5MN5A

S. aureus ftsz 12-316 t66w gtp closed form (2tcm)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
303
structure length
292
Chain Sequence
TLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGNPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cell division protein FtsZ
publication title A Polymerization-Associated Structural Switch in FtsZ That Enables Treadmilling of Model Filaments.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 93
structure length 292
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5mn5A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5mn5A01
5CB4B 1TVKA 1W581 4O2BB 4LNUB 4TV8A 1TUBB 4ZOLA 3M89A 4FFBA 4O4JA 2RHLA 3JALA 3HKBA 5JH7B 1TVKB 1Z5WA 5GONB 5LYJA 4U3JA 5BMVA 5JCOA 4FFBB 4O4JB 1JFFA 3E22A 3WGLA 4X1IA 3UT5A 1W5FA 4U3JB 5M7EA 1FSZA 4X1KA 3E22B 3VO9A 3R4VA 4X1IB 5J2UA 4U39A 3UT5B 5JVDA 2R6R1 3JAWA 4EB6A 2RHJA 4X1KB 5CB4A 5MN5A 3JASB 1W5AA 2GVIA 4I50A 4LNUA 5EZYB 5J2UB 4WBNA 4ZHQA 5LXTA 5JVDB 5MN6A 3RYCA 3JAWB 3ZBPA 4B45A 3VOAA 3VO8A 5JH7A 5CA1A 2VAPA 4I50B 4ZHQB 4XCQA 4O4HA 4WBNB 5GONA 5LXTB 3RYCB 5IJ9A 5IYZA 4TV9A 3WGJA 5CA1B 1FFXA 3JATA 4O4HB 4TUYA 5IJ9B 5IYZB 5MN4A 3WGNA 4TV9B 5CA0A 1FFXB 3JATB 3WGMA 4TUYB 4ZI7A 1RQ2A 1OFUA 5CA0B 3JASA 5EZYA 4EI7A 1SA0B 4ZI7B 3HKEA 2XKAA 4I4TA 2RHOA 3ZBQA 3HKEB 5C8YA 4I4TB 4O4LA 4DXDA 5LA6B 2Q1XA 5EIBD 4KWEA 3RYIA 2VXYA 3HKDA 4HNAB 4DRXA 5C8YB 4O4LB 5IJ0A 3N2GA 1W59A 5ITZA 3RYFA 3WGKA 4I55B 3RYIB 3HKDB 4DRXB 1RLUA 5IJ0B 3JARA 3N2GB 4EI8A 2BTQA 5JQGB 2XKBA 5ITZB 3RYFB 4F6RA 3V3TA 2VAWA 1SA0A 5FNVA 5LP6C 3JARB 1W5BA 3N2KA 2BTQB 4IIJA 4E6EA 3HKCA 4F6RB 4B46A 5J2TA 3M8KA 3VPAA 5FNVB 5KMGA 1Z5VA 4O2AA 2VAMA 5LA6A 3N2KB 4IIJB 3HKCB 4YJ2B 5J2TB 3C8LA 4X20A 1W5EA 2BTOA 3CB2A 4IHJB 5KMGB 4O2AB 4HNAA 4YJ3A 3ZIDA 4TV8B 3JAKA 4I55A 4ZOLB 4X20B 4X1YA 5JCOC 4YJ3B 5LOVA 3JALB 2RHHA 3HKBB 5JQGA 3JAKB 2R751 4M8IA 4O4IA 5LYJB 5BMVB 4X1YB 5LOVB 3VOBA 5KX5A 1JFFB 4EI9A 3RYHA 4O4IB 5EYPA 5LP6A 5KX5B 4O2BA 5EIBC 1RQ7A 4YJ2A 1TUBA 3RYHB 4IHJA 4EB6B 5EYPB 5LP6B 2Q1YA 3RB8A
chains in the Genus database with same CATH superfamily
3V42A 4KE7A 1N32B 1WDLA 4NKRA 3TR5A 3AFNA 4Y2RA 4EELA 2RSLA 5BN5B 4YCSA 1RJEA 3Q0EA 1JDUA 4XCXA 4DM4A 2JK1A 2X5XA 5JO0A 1VKZA 2VHCA 1PI3A 4D3ZA 1KDRA 4Q12A 1LNSA 3GRFA 5CH5A 4NBNA 3WAKA 4X0EA 3L8ZA 1R6UA 1B43A 3E23A 4KYUA 4AROA 2P0AA 1JLSA 1LQ2A 2EZ8A 1T24A 3MTEA 3HGQA 1I4LD 3LXMA 4OA5A 4F2WA 5CDYA 5K0SA 3AYZB 2WJHA 5ALQA 3WKDA 3ZE7A 3A14A 3B85A 4OG2A 4WBNA 1DX6A 1JQ5A 1XQYA 4CLEA 3DULA 4I55F 4IYRA 6LDHA 4B45A 2PYDA 4H6XA 4B73A 5KCZA 5TQ2B 3R7AA 3SWWA 5EHXA 1S7GA 1V5FA 4KSYA 4AZ0B 4C0SA 2WM3A 4PYOA 2C7QA 5IYZA 4DA4A 2VH2A 2ZYIA 2D06A 1MAWA 2ZQZA 2RHGB 3E9EA 5CFNA 1P0MA 2AXPA 3A32A 3PHGA 4YCDA 1MDFA 2EG9A 2NSLA 2PYIA 2AI3A 4PBSA 2HRDA 1XWWA 2JLWA 4IQFA 3GU3A 1OT5A 5JATA 3FPIA 1ECBA 2QRKA 3I8OA 5DW3A 3X2SA 5M29A 4Z4GA 4ILEA 1JDBB 5DBHX 2XB4A 2J6IA 4ZHVA 3H2GA 1XL0A 3F6EX 3BK1A 3GHYA 2DT5A 1P1IA 2VQDA 2J08A 3IAXA 2QA4F 3OWXA 3QBEA 4FTWA 4HAUA 4EKDA 3CYFA 4MW0A 1J39A 4EITA 5HM6A 5E3JA 5JJ5A 4BMXA 1ENPA 4CM4B 3H4VA 3CNEA 1OJLA 3LA8A 1GFSA 2PKQP 