3O85A

Giardia lamblia 15.5kd rna binding protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
IDPRAIPFANEELSLELLNLVKHGASLQAIKRGANEALKQVNRGKAELVIIAADADPIEIVLHLPLACEDKGVPYVFIGSKNALGRACNVSVPTIVASIGKHDALGNVVAEIVGKVEALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L7Ae
publication title Comparative analysis of the 15.5kD box C/D snoRNP core protein in the primitive eukaryote Giardia lamblia reveals unique structural and functional features.
pubmed doi rcsb
source organism Giardia lamblia
molecule tags Ribosomal protein
total genus 35
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3o85A00
3CC7F 3CCJF 1YITF 3NVKE 3LWRC 3IR9A 1VQKF 3OBWA 3OW2F 3CMEF 2OTLF 3JCMM 1VQNF 5GAPK 3CCSF 1RLGA 3AGKA 2LBXA 2OTJF 1H7MA 4TZZA 3G4SF 1DT9A 3CCVF 3CPQA 1W41A 1VQ7F 3SIVA 3LWQC 5G4UC 1X7PA 5GANK 1YJWF 3HJWC 5DCVA 1JJ2F 1K73H 3RA6A 2KTVA 5EWRA 1K9MH 1VQ4F 5IT9M 4X3MA 1Q81H 5GINC 1W42A 3I55F 3LFOA 3CCRF 3LWOC 1ZWZA 2QEXF 3WXMB 1CK2A 1K8AH 1CN7A 1KC8H 2KTUA 1Q82H 1N8RH 3O85A 4NUTA 5FLXM 3CG6A 3VI6A 3J81M 3VMFB 5G4VC 4BY9D 2AIFA 3MCAB 3V7EA 3ON1A 1GZ0A 2CZWA 3LWPC 1VQ8F 1W3EX 2KG4A 1XBIA 3J80M 3CPWF 1M1KH 1NJIH 5GIPC 3CD6F 1X7OA 4LCKA 3CCQF 3OBYA 1VQ5F 2QA4F 3G71F 3CMAF 1KD1H 2I6DA 3CXCF 3CCLF 3NMUC 1Q7YH 1KQSF 3LWVC 5A2QM 2JNBA 3CCUF 3SIUA 1S72F 1YIJF 1W2BF 3PAFA 2QI2A 1T0KB 1YI2F 1YHQF 3J7AR 4C4WC 1VQPF 3JAMM 3N4YA 3G6EF 2WALA 1PXWA 2FC3A 3PLAC 3I56F 3CCMF 1VQLF 1W40A 1VQOF 1VQMF 1X52A 3RA5A 2VGMA 1GO1A 5EO3A 3FFMA 3CC4F 1SDSA 1VQ9F 2OHWA 5GIOC 1GO0A 1IPAA 1Q86H 1YJNF 1M90H 2HVYD 2BO1A 2VGNA 4X3LA 3NK6A 3NVIB 1E7KA 5FJ4C 3N4ZA 3CC2F 2LBWA 1QVFF 3CCEF 2OZBA 1QVGF 4BW0B 3GYQA 3NK7A 1YJ9F 2ALEA 3HAXD 1RA4A 1VQ6F 3E1YA 3V7QA 3E20B 1NMUB
chains in the Genus database with same CATH superfamily
3CCJF 1TUBA 1FFXA 3N2GA 1FSZA 3C8LA 3OW2F 3CMEF 5KX5B 3K2XA 4I50A 3I3FA 5GAPK 5LP6A 3HWUA 5HY1A 2OTJF 4EB6B 3RYFA 2I6RA 1H47A 5AVMA 5CA0A 3VCZA 4I4TB 4O4JB 5G4UC 3QUWA 4M8IA 3JVHA 5LYJB 2GLZA 4ZI7B 3RA6A 3KHNA 5EWRA 5LP6C 3WJRA 1SA0A 3P10A 2RHJA 5JVDB 4E6EA 3UT5B 1W42A 5CB4A 3MQWA 1CN7A 5GONA 3F0GA 4I55A 5BMVB 1JN1A 