5MN5A

S. aureus ftsz 12-316 t66w gtp closed form (2tcm)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
303
structure length
292
Chain Sequence
TLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGNPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title A Polymerization-Associated Structural Switch in FtsZ That Enables Treadmilling of Model Filaments.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 93
structure length 292
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5mn5A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5mn5A01
5J2TA 1FFXA 4IHJB 1TVKB 1Z5WA 4TUYA 4FFBB 3N2KA 4U39A 3N2GA 4WBNB 4XCQA 2GVIA 4O4JA 4ZHQA 5IYZA 4LNUB 4I4TA 4E6EA 1FFXB 4TUYB 3N2KB 1FSZA 4X1YB 3VOBA 2VAWA 3ZBPA 4TV9A 5ITZA 4ZHQB 3JAKA 5EZYB 3VOAA 4I4TB 1Z5VA 5BMVA 5JQGA 3VO9A 5GONB 3ZIDA 5KMGA 1JFFA 4X1KB 5KX5A 3JAWB 5LOVB 5MN5A 5ITZB 4B45A 5IJ9B 4X20B 1TUBB 3JATB 4F6RB 4YJ3A 5JH7B 1TVKA 5BMVB 4FFBA 3E22B 5JQGB 5LYJB 3RYHB 4WBNA 1JFFB 5KX5B 5JCOA 5MN6A 4B46A 3VO8A 5EIBC 2RHJA 2VAMA 4O2BB 4YJ3B 4X1YA 3JARA 5C8YA 3R4VA 3C8LA 5EZYA 5LP6A 2Q1YA 1W5BA 4HNAA 4O4HB 5GONA 4TV8A 4X1KA 3JARB 3JAWA 5LOVA 5C8YB 5IJ9A 1W581 4X20A 1TUBA 3JATA 4M8IA 2VAPA 3HKBB 5CA0A 4F6RA 5JH7A 5LP6B 4HNAB 5LXTA 5LYJA 3E22A 3RYCB 4TV8B 4IIJB 3RYHA 5CA1A 2XKAA 1OFUA 4O4IA 5CA0B 4I50B 4O2BA 3VPAA 5LXTB 4EI7A 3HKCB 3RYFB 5CA1B 4EI8A 4KWEA 4O4IB 4O2AA 4DXDA 2XKBA 3JALB 4O4HA 3UT5B 4U3JA 3WGLA 3V3TA 3HKDB 1W5FA 5LA6A 3WGJA 2Q1XA 1W59A 4O2AB 4ZOLB 3HKBA 3JASA 5EIBD 1W5EA 3RYCA 5IJ0A 3M8KA 4U3JB 2R751 4IIJA 5CB4B 3M89A 1RQ2A 4X1IB 4O4LB 5LA6B 3HKEA 4YJ2B 4I50A 2R6R1 3JASB 3WGKA 1SA0A 3HKCA 5JVDB 5EYPB 3RYFA 5IJ0B 2RHHA 3HKEB 5FNVB 5JCOC 2BTQA 3RYIB 3JALA 1SA0B 4DRXA 3UT5A 2RHOA 2VXYA 5M7EA 3HKDA 2BTQB 3RB8A 4ZI7A 2RHLA 4ZOLA 5LP6C 5J2TB 4DRXB 5CB4A 3N2GB 4X1IA 4O4LA 1W5AA 1RLUA 4YJ2A 3CB2A 4O4JB 3WGMA 5J2UA 4ZI7B 5IYZB 3WGNA 5JVDA 5EYPA 5MN4A 4EB6A 5FNVA 4TV9B 5J2UB 3RYIA 3JAKB 4I55A 4EI9A 2BTOA 4IHJA 5KMGB 3ZBQA 4EB6B 1RQ7A 4I55B 4LNUA
chains in the Genus database with same CATH superfamily
1T35A 4Q3KA 3VYTC 3HZHA 4I4LA 2XOEA 4D2IA 4U2KA 3B5EA 2B2CA 1YCDA 1U0BB 1KERA 3ICQB 4R1UA 1T9CA 2F3RA 4AECA 5BRJA 4CM5A 5CBPB 1KY2A 2QN2A 5FLYA 3RWOA 3EDQA 4AZ0A 1YBHA 4H3SA 1MB9A 4DR7B 5EJMA 2V6IA 4JHLA 5A04A 1G21A 4ZV4A 4HDRB 4BIIA 2YV2A 5K45A 4F6LA 3IEUA 4C20A 2LDXA 3G9ZA 4IDPA 3NXKA 1VCMA 1TQ4A 1LWOA 1UM9B 4NESA 3OMLA 2AA3A 4EG0A 5B5SA 2Z1MA 3DO5A 2WNHA 1DRVA 2WALA 1NNEA 3D1JA 1XV5A 4LVCA 1QZ3A 4LJ5A 2OORC 3TAXA 3MJSA 3W5UA 2CV0A 4TZ6A 3PUXA 3X43A 3FYUB 3ILYA 3U9LA 3DH0A 3JQ9A 1N8RH 3FDZB 2CN1A 4BWVA 4HB4A 3QE2A 3A9UA 4LWZA 2DP4E 3D81A 3DLPX 4OF4A 3QZUA 2XUQA 5F2KA 1G6HA 3DEIA 3E9YA 1BFDA 2WU0A 4RZUA 5F1OA 4MYHA 1GN9A 3ZWYA 3WO1A 5BV7A 4A36A 4S1OA 1RC0A 4AWAA 3D5EA 3M6FA 4H7DA 4NE9A 2FFHA 5IDWA 1NOJA 4OLHA 3A6HA 4ND3A 4UVHA 1X7HA 5K8VA 1ATIA 1D2CA 3IQWA 1QOZA 2AD1A 1YQ9A 1RCUA 3K16A 3OJLA 4C81A 4GYJA 5FWDA 4RK7A 2AQHA 1P1KA 4B7UA 1QYRA 4WUTA 5C9ZA 3TXAA 1TW3A 1UPTA 4K9DA 1UZMA 1YZLA 3ZE0B 1KEKA 3JX9A 4ZZ0A 1XTTA 4PZYA 2Y1GA 3G2IA 3HADA 4KNVA 3ZWCA 2B5VA 2CT8A 3MWKA 1RCFA 1E5XA 5GINC 4MS4B 4L78A 5JUWA 1NQ5A 1R8SA 3EEQA 4Z5XA 1KAMA 3KQKA 2O8BB 3RS3A 4IICA 3U4GA 5EGNA 4EKNB 5CFPA 1RHKA 4HQOA 3I5MA 3ZHVA 3FJYA 3FFBA 4JQOA 5JH7F 1QAOA 3ODPA 1KMCA 5BR1A 3LKZA 2V03A 2GZMA 3F8WA 3QNUA 3BM5A 3GDWA 2Y1WA 2O3UA 3HXLA 3INGA 4NBNA 4RADA 4TL8A 3RARA 1DBIA 1LU9A 2KMLA 5FDFA 4YCLA 3DWGA 3K1AB 1EVZA 1MAHA 4GMFA 2B37A 3W79A 1FU7A 4PWYA 1JWLA 3QBTA 4LYYA 2Y71A 4EZIA 4RIFA 1HLGA 1UQRA 1WMDA 2ZT8A 1BX0A 3DCJA 5AOVA 2JRCA 3I1FA 1EE9A 3O2QB 5LBIA 4RJLA 1KDVA 4EB3A 4KE7A 4X8LA 2G3YA 2P9HA 3K9FC 3UC5A 4IP0A 2QQEA 5ICCA 1WB9A 3FPCA 3IA7A 1QIEA 2GCGA 3AFNA 3PFNA 3V8NA 5G4KA 3QEJA 4TWAA 5ALPA 4GX1A 2BCEA 4URXR 4Z9BA 2VWQA 1XRJA 2W6ID 4I3FA 1YC5A 4CM9D 1GZ0A 3KFLA 2F4VB 4C8IA 1CR1A 4M8NE 4PZPA 1XYYA 4KK4A 3I9FA 2NU7B 1HYHA 3KNZA 1FDRA 3BH7A 3M82A 1OMOA 2N1BA 2ZEJA 3R8XA 4LX0A 4LNAA 3P52A 1FUIA 2FPSA 4MQFA 1ICIA 3NEAA 4YJGB 4RMJA 4XJVA 3GIWA 2EJVA 2Z2ZA 4GNKA 3V4DA 4Z54A 1W5TA 5HZKA 3I09A 3BHJA 1KO7A 5DHTA 1F5NA 4FB5A 1AV6A 3GRYA 3P9NA 4HXYA 2OTCA 2UYOA 4Q3CA 2FLKA 4GXRA 1KO1A 1XZGA 4FEGA 2CLMB 3PEEA 4QRDA 5JNLA 5TRTA 2AEMA 4RANA 2GPBA 2W00A 5F76A 1J97A 2X1HA 1LNZA 4TLEA 1JAZA 3TW0A 4QASA 1FYDA 2LD4A 3IEIA 4C7JA 1RXCA 4CUJA 1FW6A 1F2UB 4ZALA 4MV6A 1H5NA 2I6DA 1XNJA 2FQYA 2W2KA 4DLTA 3KHTA 3PYXA 4EITA 1X7XA 2X3YA 2MYPA 4WY2A 2OFXA 2P5YA 2YWBA 4AZ0B 4BNLA 3ADBA 3QBEA 3H1FA 5C80A 2W6MA 2COEA 3IMFA 3OCWA 4NG5A 3AEUA 4H6WA 1G21B 2QVCA 4MVXA 5JNSA 4LDJA 1LV7A 3B7GA 2VZ8A 4YRFA 2Q9BA 5TPZA 4OQLA 1I4OA 4O4JF 4DJEC 3OG9A 4KR3A 1FUYB 2BGMA 3P9XA 3V6LA 3Q9UA 4R2HA 4JT2A 4BEWA 5LLTA 1XG5A 1Z2OX 5CCDA 2OFOA 1SQGA 5HS4A 4EENA 2I4OA 2FX2A 3RABA 3S55A 3ROXA 3I5YA 4UQPA 3JARA 1FFWA 2MR6A 4XASA 3ZU4A 4EO9A 2W0SA 4QFCA 5JU6A 2W6JD 2GBLA 4G9BA 3CR3C 4MV7A 2ZJAA 3KTOA 1XCMA 1H7MA 4OHUA 1Z6YA 5JCPA 1NF9A 3NONA 4RTOA 1D07A 3UOAB 1WSBA 2J09A 3FLBA 4MUJA 2QNIA 4YMUA 1X7WA 4POAA 1I36A 2QRPA 1D3AA 4URUR 3SVZA 3T94A 5DN6D 