2ZW9A 5BRNA 4DA9A 1UXKA 2QEQA 4DAEA 3VR5D 2VWHA 4M83A 5DWQA 4D4HA 1TXGA 5E4JA 4HFJA 4U9HS 2C8JA 4HNSA 1TK2A 2XNSA 2VGMA 1FF9A 3O3NB 2CCGA 1VQOF 2E87A 2HEGA 4INAA 1DJLA 1DG3A 4RTRA 2XZOA 1RRKA 3SS8A 2BM8A 3ILYA 3HKDB 3AVVA 2BISA 3I3SR 4C8IA 2XE4A 3JD4A 1NQWA 4G4JA 2IYQA 3QGMA 3ZH9B 4RTKA 3E4CA 2VAWA 2WILA 1YFLA 4V1CB 4NP6A 1W48A 3X1ZA 4BO7A 4A0QA 4ZEOA 2VNSA 2HWKA 2ATXA 4JLNA 1RC0A 3ANNA 3EGCA 3K0BA 1J09A 1U4SA 3ACCA 3BXZA 5DI3A 5IP5A 1R0CA 5JAMA 5K0EA 3KUCA 5KMGB 2DY1A 2WWFA 5DDIP 3TNLA 3I1FA 1KQNA 3JAKA 4H35A 2GM4A 1TQ2A 2W4IA 4M1QA 1KZYC 1QIMA 4U1RA 1CC1S 3MD9A 4U8HA 2NU8B 3RO7A 3TW8B 4ZVKA 1XKLA 1Z2AA 3FYDA 2QBYB 3DMTC 5L51A 1CR2A 5D3MB 2NU7A 1YRWA 2I4NA 1W44A 2CXTA 2RC5A 4M0FA 4QTXA 4X92A 4UUNA 2B5OA 3LHIA 2C2OA 5E3IA 3QYFA 1OH5A 1A9RA 1KETA 4YAGA 3ZH2A 1Y37A 1DO0A 2HCJB 2REQA 5B6PA 4Q7JB 3WWCA 3OPVA 2WU8A 3ZDCA 2KG4A 1Q5PA 5B1HA 2X7HA 3M82A 3B2QA 5KYXA 1V1RB 1EFRA 3EOBI 1MXFA 1U1DA 3R8CA 4DW8A 1L7BA 2HRBA 2PFGA 5FOSA 3LX6A 1PG2A 4K8RB 2MYNA 5EZQA 1AQ6A 4QEDA 4DM7A 3UMYA 1VL5A 4K46A 1W2BF 3LTEA 3A2KA 3GI1A 2W83A 3DG9A 3OX2A 1SVLA 3A6KA 4KN6A 1KFBB 1YVEI 4P38A 3AY3A 4CMJA 3ZDXB 2J45A 4YCMA 1X7ZA 3TNFA 4CKCB 1Z4QA 5I51A 3CYPB 1GGHA 2WSSA 1AKQA 3IO3A 3BJIC 3ZZTA 4LYFA 5DBFA 3T5DA 2Q5FA 2V6GA 3PHLA 5CCEA 1SVOA 1KS2A 3UT5B 1YS6A 3QPWA 2RHJA 3RV3A 1CZUA 1R50A 4EPRA 3G9ZA 4BKMA 3PJFA 3N75A 5CFLA 3U4AA 5LXTA 1FQOA 2HB6A 1FFYA 4QVIA 3HACA 2X0JA 1QOZA 2QUBA 4D9CA 1FXWF 1BMFD 1XRPA 4C14A 3PHJA 5D6NA 1XU7A 3JW8A 4B81A 4ZYXA 4N3CA 2AUNA 4F0JA 5DW0A 3N6VA 2DFNA 3M6XA 3QFHA 2ERYA 1VSQA 5HJ7A 3BHNA 1XTRA 1NXVA 1QOQB 3ODPA 1I32A 2B2CA 4OIMA 5DPMA 1WAMA 5AKEA 3TOXA 4EYEA 2GDZA 2V74B 3L1KA 5CT9A 5DHQA 3HHEA 1LC0A 4A1OA 4INJA 1IAVA 3KB2A 4QELA 3DAFA 4JJZA 1LW6E 1QFJA 3EQ8A 3LECA 4D0SA 3EWIA 1YC2A 2UVPB 3CPWF 2YS7A 3I9FA 2B1GA 3DLCA 4BKRA 2AR0A 3NHWA 4I46A 1KPIA 1Z63A 2G83A 4CQMD 3HP4A 2NU6B 2R1TA 1WCXA 5C5CA 3HNOA 4R1QA 2Y1OA 1CDOA 1JT2A 2KS6A 1PSWA 5KTOA 4QGAA 4EZBA 1GD1O 5DXJA 4V0KA 3P0FA 3AR5A 4R1SA 4MHTA 1G55A 5IZCC 2YYEA 1CBUA 1WA5A 1LLQA 3KIZA 2R65A 3HSSA 4CKBA 5K51A 4QRIA 3WP0A 3G2IA 1NTOA 2YV1A 1QUEA 2JVIA 4N7RA 4ZU6X 1R64A 4UPDA 3KELA 3EQ2A 2DBRA 1JI3A 2JZCA 4J94A 2R5FA 3WJ7A 1JV2B 2FEOA 4TLLB 3RASA 3K9HA 1VE1A 2XEXA 3JPWA 4C07A 3WA6A 3HJBA 5ALNA 4OOFA 3WKBA 4RZ2A 1M7GA 4C87A 4DCNA 3VYTC 3DKRA 4YJ2B 4DCPA 2QR5A 3VOTA 1JEJA 2CDCA 1C81A 1K7XB 2NPFA 5JNVA 3ZWWA 1M83A 3AL0C 2C31A 1C9KA 2ZREA 4KYTA 3L5OA 3D5QA 2FWPA 4HPJB 4IPTA 3VVLA 3W05A 3C5CA 4GVXA 4BNLA 2Y99A 3OTGA 1H85A 5JVDF 3BG5A 4MWOA 1HNZB 4GLFA 4XDZA 1Y4ZA 3T52A 2PZBA 2XGMA 1SVNA 1X7WA 1M7BA 1KDZA 5I7SA 3AFHA 1EP1B 3SN6A 1P1HA 1XROA 3PGJA 3C15C 3ZDQA 2DT4A 2ZRCA 2HLPA 3O7WA 2GBCA 2CXXA 3WHLA 4BMZA 2FZEA 1JU3A 4HYEA 4NENB 2EQ5A 2I2BA 4K28A 4EHBA 3OZXA 4HB4A 1AD2A 3U0VA 3ABZA 3E9ZA 4N03A 3H8JA 4LRQA 4S2EA 5ITVA 2DWOA 4Y6GB 1PFVA 1KZHA 1U2DA 3SNKA 4J0KA 3G23A 1W5TA 1H2BA 3C43A 4G65A 1AQJA 1E3WB 2FEMA 2WSMA 4AQYB 4NK4A 1J24A 1A88A 2ALJA 2PD3A 1PXWA 1SWWA 3V4ZA 4A36A 3ETEA 4MWTA 3IAS6 3HGMA 1PL8A 3KQHA 3GJ3A 4BMYA 4DCVA 3SJCA 2BW0A 4MUJA 2O20A 2M6SA 4OQDA 4RKYA 5MN5A 1JDJA 4L15A 1T9HA 1JDPA 