1W5EA 4B62A 5FLXM 2F9ZC 4BVRA 3P4EA 4O2AA 4PWTA 4DRXB 2PHNA 4O4LB 1VQ8F 2HS4A 2KG4A 1W55A 2CW4A 3IEWA 3JATB 4FFBB 1X7OA 1OFUA 4O2BB 5HY4A 3GHZA 4BT2A 2ZODA 3OBYA 4O4HB 3G71F 3M4SA 1KD1H 1CLIA 3FPIA 3LMEA 3WJQA 2GZLA 1COMA 3N2KB 5MN6A 5LYJA 1IV4A 4BT5A 4ZI7A 1S72F 2AIZP 3LDTA 1T0KB 1R1MA 2Z1TA 3ELCA 1KNKA 4G4XA 5LA6B 5JVDA 5MN4A 1VQVA 3J7AR 3S03A 2IQQA 1RLUA 1PXWA 2LBTA 5ITZA 3WGKA 4C8EA 1VQLF 2CWJA 3KIZA 2HS3A 2UZHA 1X52A 1J7HA 5LXTB 3RA5A 2VGMA 4TV9A 4X1IB 3ZP4A 2ZVYA 3FFMA 4TV8B 1T0AA 2OHWA 1M90H 2HVYD 1W57A 2VGNA 5B8FA 4ZK7A 5J2TB 3TD3A 4RHAA 4O2BA 2ZF8A 5JH7B 3F0EA 2RHLA 3NK7A 5HWEA 2L26A 4O4HA 2ALEA 5HP7A 3LYBA 3F0DA 4TUYA 3E1YA 3V7QA 3NVIB 5EYPB 3VYUC 1TVKB 5HXUA 1YITF 3NVKE 3CYPB 3OBWA 4X1YA 3RYIB 4X20A 5JQGB 1VQNF 5HY2A 1YGYA 4IIJB 2B33A 1RLGA 3AGKA 2LBXA 4NWOB 5EZYA 3VYSC 5EB0A 3G4SF 3S02A 3K12A 3SIVA 3JAKB 3VO8A 2HP0A 4EI8A 1X7PA 3RE3A 5EB1B 5DCVA 3HJWC 2GVIA 3HKEB 5LOVB 2KTVA 4ZOLB 3ZP7A 5CA1A 3C9TA 4WBNA 1JD1A 1U3LA 4F6RB 2N48A 4TV8A 4U3JB 3HKCA 3I55F 3KJJA 3HKDB 2QEXF 4ERHA 3IKFA 1K8AH 1DBFA 4O4IB 2KTUA 3D00A 5C8YA 1XHOA 1XRGA 1RQ2A 3VI6A 2V9YA 3DDNA 5G4VC 4BT6A 1NQ3A 2VAMA 2HP3A 3LWPC 5EYPA 2VAPA 5IJ9B 1TVKA 2UYKA 3QHDA 4LNUB 2VAWA 1OAPA 5HP8A 3VOBA 2CVLA 4ZHYB 5JQGA 5KMGB 2OTMA 4LCKA 3C9UA 3CMAF 3OONA 4YJ2B 4B45A 4HNAA 1W5AA 2DT4A 3ESJA 4G88A 2G9IA 3PAFA 3FBAA 2QI2A 1YI2F 2Q1YA 1YHQF 4C4WC 1VQPF 3IMPA 1W581 2RHHA 1IV2A 2MQEA 2FC3A 3L7QA 2Q1XA 4DXDA 2R6R1 5KX5A 3JALB 1VQMF 2LCAA 3HTNA 5EAZA 2CHSA 3R0PA 3D01A 4YJ3B 4BVTA 4EI7A 2H8EA 3CB2A 4EB6A 2BTQB 3I7TA 4B5CA 2FGYA 1U3PA 1VQ9F 3VYTC 4I4TA 3JAWB 4O4JA 3S0WA 5IJ0B 4C81A 1GO0A 2CSLA 5HY0A 1YJNF 2IAFA 1E7KA 3N4ZA 1QVFF 2LBWA 3UT5A 3CCEF 2BTOA 3M1XA 4NQ3A 3B6NA 4IHJB 1Z5WA 3RYCB 1VQ6F 1Q8RA 5BMVA 3WPWA 5MN5A 1W40A 2Z1FA 2NMUA 3CC7F 1UFYA 4G4ZA 4X1KB 2EWCA 3V4DA 1RQ7A 4DRXA 2Z01A 4O4LA 4KWEA 1FNJA 4TZZA 3FD5A 3JATA 5FNVB 1W41A 4FFBA 3T80A 3MBMA 3ERNA 1YJWF 1JJ2F 1KNJA 1K9MH 1VK3A 4X3MA 3D54A 3LFOA 3LWOC 1CK2A 3N2KA 3E22B 1KC8H 1U43A 1Q82H 1N8RH 3O85A 1TUBB 5LA6A 3CG6A 3N2GB 3MCQA 3VMFB 3S06A 5EIBD 1H48A 3K0TA 3MCAB 4I50B 3WPXA 2DYYA 