1FA 5JCOC 5EAZA 2RHLA 4O2AB 1PF5A 5LXTA 4X1IB 3ERNA 1TVKB 3KHNA 3CCLF 3CCVF 2G9IA 3D00A 5FNVB 1YJNF 4HNAA 2N48A 3WGLA 3SIVA 1FNKA 3JATB 2Q1YA 3CD6F 2QA4F 2H6LA 4C8EA 4C4WC 4C8GA 3LWPC 1KNKA 4NQ3A 3HKEA 4G4VA 2BTUA 3JALA 3J7AR 1W5EA 4LCKA 3HJWC 3P10A 3VIUA 5J2TA 1NQ3A 1Q86H 5HP8A 2CSLA 3J81M 2HS0A 4ZHWA 1YI2F 1DBFA 1W42A 2PMPA 3E1YA 2V9YA 3RYCA 3RA6A 2IG8A 1RQ7A 2GZLA 4YJ3B 1E7KA 3MDOA 4G4YA 2QEXF 5GINC 5JVDB 2VXYA 4X20B 2HP0A 4EI8A 3FPIA 4NWOB 1VQ8F 4DRXB 2I6RA 2CW4A 1YJ9F 4X1YA 2GVIA 3RE3A 5JQGB 5CA0A 2AIZP 4EI7A 3IEWA 3FFMA 3RYHA 3C9RA 4IIJA 3FD5A 4EB6A 2H8CA 4U39A 2CWJA 3OBWA 2HP3A 2JNBA 3UT5B 2BO1A 3DDNA 1NJIH 5LP6C 1PXWA 2CZWA 3CCMF 1VQMF 2OHWA 5KX5A 3IMPA 3LWVC 3S0HA 3IEQA 1UI9A 4XCQA 5EYPB 1R1MA 2NMUA 2HQSC 3WPXA 2VAPA 2K1SA 4TUYB 4G4ZA 3JCMM 4BVTA 3U0OA 1YGYA 3LWQC 3R0PA 4ZOLA 5GIOC 3CB2A 3JASA 2QI2A 2KGWA 2VGNA 3K2XA 5LXTB 5EZYA 3IKFA 1W5FA 5GAPK 1M90H 1ONIA 2Z1EA 3HKDA 3KJJA 3WXMB 4O4HB 4HNAB 3NK6A 1RLUA 1U3LA 3KE1A 3LWOC 5J2UA 2AIFA 4B5CA 4ERHA 4F6RB 2W8BC 2LCAA 3JALB 3P4EA 3CC7F 2OZBA 3HWUA 3RYFA 1VQ5F 3K12A 4BVQA 2UZHA 5J2TB 1H47A 3I55F 3CYQA 1IV3A 4BT7A 3CCSF 3NVKE 2R751 2OTMA 5IYZA 3CG6A 3VYTC 1K73H 3CMEF 3EORA 2KTVA 2OTLF 5LOVA 5ITZB 2RHJA 3C9UA 5JCOA 2HP0B 4X3LA 5C8YB 5AVMA 3JAWB 1ODEA 3AGKA 3M84A 3S02A 4X1YB 3ZOPA 3F6MA 5EIBC 3G4SF 2CHTA 4RQOA 1CK2A 5BMVB 4EB6B 2UYKA 3QHDA 2L26A 4FFBB 1U43A 3GHZA 2HX0A 3BYQA 1K9MH 5GIPC 5GONA 4M8IA 4EI9A 2YYEA 2ZAUA 3V4DA 4IHJA 3B6NA 4ZK7A 3LMEA 5KX5B 2FC3A 1IPAA 4BY9D 1JY8A 3IKEA 4BW0B 5KMGB 3G71F 3CCEF 1JFFA 4O4LB 5JH7A 2LBWA 2ZVYA 4O4JB 5IJ9A 3F0EA 5HP7A 3GTZA 2UYJA 3ESJA 3VMFB 4ZHVA 3RYIB 1FNJA 1X25A 5IJ0B 1H48A 3MCAB 4ZOLB 3CMAF 1VH8A 4I55A 4O2BA 1ZWZA 1OFUA 1VK3A 4I50A 3JVHA 3F0FA 4TV8B 3I7TA 2MQEA 3ELCA 1RQ2A 3CCRF 2AMTA 3HKDB 3WPWA 1GO1A 5J2UB 4E6EA 5HY1A 4BVRA 3DC2A 3MBMA 1GO0A 2IAFA 5GANK 4BT5A 1CN7A 5G4VC 4O4IA 3M4SA 5LP6A 1SZQA 3RYFB 3I3FA 1T0KB 1T0AA 3N2GA 5EB1B 3VCZA 2P6YA 4O2AA 3HTNA
chains in the Genus database with same CATH topology