3EOZA 3I0NA 2PUAA 4CF4A 1O3YA 1FLDA 3I8OA 4ZA2A 1H47A 4EEKA 2R8OA 5U4QA 3SZ3A 4DFDA 4PC6A 1O96A 5EE5B 1LV8A 3R0VA 1CJCA 5JXWA 2UYYA 3F96A 4RTRA 5B4TA 1L6RA 2QTFA 3PQ5A 3OMXA 4GI7A 2Q0SA 1NVDA 1VLZA 4UEQA 3HY3A 1QGED 1O8BA 1M6YA 2O48X 1GZDA 3B3AA 3BSYA 3B1VA 4HT3B 2ZUEA 2BKEA 2HCTA 5I01A 5ICFA 4URHA 5JS8A 3B2EA 3TR6A 1JR3D 1YHQF 4EYKA 4DQKA 4J3FA 3STWA 3GL9A 3DMDA 2YL2A 4MW0A 3Q1KA 5ILOA 3AP1A 2C5LA 1JEEA 1JBQA 3FAKA 4CDNA 3AUFA 1TADA 3E9ZA 3UANA 1AKUA 1TM5E 1H1LB 1TTPB 2B1RA 1Y5NA 3LCUA 2VYCA 3NALA 4J7UA 2EIHA 4QBFA 4EELA 1R0KA 7MHTA 1XKLA 2G9UA 1COZA 2UZIR 3RU9A 6NULA 4JXZA 3CE6A 1JFRA 1YZUA 2TMKA 3IHKA 1TK9A 4I9FA 1F6DA 4M6WA 3GAMA 3M4SA 3IH5A 1O54A 2CFRA 5AI0A 3A11A 4X64B 4ZC1A 3ER6A 4OOEA 4QODA 4UHHA 1CV2A 4HF7A 3KU4A 2JD2A 5FBWB 4Q4DA 4PX5A 3GNLA 3K0FA 4A9AA 1IMOA 5BUQA 2QP9X 1LB1B 4IMJB 2DMRA 1RQGA 4Q9KA 1L5LA 2IBMA 1W5AA 2PZ8A 3KUCA 4JWTA 4WMLA 1GCGA 4G1BA 2CL0X 1M1YE 4NP6A 2H2AA 4RZ3A 3D0OA 3TI9A 2HBRA 4C2TA 1ZUIA 3TSCA 1BXGB 1AKNA 2VHYA 4YP1A 3A6LA 4ZARA 5KKCA 1XHOA 4A16A 3VR3D 4OL0A 1WCIA 4TKVA 3DVSX 5CVDA 2NP7A 3IIKA 1KA9H 4KN5A 4YP0A 5JRDS 3PUWA 1J7KA 3VPDA 4KO3S 2MCFA 4I1YA 4KGVA 3WFZA 4RUKA 3SSAA 2PRKA 1VSTA 2Q49A 4PBRA 1P2TA 4MQFB 4FFDA 1NXWA 1JSZA 1KEUA 4PHHA 1SUCA 1ZD2P 4W1QA 2ZAIA 3A10A 3O4GA 1GO0A 3BDIA 3IDAA 5IAJA 4C43A 5LDDC 4BO1A 4DZZA 4F4CA 2YVQA 3L7MA 4DMCA 1OGJA 4A6DA 1EFLA 3MHPA 1UJBA 4DJAA 1FRVA 5CU7A 4C78A 1FXWA 1SG6A 2H9YA 2M2IA 3L6EA 1UFVA 3L0SA 4IFIA 2OUIA 1M2KA 3G2HA 3WWPA 4YT4A 4J91A 1KVTA 4CM6A 1FRQA 2B36A 3KEMA 1IEWA 1UINA 4HEJA 4YC7A 4JI3B 2KTUA 1Q21A 2FSIA 1E62A 1GPMA 3CEJA 3FMVA 2UZHA 3QITA 1X7XB 4OQMA 3R3JA 4DLAA 2X8WA 3N87A 4PQRA 1L4HA 5DHPA 2C4NA 1JP7A 5AKXA 3AEUB 4QXOA 5JBNA 4TQGA 1N2ZA 1R4AA 3NUGA 4KL8S 5DBGA 4K9PA 5I8ZA 1AN9A 3JV7A 2J3DA 4FZ5A 4ND6A 3NIWA 1OQAA 1UMBB 3AR3A 1SKQA 2B98A 3K2XA 3GDHA 3WQSB 1CEYA 4CG2A 2C4HA 2PGLA 5FL3A 1IM2A 3U17A 3JARB 1JR4A 1B15A 1UKAA 1JF8A 2BSAA 1G5TA 3QFSA 3W6UA 1QH9A 3OF5A 3ZKAA 4A7PA 4DZRA 2HT6A 2GRJA 1YHZA 3CH6A 2HWXA 2MU1A 2XJ9A 3DZ8A 4R8SA 3UHJA 2RHDA 1I9GA 1WXEA 1CERA 1C7RA 3L1KA 1X7WB 3ET4A 2CV1A 2DQ4A 5HIIA 3FSJX 3TQQA 3L6RA 4EY3A 1ZR2A 5EXEA 1EEXB 2BKLA 3BTOA 3DZGA 3EWSA 5E6SB 3WLHA 3SIWA 2C9CA 5DM60 1NR1A 3DF9A 1T8PA 2GZRA 1N2CA 1GD1O 1Z74A 2AG8A 3O90A 1YAHA 3WL6A 3AW8A 1RKUA 3FSRA 4FFOA 5T3UA 3SDSA 3QWFA 1N1MA 3LIPA 3W5BA 3KLMX 1V11A 1YR2A 2DF8A 1VGQA 4TKUB 1Y4SA 4ADSG 3S2IA 2WM8A 2GXUA 4WCFC 3AIKA 1XL0A 2Q5FA 1CR2A 4LHSA 1VYTA 4LTNA 1DJNA 1U7TA 4LJ6A 4UUMA 1WQ1R 4XIYA 1JSCA 5EE0A 1EUDA 4ZO8A 1CUVA 4IV0A 3ZH9B 1EA5A 2BFCB 2YHBA 3KBOA 1NUAA 4MWEA 2HT1A 1C50A 1ABBA 2ZRLA 1E98A 2XGJA 3U4HA 3EVBA 4WZBE 4IDNA 2HF2A 3SNKA 2DWCA 3OZFA 4Q9JA 3UJ3X 3U7GA 3BMNB 1IBMB 2OBFA 3FF1A 4XFKA 4XYMA 3Q3JB 1CVIA 4M89A 5K3AA 1NOKA 3U3KA 3X2FA 2IIPA 4OKNA 1GZSA 4RPIA 4MJXA 2NOAA 1PF5A 3PWZA 4M6WB 5GJVC 1EM8A 3DEAA 4M46A 1EQUA 2FR0A 3SJZA 3ZJYA 5FX2A 1LTQA 1R6TA 4XJXA 3EVCA 1U8TA 1Z0SA 5JARA 3K0FB 2BE7A 2RGCA 3HV0A 3TIGA 1H66A 3AM5A 4PR3A 4DIKA 3CRQA 3ZE7A 4F7WA 5K9ZA 5I5GA 3JRWA 4LBWA 3Q5GA 1ZLXA 1CZKA 1QV9A 1ZI6A 2ZAOA 3AI2A 3L5OA 5LYYA 3EIOA 4CIVA 4ZN6A 1RLTA 4ERNA 3GD7A 1NSTA 2WUGA 1WCIB 5TS3A 3H0KA 4ITVA 3KB2A 2A0XA 1HI9A 4RESA 1J1IA 1SC3A 1VHQA 4GM0A 3GDOA 4PAWA 3FPEA 1XF1A 1LDGA 4KNYA 3CMEF 5ALMA 1IEXA 4UMEA 4A0FA 1O58A 4DT1A 3SY8A 3NTVA 1BJKA 1Y1TA 4PICA 3GF4A 1D4ZA 1P74A 1E7YA 3G17A 4GL2A 2CSXA 1JKJA 2YOFA 3LYUA 1U7ZA 5K8TA 3OA2A 4G9GA 4RYDA 1UP6A 2FXIA 3ILXA 3RC2A 2VSYA 4DR5B 2Z6AA 3LXXA 3ERNA 1NKVA 1IV4A 1UWVA 2HEGA 3D3KA 4B45A 4JGGA 1YB7A 4PYOA 3TJZA 2ONJA 3D2AA 4BMSA 5JSZA 3I0ZA 1MHTA 4ETNA 5KPJA 1O0SA 3FDXA 4YEDA 1RYMA 2IXTA 2GNOA 2VF7A 2ZB7A 3AUJB 5FLXM 2A57A 2UAGA 5JATA 5K6RA 1WKVA 4I81A 1PU2A 1I0IA 2BBWA 1KQFA 1BXRA 4XJSA 3U16A 3JQPA 1OR8A 2WJYA 4DBZA 1ZD8A 1YZKA 1Z07A 2DECA 4C0LA 5C8YA 1DFGA 2JD1A 2C5GA 1DKPA 4O08A 1P9OA 2E9SA 3DJFA 3HVHA 2VYVA 3E35A 1H8HD 3B1WA 3NW9A 5IFKA 5KOJB 3C3PA 4ALKA 1XZMA 2WM3A 1T5DX 3MQFA 4HQ6A 4E6PA 1DC8A 2P6NA 5EJ2A 3C85A 3ZGLA 5E2BA 3RVLA 1FMJA 1Q0TA 2OQRA 2RKOA 3H86A 5F9MA 3ZWNA 2F1RA 4AYWA 4QZVA 3TNDA 2BMEA 1C1YA 3RODA 4WN9A 1Z83A 3OZTA 4BNDB 1I13A 2XZPA 3IB6A 4IUDS 4MKRA 4OEHA 3PLRA 1ZXXA 5HZGA 1FLAA 1O94A 2DPXA 2L17A 4RPCA 2I7TA 1HRDA 4LMRA 3KIPA 4JLNA 1NF8A 2WR8A 5DXFA 2G4VA 4K46A 3WL8A 5H02A 2V7EA 4FFVA 5SZHB 3GLTA 4AY2A 3LPCA 3AB8A 4LXGA 5F7XA 3X0DA 3MAGA 4Q3DA 1E2EA 1NRIA 3VRHA 4CLEA 4C6TA 4Y9RA 2IIBA 3R6LA 4EUSA 2I6QA 3EF1A 2ODBA 2P4HX 5G02A 5JYDA 1IDN1 2V6BA 3JY6A 2O7VA 4RD0A 1T6ZA 3EBPA 1YQQA 1XYGA 4JA2A 4DLBA 4FPXA 2MT9A 4EPXA 2FX3A 3SQLA 5JTTA 2CLHB 4JEMA 4TWIA 4YRTA 1I2DA 1AGPA 1EUDB 1XEWX 4OI4A 1TJPB 3GOQA 4AICA 4DV0B 2DKNA 1I9CA 1NU8A 3AFMA 4BKPA 4WKOA 5K6AC 1M2WA 5LQKA 1V95A 3CCRF 4ZHVA 1G5HA 3IA2A 1YAJA 2EQAA 1E69A 2AFHA 4R0NA 3WC4A 1LQ2A 2GVZC 5AI4A 3DE0X 4PCVA 3WP0A 2DPHA 3DMFA 4RABA 4Q05A 3SXPA 3OX2A 1KGDA 1ZM4A 3ILSA 4X6YA 1GPJA 3N6XA 4B71A 5FLXA 4KMOA 3SR4A 1Y3DE 1PW5A 3QVMA 5ESDA 1UAGA 1HEYA 3KR1A 3NJ8A 1SXJA 3LQ1A 3QEKA 4B75A 1J2JA 2O0HA 4QRIA 1YQDA 4L15A 1YI2F 2P2GA 2YKGA 1EIZA 4FW8A 4HJRA 