4BT7A 3ON1A 1GZ0A 2CHTA 1W3EX 4C82A 3J80M 3RYFB 3CPWF 5CA0B 3S0YA 1NJIH 2QTPA 5LXTA 5GIPC 3CD6F 1W5BA 4X1IA 3CCQF 1YQNA 3C9SA 1VQ5F 5J2UB 1SA0B 2KGWA 3CXCF 3CCLF 1Q7YH 5CB4B 1KQSF 5J2TA 3LWVC 5A2QM 2JNBA 4ZHVA 5GONB 3K14A 4I55B 3WJPA 3CCUF 5JH7A 1W2BF 4O2AB 3JAMM 3G6EF 2K1SA 3WGJA 2WALA 3WGMA 3KE1A 3I56F 3IEQA 3CCMF 3RYIA 4B46A 2HRUA 3WGLA 3S0HA 4IIJA 2H6LA 1GO1A 3FD6A 1ODEA 4EI9A 1PF5A 5GIOC 2UYNB 3JAKA 4BVQA 2P6YA 1JY8A 3F6MA 3HKEA 4X3LA 5LOVA 2HRYA 3NK6A 4ZOLA 4F6RA 2UYJA 4U3JA 1VHAA 2OZBA 3U0OA 3HKDA 1YJ9F 5J2UA 2RB9A 1RA4A 4O4IA 4C8GA 4G4WA 5IYZB 2RHOA 3LWRC 3IR9A 5ITZB 1VQKF 1IV3A 3JCMM 2H8CA 3HKBB 3M84A 4XCQA 3CCSF 4TV9B 4BT3A 4BT4A 1H7MA 5IJ9A 1DT9A 1SZQA 3CPQA 4LNUA 3CCVF 1VQ7F 3LWQC 5GANK 3TD5A 2YYEA 2IG8A 5KMGA 1K73H 1VQ4F 5IT9M 2HQSC 1Q81H 3VIUA 1XV2A 3WGNA 1FNKA 1GX1A 5GINC 1JFFB 3VOAA 3CCRF 4YJ2A 1ZWZA 2UYNA 3WXMB 3CYQA 2HS0A 1QD9A 3GTZA 3JARB 4TUYB 3C9RA 3KJKA 5JCOA 4NUTA 2ZAUA 2W8BC 3JASB 3J81M 3BYQA 4ZHQB 4R40B 4G4VA 4X1YB 4X20B 1UI9A 4BY9D 2AIFA 2ZVZA 3V7EA 2CZWA 3P0ZA 5JCOC 2UYPA 5EZYB 1XBIA 5IYZA 1IV1A 3JALA 1M1KH 2Z1EA 2HP0B 1U40A 4YJ3A 2BTUA 5EIBC 4BVSA 3HKBA 5CA1B 2QA4F 3JAWA 4WBNB 5IJ0A 2I6DA 3RYHB 3HKCB 2PMPA 2VXYA 2R751 3NMUC 2HX0A 3TD4A 3SIUA 1FFXB 3V3TA 3IKEA 1YIJF 5C8YB 4IHJA 3RYCA 5HXZA 1JFFA 5LP6B 3JARA 3N4YA 2YXZA 4X1KA 3PLAC 4U39A 2AMTA 3F0FA 4ZHWA 1X25A 2ZOVA 3JASA 1VQOF 4ZHQA 5EO3A 3DC2A 3EORA 3ZO8A 3VTIC 3CC4F 1SDSA 5FNVA 1QAHA 4G4YA 1IPAA 1Q86H 4C8IA 3Q8HA 2BO1A 1W5FA 3MDOA 3ZOPA 4HNAB 2Z1UA 3CC2F 5FJ4C 4RQOA 1QVGF 4BW0B 3GYQA 1ONIA 1VH8A 3HAXD 3QTYA 3E22A 3RYHA 1QU9A 1W59A 2OTLF 3E20B 1Z5VA 1NMUB
chains in the Genus database with same CATH topology
3CC7F 3CCJF 5HXUA 1YITF 3NVKE 3LWRC 3IR9A 1VQKF 3OBWA 3OW2F 3CMEF 2OTLF 3JCMM 4XCQA 1VQNF 5HY2A 5GAPK 3CCSF 1RLGA 3AGKA 2LBXA 5HY1A 2OTJF 1H7MA 4TZZA 3G4SF 1DT9A 3CCVF 3CPQA 1W41A 1VQ7F 3SIVA 4EI8A 3LWQC 5G4UC 1X7PA 5GANK 1YJWF 3HJWC 2GLZA 1JJ2F 5DCVA 1K73H 3RA6A 2KTVA 5EWRA 1K9MH 1VQ4F 5IT9M 4X3MA 1Q81H 5GINC 1W42A 3I55F 3LFOA 3CCRF 3LWOC 1ZWZA 2QEXF 3WXMB 1CK2A 1K8AH 1CN7A 1KC8H 2KTUA 1Q82H 1N8RH 3D00A 3O85A 