3N4ZA 1H7MA 1X52A 5HXZA 1VQ9F 1DT9A 3LWOC 2AIFA 1M1KH 1W41A 1Q81H 5A2QM 1VQ7F 1GZ0A 3CC7F 5HXUA 2OZBA 1VQ5F 4BVQA 5FJ4C 3I55F 3CCLF 1X7OA 3CCVF 3D00A 3LFOA 4TZZA 1YJNF 3NMUC 2ALEA 3CCSF 3NVKE 3SIVA 1W2BF 5FLXM 3CD6F 3CG6A 2QA4F 1K73H 3CMEF 2F9ZC 3PLAC 4C4WC 3LWPC 4NQ3A 5G4UC 2KTVA 1VQ4F 3O85A 3NK7A 3J7AR 2OTLF 2I6DA 4LCKA 3HJWC 1SDSA 3GYQA 3HAXD 4X3LA 1KD1H 3RA5A 1Q86H 5EO3A 5DCVA 3AGKA 4NUTA 3J81M 5HY0A 2GLZA 1YI2F 5IT9M 2KTUA 1W42A 3E1YA 3RA6A 2VGMA 3G4SF 1VQPF 3CCQF 1Q7YH 1E7KA 4BVSA 2WALA 2QEXF 1CK2A 5GINC 1KQSF 3J80M 1VQ6F 1Q82H 3LWRC 1K9MH 4EI8A 5GIPC 1NMUB 1VQ8F 1RA4A 2OTJF 4EI9A 1QVFF 3V3TA 1VQKF 3ON1A 1VQOF 1YJ9F 3N4YA 3I56F 3VI6A 2LBXA 2FC3A 1IPAA 4BY9D 4EI7A 3CC4F 3FFMA 4BW0B 3G71F 3CCEF 3JAMM 1YIJF 2LBWA 1JJ2F 1VQNF 3IR9A 3CXCF 3VMFB 3OBWA 2JNBA 3MCAB 3CMAF 2BO1A 5EWRA 1NJIH 1PXWA 2CZWA 3CCMF 1VQLF 1VQMF 2KG4A 1ZWZA 5HY4A 3CC2F 3V7EA 3OBYA 2OHWA 5HWEA 1RLGA 3LWVC 3E20B 4XCQA 3PAFA 3SIUA 3CCJF 3CCRF 1X7PA 1W40A 1N8RH 1YITF 3NVIB 4BVTA 3JCMM 3CPWF 1K8AH 1GO1A 4X3MA 3LWQC 1YJWF 5HY1A 4BVRA 5GIOC 1QVGF 1GO0A 2FGYA 5GANK 2QI2A 2HVYD 1CN7A 5G4VC 2VGNA 5HY2A 3CCUF 1S72F 5GAPK 3OW2F 1M90H 1T0KB 3CPQA 1W3EX 1KC8H 1YHQF 3G6EF 3WXMB 1XBIA 3V7QA 3NK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Z A;  1H7M A;  1X52 A;  1VQ9 F;  1DT9 A;  3LWO C;  2AIF A;  1M1K H;  1W41 A;  1Q81 H;  5A2Q M;  1VQ7 F;  1GZ0 A;  3CC7 F;  2OZB A;  1VQ5 F;  5FJ4 C;  3I55 F;  3CCL F;  1X7O A;  3CCV F;  3LFO A;  4TZZ A;  1YJN F;  3NMU C;  2ALE A;  3CCS F;  3NVK E;  3SIV A;  1W2B F;  5FLX M;  3CD6 F;  3CG6 A;  2QA4 F;  1K73 H;  3CME F;  3PLA C;  4C4W C;  3LWP C;  5G4U C;  2KTV A;  1VQ4 F;  3O85 A;  3NK7 A;  3J7A R;  2OTL F;  2I6D A;  4LCK A;  3HJW C;  1SDS A;  3GYQ A;  3HAX D;  4X3L A;  1KD1 H;  3RA5 A;  1Q86 H;  5EO3 A;  5DCV A;  3AGK A;  4NUT A;  3J81 M;  1YI2 F;  5IT9 M;  2KTU A;  1W42 A;  3E1Y A;  3RA6 A;  2VGM A;  3G4S F;  1VQP F;  3CCQ F;  1Q7Y H;  1E7K A;  2WAL A;  2QEX F;  1CK2 A;  5GIN C;  1KQS F;  3J80 M;  1VQ6 F;  1Q82 H;  3LWR C;  1K9M H;  5GIP C;  1NMU B;  1VQ8 F;  1RA4 A;  2OTJ F;  1QVF F;  1VQK F;  3ON1 A;  1VQO F;  1YJ9 F;  3N4Y A;  3I56 F;  3VI6 A;  2LBX A;  2FC3 A;  1IPA A;  4BY9 D;  3CC4 F;  3FFM A;  4BW0 B;  3G71 F;  3CCE F;  3JAM M;  1YIJ F;  2LBW A;  1JJ2 F;  1VQN F;  3IR9 A;  3CXC F;  3VMF