1SQ0A 3GPCA 4U5QA 5DW0A 1IV1A 3WLIA 2P79A 1K7YA 4PVDA 4CKZA 3GYGA 5IUNC 2XD9A 3F6MA 3HLTA 2BM9A 1TF2A 1GUYA 4IW3B 2OK7A 3GAFA 5J43A 1M2EA 3KOWA 4FN4A 1Y1PA 4IIFA 1HFJA 5K09A 5ER6A 4IOKA 3LUHA 3PPYA 1MPTA 5IDXA 3RSQA 1EBBA 1V8ZA 2ZYGA 4NATA 5DBEX 3MCWA 3VMFA 3N8NA 3X1XA 4KUHA 1M73E 4JIGA 2EZ8A 4Z4GA 2FMUA 3PRKE 2YINC 2LGJA 4LGMA 5EWJA 4ZTBA 3DL7A 2MYUA 5AVRA 5EL0A 1NV8A 2AXNA 2XQGA 3L8MA 4OQXA 1YO6A 3VU0A 3W9UA 1MW8X 1JHQA 3ZLTA 2CMFA 2CXQA 2IKQA 5CT4A 3ZTWA 3D9QX 4YRQA 1Z0IA 3B6MA 3IR7A 4R3NA 1UK6A 4I4TF 4TQUS 4ZT6A 1VG9B 4FDVA 4PFKA 4QJ5A 3UJ6A 3L6OO 1YL7A 5D5QA 5B36A 1FUEA 3FHTA 2RJ3A 4FT2A 4RHYA 4D0SA 2DX7A 3QKRA 2IHNA 3H0EA 1XQ1A 2GESA 4ZT5A 3SFZA 2K5UA 3QX7A 3IL2A 4E15A 3L0OA 2QL5A 1ZM9A 2HN9A 4EUFA 2AMFA 2O8EA 4HI0E 4IVNA 4HRXA 1ZX1A 1SUSA 2BHLA 5C8YB 4MV9A 1DKUA 1GTMA 3QE9Y 3TO5A 1IUKA 3GBSA 4X45A 4U7DA 3C4QA 4BNXA 4MUHA 1UI9A 4RIGA 4G67A 1RXEA 3WGGA 2DJ5A 5J3JA 3TZCA 1J7HA 4MA0A 4NXNB 4RW0A 2HPAA 2PX3A 3M81A 3O4IA 3DFIA 1NU6A 3CH7A 3MRTA 3O9MA 3T5MA 5TQJA 5JO9A 1Z5GA 3NPMA 5HM6A 1J2RA 2EKQA 2FDRA 2FEOA 1XTIA 2DUNA 3K2EA 3K8QA 5DHFA 4M86A 3ZVKA 1WXDA 4WK2B 2DQZA 1MEEA 3BTVA 3WIVA 1L8XA 4KP7A 2QG6A 1IULA 5AESA 1K5PA 1UH5A 4EW1A 2P3QA 4KOAA 5G53C 3DHVA 3H83A 5EE3A 4EY4A 1Z2DA 4QKQA 3BXGA 4OLJA 3T5PA 1L2TA 4IRMA 1I5OA 4RTMA 1GCAA 1XJQA 4F9GA 2ZB2A 2HLHA 2PSFA 2ZWIA 4MKGA 4XA8A 5AQEA 3EQ2A 4M0CA 2UVQA 5DWDA 4Q3NA 1TYBE 2PUGA 3TD5A 3UWSA 4NCBA 2OD9A 1R37A 4GEKA 1XSEA 1KD1H 3SF0A 1C3OA 1TVCA 4GE3A 1KPHA 5GZ3A 4O02B 1HWYA 3V8BA 5ALQA 4ABYA 2CL5A 3GRPA 4AJOA 3OPYA 2NZ2A 4NZZA 5KNBD 4OP2A 4PYQA 5CK4A 1W8IA 4HOYA 4K0RA 4DMMA 4IZ6A 2C4WA 5DIZA 4BT3A 4ND8B 5K8JB 2IVZA 3DL2A 1TKAA 4ZJPA 2NU8B 3DV0A 3RE3A 3A9SA 2EKZA 3LQRA 5HX7A 4RS4A 1ZBQA 3WGNA 4O4IF 1Q57A 1W40A 4B3MB 3P9ZA 5HKLA 1P7CA 4XCVA 3ZWVA 3KE9A 4ZRDA 3LUKA 4R16A 2OCIA 1OBVA 3P26A 4D6XA 4HV4A 2VXCA 3IEVA 3VVCA 4D5GA 2P30A 3RVPA 1ADGA 3FE2A 4UFPA 1JJ2F 4B34A 1K6XA 3HBJA 3RFCA 4PC1A 3R5SA 3WTCA 1RMYA 4KXXA 1T0IA 4MHTA 3KFVA 2DYKA 2CXTA 2RB9A 1ONSA 4I4CA 1KNQA 1OBFO 4YMLA 4CMEA 3FHJA 4ZQGA 1KVUA 1I24A 2Y77A 5AYVA 1VG1A 1VKRA 6CHYA 2PMCA 1WF6A 2PIDA 2BGNA 5IAKA 2HTFA 2VJKA 4A8JC 4I08A 4EG8A 3E9CA 4W8GA 3W6OA 1OLSB 3VR6D 1A76A 4E5SA 1HDYA 1J06A 1KI8A 4CFZA 3QPUA 3VMFB 1ZK1A 2W2NA 4JK3A 3D01A 5AKEA 5J58A 4Y9DA 1JR3E 3LQFA 3W6NA 4KV7A 5JI2E 5IYZF 3E4CA 4YUYA 3L04A 1II8A 2A3NA 1HDOA 4P7FA 1Q22A 2DBYA 2IYPA 2APJA 3EA0A 1ZHFA 2G5TA 4H4CA 1WA5A 1K68A 3L1JA 1ZRSA 1G2PA 1NMEA 2OUKA 2ZCUA 4J0EA 3S5JA 3H1AA 4CMIA 5KNBH 3FOCA 4Z3OA 1FJHA 4UUPA 3CX8A 4LHZA 5CXQA 4CQJA 5KOHA 1U4OA 3RVJA 4GWLA 2ZRIA 5CLIA 1J0BA 4KO2S 2Z1TA 3C1TA 3EGEA 1XXHE 3OX4A 5GONA 3V42A 2IZ0A 2RB5A 2VK2A 1I6LA 2VJOA 3LLCA 1QP0A 1RQPA 1PV2A 4AULA 4NZOA 3VJMA 2Z2JA 3NETA 3TR0A 4IWXA 2OCLA 3A4TA 3ANYB 3GN2A 2PV7A 3QXGA 2EEZA 1OKKD 1Q2UA 3FR7A 1ONPA 4DXAA 1YCHA 4FSXA 4RZ2A 1Y7HA 5JJLA 1GTSA 1P7ZA 3ZWAA 2LZ0A 1N4AA 3RUHA 5EJ7A 3D2BA 1ODJA 2QW0X 4RVUA 5DNEA 5JXGA 3GFTA 1M5RA 5H70A 1QP4A 1L1EA 4ZK7A 2Q2VA 3LBAA 1F0KA 2YASA 3TPZA 1RLJA 1S72F 2C07A 2EFGA 2WA2A 4TS3A 1F6WA 3R5KA 1HYQA 2XSZA 2BSQA 1FTSA 4G8BA 3S2UA 3SKVA 2V9YA 3SWWA 3L8CA 4YQYA 3PPVA 3R7FA 1QUFA 2PEZA 3ROQA 4KMRA 3WV4A 9GPBA 3KXPA 4BKOA 2J6IA 3ZD8A 4AN1A 4EEZA 4YJ3F 4QHTA 3BN3A 2NXCA 4OBXA 1NJIH 4BVGA 3VR6H 1VXOA 9ABPA 4MIYA 4FINA 5IN5A 2OPHA 1HE3A 4CG0A 1PGNA 4BECA 3AG6A 2RDMA 2XXBA 4O4HF 4RJIA 3USZA 5DMHA 2BTUA 1HL7A 3KOXA 1MQ9A 2I3ZA 1YDHA 3ZWDA 1YT5A 1JQ5A 3QKIA 5E9WA 2NUPB 3HR4A 1KNXA 1XAJA 2Y6UA 1XGKA 1C3OB 3B8EA 2D4AA 4AJ4A 3EUWA 1KR2A 1V8DA 1Z7WA 3L84A 4FX5A 4FLFA 2VSNA 5KTRA 1L8QA 4RPKA 3AGKA 4LDRA 1VP9A 1U8AA 1XFDA 1Q6YA 1N0WA 2C0CA 2HYDA 3K2QA 2FRXA 4HUJA 3IP8A 5BNWA 4QJBA 2Q5IA 3DV0B 4HMPA 4IPTA 2NZXA 4OHOA 1WMEA 1IBKB 1MDBA 3PQ7A 1NYRA 3C41J 1VCNA 2XLBA 4GYYA 1AQ6A 4IQGA 3VNBA 4QICA 5ITVA 4DA4A 4WKGA 1CY1A 3O03A 2BFAA 5D5PA 1SKYB 2VJYA 2DLNA 5MHTA 1T2AA 3T1OA 1ST3A 5KAPA 3H17A 1P7VA 1YB2A 5EG5A 2VTDA 2QUJA 3D8NA 1PL0A 2AI1A 3A6JA 3IUYA 2R6DA 5IF9A 3UK7A 4F84A 4RHFA 5HWEA 1CZOA 1E6UA 5CGQB 2J0UB 4YWHA 3TTVA 4EJFA 4CLOA 4G2TA 2AX4A 3BE6A 3KQYA 4ZCMA 1R0WA 4I8IA 5H0IA 2NTVA 1ODSA 1SKAA 3CLRD 3MT9A 1L9KA 3O1IC 3VUFA 3PCRB 3R7NA 3VUEA 3G6EF 3L0ZA 5MN5A 2GEJA 2I2DA 3DTNA 1BA3A 2EQ5A 5GADl 1E4YA 3PWSA 1YJWF 5CH5A 1Q16A 4QX6A 5BORA 1BE8A 1NBEA 3EEYA 3HR8A 1LZKA 2V5UA 3Q6IA 4M4SA 4QUBA 3W5SA 1HR0B 3GCZA 3OCJA 1X1QA 5GM1A 2DT5A 3O94A 3UOGA 1AHHA 2J46A 2UYQA 4L95C 3IMCA 4US1R 1II8B 4QOHA 4X1YA 3PHJA 4H1HA 4P5EA 4IWYA 3P5SA 5A1TA 2WWWA 3MMSA 4UAUA 3AVXA 4R1SA 4URWR 1ECGA 4FILA 2WJGA 3T1HB 4H16A 1OE0A 2VHXA 4WLOA 4C4PA 4BXOB 1ZHHA 4CMIB 3E9EA 3ZBUA 1FXSA 2WFLA 3FVWA 1J0EA 3VXKA 2MSLA 1JPNA 4ZT7A 1ISSA 4CJXA 4Y2RA 5B6JA 2P9ZA 4GH5A 4W5HA 3RKRA 2CWDA 2CMDA 1HG1A 3VYUC 3CX4A 3DYBA 1XQXA 3PFCA 3RIMA 1E92A 4BRWA 2WG2A 1CEEA 3PTLA 3OICA 3N0TA 1CK2A 2XPCA 4BJ6A 5CEJA 3FHCB 5EMMA 1JDSA 2Q8PA 1BG6A 1IRIA 5DGDA 5KSOA 3Q6NA 1AJEA 3NJ4A 4QPNA 2VYVD 4LS3A 3BSSA 3TOXA 3NIBA 3UUEA 5LYJF 4LRQA 1GFWA 2I6UA 1NI4A 2AC2A 4UAGA 1RABA 1RBQA 5FOXA 3DTTA 5AHKA 2F1OA 3I62A 3ZOKA 1RYDA 2SKEA 