1NNEA 4EG5A 2V97A 3FCUB 1YZVA 3OTHA 2DWQA 1PDWA 2XJ4A 3B3FA 1PGQA 1QE0A 4N0MA 3LY7A 5TDHA 4ZHQB 4L8VA 1A98A 4O4HA 1GAJA 5HSGA 1KH2A 5IK2D 2PE5A 1H2ZA 2DGDA 3ND5A 2VYNA 3GGOA 4C6SA 4OHVA 4MUAA 1TTPB 2GYYA 2IQIA 2RGAA 3OBYA 2RK6A 1P62B 3N05A 3MJ4A 1WCYA 1YS7A 2WUEA 2YC4C 1Z2OX 1T2FA 3A04A 3VSAA 5F98A 4OKIA 4DY4A 3BIOA 3ABRB 4MPRA 2Y1KA 4CHTA 5HF9A 1GNPA 3AR8A 2HBYA 2ZULA 1BJTA 1Y7IA 2QRMA 3RS8A 1QFMA 4IEFB 2P3LA 5ICEA 1NE7A 1K89A 2WJ4A 3R3SA 1PL6A 2D6FA 4MQFB 3V32A 4AI6A 2B1IA 5TVKA 4ZI7B 1CNFA 2YYZA 4RQAA 5G0VA 4V3CA 5GIPC 3SX0A 4G0MA 3BWDD 5A3RA 1R4MB 1NW7A 1KE1A 1XZNA 4O0MA 4S1PA 1IBKB 1FNNA 2HCBA 5JPCA 3EY9A 3NOOA 4MI6A 5FXMA 3ZV6A 4ZO4A 2IQQA 5BQ3A 4OM7A 1K2VN 1EDDA 1GQYA 2JD0A 3PPYA 2XE7A 3DAPA 3CW8X 3R0XA 4WLFA 2BRUC 5AJVB 1G20E 2EX1A 1N8TA 4DEVA 3P9SA 2PLWA 2ZM5A 2QPTA 1SUBA 2CV0A 1NXOA 5FOWA 4BVBA 2IH5A 2ZIFA 3EF0A 2QJRA 4Y6PA 5EAIA 1E9EA 1QHFA 1I2MA 3PC6A 3ANSA 5TY0A 2C5GA 1Y5LA 3L77A 3R3WA 4TMKA 2ZJ1A 2IHVA 3TIXB 3LWQC 3AW9A 4JI8B 3OLVA 3Q11A 3FHOA 2Q2NA 2E18A 1JG6A 2HDHA 1PP4A 3IPLA 3ZWAA 4RY2A 2GWRA 1BX3A 1YO6A 5EQFA 2G28A 1GPUA 2ZZMA 4AJ4A 4W6ZA 4ER6A 2C20A 4QVKA 4XUGB 4YFYA 4EZEA 5A9SB 4GQIA 3ESJA 1Q50A 4J03A 2WINI 1KJWA 5K99A 4K0KB 5U9CA 1X92A 3EXHA 4OBBA 4RMJA 1O6GA 2D00A 4Y8VA 2OXIA 4A91A 3T1HB 1XVVA 1O03A 5HOQA 1YIOA 5C52B 4A9AA 2FRVA 5B6JA 1LZLA 3W9UA 1SVIA 2OGZA 3VOBA 5KX5A 1VIMA 3BGVA 3D7NA 4QPZA 1QVZA 2Y8EA 1OD6A 1C7EA 4KLNA 2Y4NA 4P1ZA 5LC1A 1U5BB 2AN9A 2CJXA 2AD5A 3HP1A 4LTMA 3C70A 4YBRA 1R18A 4KNYA 2R8PA 3AOEA 4L0CA 1DKMA 1NNSA 3ZHZA 2HYIC 1TMKA 3EODA 4DTCA 1WSBA 2Y0CA 3STWA 2UUCB 3FMPB 1ZXXA 2RAPA 4FZ5A 3QVVA 1P2UA 4P4LA 1V1MA 1QDUA 4JUCA 1Z0KA 2JCGA 4FYWA 2CHTA 1AV6A 4EKYA 4GP6A 1CG6A 1KAQA 4NE2A 2G04A 4ZQEA 3U4HA 1WD5A 1E59A 4XVHA 4H7KA 2VZLA 3L6RA 4OXQA 1D2HA 4IF4A 3VR5H 4O4JB 4WCFB 2JVKA 4FHFA 1F0PA 3DVSX 4ZAGA 4P2GA 3O21A 3TRIA 3FCAA 5JCXA 5CK5A 4AO6A 1VIDA 2PUAA 1MO5A 5JRZA 4OXRA 1AA9A 1XJQA 5K0FA 1Z06A 2O23A 1AUXA 4RTMA 3FYCA 1XVLA 1UFYA 4YUZA 3FSRA 3H2IA 4MAAA 4O4LF 4HH4A 1O0BA 4U2DA 4LNUA 4KQMA 2H2AA 3VYSB 1JMKC 2GCOB 2JJMA 4AURA 1KTIA 1HTBA 4Q4HA 3KPUA 2IK8A 4PPFA 2NIPA 4N39A 2O8BA 1OFIA 4Y2UA 3RYCB 3RADC 1TMGE 1KFJB 5LB2A 5IJ9A 3FUUA 3TRKA 5HWSA 3U44A 4AYWA 1NDUA 4BUZA 1DIBA 3RU3A 4DCGA 3BFKA 4RZXA 2P35A 4CV1A 3GLGA 4JZYA 4HWOA 4Y7CA 4TV9B 3PLAE 4NWOB 1F8FA 4CR7A 4YUAA 5CLJA 5JZOA 1N6LA 1OILA 3BH0A 4L8WB 1G1MA 2QX8A 3MWEB 1KK1A 4UU7A 4Y1RB 4DJAA 3RROA 1A8IA 1TYAE 5IT9M 1KOGA 5EE3A 3SBDA 3DDNA 2ZUUA 3OCCA 3IJPA 3SXUB 3RD5A 4ZTUB 5K8UA 3U0BA 4HDNB 5EMLA 1NVGA 1KPHA 4DWWA 3VC1A 3DPIA 1WF6A 4J76A 2W7TA 2H17A 3KKNA 1JLMA 5A6SA 3QBJA 1P2VA 1UINA 2IQ5A 1DFGA 4AP5A 2VRCA 3OJLA 3QFTA 4RHFA 1O6BA 2WIBA 5EA2A 1VKNA 1Y81A 4LQCA 2P65A 4TSRA 5D2CA 2FR0A 2HEIA 1YBFA 4D45A 1L4EA 5IFKA 5IU6A 4FOTA 4UQPA 5BQPA 3UC5A 2JGLA 3G7UA 1IHYA 1XZDA 1GYRA 1HEUA 5B2ZA 5B36A 3RYFA 1GCGA 3LXXA 2I4IA 2F3PA 3ESDA 3G85A 4HQNA 4LC0A 4RPLA 5CVUA 4ZTBA 3ZCTA 1XZJA 2DLNA 1UXJA 1CQPA 1DMSA 3GZ4A 4FUTA 1EM8A 5CB4F 4BRUA 4CKEA 2YVAA 1QH8A 2ZUCA 3L5KA 4MVJG 3DVQX 4RZSA 4LVOA 3GDWA 3RVJA 4GVPA 4E12A 4FS3A 5ADVA 1L5RA 3RJMA 3D6UA 2OUKA 