B;  3OBW A;  2JNB A;  3MCA B;  3CMA F;  2BO1 A;  5EWR A;  1NJI H;  1PXW A;  2CZW A;  3CCM F;  1VQL F;  1VQM F;  2KG4 A;  1ZWZ A;  3CC2 F;  3V7E A;  3OBY A;  2OHW A;  1RLG A;  3LWV C;  3E20 B;  3PAF A;  3SIU A;  3CCJ F;  3CCR F;  1X7P A;  1W40 A;  1N8R H;  1YIT F;  3NVI B;  3JCM M;  3CPW F;  1K8A H;  1GO1 A;  4X3M A;  3LWQ C;  1YJW F;  5GIO C;  1QVG F;  1GO0 A;  5GAN K;  2QI2 A;  2HVY D;  1CN7 A;  5G4V C;  2VGN A;  3CCU F;  1S72 F;  5GAP K;  3OW2 F;  1M90 H;  1T0K B;  3CPQ A;  1W3E X;  1KC8 H;  1YHQ F;  3G6E F;  3WXM B;  1XBI A;  3V7Q A;  3NK6 A; 
#chains in the Genus database with same CATH topology
 4LNU A;  2ZOD A;  5IYZ B;  2EWC A;  1M1K H;  1W41 A;  1KNJ A;  1VQ7 F;  3N2K B;  1TUB A;  5HXU A;  5LOV B;  2HRU A;  4G88 A;  5FJ4 C;  4X1K A;  3QUW A;  1X7O A;  3F0G A;  4TZZ A;  2Z1T A;  3ZP4 A;  2ALE A;  1IV2 A;  4G4W A;  5FLX M;  1Z5V A;  3VOA A;  5G4U C;  4BT4 A;  1VQ4 F;  3O85 A;  3NK7 A;  4BT3 A;  3JAK A;  3MQW A;  2I6D A;  1SDS A;  2CVL A;  5GON B;  3RA5 A;  5EO3 A;  5DCV A;  5HY0 A;  5CA1 A;  3HKE B;  1W5A A;  1W5B A;  2GLZ A;  4IHJ B;  2KTU A;  3KJK A;  3D01 A;  3FD6 A;  4X20 A;  2VGM A;  1VQP F;  1Q7Y H;  2WAL A;  4DRX A;  1JFF B;  1W59 A;  4G4X A;  5MN4 A;  1Q8R A;  3RYC B;  4U3J A;  2IQQ A;  3TD3 A;  3VYS C;  1Q82 H;  5JQG A;  1NMU B;  4WBN A;  5LYJ A;  1RA4 A;  2HRY A;  3L7Q A;  4I55 B;  4BT6 A;  3V3T A;  1VQK F;  1QVF F;  4O2B B;  3I56 F;  1QD9 A;  3VI6 A;  4B62 A;  4C8I A;  2LBX A;  4ZI7 A;  3CC4 F;  3JAR A;  3LYB A;  3C9S A;  3JAM M;  1YIJ F;  3S06 A;  1VQN F;  5LA6 A;  5CA0 B;  3CXC F;  1JD1 A;  5EIB D;  3S0W A;  2ZOV A;  3RYH B;  4R40 B;  3LDT A;  4IIJ B;  3CYP B;  5EWR A;  3VTI C;  1YQN A;  5EYP A;  1JN1 A;  3E22 A;  4O4I B;  5LP6 B;  3CC2 F;  3V7E A;  3OBY A;  4TUY A;  1XRG A;  1RLG A;  4YJ2 A;  1VQV A;  3E20 B;  1CLI A;  1X7P A;  4C81 A;  3N2G B;  4TV9 A;  1FSZ A;  4C82 A;  1YIT F;  3OON A;  3HKC A;  4LNU B;  1IV4 A;  1YJW F;  1GX1 A;  5MN6 A;  2FGY A;  3P0Z A;  1OAP A;  4PWT A;  2HVY D;  4ZHY B;  1TUB B;  3C8L A;  5CB4 A;  4O4H A;  5HY2 A;  4BT2 A;  3VOB A;  4I4T A;  3HKB A;  1SA0 A;  4X1K B;  2DYY A;  3S0Y A;  2HS3 A;  3JAS