5JC1A 2XTJA 3K9HA 1LJLA 2OP1A 2PV0A 2VPWA 5JZOA 1U0GA 2RHGB 4BE9A 3PXUA 1RNLA 4GM4A 2QI9F 3FG9A 4XM0A 5LSAA 1CDZA 3PNLA 1FYEA 2R68A 4OBBA 1O94C 2X14A 3QVVA 4YO7A 3WLTA 4DOMA 5T3YA 4R2KA 5C37A 2G1KA 5T8KA 5F98A 1EK0A 1P3JA 5G0UA 1C0PA 4ICIA 721PA 5FPSA 5EIEA 5CCBA 4FC6A 3FGOA 1ABEA 4NJOA 4NEHB 5T5QA 1W88A 2WAYA 4INJA 3N2GB 1ZMOA 3HXPA 1KMQA 1OA0A 4YHBA 2J85A 5LIPA 1ZQ9A 3RWBA 4Z4QA 2V55B 4RLFA 5EIAA 4ZT4A 1G21E 4XM2A 1P17A 4OB6A 3DFMA 1MJGM 4MDFA 5EJEA 1KYWA 2XF2A 1SKMA 3ZGZA 5DKFA 4BGUA 4N65A 1NPTO 1DBVO 1CU1A 5DT2A 4PLVA 2C98A 5CB4F 1N5IA 1K9SA 1V4NA 3FB4A 1D2EA 1TF7A 3LSYA 4KPGA 3DVLA 4TXNA 2OV3A 4MR8A 4X94A 2OHIA 4GYWA 5DLPA 3RGGA 4DS3A 2IEYA 3OQVA 2VHJA 2BAGA 3T15A 5BV8A 1R64A 4DIBA 1KKLA 5JCJD 1T0BA 1VSQA 2CCKA 1WM1A 3Q15C 4Y98A 4X62B 1WSAA 1XZ8A 3WSVA 1JFVA 1F8YA 1VSVA 2VNAA 3BXPA 3IP3A 3R41A 1QUEA 2M1XA 3EGXA 2Y1FA 3JQQA 4QO7A 3RIEA 4BPBA 3IKLA 5DO9A 4S1WA 4ZAXA 4ITUA 1YHYA 1SXJC 2QMYA 3LWNA 3UT0A 1MO4A 2H1RA 3WIBA 3LWPC 3WFIA 1Q91A 3T9FA 3VKVA 1ZICA 2QIPA 1XVVA 2QY9A 1AS2A 2XT6A 4JSRA 2RG7A 4ZVUA 2PX4A 4KYIB 3UWKA 5HQ3A 1NQWA 4Y2YA 3H2ZA 4PONA 2GJAA 4XQ9A 4ZVLA 2VUTA 4EZEA 1TT5A 1NDQA 4Y6SA 4KJXA 4DLRA 3MTJA 4DA0A 3KV1A 4D43A 2R6HA 1ZUNA 1MRZA 4G86A 1FRFS 2OGSA 1C5KA 3W6PA 3RHTA 4CV1A 4ON9A 2R79A 3K0HA 4OAPA 1W3EX 3OM0A 1L5ZA 1SBIA 4LJLA 4ZREA 2UVPB 5LQJA 3H9EO 1XKQA 1EWKA 4UDXX 1DOHA 4NMXB 5HDBB 4EI2A 4HNVA 3GLIA 3F1KA 4B6RA 1VKHA 3QU9A 4NJMA 1T5HX 5EEHA 4FYKA 4HH4A 3WWCA 1QIHA 4MSUA 2WQZA 3UHAA 4DEVA 2CDNA 4HH1A 4BV8A 2XI4A 1UKZA 5FBLB 3S06A 5D2CA 3WLPA 1M8KA 3OQ6A 3GGGA 3NNSA 4RC9A 2A3RA 2EW8A 1GRQA 3OIVA 4NLLA 5ALTA 1GVHA 2IXBA 3W5DA 4Q21A 1W5FA 3F6RA 4H7IA 5I45A 4UULA 3L4JA 1NMYA 2VP6A 1AA9A 1W73A 4L8VA 4ND5A 4ZCSA 1BHO1 1R6UA 1U43A 3ZWXA 5A4IS 5AM5A 3IP5A 2Q5OA 3PE3A 4I0WB 4RL6A 4QQRA 4P0QB 4MGKR 2C5BA 2H85A 3IQDB 1EVQA 3CRVA 5EQTA 4JP5A 1CUHA 2B82A 2V54A 4EATA 1GSIA 1NQTA 2JFGA 3FLEA 4O0LA 4EA7A 3WV5A 4G4XA 1HXHA 2IHUA 1N7IA 1SRRA 3BL8A 1R5JA 1U6KA 3LDAA 3MLBA 1MX1A 3IVCA 4HSEA 1N4DA 4EHIA 3LD9A 1OXVA 2WSSA 4L8LA 1YGYA 4N40A 4CEIB 2PN1A 3ILHA 2VJAA 3L79A 5E7JA 2XUAA 4I50F 3QPWA 4BO6A 4BP8A 1YWGO 4X65B 5FTLA 3CTPA 1X74A 2QOEA 3FCEA 1JHOA 4EW6A 1Z3CA 1BS9A 4D4HA 2EJUA 2PM8A 1UBOS 5DW3A 1QYDA 1W88B 3O3MB 1DV2A 2E4AA 4FR5A 2FMIA 5K3OA 3PVSA 4AJ9A 1EP9A 1N6KA 2BKXA 3A6DA 3OEWA 3QJYA 2IUYA 4EA8A 3L77A 4NOLA 4MWBA 1T24A 2F43A 4QLOA 2YZ7A 1V3VA 3Q2IA 3WJ2A 3C15C 2ZUDA 1J5EB 1Q3KA 4L07A 1HFKA 4ABTA 3FKJA 2OZEA 5DHUA 4Y2GA 4YCJA 1ZWKA 2BJWA 3L2OB 4KQMA 4R8MA 2Q0QA 4MAAA 1FMCA 3ZHQA 5JPIA 4CCSA 4BLVA 1NKSA 5H4GA 2F8SA 2GCOA 4M1SA 1EX6A 4HRYA 2G6BA 1L4KA 4PQGA 2PQ2A 1SPBS 4HGRA 3TQOA 5ITZA 3OESA 1TEVA 2ECKA 5CVUA 5F33A 1CUFA 3FFMA 3FNGA 4EJSC 1N6RA 4R40B 4G5YA 2C4MA 1SCBA 1NN3A 4N3AA 4EWLA 3JQRA 2WILA 3IPAA 3PDHA 3EGXB 3MGBA 1EE2A 3VJKA 1A2QA 5TC4A 1IDOA 2LE0A 3KKNA 3GGDA 3LUPA 2JI9A 1RJ9A 3BRSA 3JYHA 3LUAA 1DUSA 4NOJA 1C1XA 4TOIA 4XW2A 4LOKA 4LYHA 5KHAA 2IXEA 3BORA 5C53B 3EEFA 4PZAA 3HWRA 4U2GA 3TZEA 2OM2A 4EPYA 3BDVA 2G07A 1K1EA 1C9NA 4BCDA 2OAEA 3ZZ0A 1T3LA 1E9CA 3VPXA 3AERA 4CIAA 4ZC8A 3O8DA 4MCAA 7MDHA 1FNMA 3DOIA 5HQ3B 4G4WA 5H83A 1YCFA 3N5KA 5JE8A 4E31A 5K0TA 3I3FA 3CRZA 4KVZA 4IH4A 5THKA 4MPDA 1ZSVA 2Z4TA 3DXZA 5J47A 2C2ZA 1NUUA 3AINA 5FP0A 2ZRDA 1NPYA 1O9GA 1EINA 3VM6A 3OZ7A 2I4MA 4F6CA 1F5SA 5KC8A 2FEMA 3HCEA 2OLJA 2PMFA 1X7YA 4OFZA 1KAQA 1Z6ZA 4NSNA 1OY1A 1MOPA 2ZM5A 1UOQA 2PSEA 4G8JA 1XHEA 2PNJA 4KDCA 4LXUA 4IOLA 3GLGB 3VPFA 1A8SA 1L4YA 2VJBA 3HJGA 4DV6B 4Y6RA 3R0JA 3N2ZB 1L5VA 1E1MA 3PTAA 4WNAB 3WJPA 3AY6A 1EVYA 3CN9A 3GFQA 3NM4A 3AVPA 4NDNE 4ONEA 4UAJA 5JEDA 1IVSA 4QUJA 4MWSA 4N1AA 4PYIA 5ALHA 1AUQA 3HJAA 1YRBA 1JG4A 1VXRA 4PANA 4EGJA 2E37A 2YNMA 3AY7A 3DYVA 1N8SA 2FK7A 1KDYA 4OM7A 2W2VA 4DMUB 2I3BA 3HB7A 3CWZA 5HGXA 2I71A 1FFAA 1UQUA 4OI0A 1O08A 1M0SA 2GASA 3FCSB 3FVVA 4Q39A 2VPTA 4WOKA 3USES 1L4NA 2LR0A 1W76A 2VRCA 3O84A 4RZIA 1RRFA 1NR7A 1OFIA 1KAOA 3NK7A 1JLKA 5B1YA 2ENUA 3KZMA 4MEBA 3WXMA 1FU8A 4DM3A 4YLYA 3C3XA 3QUAA 4M38A 4AKIA 5D7BA 1HL3A 3KJQA 4ND1A 2JGKA 4UCXA 5DDIP 5ALLA 2Q9CA 5L7TA 2HQBA 3ACBA 2CDBA 3PQFA 4Q18A 3TLYA 1CX9B 4DQ0A 5KSWB 1QB8A 5J2UA 3GT0A 1SXHA 1T5BA 4BMNA 5IHPA 3DAFA 1BS2A 1I1QB 1YI0A 4KR6A 2H1SA 5EQFA 1RAIA 1BMFD 1SHJA 2RK6A 3FWZA 4DCTA 1VFPA 3FWHA 4R68A 5EUBA 4EI9A 4ZEWA 1P19A 4P7BA 5IK2A 3FNIA 1EZ1A 4QTUB 5MFPA 1JFSA 3V9PA 1Y89A 2QUIA 2A35A 4U2EA 3WYEA 1VLHA 2IPLA 3LW7A 2WJHA 1X9GA 3CF4G 3TQHA 4ECAA 1KVQA 2C7VA 2NO9A 2QV7A 3KE8A 1E61A 4LHWA 2KLHA 4MQBA 1MA0A 3FUXA 5FTMA 1MNQA 3NWPA 4B40A 3B3FA 3IUBA 4J4HA 5AJYA 4NS1A 3EBOA 1CUIA 3OKCA 2BUBA 3P9IA 3A3NA 2OO5A 3ZI4A 2H1FA 3O5AA 3I1IA 5FKJA 4JLSA 1I7NA 2FPIA 3W1EA 3ER8A 1QWOA 3HWWA 3RBZA 3VTKA 4DC0A 3KEQA 1KAHA 1P1HA 2GCOB 4IKEA 7AT1A 5DSXA 3JAWB 1YJAA 4OAQA 5ITZB 5T67A 4X3CA 1GSAA 4E13A 2OP0A 3NBYC 1Q1EA 2ESRA 5FI1B 1PNRA 1K86A 3KEFA 2R11A 4J3NA 3I04M 3PL1A 3A1TA 1LI7A 3UPDA 3OFJA 4P3PA 2NZWA 4UU0A 4KE9A 1RJ9B 4D99A 1CXZA 4Z7OB 1W4RA 3ESDA 2UUBB 3OQNA 1H6BA 1CP3A 4NH4A 3NBZC 2Z6QA 1DSSG 3DVAA 3HMKA 2ZRKA 3DEZA 3DMRA 2OENG 1PT8A 