2LBTA 1LLDA 1TADA 3AEUA 2ZKLA 3C3WA 5ESDA 4JXZA 3CZRA 3WYCA 4F38A 1YGYA 2ZUVA 1OAOC 2C2XA 3CO5A 2MYUA 3PV0A 5J2TB 4GOLD 1K75A 1W1WA 4UKDA 3JSAA 5HIIA 5L95A 4IW3B 2C7OA 2RBKA 3GRCA 3IUYA 1TNDA 3MXOA 3O26A 1K98A 1KKLA 3BE8A 4OXKA 4AZTA 2E55A 1QRAA 1VMEA 1QFSA 2PUHA 4YRTA 1B93A 1ODEA 1R00A 3ICVA 4ENUA 1XRMA 1GPKA 3MGCA 3UJBA 2ON6A 1J33A 1YOVA 3GD5A 3UNXA 1L5FA 1XXHB 2W4QA 4XM0A 1DC5A 1U1EA 2VK2A 2QF7A 4W5NA 1PL0A 3DE5X 5H8WA 2HRUA 1E6KA 1MG0A 2JD2A 1Q12A 2CXRA 4UVGA 4CDRA 1ZJZA 5FH9A 1HE3A 1HK7A 3UFXA 1XN1A 3WJPA 3JD3A 4IY1A 4Q1VA 1PYOA 3TQFA 3ZX4A 1JR3A 4EF4A 1PD1A 4EW3A 7AT1A 3LOQA 1HT2E 2OKGA 5L3ZA 3RC9A 1GFIA 3MERA 4JC0A 4ZO6A 4OJQA 3RT9A 3RE1A 4II2A 3ZCRA 1LS1A 4NDZA 5EWJA 4CCWA 2QSJA 4DMMA 2JCBA 3FNIA 4RA6A 1G3UA 1LVHA 4G4WA 1J0AA 1P0QA 1VOTA 2FA9A 2BEWB 3DPUA 3HEMA 1VMAA 2QMYA 1ADCA 3PDWA 3CR7A 3QE0A 3NNNA 3R74A 2BP7A 1VPVA 1GLNA 3WGQA 2GCPA 3BD8A 1IM5A 1GAWA 4XVRA 2A1UA 5CNKA 2GBPA 5J4VA 2EBHX 1AGPA 1CSEE 3AM3A 4IXMA 2XDQA 1IBCA 3OLWA 4OMDA 3K31A 2XWQA 4TV8F 1J00A 2IP2A 1IHPA 3MBOA 2EQBA 4KZPA 4WINA 3WGZA 2OCKA 3HN2A 4ALIA 5DGCA 4RVDA 1EJ2A 2BUAA 2GJKA 1NJ2A 1PK8A 3A9WA 1GT91 3MDOA 2CCKA 4XB2A 3EAGA 5BR7A 4MARA 4A8JB 1X9GA 1Z4MA 1VJ0A 4ARZA 3PI6A 2ZOVA 4U6QA 3OEHD 3OY7A 4XUEA 1GDHA 1FDOA 1RTKA 5AWFC 4COKA 3JZAA 3ZQJA 4EG1A 3RWMB 1GIAA 1SJ9A 5ALPA 1QLJA 2IFTA 2DQYA 2CFRA 3TUZC 4DKJA 1AXEA 2SCUB 2VJMB 4QGBA 1NF3A 3L1JA 1GEGA 2YDXA 3R3JA 3V7FA 1YI2F 1S2OA 2DQKA 1VCNA 2AN5A 2Z43A 1XJWA 4FYHA 1E9RA 4KTVE 1J5EB 1JAYA 3IEXA 2EFHB 4BX0A 3C3PA 3I0NA 2WTUA 4QDKA 1ZCBA 2VR1A 1U0RA 3STTA 1JFTA 3VCZA 4P93A 2R8RA 1QIDA 2R62A 5JCJA 2HIMA 4CM9D 4LZPA 3HBLA 5SYNA 3U9SA 4BNFA 3EIXA 4EGQA 2PFKA 4DMHA 4EY5A 1JEDA 1FE8A 4Z1OA 1IEWA 4N6GA 4CGZA 5G2OA 2WJAA 1C1HA 3EXG2 1U8EA 4P53A 4DQ0A 4AF6A 5FLXM 2ATVA 3RFCA 2VHUA 1V5EA 4WLEA 5A7GA 4E2YA 3QU4A 4XVCA 2QR2A 4QU5A 2FWIA 4QYMA 1IY2A 4F6RB 4C4AA 1EI9A 4ER5A 2R6JA 2BKVA 5BQFA 1MQAA 3VISA 2I3ZA 2VDQB 4E2FA 4HUQA 3D02A 3RC1A 5A03A 4DIEA 1H1LB 1XALA 3MAAC 3T7EA 3PR1A 1AJEA 2XNJA 5A62A 4LHWA 1GTL1 2CLMB 2ZI6A 1RAFA 3RJTA 3KTOA 1QZTA 4FX2A 4E22A 2CYAA 1RPNA 3L7DA 4RE6A 2N1MA 5B1IA 4P34A 4ERNA 1KS9A 4KV9A 4RKFA 4FBMA 5HKKD 2VRNA 5BMVB 3DEKA 3PE4A 4O8ZA 4PFQA 4OHWA 2JLUA 2ZJBA 2IPNA 4CM7A 1YR8A 3NHZA 3OQPA 1BROA 4H3SA 1T4GA 2XCOA 4JENA 4PO1A 4PYIA 1BH2A 3RYHB 1RRFA 3H13A 3R5SA 4ZAWA 2ADFA 4ZO9A 1EGHA 1TVKA 3BILA 3FCSB 2PKXA 1FZQA 4WKOA 3OLXA 1ZH6A 3PP8A 5EIFA 3SBOA 4JEMA 2NQ2C 3NDPA 1XIVA 1R5NA 1Z5WA 3FOCA 4C4WC 1WNTA 4L9RA 3THYA 1YSCA 3OE1A 3BBPA 1BW9A 3N9IA 4GVLA 4QD3A 3SDZA 3U09A 5CT8A 3MJHA 3IP1A 4EKGA 5ENVA 5EJ2A 3PC3A 4FWTA 3HXKA 4K9LA 3M81A 4FBGA 5DE3A 4C7BA 1YFKA 3CH7A 1PV4A 2JZOA 4G9EA 2CN1A 1ZUNB 4YCLA 2FQQA 1A9XB 2VAXA 4YRFA 4US2R 2EZUA 3TM4A 5HQTA 2A9QA 5ALSA 3N39C 3P27A 4R0VA 5DFAA 1C3VA 1UEJA 4LV8B 2BFFA 1N0IA 3PITA 3N8GA 4PYQA 2IV3A 1PEYA 1E9SA 2DR0A 1BCSB 4RELA 1MXHA 3IERA 2FZGA 4POOA 1EK6A 2FKAA 2IW1A 1MT3A 3AHCA 3COZA 3TCNA 3BZUA 1P3DA 1NXQA 1T6ZA 2WI8A 6CHYA 3LY5A 2H4WA 1L6RA 2ZZNA 5HY0A 2WWXA 2FPSA 3KD2A 5CIWA 5JSQA 4ZJZA 1T8SA 2R8YA 4HX2A 1NPYA 1VPTA 1I01A 3E61A 3IALA 1U11A 1SUSA 1ZHFA 3BD9A 