B;  3WJR A;  3S03 A;  3CPQ A;  4F6R A;  3Q8H A;  1YHQ F;  3G6E F;  1XBI A;  1X52 A;  5HXZ A;  1VQ9 F;  1FFX A;  1U3P A;  1UFY A;  2RHO A;  5EZY B;  4ZHQ A;  1J7H A;  5A2Q M;  1GZ0 A;  2CHS A;  3M1X A;  3JAK B;  2UYN A;  3WGK A;  5B8F A;  5CA1 B;  3LFO A;  2B33 A;  3NMU C;  5ITZ A;  1W2B F;  3F0D A;  2F9Z C;  5C8Y A;  2ZF8 A;  3PLA C;  3JAW A;  2QTP A;  2DT4 A;  4U3J B;  2PHN A;  3GYQ A;  3VYU C;  3HAX D;  2UYP A;  4X1I A;  1KD1 H;  1TVK A;  1IV1 A;  4WBN B;  4NUT A;  5LYJ B;  5MN5 A;  3WJQ A;  5FNV A;  3QTY A;  5IT9 M;  5BMV A;  1W55 A;  3JAT A;  4FFB A;  4ZI7 B;  1U40 A;  2RHH A;  3CCQ F;  4BVS A;  3JAR B;  1COM A;  1KQS F;  2BTQ B;  1Z5W A;  4B46 A;  3J80 M;  2YXZ A;  1VQ6 F;  5LA6 B;  3LWR C;  3MCQ A;  2HS4 A;  3TD5 A;  2Q1X A;  2OTJ F;  5KMG A;  3D54 A;  3ON1 A;  4O4L A;  3C9T A;  3E22 B;  3N4Y A;  1VQO F;  4O4J A;  3VO8 A;  4YJ2 B;  1W57 A;  3WJP A;  4DXD A;  4YJ3 A;  3RYI A;  5IJ0 A;  4TV9 B;  5JVD A;  1JJ2 F;  3IR9 A;  3FBA A;  3HKC B;  3WGM A;  2RB9 A;  4TV8 A;  2H8E A;  2ZVZ A;  1VQL F;  5JH7 B;  2BTO A;  2KG4 A;  5HY4 A;  3K0T A;  3TD4 A;  5CB4 B;  5IJ9 B;  2VAW A;  2LBT A;  5HWE A;  1XHO A;  4I4T B;  3HKB B;  1SA0 B;  4RHA A;  1XV2 A;  3PAF A;  3SIU A;  3CCJ F;  1W40 A;  3ZP7 A;  1N8R H;  3K14 A;  1VHA A;  3NVI B;  4I50 B;  3KIZ A;  3CPW F;  1K8A H;  1FFX B;  4X3M A;  4ZHQ B;  2R6R 1;  3UT5 A;  1QVG F;  5EB0 A;  3WGN A;  2UYN B;  3CCU F;  4KWE A;  3WGJ A;  1S72 F;  1W58 1;  3OW2 F;  2VAM A;  1W3E X;  2Z1U A;  1KC8 H;  3T80 A;  3ZO8 A;  3N2K A;  3V7Q A;  1QU9 A;  3N4Z A;  1H7M A;  2Z01 A;  4B45 A;  1DT9 A;  1Q81 H;  1QAH A;  2Z1F A;  5JCO C;  5EAZ A;  2RHL A;  4O2A B;  1PF5 A;  5LXT A;  4X1I B;  3ERN A;  1TVK B;  3KHN A;  3CCL F;  3CCV F;  2G9I A;  3D00 A;  5FNV B;  1YJN F;  4HNA A;  2N48 A;  3WGL A;  3SIV A;  1FNK A;  3JAT B;  2Q1Y A;  3CD6 F;  2QA4 F;  2H6L A;  4C8E A;  4C4W C;  4C8G A;  3LWP C;  1KNK A;  4NQ3 A;  3HKE A;  4G4V A;  2BTU A;  3JAL A;  3J7A R;  1W5E A;  4LCK A;  3HJW C;  3P10 A;  3VIU A;  5J2T A;  1NQ3 A;  1Q86 H;  5HP8 A;  2CSL A;  3J81 M;  2HS0 A;  4ZHW A;  1YI2 F;  1DBF A;  1W42 A;  2PMP A;  3E1Y A;  2V9Y A;  3RYC A;  