4NUTA 5FLXM 3CG6A 2F9ZC 3VI6A 3J81M 4BVRA 3VMFB 5G4VC 4BY9D 2AIFA 3MCAB 3V7EA 3ON1A 1GZ0A 2CZWA 3LWPC 1VQ8F 1W3EX 2KG4A 1XBIA 3J80M 3CPWF 1M1KH 1NJIH 5GIPC 3CD6F 1X7OA 5HY4A 4BVSA 4LCKA 3CCQF 3OBYA 1VQ5F 2QA4F 3G71F 3CMAF 1KD1H 2I6DA 3CXCF 3CCLF 3NMUC 1Q7YH 1KQSF 3LWVC 5A2QM 2JNBA 3CCUF 3SIUA 3V3TA 1S72F 1YIJF 1W2BF 3PAFA 2QI2A 1T0KB 1YI2F 5HXZA 1YHQF 3J7AR 4C4WC 1VQPF 3JAMM 3N4YA 3G6EF 2WALA 1PXWA 2FC3A 3PLAC 3I56F 3CCMF 1VQLF 1W40A 1VQOF 1VQMF 1X52A 3RA5A 2VGMA 1GO1A 5EO3A 4BVTA 3FFMA 4EI7A 3CC4F 1SDSA 4EI9A 2FGYA 1VQ9F 2OHWA 5GIOC 1GO0A 1IPAA 4BVQA 5HY0A 1Q86H 1YJNF 1M90H 2HVYD 2BO1A 2VGNA 4X3LA 3NK6A 3NVIB 1E7KA 5FJ4C 3N4ZA 3CC2F 2LBWA 1QVFF 3CCEF 2OZBA 4NQ3A 4BW0B 3GYQA 3NK7A 1QVGF 5HWEA 1YJ9F 2ALEA 3HAXD 1RA4A 1VQ6F 3E1YA 3V7QA 3E20B 1NMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 F;  3CCJ F;  1YIT F;  3NVK E;  3LWR C;  3IR9 A;  1VQK F;  3OBW A;  3OW2 F;  3CME F;  2OTL F;  3JCM M;  1VQN F;  5GAP K;  3CCS F;  1RLG A;  3AGK A;  2LBX A;  2OTJ F;  1H7M A;  4TZZ A;  3G4S F;  1DT9 A;  3CCV F;  3CPQ A;  1W41 A;  1VQ7 F;  3SIV A;  3LWQ C;  5G4U C;  1X7P A;  5GAN K;  1YJW F;  3HJW C;  5DCV A;  1JJ2 F;  1K73 H;  3RA6 A;  2KTV A;  5EWR A;  1K9M H;  1VQ4 F;  5IT9 M;  4X3M A;  1Q81 H;  5GIN C;  1W42 A;  3I55 F;  3LFO A;  3CCR F;  3LWO C;  1ZWZ A;  2QEX F;  3WXM B;  1CK2 A;  1K8A H;  1CN7 A;  1KC8 H;  2KTU A;  1Q82 H;  1N8R H;  3O85 A;  4NUT A;  5FLX M;  3CG6 A;  3VI6 A;  3J81 M;  3VMF B;  5G4V C;  4BY9 D;  2AIF A;  3MCA B;  3V7E A;  3ON1 A;  1GZ0 A;  2CZW A;  3LWP C;  1VQ8 F;  1W3E X;  2KG4 A;  1XBI A;  3J80 M;  3CPW F;  1M1K H;  1NJI H;  5GIP C;  3CD6 F;  1X7O A;  4LCK A;  3CCQ F;  3OBY A;  1VQ5 F;  2QA4 F;  3G71 F;  3CMA F;  1KD1 H;  2I6D A;  3CXC F;  3CCL F;  3NMU C;  1Q7Y H;  1KQS F;  3LWV C;  5A2Q M;  2JNB A;  3CCU F;  3SIU A;  1S72 F;  1YIJ F;  1W2B F;  3PAF A;  2QI2 A;  1T0K B;  1YI2 F;  1YHQ F;  3J7A R;  4C4W C;  1VQP F;  3JAM M;  3N4Y A;  3G6E F;  2WAL A;  1PXW A;  2FC3 A;  3PLA C;  3I56 F;  3CCM F;  1VQL F;  1W40 A;  1VQO F;  1VQM F;  1X52 A;  3RA5 A;  2VGM A;  1GO1 A;  5EO3 A;  3FFM