3CXUA 2NO0A 3HV2A 3EPLA 4UQOA 1N2BA 2CF6A 5A3VA 3FNBA 4IWNA 1X1BA 3MLAA 3M9WA 3OI7A 3QUAA 1JXAA 3O8QB 2ENWA 3HKEA 4OIFA 4DILA 2ADMA 4OAPA 3B3AA 3OQJA 3A0RB 3G7SA 4ZVQA 5AW9A 1AMOA 3R41A 1YCDA 2F9ZC 2X9LA 4JC8A 4NFHA 3BIJA 1WP9A 1VPLA 2HF7A 3IVXA 4NJEB 4OREX 4YGXB 2RKWA 1DIGA 1JKFA 2QI9F 3L02A 2I78A 3MRXA 3NU1A 1UZAA 2Z95A 5E9JA 3WBJA 1H9BA 4PY2A 4A0GA 4BZPA 4Q39A 3WGKA 2XD9A 3CNOA 1WMFA 3KVYA 4E09A 4U2KA 2VATA 3NHSA 1VL6A 2CFSA 2EKPA 3OSZA 1K3UB 1A0OA 4WZBB 1T4CB 4HWGA 1KWKA 2CFOA 5JFOA 3QBTA 2GZSA 2R00C 4LJKA 1VYVA 4UULA 1DPFA 1YS9A 3HXOA 4US1R 1XEXA 4CNBA 4X65B 4UOEA 3JYNA 3VKGA 1U7HA 2FJ0A 1FB5A 4ZVRA 4FUQA 2ZIZA 4EEKA 1W88A 2Q5CA 3R5JA 1VLJA 4EHNA 1G21E 2EKLA 1SEPA 3RBZA 2XNHA 1WB6A 3ZS8A 1KO7A 3T1VA 4DXHA 3Q3IA 1IQPA 4BXOA 1US8B 3LYUA 1TYCA 5EGSA 1N6IA 1UKVY 3PQ5A 3NM6B 3FHCB 2IU0A 4O4IB 1XP5A 3QV1A 4HGNA 5FLEX 5TPWB 3WIVA 1TE2A 3INNA 3KR9A 3X0DA 4D99A 1B14A 1B3BA 1RQ7A 1GSIA 1SUAA 2ISCA 5LD2C 3SIUA 4XVUA 4WOKA 1TYEB 1UOEA 2HJVA 5ALXA 4RHUA 2IYLD 2PQMA 3Q98A 2P77A 1I2AA 3L46A 5DX1A 1Q1GA 4XOUA 3AT1A 3OP4A 5JH7B 4KW7A 4NLLA 4QUEA 3SGLA 1N6HA 4AULA 4U7HA 5C4GB 2QTLA 3WYDA 4JXXA 1MEOA 3QNMA 3GA7A 3WRYC 1WETA 3QKIA 1X80B 4WN9B 3QKRA 4INPA 2WJ3A 3ETDA 2GLZA 1E79A 3HBFA 1H5NA 3L6UA 4N9WA 5DOZA 5CDFE 3LW7A 1XHOA 4RABA 5E7QA 1S3FA 3IKJA 1K63A 5IKOA 1EUQA 3VNVA 4LI3X 2ZVJA 4ZV9A 4OSEA 1W6UA 1M76A 1NV8A 4N6OA 5DM2A 4IIHA 1PGPA 4AJLA 5LQDA 5TMEA 1H2WA 2PZ8A 4Q5IA 1Z4JA 2F55A 2O8EB 3C8ZA 4OGGA 1T4DA 3B6IA 3LQ4A 3ZOPA 3NHYA 5ALDA 3BDAA 1E20A 1ULHA 3OE4A 4KLCA 5BXQC 3K70D 2O8FA 2ORIA 2QVXX 5H7XA 4ARSA 2DTEA 3HU2A 1G5QA 3OF5A 4YP9A 4DPMA 5JI3E 3MN1A 3OQHA 4Q3DA 5KOYA 5BSVA 3TQHA 1JVNA 2AN3A 2PK3A 1AY0A 3STHA 5JV5A 1C14A 1MFPA 1M8PA 3A9SA 1QLWA 3LRXA 5C8DA 2J1LA 3F9RA 3KL2A 3T94A 2XTAA 1KE2A 5AW1A 6ABPA 4EKNB 2FVYA 3JQCA 2IEDA 1DQPA 3UOWA 1LEHA 1PJAA 3VAYA 4ASUD 4A2WA 2I54A 8ATCA 4BO2A 4ITVA 1UL1X 2CMDA 3S1AB 1LTQA 3Q5EA 2W2LD 2FUCA 1HRDA 2ZGVA 4QG7A 4DLTA 4F9TA 1SVWA 3PZBA 3K2XA 1DQSA 2A1IA 3MTBA 4TSFD 3VU0A 4FB4A 2M98A 2OFXA 4EJFA 1PJTA 2I29A 3M6AA 1EWYA 1WB4A 4FI3C 2HF2A 1VE7A 2D74A 3IE2A 2VDOB 4AD8A 5ICGA 1E77A 3FZNA 1CQWA 1GLVA 1NJ8A 3KKKA 4R16A 3F4KA 3W6NA 2F8MA 2AHRA 5ILGA 2G4VA 5C1DA 1IEVA 3QENA 3SU8A 4WPGA 2P9JA 5CG2A 4DJDC 5JIBA 3EZ7A 4HGPA 4ITRC 5EKDA 2I67A 4CL2A 5HDBB 4BL5A 3JARA 1R2QA 3KJIA 1NUSA 3DD5A 4DCMA 1Y9ZA 5FTJA 2GFQA 1YZ3A 3P9CA 5JE8A 4Q02A 4HT3B 1T36A 4LJ5A 2COKA 3Q5DA 1NQUA 2FE4A 2A2ZA 2DUJA 5D00A 2DH5A 3N2LA 3ZI4A 4L5IA 1QO7A 3ZW9A 3WYEA 3I61A 1GTZA 4D2IA 3EFBA 2TMDA 5K0JA 3WBFA 3QMMA 2ZJ2A 1LBIA 5KYWA 4RCZA 3HJHA 1M2FA 1EFPB 1HLGA 5KTNA 2HSEA 4H0FA 4BFYA 3ML1A 1T6XA 2EIXA 3V80A 3RE3A 3ZNPA 1PJ3A 4ZZ3A 4OLBA 1D07A 2WIKA 4FLMA 3K6KA 2FU5C 4PWZA 3V2IA 4DL9A 4E2WA 3U49A 3DLPX 2I3GA 4FNAA 4RK6A 3R4CA 3C87A 4Y9TA 2A9RA 3WNQA 1SWVA 1NAIA 2B20A 3WOHA 1JMYA 2WYWA 4PSCA 4PNZA 3TE6A 4D41A 5FF9A 1P7PA 5AW6A 1KGDA 4GLOA 1P19A 2QTRA 3HA3A 4IIUA 1HYBA 4OHFA 4YRCA 4XGKA 4XSVA 3ADKA 1S1CA 4DARA 4I6EA 2QRJA 1N57A 3U40A 3KJFA 1T35A 1YMQA 2YFHA 1WB9A 5BN4A 5I7EA 3CCLF 2ZTLA 3SZOA 2Z5LA 2C7BA 2FW0A 3ZXIA 2XIJA 3FBWA 3H1EA 2PT7A 3CKLA 3O2JA 