1RAEA 3AERB 3MTQA 5ALVA 4XYBA 1KFJB 1ISMA 4L4UA 2ZIFA 2JFYA 5IJ9A 1JI3A 2VHCA 3G2OA 4A92A 1Z13A 4P4UA 3BZWA 2WWYA 3IIIA 1WXHA 2FW6A 4BZWA 3TRFA 4OXIA 5I7UA 5JV5A 3T5AA 1TAHA 2QRZA 2UDPA 1DHTA 1PNQA 3B36A 3JD0A 3LX4A 4JYCA 3MYYA 3MT7A 4XOIA 5IC5A 1S8NA 1PX2A 1I32A 3HY4A 2ZXUA 2Z2YA 2ZS7A 3DKKA 4K8OA 2CNDA 2W9XA 2GGSA 2J9FA 5JWOA 3D64A 3FMOB 4C14A 3TQCA 4N8EA 2B8JA 1CCWA 2FUEA 2VF5X 3PCXA 5JQGF 4QUIA 5GIOE 1JQBA 1IHUA 4M9CA 3FIUA 5AM4A 4KXMA 4DLYA 5K0GA 1HX7A 3ENWA 1FVHA 3NEJA 2I65A 4GVLA 4RV5A 2W4QA 3FFXA 4Y67A 2WU3A 2QIOA 3DEJA 4LTMA 3UCFA 5CXXA 4BFZA 4E11A 3GB9A 4JX8A 2TS1A 2NTYC 1IB6A 1R74A 2FW8A 3GPIA 1KC1A 3LA6A 3PNOA 3WBFA 2GETA 2VS1A 4UCQA 3H4MA 3GJ3A 3AKYA 3EFHA 2ZZNA 1JHRA 1OX6A 1P61B 2QLMA 1OWMA 2W6CX 2YV5A 4LK2A 4AY3A 1TAGA 1CE8B 1ZSYA 3LX8A 3ZX5A 1J22A 5HILA 1M33A 4RPLA 1Y7PA 4HG2A 4IXMA 2QUAA 4NIMA 1W4BA 1Z4IA 2YMPA 4UNIA 2PJZA 2CXSA 4BTVA 5DTIA 1B2RA 1GL3A 3GRVA 5A2QM 3IIMA 5L3SA 4DVJA 3QGMA 3GRRA 1AO3A 3KELA 2DWOA 3BBPA 3FYCA 3I04A 4QG7A 5GQSA 2B4RO 2HF7A 3CTMA 5ES4B 3U61B 5J2UB 2GHTA 4XGRA 4Y2SA 4G0NA 4B6GA 5E3HA 3C7AA 4LDQA 4ZZ1A 2HK9A 4MYCA 5L6LB 2CFIA 4IHJA 1PT6A 2HS3A 1ZGBA 2YMQA 1FDSA 4G0ZA 2XWSA 4NUTA 2OCDA 5EQDA 1YSCA 3MMNA 4FT4A 2VYND 4X9XA 3UK2A 1PS0A 3GA5A 1OPXA 1GRVA 4HDCA 3BH6A 1K8AH 1N2GA 3FMGA 3RRNA 2DJIA 2I29A 1IWPB 3DE7X 2FJUA 2INGX 1ZNYA 1EFKA 1NBMD 3FUVA 2HS0A 3JQGA 1FDWA 4CCAA 2CLIB 1V9CA 3ZHSA 3IIJA 5E3JA 2QT0A 3NB0A 3UA4A 1T26A 3KT0A 5SYAA 3L9WA 1X87A 4BVEA 1VI6A 1RYNA 1JLLA 2ODQA 3CV3A 3BWXA 1RC1A 5DZSA 3HXOA 2WB2A 1XX6A 3AF6A 1Q81H 2OHVA 1DRKA 3ASYA 4OK3A 2PFKA 4ZCRA 1DC6A 4W5OA 3HCCA 1WIWA 2IGTA 2VQ6A 3LVFO 4TX1A 5B12A 2OL4A 1XWIA 2VQSA 1WNTA 2FPIB 3ITEA 3AEZA 5IM4A 2COKA 4L50A 2YV3A 4F6RB 4HC4A 4GU5A 4UBIA 3MCAB 1EVKA 2RCNA 1O87A 2LP4Y 2ZR9A 2GZLA 5G0TA 4C0KA 4RSHA 3DBHB 1P5FA 1RYEA 2ZOSA 1YFKA 3L0PA 4OM8A 4XD7A 4I9NA 3TSZA 3BX1A 4R5HA 4Q7JB 2WHRA 4LISA 3UTCA 3KR0A 4F21A 3PRYA 2Q2OA 2FEKA 4G2NA 5K5EA 3KQMA 3UJPA 2JFZA 1NQOA 1ZONA 2QKYA 3HDVA 1YJBA 4O25A 2C20A 5FOUA 3ZHOA 2WTBA 3FGPA 4U7FA 5AVSA 4LQ4A 2WV7A 4PPNA 1GQQA 1OAKA 4KV9A 2NGRA 4MB0A 3V97A 2O8NA 3N6VA 2I1WA 1XPJA 1ZGAA 3ISJA 1VIMA 1W0KA 2E1RA 3DDSA 3Q9NA 4UNRA 4HAVA 4OKSA 2ZYHA 4FEYA 5A2QA 4RACA 4BQRA 1YK1A 5KS2A 1ZC3A 1QIFA 2H7CA 4MVJI 3J7AC 1KRXA 2HEIA 3AW9A 4DSTA 1MRSA 4H4DA 3RU2A 2XGMA 1DG1G 3NQ41 1TCAA 2GD1O 4BKQA 4RTKA 4L5JA 2O06A 1ILWA 4KVFA 4BQNA 3LV8A 2ID9A 3MWLA 3ECAA 2G17A 2GA9A 3BILA 2X4DA 3PKJA 3X44A 3L8DA 5FYQA 1TO1E 2SECE 4QT4A 5FBZA 2M32A 5KHLB 5KUTA 2P4EA 2PUFA 1Z5UA 1W4AA 2HU2A 1EVIA 3EYWA 1E2QA 1ONOA 3HWSA 4U5XA 1PJ8A 2D54A 3WQQA 2JZOA 2OV2A 1NJ2A 4JQSA 1A82A 1NJSA 2XVAA 2X0RA 4BU1A 1Q1ZA 1R0RE 1ICEA 3NC0C 2MWMA 4W8OA 5C1BA 4BVSA 4OK5A 1FFBA 5AIBA 1RRMA 1BX3A 1F14A 3A1SA 1IZ0A 2JVKA 4KFSA 4CF5A 3A37A 4ZP1A 3IUNA 3S2EA 2F9MA 2PUBA 2OESA 1K27A 4OJMX 3VJLA 2MIIA 4N6OA 5C1DA 1JG2A 4X1IA 1X7ZA 4YRSA 4CF3A 1SHUX 4QE3A 3ZDYB 4DGSA 4F04A 1K6IA 5EP4A 2WM2A 3E2PA 1OFTA 2QBYB 4KI0A 3A6PC 2OV1A 4IJWA 3KKQA 2G9ZA 2X6RA 1GV1A 4NAVA 4UE2A 2UYHA 2P6YA 1VMAA 2V6GA 4OG2A 5IVHA 3BGSA 5L3SB 4ENPA 5FADA 1SO8A 3AUUA 2V98A 4H59A 4BFYA 4BX8A 3VR2A 5K05A 1XYVA 2DBVO 5HS6A 4FFSA 2DG2A 3QXCA 1I30A 3HEBA 4OQFA 4RQTA 3S2SA 3HFJA 1NQAO 1GTL1 1NW3A 2WSSD 4K6CA 2E2WA 3KZ1E 1EIWA 4A03A 4IHJB 2F1IA 2NXJA 5ECWA 1MO5A 2ZROA 5A7FA 2G40A 2I4NA 1ZGCA 4B2PA 2WD7B 1R4NA 4D9JA 1X38A 2QQFA 1X8KA 3C87A 5CIQA 1JJAA 2I87A 3HEAA 1MIHA 3CZPA 3PX3A 4RCVA 4L6CA 2BGGA 4DDVA 4YRKA 4GMXA 2UUCB 2IGBA 2IZZA 5IULC 4UREA 1FFDA 4R8LA 1E3WB 1M6HA 2IU3A 3I05A 3K8OE 3OMWA 3ZTYA 4Z53A 1RJDA 5IT4A 4HQLA 4IJUA 4B7ZA 1N3IA 5KYTA 3OOYA 4ZYYA 3RYHB 3J7AR 3L7LA 3PHGA 3QIAA 4DYHA 1YS7A 2AJTA 1UDXA 2CJFA 1U3TA 2YXEA 3T3MB 4DQVA 3R3WA 2ZS8A 5ELXA 1PNOA 2DBQA 1M2FA 2PZJA 2ZQZA 5CH8A 4FGLA 5CK5A 1C81A 3OQHA 4EY5A 1J2UA 5EZYA 1U3CA 3KB6A 4U02A 3I9V6 2O9JA 3MRVA 4Q1FA 1ZIOA 1Y7TA 3O2NA 3CZQA 2GOYA 1AA6A 1ZH6A 2XQVA 3BXFA 3C43A 1WUTA 4IFBA 1MMFB 1NMSA 2IIVA 5BYJA 4QEDA 1DAKA 2D5IA 3DUFB 3IXMA 2QMOA 3ETGA 4EB8A 1AQYA 2RK4A 1Z68A 1UMCB 3H42B 4OKIA 4Q01A 4INPA 4G5HA 1P62B 2YRXA 3WAGA 1MD9A 5T4EA 3RJ9A 2GXAA 1EWTA 4B62A 2PQ6A 3RVNA 2FFQA 2H1IA 4FK8A 4EPRA 1CF9A 3PHHA 3SHOA 2ZBUA 3QKSB 4M49A 1G98A 4RMGA 2NLOA 3VTAA 1E1CA 2BGRA 4MAMA 3TX6A 4U3JA 1RWKA 4PWTA 1H1TA 1CZUA 2IS2A 1ITZA 1IN7A 3HKBA 2ZSEA 4B9EA 3PWKA 3ML1A 3ELCA 4HMOA 1CDOA 2I3DA 1VOTA 1QAMA 2ZSUA 3D4IA 1MAUA 3I39X 4WZAA 3RF6A 4UTNA 4TWBA 1THMA 4DW8A 3PNSA 2D1YA 3G85A 3GJQA 4CDMA 4TVBA 3WX0A 1B6TA 3UQYS 4X44A 1AS3A 2PMBA 1J2TA 3GRKA 3KYIB 1ENYA 3L02A 5EY5B 4EVSA 5FNVB 2LCFA 4NV0A 3HSYA 3M6AA 1SKYE 3OC6A 4LJKA 5SY9A 5LUAA 6ABPA 1E7WA 5C31A 5DOZA 1Q7EA 4C7KA 1OROA 2VRNA 3CLKA 4HH3C 2CHSA 4HR7A 4N5MA 5CFLA 2QGFA 3KIZA 2CHQA 2D1TA 1PT7A 1K8YB 2QTPA 2HA0A 4B2LA 3SDBA 4F92B 2RHMA 5HQTA 4N48A 5DBFA 2YNMD 2HOQA 2LBXA 4PVCA 2B4YA 3EXEA 5K3EA 2ZYTX 1KEWA 5E6RA 2GJ8A 1V71A 5CLHA 2HXSA 1KSFX 4LCKA 5HCUA 2H16A 4C03A 4K26A 1X7ZB 3JZFA 2QL6A 4IS3A 3SQXA 4PGMA 5B1EA 1Q5PA 3LC0A 1EGMB 1OYWA 4FD3A 4L0MA 1QLJA 1B16A 4ZYTA 4J2HA 5B4UA 1GKUB 4C04A 1P4SA 