A;  3CC4 F;  1SDS A;  1VQ9 F;  2OHW A;  5GIO C;  1GO0 A;  1IPA A;  1Q86 H;  1YJN F;  1M90 H;  2HVY D;  2BO1 A;  2VGN A;  4X3L A;  3NK6 A;  3NVI B;  1E7K A;  5FJ4 C;  3N4Z A;  3CC2 F;  2LBW A;  1QVF F;  3CCE F;  2OZB A;  1QVG F;  4BW0 B;  3GYQ A;  3NK7 A;  1YJ9 F;  2ALE A;  3HAX D;  1RA4 A;  1VQ6 F;  3E1Y A;  3V7Q A;  3E20 B;  1NMU B; 
#chains in the Genus database with same CATH topology
 3CCJ F;  1TUB A;  1FFX A;  3N2G A;  1FSZ A;  3C8L A;  3OW2 F;  3CME F;  5KX5 B;  3K2X A;  4I50 A;  3I3F A;  5GAP K;  5LP6 A;  3HWU A;  5HY1 A;  2OTJ F;  4EB6 B;  3RYF A;  2I6R A;  1H47 A;  5AVM A;  5CA0 A;  3VCZ A;  4I4T B;  4O4J B;  5G4U C;  3QUW A;  4M8I A;  3JVH A;  5LYJ B;  2GLZ A;  4ZI7 B;  3RA6 A;  3KHN A;  5EWR A;  5LP6 C;  3WJR A;  1SA0 A;  3P10 A;  2RHJ A;  5JVD B;  4E6E A;  3UT5 B;  1W42 A;  5CB4 A;  3MQW A;  1CN7 A;  5GON A;  3F0G A;  4I55 A;  5BMV B;  1JN1 A;  1W5E A;  4B62 A;  5FLX M;  2F9Z C;  4BVR A;  3P4E A;  4O2A A;  4PWT A;  4DRX B;  2PHN A;  4O4L B;  1VQ8 F;  2HS4 A;  2KG4 A;  1W55 A;  2CW4 A;  3IEW A;  3JAT B;  4FFB B;  1X7O A;  1OFU A;  4O2B B;  5HY4 A;  3GHZ A;  4BT2 A;  2ZOD A;  3OBY A;  4O4H B;  3G71 F;  3M4S A;  1KD1 H;  1CLI A;  3FPI A;  3LME A;  3WJQ A;  2GZL A;  1COM A;  3N2K B;  5MN6 A;  5LYJ A;  1IV4 A;  4BT5 A;  4ZI7 A;  1S72 F;  2AIZ P;  3LDT A;  1T0K B;  1R1M A;  2Z1T A;  3ELC A;  1KNK A;  4G4X A;  5LA6 B;  5JVD A;  5MN4 A;  1VQV A;  3J7A R;  3S03 A;  2IQQ A;  1RLU A;  1PXW A;  2LBT A;  5ITZ A;  3WGK A;  4C8E A;  1VQL F;  2CWJ A;  3KIZ A;  2HS3 A;  2UZH A;  1X52 A;  1J7H A;  5LXT B;  3RA5 A;  2VGM A;  4TV9 A;  4X1I B;  3ZP4 A;  2ZVY A;  3FFM A;  4TV8 B;  1T0A A;  2OHW A;  1M90 H;  2HVY D;  1W57 A;  2VGN A;  5B8F A;  4ZK7 A;  5J2T B;  3TD3 A;  4RHA A;  4O2B A;  2ZF8 A;  5JH7 B;  3F0E A;  2RHL A;  3NK7 A;  5HWE A;  2L26 A;  4O4H A;  2ALE A;  5HP7 A;  3LYB A;  3F0D A;  4TUY A;  3E1Y A;  3V7Q A;  3NVI B;  5EYP B;  3VYU C;  1TVK B;  5HXU A;  1YIT F;  3NVK E;  3CYP B;  3OBW A;  4X1Y A;  3RYI B;  4X20 A;  5JQG B;  1VQN F;  5HY2 A;  1YGY A;  4IIJ B;  2B33 A;  1RLG A;  3AGK A;  2LBX