1WZNA 5BXYA 4LNHA 3RT7A 2V54A 1I6WA 3PUJA 1WEHA 3CRW1 3VA7A 2R8ZA 5IJAA 1ZIDA 4YVFA 3LGSA 1A2BA 4JY7A 1KI8A 2WRZA 4CYMA 3ZJTA 5BSHA 3CTPA 5AYVA 2WSSD 4YK7A 1GV1A 3IMEA 1ZIXA 5BVHA 5J1TB 3I9OA 4QHTA 1IEQA 4EO4A 1AKWA 1EK5A 1SK8A 5EZYB 1G3IA 2ZQ5A 3I1YA 4BDSA 3W7BA 3LHKA 2BFEB 2VDVE 2WJWA 4JKOA 4ERXA 3EPJA 1ISGA 2CW4A 1R6AA 1DJMA 1GTG1 1D2GA 3V8RA 3TAHA 5EWLB 3WGVA 1F4LA 3OKFA 4MW1A 3FCCA 3V7WA 1CHDA 4GZLA 5IEBA 2VUIB 3QTLA 1P18A 3IVCA 1O95D 3K09A 1FFSA 3IV6A 1OAAA 1X7GA 2C1ZA 4GYJA 2WJGA 5CLFA 2ECPA 3GDGA 4Q9NA 1ESMA 4LPKA 3JATB 1KYWA 4ARBA 3W7VA 4EMTA 3JWGA 3N7UA 1JHAA 2JH3A 5AJXA 2VHTA 5HWEA 3T7TA 1IZYA 4H18A 2C3YA 2YQ4A 2GTIA 3Q3HA 2ZWPA 3LLSA 1CRLA 3G0CA 1DZ3A 3V33A 4DDTA 4CNQA 4YJ3F 2BH2A 1KK2A 4EJSB 1F3OA 1IBLB 2GZRA 1DBVO 3PUHA 3R20A 4F86A 3H7IA 5LUBA 1D1QA 4XQ0A 5FDFA 2H2IA 4J0EA 5FV4A 3BMOA 2FW7A 2DEUA 4KQKA 1XRSB 1MRNA 1TAQA 4UDOA 5I4BA 1SCKA 5A04A 2YCLA 2ZP1A 4DRXA 1ZSYA 2R5NA 1U2QA 5FBRB 4I5DA 3O3OB 2IYVA 1T5IA 3PHCA 4IGIA 1YZQA 4RZUA 4DWJA 5KTSA 3TLKA 3O03A 1JHOA 2JFUA 1AVTA 1ZXBA 1DDIA 3BRWA 1TUEA 1WXQA 4L7VA 1Z7YA 4NMWA 4BO4A 1DKQA 1X74A 2D1SA 1PX0A 4RIEA 4ZGWA 3QEAZ 4OI4A 2H9IA 5KTKA 4LHYA 1U8FO 1OBCA 4LUCA 5AI5A 5BR1A 4UVHA 3LUJA 5MFPA 3LWOC 4IIJA 1PAUA 3L8CA 4DCOA 2WKWA 1M1KH 1UJ4A 1XTUA 1I6MA 2EFYA 1CNEA 1DEOA 1NM5C 3DM9B 1SBIA 4HXFB 1FX1A 4YCJA 4L8YA 4A15A 4JI7B 2LCQA 1ENOA 3ZWOA 3PA8A 4AJEA 5JZMA 2A5GA 3ILSA 2GLTA 3PENA 2HOQA 1ML3A 2O48X 3CRVA 1EEXB 4IV5A 3L4KA 5KKCA 3PVCA 4N5IX 2WNIA 4YMGA 1TCCA 1E3IA 1QYDA 3OEYA 4G5QA 4G1FA 4XDYA 4DLNA 1DXHA 4X1YB 3BX1A 1BOFA 1YZUA 3Q40A 4PLPA 3NJ8A 2FZ4A 3PUWA 3BQMB 3A9VA 2DFDA 3JD2A 4M99A 2FGYA 3L7NA 4NG4A 4C3UA 1J7KA 5A1JA 3GYBA 3QYAA 3PBKA 4IFTA 4PX9A 5SY9A 1QHYA 4RF3A 2HWWA 2GYVA 1Z68A 2V9ZA 2RD2A 1NUAA 2Y4OA 3TSZA 3GCZA 3NRBA 3DFFA 3HQ4O 2VHVA 2P4QA 1FTGA 1M2VA 4LSGA 4GNRA 2PKCA 4HQKA 4AJ9A 2IEBA 2ZYVX 1C7QA 3BMCA 3EUFA 3MWFA 1I7NA 1MPTA 4FFLA 3BXPA 3R7LA 3NPMA 3WWYA 1U4OA 2WIGA 4P5EA 3LWRC 1ODKA 2VLIA 3ZVNA 4W7HA 4LCEA 1NFFA 1YIAA 2Q6KA 4WNAB 1KEEB 2GEFA 3W8DA 3T15A 5HM8A 2FX2A 4Y2GA 3DZFA 1XTBA 1MKYA 1M1YE 1JNXX 1VQPF 3EQ6A 2FWAA 3GPBA 1LDNA 1HDZA 4IQ0A 4LRXA 4XUCA 5CXSA 3FVQA 3UHFA 3W2EA 1A82A 2R1VB 1DIHA 1RYHA 4N1AA 1QVVA 1HYHA 3KSBC 2VP6A 4YRDA 2BDUA 2QNBA 1XX6A 4B82A 4JUIA 4UZFA 4DYVA 1PNOA 2X76A 1Z9BA 3CNNA 2AS0A 1A96A 1QQ7A 3A27A 4MNTA 4P3OA 1AGRA 1Z12A 3ETHA 3HWX1 4QWMA 4NJMA 4ZCTA 1Z82A 2AMJA 1P1BA 1SVKA 3FOZA 4M38A 3OT1A 3JWPA 1RZVA 3Q12A 3CWZA 4IXTA 4PAQA 3RVMA 3OZUA 1JXMA 5T4HA 2IJGX 4OH1A 3KT0A 3SZLA 2DERA 2VYND 1BHSA 3M33A 4YC7A 4DAOA 2P2LA 2J3JA 2WHYA 3OPYA 2B34A 4CUZA 4TUYB 3F7OA 3GCDA 1KBOA 5AVOA 2FRDA 1ONPA 4HKTA 2ZROA 4M9RA 3P2EA 1KVQA 4JT9A 4MWBA 5F7XA 3CCFA 3E8MA 2AN4A 1ZVKA 2MINA 1QBKC 3FPSA 5F5NA 3LL4A 2IYFA 1T3HA 1NRJB 2NAPA 3LKVA 4PW0A 4CDNA 1MB2A 2VP4A 1N0HA 3L49A 3WC4A 1U99A 2QRHA 2OTJF 4DEXA 3DMPA 1KEUA 3TD9A 2VXYA 4FNMA 4LCJA 4OHUA 1XMSA 2EIHA 5LLSA 1SBTA 1FXWA 1D4OA 4ND3A 3T0FA 3ZD7A 1YTLA 2F3RA 1OLXB 2PZEA 1PKEA 4AXBA 5BYKA 1J07A 3IVGA 3PR2B 4EUKA 5CLGA 2J30A 4JJGA 4CI9A 4YRBA 2C4TA 4YJFA 1L8QA 1V3QE 2JW5A 1N0VC 1Z0JA 3M1LA 5EPOA 5K45A 