5CAEA 1QZUA 3FTEA 3M2TA 1VE5A 4L0DA 2O7SA 4UPDA 5KC9A 1CRWG 4E3WA 2JDIA 2FZ5A 1PV1A 3NP7A 3VH4A 1J00A 4G0OA 3WWEA 3GJTA 1SCUB 3JZIA 4IHKA 4NFYA 1NI3A 2IHJA 1Y1LA 1YB4A 2DFDA 3ON5A 4TXJA 1FJ2A 5KNDA 5HZMA 2AG5A 4TSFA 5G1NA 2JHPA 4YGXB 3I9V1 2V1XA 1P7PA 4M9XA 5DSTA 6AT1A 4E46A 4UMVA 4YBRA 2B1QA 3G4SF 1YJ9F 3G8AA 5CLJA 1R4NB 4JKIA 1QBKC 3VR4A 1PJ4A 1NJGA 3CLTC 3FRJA 3O3OB 3UW3A 4X1KB 2QYSA 3WJ7A 2QSUA 3U6KA 1UPCA 1JNXX 1ZNZA 2AZMA 3KVVA 3D1LA 5EJ4A 5J4VA 4C8GA 1GNSA 2CCJA 2ZTHA 2W71A 1RM4A 4MP8A 4X6XA 4A2PA 1EJBA 1Z56C 3F49S 2P77A 5B37A 1J0AA 1FQJA 4U2CA 4TMVA 1U9CA 4HTAA 3RSHA 3T3EA 4JEUA 5E8JA 2JFUA 3E9RA 4EARA 1LFAA 3B1XA 3WGUA 2FW9A 2Z43A 4FFNA 1ZVKA 1SUBA 4FUTA 4JBXA 3VAZA 3DTVB 4EFNA 5I47A 2R7AA 3GRFA 1WZUA 1F0NA 3KXLA 4YRPA 1TC2A 2PTGA 3D4NA 4COKA 5JS1A 4PU0A 1QMPA 4LRWA 4OYYA 3ETCA 1CF4A 1S7CA 2QZZA 3GFGA 1NX9A 2DPGA 3VHRA 1OV4A 2P6MA 3OJEA 2P3SA 3HTNA 1N8TA 2FYTA 4AYXA 1QDLB 3B2NA 4MUBA 4MYUA 3THXA 4WJKB 1SULA 4J94A 2VAPA 1CY0A 2XKAA 5G4UC 1YDEA 3SYNA 1P81A 2XOKA 4KPEC 4XB1A 3DEFA 1IPHA 4BT2A 4L8FA 2NMVA 1KYYA 1JH9A 2OTLF 5KVQA 2XUDA 4EBBA 4N5IX 4L5IA 3WZ2A 2RBGA 2CLKB 3FAZA 4PO3X 3CXRA 3H8JA 1TA0A 1X3SA 2W4MA 3IAFA 1R15A 1BW9B 3IPCA 3E48A 3KVRA 1TOAA 1PKEA 4MINA 3EZYA 1Z62A 1X7DA 1KI3A 3ZVMA 2GMWA 4DBLE 1N78A 3C97A 4R83A 1YDWA 3UMSA 3TQRA 1OH8A 4U3JB 3TUJC 4TLMB 4WFIA 1ZSNA 4EH1A 1XU9A 3L82B 5EJAA 4LHYA 1K66A 3B9PA 4AMBA 5KTYA 1UPAA 1JJIA 4HTFA 3U4MA 4JJGA 4MHSA 3GNTA 3PNMA 3IQGX 3U0VA 3WISA 2WV9A 4CV3A 1XD2A 3M9WA 3FVRA 1AGRA 1B8PA 1B4DA 1GKKA 1MUUA 2WF5A 3N8KA 3OSZA 1F0PA 4AJEA 3IPXA 3B20A 5TMBA 4NK5A 1XZEA 1Z33A 1WDTA 2YUIA 1LDBA 4NBTA 1WCV1 4X93A 3VR1A 1C2TA 1VPVA 2R97A 4M8SA 3RUEA 3PBKA 1J6UA 1QV7A 3D0QA 5D6OA 1EXDA 3TW8A 3LY8A 1XWFA 1FBNA 2I22A 2BKUA 5H81A 4EHHA 1X7GA 2W43A 3A58B 4FI3C 4J0KA 4QDJA 4ARBA 4GLBA 2PBZA 2V7VA 3G5TA 4BZZA 4YIHA 1Y8RA 1GG2A 3FFWA 2W7TA 5E6RB 4QREA 5A4FS 1DL5A 3RHZA 4K7JA 3PNPA 1S4MA 1H42A 4HPWA 4DA8A 1D2AA 3JQ6A 2O6HA 1RRCA 5K4AA 4B3DA 1KRWA 1G2QA 4JP2A 1XZCA 3ZQ6A 3NBFA 3HJNA 4KODA 4XEUA 4BLQA 1CLUA 3GDFA 3S29A 3HWUA 4US0R 4D0GA 5BVHA 4FDAA 2HIHA 3A2MA 1JHZA 1QCYA 3HQ4O 3L5KA 3ND9A 4R81A 4EK9A 4CEJB 2UZ1A 1AGXA 4PYNA 1EK6A 2PAFA 4HH0A 2HJWA 3CSUA 3KBBA 4MRMB 4RVOA 4YACA 5HDQA 1QIIA 5K51A 3ZK9A 5HWSA 2XCTB 4B6FA 1UL1X 4NG4A 3THRA 1EQ2A 4CTKA 3CX6A 5HIMA 1Y5IA 3GFPA 2VBIA 4YHHB 2ENWA 4AKGA 3R7DA 3B6EA 4D4JA 4ARZA 3F8TA 5CVCA 1XJCA 4EHFA 4Z4HA 2CVLA 1KZ4A 4AG3A 2F9LA 4D0NA 4DMKA 2HU5A 1GU0A 5AW4A 3BXOA 4B33A 1F7VA 2HRCA 4PX2A 1SQSA 3JZDA 2C59A 5AVZA 1OD6A 4GHWA 4HQFA 4PE5B 3RFXA 4XPIA 4HLNA 2G04A 4MI3A 2Y76A 2GK7A 1WSWA 3WMRA 2XVYA 4IF6A 1BC5A 4BNHA 3GUZA 3GFSA 2P9CA 4HFJA 2P9EA 3GCWA 3FNEA 3E1SA 1AM4D 3O8LA 3RASA 2YVAA 4LOLA 3KETA 5KTSA 2W2OA 1I6WA 2F1HA 1E5LA 4BGVA 1NUTA 2XCRB 3UUGA 1UZNA 2POCA 3NOOA 5KNCH 3L6UA 1GVNB 3NBAA 4DCCA 1INLA 4O2LA 3C2QA 1E5TA 1ZW6A 4NCHA 2B4TO 1OYOA 1W9MA 1FP2A 2X5OA 2E55A 3ZY2A 3SVTA 3HVRA 5IASA 5F9HA 1IPAA 2IP4A 3D8HA 3THXB 2AOUB 2ZYWX 1UMDB 2C2XA 4L5YA 1SBHA 2IYZA 5BN5A 1RBMA 4OIMA 4KXUA 2P4SA 2I33A 2YWRA 3EJWA 1E1QA 1CY4A 2CJYA 4IS2A 1T0KB 2PO7A 4N8DA 1X13A 2WYWA 4XARA 1ENZA 2A94A 2I0FA 1R6DA 2XGOA 2XR1A 4ZVVA 2ATIA 3OD1A 4XI9A 4A5SA 1KWKA 3LLUA 3P0IA 1OC4A 1BWQA 2WF7A 4DCMA 1CZHA 2A9OA 3VZDA 4ALIA 2ZIVB 4RIHA 1NBME 4U00A 4WT7A 5HA5A 4F45A 4ZQEA 1AU9A 2CKDA 4QQ8A 3D2LA 3S2ZA 2XDYA 2JFFA 5L3RA 3B85A 5BNZA 1XE3A 1XHFA 2ADMA 5FWAA 5I9MA 1A8IA 3HVJA 4Q1VA 3LU1A 5D3MA 1G3IA 2H06A 2NWQA 2ZRJA 4ZIRA 1ZAYA 3PFGA 3T8YA 5M3BA 5TLSA 3Q3EA 1ZRMA 4HBGA 2H54A 3FFTA 1IEVA 4P2GA 5CNMA 5A3JA 1FMFA 1LK7A 1GPYA 1XD2B 2RAUA 3M5CA 1VTKA 3NS7A 3GLSA 5B1DA 1IK6A 3RRYA 3ZS8A 1OTXA 1F9EA 1QORA 3H9GA 4KZPA 4LPSA 4TTRA 3SJCA 1U9YA 3QHAA 3IJ5A 4TPKA 4ZCTA 1NM5A 1PZNA 4PZDA 2VSFA 5CFQA 5IBPA 3FIJA 4QPZA 2LRHA 4RGBA 1N2OA 4XWGA 4WK0B 1BAPA 2IT1A 4GF5A 5TEVA 2IQQA 3ZV7A 4BMYA 4DCSA 5JAMA 3N76A 4FZRA 3OBBA 1G66A 1RACA 1WMFA 1QGZA 5JSHA 2AB0A 2BJHA 2FN7A 2HA7A 1TO6A 1U9IC 4M21A 2R87A 3DDZX 4NDZA 2FY8A 3PQ3A 1P6UA 1L7VC 2FPLA 2LBPA 2R60A 4P82A 1Y8RB 5A03A 1EHCA 2IPAB 3DDHA 5LA6F 2HSWA 3E81A 1I01A 2R8XA 2VWPA 4FYXA 4RVGA 4BS9A 1F8FA 4C0SA 3NM6B 2I80A 1UK7A 4RD1A 4Z4CA 1BYIA 2R3SA 3RU3A 1Z5PA 1TJ4A 1EI9A 4FNOA 4GEGA 2Q5CA 4QJ3A 3I7TA 3UK6A 3QEOA 4TMFA 1JW9B 2VHZA 2I54A 2YHIB 1FNDA 2V6JA 3H9UA 3HJBA 1GG9A 3Q0EA 3QOWA 3KKKA 3LHSA 4IJ6A 4DE5A 3DVQX 4QELA 1TQ2A 3VOAA 1Q82H 2W48A 1M66A 1KJYA 1KQNA 4DUGA 2FU5C 5F1PA 4E32A 1E2FA 3EISA 3MQWA 2IV7A 1UDRA 1WTAA 4GLOA 5JT1A 4GVPA 1C2YA 2FSFA 4OGLA 2EW2A 4D8YA 1NW8A 1JIUA 4EHDA 1TUBB 2AWNA 1FP7A 4JI2B 3K6KA 2BZ0A 3K9BA 3GLGE 1SVOA 3F67A 1BJRE 3DE5X 3D7NA 3PNYA 2W8BA 2HHCA 3GMDA 3KPUA 4MKXA 3REOA 5AM3A 2BFEA 3FOZA 2WVGA 3AEKA 3ZYCA 2Q8NA 4DG8A 3L6BA 1OGYA 2PUTA 4MQEA 3VISA 5C0OE 1K5HA 2CD7A 3MCUA 4N0EA 3C7DB 3IAHA 2ZAYA 3PNKA 1IXYA 2FE4A 1E7KA 1UODA 4RVNA 4W1PA 1JU3A 3LG2A 2W70A 5JS6A 2A9VA 4ZOQI 3HP4A 5DRTA 1KS9A 3O6VA 4OHXA 4ZZ3A 3DTVD 2BEVA 2P3OA 4AMUA 4C2AA 2V59A 4M99A 2HYIC 4NX2A 3A1CA 2GAJA 2ZIGA 1YVEI 2A5JA 4GRDA 1DHRA 4V39A 3SX4A 3T99A 3BWCA 4FCVA 