A;  4NWO B;  5EZY A;  3VYS C;  5EB0 A;  3G4S F;  3S02 A;  3K12 A;  3SIV A;  3JAK B;  3VO8 A;  2HP0 A;  4EI8 A;  1X7P A;  3RE3 A;  5EB1 B;  5DCV A;  3HJW C;  2GVI A;  3HKE B;  5LOV B;  2KTV A;  4ZOL B;  3ZP7 A;  5CA1 A;  3C9T A;  4WBN A;  1JD1 A;  1U3L A;  4F6R B;  2N48 A;  4TV8 A;  4U3J B;  3HKC A;  3I55 F;  3KJJ A;  3HKD B;  2QEX F;  4ERH A;  3IKF A;  1K8A H;  1DBF A;  4O4I B;  2KTU A;  3D00 A;  5C8Y A;  1XHO A;  1XRG A;  1RQ2 A;  3VI6 A;  2V9Y A;  3DDN A;  5G4V C;  4BT6 A;  1NQ3 A;  2VAM A;  2HP3 A;  3LWP C;  5EYP A;  2VAP A;  5IJ9 B;  1TVK A;  2UYK A;  3QHD A;  4LNU B;  2VAW A;  1OAP A;  5HP8 A;  3VOB A;  2CVL A;  4ZHY B;  5JQG A;  5KMG B;  2OTM A;  4LCK A;  3C9U A;  3CMA F;  3OON A;  4YJ2 B;  4B45 A;  4HNA A;  1W5A A;  2DT4 A;  3ESJ A;  4G88 A;  2G9I A;  3PAF A;  3FBA A;  2QI2 A;  1YI2 F;  2Q1Y A;  1YHQ F;  4C4W C;  1VQP F;  3IMP A;  1W58 1;  2RHH A;  1IV2 A;  2MQE A;  2FC3 A;  3L7Q A;  2Q1X A;  4DXD A;  2R6R 1;  5KX5 A;  3JAL B;  1VQM F;  2LCA A;  3HTN A;  5EAZ A;  2CHS A;  3R0P A;  3D01 A;  4YJ3 B;  4BVT A;  4EI7 A;  2H8E A;  3CB2 A;  4EB6 A;  2BTQ B;  3I7T A;  4B5C A;  2FGY A;  1U3P A;  1VQ9 F;  3VYT C;  4I4T A;  3JAW B;  4O4J A;  3S0W A;  5IJ0 B;  4C81 A;  1GO0 A;  2CSL A;  5HY0 A;  1YJN F;  2IAF A;  1E7K A;  3N4Z A;  1QVF F;  2LBW A;  3UT5 A;  3CCE F;  2BTO A;  3M1X A;  4NQ3 A;  3B6N A;  4IHJ B;  1Z5W A;  3RYC B;  1VQ6 F;  1Q8R A;  5BMV A;  3WPW A;  5MN5 A;  1W40 A;  2Z1F A;  2NMU A;  3CC7 F;  1UFY A;  4G4Z A;  4X1K B;  2EWC A;  3V4D A;  1RQ7 A;  4DRX A;  2Z01 A;  4O4L A;  4KWE A;  1FNJ A;  4TZZ A;  3FD5 A;  3JAT A;  5FNV B;  1W41 A;  4FFB A;  3T80 A;  3MBM A;  3ERN A;  1YJW F;  1JJ2 F;  1KNJ A;  1K9M H;  1VK3 A;  4X3M A;  3D54 A;  3LFO A;  3LWO C;  1CK2 A;  3N2K A;  3E22 B;  1KC8 H;  1U43 A;  1Q82 H;  1N8R H;  3O85 A;  1TUB B;  5LA6 A;  3CG6 A;  3N2G B;  3MCQ A;  3VMF B;  3S06 A;  5EIB D;  1H48 A;  3K0T A;  3MCA B;  4I50 B;  3WPX A;  2DYY A;  4BT7 A;  3ON1 A;  1GZ0 A;  2CHT A;  1W3E X;  4C82 A;  3J80 M;  3RYF B;  3CPW F;  5CA0 B;  3S0Y A;  1NJI H;  2QTP A;  5LXT A;  5GIP C;  3CD6 F;  