4RS4A 1KMQA 2H4FA 3GFBA 3REQB 1XVIA 3BF7A 4OQLA 1YZFA 3VGJA 3I4FA 3I5AA 3BS4A 3S0JA 4YRJA 4BGEA 4YQZA 4X71A 4IDHA 3ONDA 5AD1A 3AIKA 2EP8A 4KL8S 3OZCA 3ZJVA 3QELA 2MMCA 2ORVA 5I9IA 1KMIY 2CZWA 2BSAA 4BNJA 4FKBA 5CA0F 5JYDA 3GC6A 4PAOA 4ATNA 3GLIB 3GQBB 4RY0A 7MDHA 1W85B 3FYSA 5JCOC 3ZDEA 4EFLA 2QVBA 4UEOA 2BLNA 1AKUA 2DZDA 2PH5A 3VR2A 1RRMA 2VYCA 2WT4A 3F6RA 2INGX 4NECA 4EHAA 3PFHA 2XD4A 3I01M 1ULZA 4KAJA 3PR3A 2YUTA 1KJIA 1XTIA 4L9SA 4OMFG 3MGGA 4ZQFA 4JIGA 5IF3A 4P9NA 2CD7A 1TIKA 2GVDC 1HE5A 3NP7A 2ZYWX 4FMPA 3HCOA 3ZV5A 4JBYA 1NBOA 3EVZA 1MOSA 2PQ0A 2I76A 5ES4B 4BIMA 1FL9A 1YVUA 5ARDA 2XUGA 2WD7A 4WKNA 3K9GA 4Y3UA 1YGPA 2EJBA 5AW3A 4FNGA 2B8TA 1FRNA 1XZCA 4J1TC 3CN9A 2FR8A 5ICSA 1DTWA 1RE0A 5ECDA 2D59A 1QAOA 3JS5A 3KCQA 4U6SA 2HWXA 3GFPA 4TZTA 3EULA 5F73A 3G0HA 2X2EA 2YMPA 4IHQA 5A4JA 3QU2A 4HQ0A 3S28A 1TPZA 1O5IA 1A1VA 3MRTA 4MUGA 5D6OA 3HCDA 3UT6A 3V1NA 3K94A 4A27A 2O1XA 3M6LA 4CTNA 3EH2A 4MUBA 1CRQA 1SFRA 2AZDA 3CURA 5JVDA 2X7XA 4OHPA 4QPPA 3RHTA 2E3JA 2MQEA 5DO9A 4BLPA 1KZ7B 2LZ0A 3MBMA 2H1SA 2YRFA 4GBMA 2CXHA 1RXIA 4QYTA 1QTQA 3U6BA 3K70B 3CLRD 2Y66A 4XWYA 4WBNB 1ADJA 3FWZA 3MB5A 3D00A 2P75A 5HKBA 1M1UA 1M54A 2H08A 1T2VA 1VHQA 2ATCA 5E1OA 5HCNA 4B40A 3LSYA 3AP2A 3ICQB 2LD4A 4V1CI 3VH4A 2G80A 5IYZB 1ZESA 1KFKB 4MJLA 3G2KA 4MVXA 2OV2A 1TQDA 2EW8A 4F21A 1KBQA 2EDAA 3TLCA 4B8ZA 4CT0A 3GAAA 2V0CA 3NHRA 4EH1A 2E4UA 4O0LA 1Z75A 3HFJA 3GG2A 1D8TA 3SLKA 2FZWA 4F3NA 2RHOA 5BQOA 1VRWA 5BSMA 4C29A 3H2JA 1QZUA 1PE0A 1YE5A 1XRGA 2YYSA 1E1CB 3BTUA 3CISA 4QOJA 2OFFA 3VH1A 5KQSA 1ZG3A 4N7MA 3V5NA 1OY1A 3BKWA 4C5BA 1AKNA 3AIOA 1KKMA 3N2GA 1BQ4A 3FZEA 3QRWA 4KAAA 4RL4A 2VWGA 5F9FA 1C0PA 1CP3A 1K0FA 2J5XA 1PYDA 3AEKA 4G4XA 3KVOA 4V38A 3W4IA 2C7RA 4NQ3A 1D4FA 4MAFA 1GUDA 4URHA 1SCAA 3PC4A 1IUKA 1Y4DE 3PRHA 1K6JA 3CRQA 3MOSA 4KZKA 4RGYA 2YXBA 3IP5A 4TYPA 4WE3A 1J0DA 3GP3A 4KCGA 3RVKA 3ADBA 1NXPA 3ZXSA 2EYUA 4RZHA 1UEIA 3THOA 1N8NA 2HYDA 1ISRA 3EF1A 3LMEA 2YVUA 2A0UA 2Q0QA 4YRLA 5AM5A 5EJMA 2ERXA 2P2ZA 4X93A 2EKQA 3M1IA 3CRRA 1O5TA 2X6TA 1ZNQO 1F9EA 4FB5A 4D9KA 2B2NA 3HFRA 4NXMB 3U31A 3JAMM 1CQJA 1JKJA 2JLZA 2ZIAA 2PWPA 1FSSA 4YI5A 4H3HB 2J0UA 2JLRA 3IBCA 2G70A 3JAKB 5AM1A 4BGIA 1M2EA 1GPDG 3AI7A 2GBLA 1WOMA 4TOIA 1QH9A 1M0EA 3LBFA 1SZJG 1VBNA 2NU7B 2J7PA 3AB8A 5AKZA 4KK4A 4JZKA 1ZRHA 2BE7A 2C8LA 3EDCA 1DXOA 1GT6A 3CCSF 2C9CA 4R0NA 1DG9A 1Z18A 4WW0A 2LDXA 5LYYA 1BVYF 1XZQA 2EL7A 2REQB 1VC2A 4MVJP 4TRNA 2F00A 3K5IA 3FHTA 1KIFA 4MVWA 4CLOB 3HO6A 3L01A 3VPBA 3IAM6 4UNNA 5KYXB 1V8BA 2ARKA 3TGPA 5B4TA 2UYCA 2WMNB 3BN3A 1JR3D 4PSAA 1Z33A 3KU1A 4LCBA 3BK7A 3IQFA 3AR6A 1S01A 1DLJA 3FTDA 2VSOA 2H65A 3DZKA 3MK31 3FOAA 1TDJA 1NX9A 3E3LA 5F33A 2QLNA 5A3SA 4P3PA 4Y9RA 3ZKAA 3RS5A 3T38A 2HK6A 1E7SA 4JWTA 1ZH8A 4QEKA 4H27A 1X7ZB 3SIPA 1RI2A 3HYSA 4DDHA 1PNQA 1HL7A 3MWYW 2HIAA 3VKFA 4J6FA 4V39A 1JR4A 2XWBF 3QX7A 1XE3A 1F2TA 4WKGA 3OPMA 3K35A 3KL4A 3KYCA 3FMGA 3A1EA 2FEAA 4P0TA 3GUZA 5IBRA 3OICA 3KWFA 3TX6A 5LXTB 1BFDA 1XRLA 2AFIA 2R9VA 3NM5A 5AJTA 4PCVA 3OMLA 3K12A 1DTSA 1SELA 3T3MB 4AWBA 1GL3A 2P62A 3BIWA 4X91A 5J59A 4LOHA 1SAYA 1WX1A 3H5AA 3IT1A 5TX7A 3LDHA 2QZJA 