1RXVA 2R85A 4B2IA 3U5TA 4DILA 3NVKI 4GECA 3HB1A 2ZVZA 4O2AA 1GFIA 1SU8A 1O9BA 1H85A 1NP3A 3OF2A 4FI3F 2QT9A 5CYFA 4DNOA 4UCFA 4E1AA 2BM1A 2PU7A 1SVSA 3E1YA 2VP0A 4OP1A 3VTIC 1RMTA 4Y8VA 5IJ0A 2J3LA 3LFHA 3BC1A 3ASUA 3OI7A 4LRUA 2P4QA 1J4AA 2AN4A 4S3MA 5TMPA 4W5RA 3VZSA 1P2DA 2JGIA 1QX4A 1BMQA 2Y2UA 3KJZA 5EXTA 3BKXA 5I4IA 2K2WA 3TGWA 1ZMRA 4X41A 3MMZA 3EEIA 1JVSA 5GVRA 4RV4A 5C3MA 1PR6A 3DWIA 3RVMA 4D8XA 2H52A 4OIFA 1JBKA 3ACDA 5IKEA 3UIEA 3LYAA 3WYBA 1S3GA 4E09A 5F7OA 1MO3A 2VUSA 2P9FA 4BBAA 5JD4A 4MIEA 2YHSA 1I7PA 2P1RA 2ZFUA 5G3YA 2PJDA 5EKXA 2D3TA 3EGWA 5JWHA 2O52A 3JRNA 4KDEA 3T06B 4B6SA 4Q37A 1NT2A 3KZKA 5JQWA 3K20A 2H5IA 3HGMA 4JC0A 4JV5B 1Y82A 4ESOA 1AUPA 2M9MA 3AVWA 1O77A 4LQDA 1G8KA 3REFA 2SHKA 2HMAA 4YRZA 4MR9A 2CL7X 3JAKB 4I55A 2QTBA 3EZXA 5HIJA 2FP4B 5BN4B 5CLFA 4KRFA 1U4NA 1JHYA 3D8RA 4LF9B 4WLUA 1BCRA 1QOPB 3ZHYA 4F5WA 4H4EA 4GC9A 4M0DA 4EEXA 2R62A 5F73A 1Y8AA 5DYWA 2IE0A 1VKOA 4U9HS 1WP9A 1CD5A 1LH0A 3SSOA 3ZH2A 5FA5A 1PDVA 5L53A 5BNTA 3WY9A 1KETA 3QKWA 3MUNA 4NBSA 4P36A 4PZ9A 1E9SA 3NHKA 4X7RA 3S0JA 2D7DA 4CMHA 1FSSA 5AD1A 2PH5A 3VOBA 2ECFA 3AILA 1C0IA 4YRMA 1XCGB 2PZAA 3Q8XB 4KWIA 2IYSA 4LWQA 4B32A 3LXMA 4ROSA 4D02A 5KJ6A 3W5HA 1XC7A 5AFSA 5EIHA 3FPAA 4J7CA 5DNWA 2ECQA 3IEXA 1RADA 9MHTA 3LP5A 4UOQA 2DFVA 2JDID 5EZ5A 2E6UX 4YR7A 2CLFB 3GJ7A 3KOUA 3CZ4A 3C1AA 3QBVA 2EOAA 4G1UC 1HV8A 5JCZA 5CB0A 2G1PA 1AKWA 2GN6A 2ID8A 3NV7A 3V1LA 1FXUA 1AZTA 1QS0B 3TVDA 1XALA 2Q46A 3JQBA 4HAZA 3V7UA 5KBYA 2K1SA 1QSGA 3EASA 5FYDA 5CIYA 4GNRA 3EOBI 3C8LA 5GJWC 1QRAA 2W8BB 3P2YA 5FULA 3AJDA 3CCVF 2BFEB 3VU9A 2JLZA 1WPQA 3QENA 1AMUA 4Y0VA 3PSAA 2HLDA 4V3CA 2CBGA 2WHQA 1PNTA 4GKJB 5JAQA 1RTTA 2XHZA 3R6DA 2D7CA 5KJFA 1UBRS 2ZJYA 4IOMA 3CVJA 4IDFA 2YC4C 2OTMA 2GTHA 1CHNA 2P9YA 2DR0A 1G6OA 4B3XA 3A6GA 2OBXA 2CXPA 4N18A 4PC3A 4S1NA 4PY2A 4YUVA 5BWMA 3E1GA 3P96A 1CQIB 4KC0A 1N3YA 3K4HA 2KYRA 5FWXA 3EN0A 2H08A 1XBIA 2QGNA 2QG4A 4L9WA 1E18A 4TXLA 3NKVA 2GZ3A 2KSQA 3VC7A 4HBZA 4IVPA 3DBOB 1GSHA 1WPGA 3GBPA 1KFEB 1RU3A 1TTQB 4O2AB 4ZOLB 3PZBA 1FB5A 4TTAA 1NURA 4UNSA 2HI0A 4EKDA 3T7DA 2OHOA 2XOKD 5EWLB 3W4KA 4I1UA 5BUCA 2IU4A 1JDBC 2QTWB 1TFRA 1SK9A 2KWIA 5IH7A 3F71A 5IJ0B 1DI0A 4JS0A 1VIVA 1LUAA 3ONEA 4K6MA 5SY6A 4DMRA 2ZE7A 4Q48A 1XTRA 2PVCA 4JC4A 5JYEA 3ER9A 1UPUA 2XA1A 3G8DA 1DQPA 5EGSA 3RT7A 1XZFA 5AICA 4JB3A 2AK3A 2O3SA 3RVQA 1XVTA 1X2BA 3L7JA 4MRRA 4YJDA 3TCKA 4EHNA 5KNDH 5EQJB 4H31A 4AC9A 4Z9XA 2EXXA 1CBUA 2O8DB 2DB3A 3U7EB 2H9AA 2P5TB 2OB1A 3IV7A 2PMWB 4HQ0A 4I9HA 1D8TA 4F56A 4FU0A 1OLXA 4CT5A 3VR4H 1K92A 4A5OA 4B6OA 2SICE 2D2IA 4G5GA 2Q21A 4QIHA 1AUVA 2EFDB 2HPHA 1V35A 1NLMA 2KI5A 2WOOA 3TD4A 2C42A 1QK3A 1Q0RA 4IG9A 1HKUA 1JG6A 4JZYA 1OXSC 3LGSA 1OBOA 3P9CA 3LDFA 3W8EA 4V1CA 2IH5A 4GOND 1KJWA 2Z95A 2C0QA 3LYLA 2X8AA 4I55B 4JGIA 4V0MA 1DDOA 3FUCA 3AUTA 4K6OA 4RAQA 5YASA 3X3HA 1V4BA 3NOVA 2A7XA 4TYNA 4HYTA 5FTKA 1T8RA 3C98A 3ESCA 3KUXA 4REMA 3SG0A 5JBQA 2J0SA 1VHDA 4QPDA 3ZW9A 2HWKA 4ZD6A 4GPTA 4WLVA 5JZVA 5CCXA 1MBZA 2QN1A 1T2FA 4OXQA 3GWGA 4JASB 3HJUA 1OJLA 4MP6A 4O3MA 3GLQA 2NT3A 3IP9A 3AR4A 3ORSA 2IF0A 1CW2B 3OUTA 1PT9A 2A9PA 2H63A 1QGUB 5LOVB 2JC3A 4UEWA 4RK6A 1C29B 3WLAA 3T1TA 2IY7A 3FCXA 1VQ4F 3VU1A 3CF2A 3CRRA 3I01M 2WZCA 3PC8A 4Y1FA 4YFVA 1ULTA 3AUAA 5K3FB 2H00A 1LY1A 2BHNA 4FMDF 5FI3A 3ZJ5A 3FDFA 3SK0A 4OGWA 3U4CA 4JUFA 4PW0A 4L5BA 4E5DA 1T43A 2QE7A 2W0MA 1ZEMA 3ZHXA 2M1ZA 3PF8A 3MJVA 1DKRA 1N33B 2FGYA 1U7PA 3HZZA 4CI0B 5AVUA 1XLTC 4JBGA 4C0BA 1TPYA 4G5QA 3UAWA 1RT9A 3VYWA 1I7LA 4W5QA 1AE1A 1ZJWA 2YZGA 1BH6A 3O0TA 2XMGA 5C8VA 4U2BA 2PPVA 4WNIA 2FZ4A 3RS4A 1TEHA 2X0FA 1BIFA 3RUPA 3FLAA 1NHGA 4EUHA 1FRZA 1B74A 1OHHA 3RYFB 1F12A 1OXXK 1IZ8A 1T1IA 2I6TA 2O2IA 4JP1A 4JU9A 4Y9UA 2BELA 2WHYA 5KYVA 1A77A 3S40A 4G4YA 3ZWMA 1EXWA 3DC7A 3LHIA 2BP7B 2QRMA 2BGWA 3HKDB 4FZ3A 4QUGA 1OB5A 3DPIA 5IVKA 2QRHA 3PLAC 4DEYA 5FWXB 4J0FA 4OUDA 4NXMB 3C8DA 3LBNA 3DAGA 3DDUA 3NYRA 4OCZA 3GD5A 4GPAA 2MDTA 2COUA 2VEDA 4K5QA 2W37A 4MUAA 2XZLA 2YWEA 2W98A 1GQ2A 2QMHA 1QCDA 3IPLA 4BMDA 2XYPA 1T4GA 5KEIA 3A06A 3B6KA 1XEXA 1BMDA 1E94E 3D4OA 5JMTA 1TVEA 3O21A 4JDPA 4S12A 3RS8A 5KWVA 3AESA 1NWCA 2Y4NA 2CLCX 3G8CA 4ZAFA 4DIFA 2WSMA 2G0NA 4N7RA 4TYYA 1OU0A 2Q8QA 3DULA 1UBMS 5EINA 3IEWA 1KZYC 4KGZA 4NV3A 3GUYA 4NONA 1L5HA 2GZSA 3QLEA 5ECDA 1KR5A 4CRWB 5KSZA 1OIWA 1X1AA 4O4LA 4KH0A 2EJWA 2IYFA 3P9SA 2BM0A 4LRXA 3NBMA 1QIJA 3NNNA 3H3XA 4QDKA 1XMSA 2HVYD 3MAAC 3NYQA 3SLGA 3KKLA 3WFJA 3I01A 3D6TB 1T3TA 2RGRA 5F7ZA 2PLNA 2X5JO 4OSPA 5CHYA 1Y6ZA 5JXJA 3VFDA 4NYIQ 5K8LA 2XUIA 2PYIA 3P0JA 3ROKA 4EA6A 2C2OA 1K8XB 4TZTA 3PNBA 4L16A 4WOCA 1RPJA 2MINB 4AM8A 2FN8A 3QUWA 1EFHA 1WMBA 2G1UA 1TVKB 2CNKA 2RH8A 4PHCA 4WJLA 1WUYA 2O0KA 2HJVA 4V1CB 1DC4A 1B6GA 1I2BA 4KG7A 3CC7F 1KYXA 1H6CA 1NM5C 3QNWA 3UV6A 3FMFA 4BLSA 3IQIX 1VQ7F 3V4FA 3V8VA 3TJRA 4A0RA 3ORQA 4QQKA 3ZOZA 3ICVA 5BN3A 3WWDA 2C2YA 2Q3DA 4EX7A 5FO0A 4G23A 1FDVA 4K88A 3A6KA 3AXSA 4QBKA 5JSYA 1PQYA 2OK8A 3SD7A 3UAYA 4F06A 1ZOOA 1XN4A 3AR2A 3MXOA 3W9BA 3WO0A 3ESAA 2HIGA 3MJTA 3OOEA 4QO8A 2H8KA 3X2SA 2PS3A 4BX9A 5BPFA 