1W5B A;  4X1I A;  3CCQ F;  1YQN A;  3C9S A;  1VQ5 F;  5J2U B;  1SA0 B;  2KGW A;  3CXC F;  3CCL F;  1Q7Y H;  5CB4 B;  1KQS F;  5J2T A;  3LWV C;  5A2Q M;  2JNB A;  4ZHV A;  5GON B;  3K14 A;  4I55 B;  3WJP A;  3CCU F;  5JH7 A;  1W2B F;  4O2A B;  3JAM M;  3G6E F;  2K1S A;  3WGJ A;  2WAL A;  3WGM A;  3KE1 A;  3I56 F;  3IEQ A;  3CCM F;  3RYI A;  4B46 A;  2HRU A;  3WGL A;  3S0H A;  4IIJ A;  2H6L A;  1GO1 A;  3FD6 A;  1ODE A;  4EI9 A;  1PF5 A;  5GIO C;  2UYN B;  3JAK A;  4BVQ A;  2P6Y A;  1JY8 A;  3F6M A;  3HKE A;  4X3L A;  5LOV A;  2HRY A;  3NK6 A;  4ZOL A;  4F6R A;  2UYJ A;  4U3J A;  1VHA A;  2OZB A;  3U0O A;  3HKD A;  1YJ9 F;  5J2U A;  2RB9 A;  1RA4 A;  4O4I A;  4C8G A;  4G4W A;  5IYZ B;  2RHO A;  3LWR C;  3IR9 A;  5ITZ B;  1VQK F;  1IV3 A;  3JCM M;  2H8C A;  3HKB B;  3M84 A;  4XCQ A;  3CCS F;  4TV9 B;  4BT3 A;  4BT4 A;  1H7M A;  5IJ9 A;  1DT9 A;  1SZQ A;  3CPQ A;  4LNU A;  3CCV F;  1VQ7 F;  3LWQ C;  5GAN K;  3TD5 A;  2YYE A;  2IG8 A;  5KMG A;  1K73 H;  1VQ4 F;  5IT9 M;  2HQS C;  1Q81 H;  3VIU A;  1XV2 A;  3WGN A;  1FNK A;  1GX1 A;  5GIN C;  1JFF B;  3VOA A;  3CCR F;  4YJ2 A;  1ZWZ A;  2UYN A;  3WXM B;  3CYQ A;  2HS0 A;  1QD9 A;  3GTZ A;  3JAR B;  4TUY B;  3C9R A;  3KJK A;  5JCO A;  4NUT A;  2ZAU A;  2W8B C;  3JAS B;  3J81 M;  3BYQ A;  4ZHQ B;  4R40 B;  4G4V A;  4X1Y B;  4X20 B;  1UI9 A;  4BY9 D;  2AIF A;  2ZVZ A;  3V7E A;  2CZW A;  3P0Z A;  5JCO C;  2UYP A;  5EZY B;  1XBI A;  5IYZ A;  1IV1 A;  3JAL A;  1M1K H;  2Z1E A;  2HP0 B;  1U40 A;  4YJ3 A;  2BTU A;  5EIB C;  4BVS A;  3HKB A;  5CA1 B;  2QA4 F;  3JAW A;  4WBN B;  5IJ0 A;  2I6D A;  3RYH B;  3HKC B;  2PMP A;  2VXY A;  2R75 1;  3NMU C;  2HX0 A;  3TD4 A;  3SIU A;  1FFX B;  3V3T A;  3IKE A;  1YIJ F;  5C8Y B;  4IHJ A;  3RYC A;  5HXZ A;  1JFF A;  5LP6 B;  3JAR A;  3N4Y A;  2YXZ A;  4X1K A;  3PLA C;  4U39 A;  2AMT A;  3F0F A;  4ZHW A;  1X25 A;  2ZOV A;  3JAS A;  1VQO F;  4ZHQ A;  5EO3 A;  3DC2 A;  3EOR A;  3ZO8 A;  3VTI C;  3CC4 F;  1SDS A;  5FNV A;  1QAH A;  4G4Y A;  1IPA A;  1Q86 H;  4C8I A;  3Q8H A;  2BO1 A;  1W5F A;  3MDO A;  3ZOP A;  4HNA B;  2Z1U A;  3CC2 F;  5FJ4 C;  4RQO A;  1QVG F;  4BW0 B;  3GYQ A;  1ONI A;  1VH8 A;  3HAX D;  3QTY A;  3E22 A;  3RYH A;  1QU9 A;  1W59 A;  2OTL F;  3E20 B;  1Z5V A;  1NMU B; 