3RA6 A;  2IG8 A;  1RQ7 A;  2GZL A;  4YJ3 B;  1E7K A;  3MDO A;  4G4Y A;  2QEX F;  5GIN C;  5JVD B;  2VXY A;  4X20 B;  2HP0 A;  4EI8 A;  3FPI A;  4NWO B;  1VQ8 F;  4DRX B;  2I6R A;  2CW4 A;  1YJ9 F;  4X1Y A;  2GVI A;  3RE3 A;  5JQG B;  5CA0 A;  2AIZ P;  4EI7 A;  3IEW A;  3FFM A;  3RYH A;  3C9R A;  4IIJ A;  3FD5 A;  4EB6 A;  2H8C A;  4U39 A;  2CWJ A;  3OBW A;  2HP3 A;  2JNB A;  3UT5 B;  2BO1 A;  3DDN A;  1NJI H;  5LP6 C;  1PXW A;  2CZW A;  3CCM F;  1VQM F;  2OHW A;  5KX5 A;  3IMP A;  3LWV C;  3S0H A;  3IEQ A;  1UI9 A;  4XCQ A;  5EYP B;  1R1M A;  2NMU A;  2HQS C;  3WPX A;  2VAP A;  2K1S A;  4TUY B;  4G4Z A;  3JCM M;  4BVT A;  3U0O A;  1YGY A;  3LWQ C;  3R0P A;  4ZOL A;  5GIO C;  3CB2 A;  3JAS A;  2QI2 A;  2KGW A;  2VGN A;  3K2X A;  5LXT B;  5EZY A;  3IKF A;  1W5F A;  5GAP K;  1M90 H;  1ONI A;  2Z1E A;  3HKD A;  3KJJ A;  3WXM B;  4O4H B;  4HNA B;  3NK6 A;  1RLU A;  1U3L A;  3KE1 A;  3LWO C;  5J2U A;  2AIF A;  4B5C A;  4ERH A;  4F6R B;  2W8B C;  2LCA A;  3JAL B;  3P4E A;  3CC7 F;  2OZB A;  3HWU A;  3RYF A;  1VQ5 F;  3K12 A;  4BVQ A;  2UZH A;  5J2T B;  1H47 A;  3I55 F;  3CYQ A;  1IV3 A;  4BT7 A;  3CCS F;  3NVK E;  2R75 1;  2OTM A;  5IYZ A;  3CG6 A;  3VYT C;  1K73 H;  3CME F;  3EOR A;  2KTV A;  2OTL F;  5LOV A;  5ITZ B;  2RHJ A;  3C9U A;  5JCO A;  2HP0 B;  4X3L A;  5C8Y B;  5AVM A;  3JAW B;  1ODE A;  3AGK A;  3M84 A;  3S02 A;  4X1Y B;  3ZOP A;  3F6M A;  5EIB C;  3G4S F;  2CHT A;  4RQO A;  1CK2 A;  5BMV B;  4EB6 B;  2UYK A;  3QHD A;  2L26 A;  4FFB B;  1U43 A;  3GHZ A;  2HX0 A;  3BYQ A;  1K9M H;  5GIP C;  5GON A;  4M8I A;  4EI9 A;  2YYE A;  2ZAU A;  3V4D A;  4IHJ A;  3B6N A;  4ZK7 A;  3LME A;  5KX5 B;  2FC3 A;  1IPA A;  4BY9 D;  1JY8 A;  3IKE A;  4BW0 B;  5KMG B;  3G71 F;  3CCE F;  1JFF A;  4O4L B;  5JH7 A;  2LBW A;  2ZVY A;  4O4J B;  5IJ9 A;  3F0E A;  5HP7 A;  3GTZ A;  2UYJ A;  3ESJ A;  3VMF B;  4ZHV A;  3RYI B;  1FNJ A;  1X25 A;  5IJ0 B;  1H48 A;  3MCA B;  4ZOL B;  3CMA F;  1VH8 A;  4I55 A;  4O2B A;  1ZWZ A;  1OFU A;  1VK3 A;  4I50 A;  3JVH A;  3F0F A;  4TV8 B;  3I7T A;  2MQE A;  3ELC A;  1RQ2 A;  3CCR F;  2AMT A;  3HKD B;  3WPW A;  1GO1 A;  5J2U B;  4E6E A;  5HY1 A;  4BVR A;  3DC2 A;  3MBM A;  1GO0 A;  2IAF A;  5GAN K;  4BT5 A;  1CN7 A;  5G4V C;  4O4I A;  3M4S A;  5LP6 A;  1SZQ A;  3RYF B;  3I3F A;  1T0K B;  1T0A A;  3N2G A;  5EB1 B;  3VCZ A;  2P6Y A;  4O2A A;  3HTN A; 