1NAHA 2ZODA 3A1NA 1V45E 4G84A 5CDFA 1JB1A 1KDRA 2WWRA 1ZXBA 3D7LA 1Y6QA 3EB9A 4NWIA 3IILA 1Z39A 3NWEA 4XCXA 1GRRA 5K0SA 2B6HA 2RGNC 4ER7A 1IJEA 4KR9A 3GARA 2FSUA 3D00A 3IT2A 4J0DA 3A28A 3MFQA 3N0RA 4OU4A 4RKEA 4BUCA 1JTFA 4R7TA 2BZSA 3VNUA 3CCBA 1V5GA 1LCIA 3PGJA 2SNIE 4AUEA 2ZJ7A 1E3DA 3CYFA 4NFSA 3QFCA 4TMXA 4XR9A 3WRVA 4RFVA 5EKTA 1W581 621PA 4LYGA 1RIFA 1T6BY 2VZ0A 1CDEA 2ZUSA 4BVRA 1LNSA 1N8KA 3I5AA 3SF8A 4OLBA 3U7QA 3ZIUA 1YFJA 3VSEA 1VDMA 1G291 3WYCA 4LRTB 3INYA 4C87A 1DLJA 2A59A 2F59A 1HTWA 1N5OX 1QG2A 2PKCA 1IY1A 4EF5A 5FJ4C 1XVIA 3E2IA 3PDWA 3V4LA 5KYWB 1U7XA 3MOGA 3EZ7A 3PQ2A 5C3UA 2LUOA 4IL5A 1VBNA 3O82A 3HYLA 4C3OB 3WQHA 3QE0A 1VSBA 4HGYA 3QI2A 5DLQC 2PKRA 2P11A 4L9RA 4RKYA 1L5NA 2HU7A 5I48A 1PXWA 1FA9A 1PZGA 1XEWY 2I62A 3LPDA 4S05A 4YRCA 5LPNA 4NBUA 3MT8A 4ITRC 2NO4A 1ZM3A 3G13A 3OLYA 3SC2A 4HYYA 1U80A 4O8CA 4OH7A 4XQCA 5CEFA 4J76A 3VDQA 1KORA 3T7EA 5HHTA 1FS5A 1GNVA 1SC6A 4KH1A 3NVMB 3PPIA 5IC6A 2FR8A 3IV9A 5JCOC 1USGA 3DMGA 1W4CA 4DAOA 1VSUA 1TM2A 1T3HA 1KRHA 4RHXA 3HO1A 4OJTA 4HEQA 4BUJA 1XKTA 2JGJA 3FSGD 5GV8A 3H2IA 3HCDA 5DU2A 4JNKA 4ZWNA 1YTUA 2OLEA 1UFRA 3M6XA 5LZ8A 5K01A 3AESB 5T6MA 5I7FA 1GM5A 1PFWA 3IO5A 3JSAA 1U1DA 3P8ZA 4G9EA 5M04A 1N92A 5CM9C 3CVYA 3IDQA 2W2XA 3VYSB 1M5UA 5F52A 2R00A 4M1WA 4YLGA 3KQPA 2IZ1A 1P6QA 3K72B 4G0MA 1L5HB 3S0YA 1FUUA 2C31A 1AKRA 4YDRA 5IUKC 4CM8A 3NBKA 4I3GA 4R1OA 5KWJA 3GZTB 3H4TA 4RDIA 1SOAA 4EB6A 4XWAA 4ZEXA 2OFFA 4M53A 4WFKA 2BTOA 1NMZA 1O5TA 2EHJA 5A5DA 2GF0A 1RI4A 2IZ5A 3LTEA 1USVA 1JKMA 2REOA 4KPUA 4PSDA 5JANA 4KREA 1NAIA 2ES4A 2CUZA 3WLEA 2B0JA 3MB8A 1BQ3A 2ACWA 1VPWA 3FCYA 1WSDA 1KYVA 3P0FA 4QTYA 1P2GA 4FLEA 1G8MA 4E2ZA 2Q29A 1CLEA 1OWLA 3DM5A 4YFYA 5LQAA 2LPMA 1XJ5A 1R10A 4KB5A 3ZBPA 4DC1A 1PHPA 5DIFA 4V0OA 1K7XB 3S8EA 3JYQA 3ON1A 4B5CA 2RCYA 2ZVDA 4IO0A 1FSFA 3EGOA 4LOAA 4LV6A 5FCDA 3RJMA 4BRSA 1I3CA 3I1YA 4LF7B 4HB0A 3O0DA 3BSFA 2WU1A 1GNRA 2XMDA 5DI3A 5CJ2A 2O50A 3PE6A 3C3JA 2OO3A 4K9KA 1YIDA 3BWBA 4BJ5A 1CUAA 2JJYA 3I8SA 4OSEA 5C5IA 1DMRA 1G3MA 3CN7A 2A33A 3HCNA 4PYLA 5FR2A 1ZKMA 4RX1A 2G1AA 1PFKA 4EUEA 3GV0A 2N75A 1T0HB 2NVUA 2JLBA 4LCJA 1SD5A 1CY2A 1N5RA 2HQSC 5EXSA 3QXXA 5JAOA 4WKBA 3ZX4A 3GJZA 5TS2A 1M7HA 2PZEA 3D6MA 3ZD9A 5C4MA 3D0RA 4EYQA 3ORFA 5HBGA 2XXAB 2Y68A 4X24A 3ND5A 3AQ4A 3L49A 3JYOA 3SHQA 2JLWA 1ZC4A 1QF6A 3Q7EA 4M1KA 4C21A 1WAMA 3FNHA 3FWKA 2PZBA 3WPXA 3ZLJA 3EGDA 2FSHA 2OVBA 1KQ3A 3W3AA 3QPVA 4GR9A 4RK0A 3BWVA 2BT4A 5EC8A 1M2JA 4XKJA 2V96A 4DUZB 4LVNA 2XAUA 2BOVA 3JQBC 3TZHA 1XXLA 2J31A 1QVZA 2HCFA 4DJJA 4LWPA 1HEUA 1M6NA 3MBMA 1Z4QA 1K8ZB 1A8PA 3G7NA 3S6JA 1U0TA 5ED0A 3KHNA 2EZUA 2Q3HA 3M5DA 3NC1C 3QX8A 4BQIA 4E14A 2B8TA 1D2HA 2CHVA 3WRYA 1ZD4A 2OKGA 1ZGJA 1PG2A 1RI1A 4R2MA 5EAZA 1K88A 5F5NA 5HF8A 2R8YA 1U0NA 3VH1A 1ZM7A 2XDWA 3FPGA 3HHPA 1NMXA 2LIVA 1JMYA 4LVOA 3S7ZA 4MQ4A 2WYIA 3RM3A 3ZCXA 3BA6A 4BVHA 3WKEA 1RXUA 4F1KA 5JEEA 2DWUA 5KWIA 2FPOA 3CGGA 4Q9IA 5JVDB 5EKUA 5T4HA 1OV6A 4AJLA 4KPYA 4HQKA 4DQUA 5CDYA 1BO6A 4QU8A 3WRXA 2JEOA 2WKQA 1G7RA 1NR5A 3C4VA 4QXRA 5BSRA 5C8YF 2A0YA 1QKIA 3VC3A 1G41A 4RVFA 3BMOB 1JI0A 3OP4A 4KKVA 4QEKA 2HBQA 2P91A 1ZXLA 3UPUA 5B2ZA 3LFOA 1TM4E 1H2EA 3EXHA 4GKBA 1DT3A 3O2SB 1JDTA 4QXMA 1ZISA 2GA8A 2WINI 5KTOA 3TYXA 5EMKA 2QNBA 4WHMA 2PDAA 3K9QO 2XA9A 3ZEIA 4B5LA 4YJ2A 3IOYA 3IULA 2H1CA 2GKGA 4KN9S 4TTIA 2GCIA 2ZW9A 4F4JA 4P0PB 2V9CA 5SZJA 5L7WA 2VK8A 3G82C 4RF5A 1TKCA 3H2KA 1H2HA 1JIKA 4I7EA 1YA4A 3REGA 1WW8A 3SS7X 1SOMA 2I67A 1MAVA 1D5CA 1MVNA 3TNJA 2AZXA 1N32B 4EB6B 1GQYA 2WKWA 2JJ2A 2O8FA 1LPMA 1E1RA 3QUTA 1KK3A 3E58A 5J4HA 5J2TA 3HYNA 4XDYA 3DMTC 1QAHA 1E32A 4P4TA 3ZV5A 1YDFA 2YY7A 5AK5A 1POWA 1TGYA 3V7YA 1XQWA 4HQRA 4EPTA 1CETA 4KPUB 5ARBA 2AR9A 4KE8A 4JJ7A 4KZKA 3GGOA 1DQRA 3U7JA 2AK2A 3MPUA 3DZIA 1T36A 5AW8A 1GZ3A 3NP9A 1I7QB 4NU6A 1DAHA 2HW8A 5IDQA 4FX2A 1UDCA 5KZMB 2OGTA 1GLNA 1FFSA 1VIYA 2E3JA 2X2OA 3RSFA 3RC9A 3M4JA 1O6GA 3CCEF 4YK7A 4BZQA 2H4JA 1V1JA 4NE7A 3CD6F 5DHAA 2WE7A 3MPOA 1OH5A 4QDXA 1ND5A 3K9NA 4R9RA 1UJ6A 1WQ3A 4GOLD 4GX0A 4PZCA 2R8BA 3PI7A 2BEUA 3MQ2A 5EJIA 5DI3B 5BP7A 1HE1C 5DLYA 2HRDA 2H1OA 4GI1A 2ZCVA 2ZQ5A 3KT3A 3N05A 4A27A 4FDTA 4OSOA 2ZSBA 3QEAZ 3DCNA 2BCJQ 1E64A 16PKA 1Y0BA 2ZU6A 3TPCA 3GLFA 3IAUA 4XGQA 3NCTA 2GI4A 1NNI1 4DB2A 3WDMA 2QTLA 4M8IA 2PWZA 3CT6A 1MVOA 2AG1A 3N74A 3QWIA 1U5BA 4P98A 3WK8A 1JMVA 3W0LB 1OAPA 2YJGA 3PLNA 3SJAA 3WGTA 1XAHA 5AM2A 1TU0A 3IIEA 5LQSA 4AUNA 3ENVA 2CSUA 1JKXA 1GPBA 3HKCB 2BW0A 2H4XA 4YJFA 3F74A 1UC8A 3H99A 2J48A 1IL0A 2L18A 3EGDB 3OTGA 3KCNA 3PICA 2ACKA 1HPLA 1HYBA 2DWPA 2ISQA 3H75A 5A71A 1RVV1 5EJ6A 1G5PA 1CIPA 1PKXA 2NO1A 2Y66A 3ED1A 4MW9A 4P9NA 4Z9AA 4CODB 4LXYA 4AK9A 1M0EA 4HWKA 1UBHS 2DUMA 3F4LA 4O5AA 1NSFA 1S3IA 2FPXA 2G72A 2FFRA 3WIOA 1Z63A 1IQUA 1K63A 4Q4JB 1TQHA 1RWNA 3L8GA 4QDOA 1EG2A 4L9AA 1E8MA 3T54A 2EZ4A 1Z4MA 4ZQHA 2N1MA 2ZWVA 2YW2A 1OHHD 2B69A 1JQJC 3AF4A 4CTOA 1E3QA 1KK1A 5DBIA 4ENWA 2J9YB 3A9CA 3AVYA 2QROA 4JLMA 5IHXA 1AQIA 5JC8A 3ZHTA 1G3UA 1K06A 1XD8A 2EU8A 3EPRA 5CP8A 3RVBA 2PRZA 1USIA 4YQEA 3SE0A 1ECFA 3LC2O 3OETA 2BMDA 3UMVA 4GI3A