#chains in the Genus database with same CATH homology
 3CC7 F;  3CCJ F;  5HXU A;  1YIT F;  3NVK E;  3LWR C;  3IR9 A;  1VQK F;  3OBW A;  3OW2 F;  3CME F;  2OTL F;  3JCM M;  4XCQ A;  1VQN F;  5HY2 A;  5GAP K;  3CCS F;  1RLG A;  3AGK A;  2LBX A;  5HY1 A;  2OTJ F;  1H7M A;  4TZZ A;  3G4S F;  1DT9 A;  3CCV F;  3CPQ A;  1W41 A;  1VQ7 F;  3SIV A;  4EI8 A;  3LWQ C;  5G4U C;  1X7P A;  5GAN K;  1YJW F;  3HJW C;  2GLZ A;  1JJ2 F;  5DCV A;  1K73 H;  3RA6 A;  2KTV A;  5EWR A;  1K9M H;  1VQ4 F;  5IT9 M;  4X3M A;  1Q81 H;  5GIN C;  1W42 A;  3I55 F;  3LFO A;  3CCR F;  3LWO C;  1ZWZ A;  2QEX F;  3WXM B;  1CK2 A;  1K8A H;  1CN7 A;  1KC8 H;  2KTU A;  1Q82 H;  1N8R H;  3D00 A;  3O85 A;  4NUT A;  5FLX M;  3CG6 A;  2F9Z C;  3VI6 A;  3J81 M;  4BVR A;  3VMF B;  5G4V C;  4BY9 D;  2AIF A;  3MCA B;  3V7E A;  3ON1 A;  1GZ0 A;  2CZW A;  3LWP C;  1VQ8 F;  1W3E X;  2KG4 A;  1XBI A;  3J80 M;  3CPW F;  1M1K H;  1NJI H;  5GIP C;  3CD6 F;  1X7O A;  5HY4 A;  4BVS A;  4LCK A;  3CCQ F;  3OBY A;  1VQ5 F;  2QA4 F;  3G71 F;  3CMA F;  1KD1 H;  2I6D A;  3CXC F;  3CCL F;  3NMU C;  1Q7Y H;  1KQS F;  3LWV C;  5A2Q M;  2JNB A;  3CCU F;  3SIU A;  3V3T A;  1S72 F;  1YIJ F;  1W2B F;  3PAF A;  2QI2 A;  1T0K B;  1YI2 F;  5HXZ A;  1YHQ F;  3J7A R;  4C4W C;  1VQP F;  3JAM M;  3N4Y A;  3G6E F;  2WAL A;  1PXW A;  2FC3 A;  3PLA C;  3I56 F;  3CCM F;  1VQL F;  1W40 A;  1VQO F;  1VQM F;  1X52 A;  3RA5 A;  2VGM A;  1GO1 A;  5EO3 A;  4BVT A;  3FFM A;  4EI7 A;  3CC4 F;  1SDS A;  4EI9 A;  2FGY A;  1VQ9 F;  2OHW A;  5GIO C;  1GO0 A;  1IPA A;  4BVQ A;  5HY0 A;  1Q86 H;  1YJN F;  1M90 H;  2HVY D;  2BO1 A;  2VGN A;  4X3L A;  3NK6 A;  3NVI B;  1E7K A;  5FJ4 C;  3N4Z A;  3CC2 F;  2LBW A;  1QVF F;  3CCE F;  2OZB A;  4NQ3 A;  4BW0 B;  3GYQ A;  3NK7 A;  1QVG F;  5HWE A;  1YJ9 F;  2ALE A;  3HAX D;  1RA4 A;  1VQ6 F;  3E1Y A;  3V7Q A;  3E20 B;  1NMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...