#chains in the Genus database with same CATH homology
 3N4Z A;  1H7M A;  1X52 A;  5HXZ A;  1VQ9 F;  1DT9 A;  3LWO C;  2AIF A;  1M1K H;  1W41 A;  1Q81 H;  5A2Q M;  1VQ7 F;  1GZ0 A;  3CC7 F;  5HXU A;  2OZB A;  1VQ5 F;  4BVQ A;  5FJ4 C;  3I55 F;  3CCL F;  1X7O A;  3CCV F;  3D00 A;  3LFO A;  4TZZ A;  1YJN F;  3NMU C;  2ALE A;  3CCS F;  3NVK E;  3SIV A;  1W2B F;  5FLX M;  3CD6 F;  3CG6 A;  2QA4 F;  1K73 H;  3CME F;  2F9Z C;  3PLA C;  4C4W C;  3LWP C;  4NQ3 A;  5G4U C;  2KTV A;  1VQ4 F;  3O85 A;  3NK7 A;  3J7A R;  2OTL F;  2I6D A;  4LCK A;  3HJW C;  1SDS A;  3GYQ A;  3HAX D;  4X3L A;  1KD1 H;  3RA5 A;  1Q86 H;  5EO3 A;  5DCV A;  3AGK A;  4NUT A;  3J81 M;  5HY0 A;  2GLZ A;  1YI2 F;  5IT9 M;  2KTU A;  1W42 A;  3E1Y A;  3RA6 A;  2VGM A;  3G4S F;  1VQP F;  3CCQ F;  1Q7Y H;  1E7K A;  4BVS A;  2WAL A;  2QEX F;  1CK2 A;  5GIN C;  1KQS F;  3J80 M;  1VQ6 F;  1Q82 H;  3LWR C;  1K9M H;  4EI8 A;  5GIP C;  1NMU B;  1VQ8 F;  1RA4 A;  2OTJ F;  4EI9 A;  1QVF F;  3V3T A;  1VQK F;  3ON1 A;  1VQO F;  1YJ9 F;  3N4Y A;  3I56 F;  3VI6 A;  2LBX A;  2FC3 A;  1IPA A;  4BY9 D;  4EI7 A;  3CC4 F;  3FFM A;  4BW0 B;  3G71 F;  3CCE F;  3JAM M;  1YIJ F;  2LBW A;  1JJ2 F;  1VQN F;  3IR9 A;  3CXC F;  3VMF B;  3OBW A;  2JNB A;  3MCA B;  3CMA F;  2BO1 A;  5EWR A;  1NJI H;  1PXW A;  2CZW A;  3CCM F;  1VQL F;  1VQM F;  2KG4 A;  1ZWZ A;  5HY4 A;  3CC2 F;  3V7E A;  3OBY A;  2OHW A;  5HWE A;  1RLG A;  3LWV C;  3E20 B;  4XCQ A;  3PAF A;  3SIU A;  3CCJ F;  3CCR F;  1X7P A;  1W40 A;  1N8R H;  1YIT F;  3NVI B;  4BVT A;  3JCM M;  3CPW F;  1K8A H;  1GO1 A;  4X3M A;  3LWQ C;  1YJW F;  5HY1 A;  4BVR A;  5GIO C;  1QVG F;  1GO0 A;  2FGY A;  5GAN K;  2QI2 A;  2HVY D;  1CN7 A;  5G4V C;  2VGN A;  5HY2 A;  3CCU F;  1S72 F;  5GAP K;  3OW2 F;  1M90 H;  1T0K B;  3CPQ A;  1W3E X;  1KC8 H;  1YHQ F;  3G6E F;  3WXM B;  1XBI A;  3V7Q A;  3NK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...