3IOEA 4V3BA 3TNJA 5E6SA 2UAGA 1KDVA 4M2LA 3FTPA 2DP4E 1OX5A 3U4CA 3PE6A 4JJ6A 5CNMA 1S8OA 2WG0A 3VPXA 2XKAA 4QLOA 1RQPA 4RLQA 4ZD6A 4P3KA 3V8QA 3TSYA 4MQMA 1BS2A 5K3BA 1SQ0A 2AG8A 2VK4A 4O4LA 4JP1A 4DXDA 1BE6A 2Q1TA 2DC1A 2O6HA 1E5VA 5FWYB 4F3YA 4Z3OA 1F60A 2NVWA 5J43A 2BGWA 1SIBE 2RAUA 4RAOA 2R1TB 4LY0A 4QIHA 3RAPR 2QN8A 4IUBS 2EDCA 2HV9A 1KAMA 4LS3A 4Z8YA 4DABA 5J40A 4KE9A 3KTDA 3EPKA 1COZA 2NPOA 2D5LA 5JTTA 1W94A 2FWRA 2H59A 5JCJD 2HA5A 1F20A 3M6FA 4KR6A 1QE5A 3VPCA 1U94A 2W6QA 4CKBB 2G5GX 3AKCA 1KIAA 4KC0A 1WQ4A 1VYHA 5KI6A 2GPAA 1X7DA 4YECA 2UU9B 4QDJA 1SMKA 3N70A 2ICAA 1E3QA 2D3TA 2OVBA 3D0QA 2BDTA 2ZJ6A 1L1RA 2AT1A 4IZ6A 3V7QA 1IB6A 3HZOA 3RR2A 2OPHA 4BU0A 2G5CA 2G1AA 1TKAA 2XQGA 1KI6B 3B7GA 3K53A 4N8DA 3OECA 4HRYA 3EEIA 4NNOA 1NJSA 3Q10A 1TC2A 4RJTA 3F8SA 3PD1A 4W9NA 4RLHA 1MIHA 1WQ3A 2POQX 4LHSA 1C0EA 3DOUA 2CHSA 1E60A 3QUBA 4EHFA 1CK4A 4YRRA 5DSTA 4B79A 3I5UA 1ZGGA 3Q7SA 5IDQA 3OLQA 2YHAA 3T7IA 1N2JA 1N6RA 3CSUA 4D3SA 2ZF8A 1A9ZA 3K73O 4I6JA 5K6TA 5EHNA 2AEEA 2P5UA 4PN3A 1A4XA 3NAGA 3F6MA 3LRTA 1FLDA 3SIXA 1MT0A 4L78A 1NW4A 3IXMA 2QNRA 1JD1A 3K0EA 3ZZUA 5I7VA 2PMWB 2UZ1A 1A4IA 3L6BA 1U98A 4C0HA 1X7WB 3GV0A 3TKLA 4EG3A 4ES6A 4P84A 4F3TA 5KSPA 4LRWA 1RXSA 4GMGA 4QGHA 2CUKA 1FVHA 4OL9A 4ZOQI 3QSGA 1G3MA 4NABA 1H05A 4K3UA 1ETUA 1UPBA 5EPEA 3D3WA 1ID8A 1C30B 1NNLA 2WOOA 5A02A 1Z8HA 1ZL0A 5FEUA 1NN3A 1O4VA 5HBRA 4GAEA 2NZYA 2BOVA 1J99A 4ZI5A 1E7MA 2XSZA 3ZIAA 3CF4G 2POCA 1U3DA 1ZCJA 3JX9A 1IN7A 1G9SA 4Q48A 1DAEA 1K2WA 1PK9A 1XI2A 3M3PA 4JU9A 5I4CA 3C7CB 4F46A 5JNLA 5KDDA 2Q0XA 2O2JA 1WHTB 4U39A 2OV6A 2IHJA 2ZAIA 3NCHA 5ADWA 4GECA 3OD5A 4LZNA 5HR5A 1EDBA 1AGNA 4IINA 4E5UA 2R1ZA 2BE9A 3AESA 1HURA 2C5BA 2ZUSA 3F47A 1GGMA 3IYLW 3LDUA 3OJCA 3EAQA 3PXUA 4CW7A 1OYOA 5BYBA 2GLXA 3L7BA 2GFHA 3VYUC 3EQ9A 4X94A 1I9CA 4XOIA 4XB1A 5ALOA 5K3AA 4K9NA 3VYRB 4YN3A 3H1GA 2P1DA 2AJTA 3PNVA 3DBLA 4KGXA 4N54A 4YRNA 5BQXA 1TL7C 3IUPA 4O4HB 4RH3A 3LUFA 4L0MA 1RPJA 1BXRA 2P6PA 2WM8A 3MJCA 3DBIA 3SMQA 4MUXA 5AUPB 5AI4A 3H5RA 3LCJA 2OHOA 2V6MA 3OA0A 1SDSA 4JBWA 3K8ZA 1SBQA 2ACWA 3IB6A 1QV7A 1Y6QA 5JS2A 2GPJA 3R3YA 3V1YA 5ICMA 2IUFA 1ZFNA 1PT5A 1ZDMA 2JRLA 3KB1A 3NHPA 3QTBA 4TTAA 1KJ8A 3F74A 2FQWA 3CGWA 4UD6A 3DZBA 3K6RA 3CVOA 5E1DA 4ZVPA 4BP9A 4HLDA 2WHPA 3NALA 1U4NA 1DMRA 2GZLA 1DO2A 4H1WA 3WK6A 3JR7A 4BBZA 4Q16A 3PTLA 3R5TA 4OV6B 3IJ5A 3ELWA 3HP7A 6NULA 1BCRA 1Z2EA 1RYMA 4LJYA 1N7IA 2RB9A 4BT2A 4G4SP 2HUPA 1SD2A 4M87A 4DZRA 3DCJA 1RKQA 1H0HA 4KPUA 5HJEA 8AT1A 5EJGA 2ODEA 4NYIR 2ZWVA 5A5EA 5EFOA 5GADl 3QK7A 2A9JA 3BB4A 3MT9A 2PANA 4XCVA 1SHZA 2HA7A 2PMFA 3G71F 1PR6A 2DYKA 1DBWA 2BTQA 2HPAA 5JQGB 2Q2OA 3C16C 4P4UA 2YWXA 5G0SA 3TWOA 4BVGA 2NM0A 1T1EA 2AC4A 5AI9A 1YRYE 4CFSA 1U28A 2FG7C 1O94D 2X15A 3IRUA 5FUWA 3OETA 4G1UC 2H9AA 4WFJA 5G53C 1OBHA 5HA5A 4EIWA 4YAKA 3UB4A 2QPOA 3M49A 1B6GA 2FFAA 1LB1B 2GN9A 1FXUA 4DA7A 1EPUA 3ILVA 4FKZA 1W5EA 3QUTA 1J2EA 4BDTA 2I99A 2XXJA 3N5CA 1ZKMA 3LWBA 1PJ4A 5MF6A 5KPJA 3RIEA 3NW9A 1A9PA 1QMGA 2IPLA 4IIFA 3ZCVA 3MWDA 1P1JA 2Y76A 4EGFA 4IOJA 4IRXA 4YACA 2GERA 3HLKA 7ADHA 1NN1A 1KL7A 2IEIA 3H6GA 3LZDA 5T6BA 5EVJA 2CKDA 5LYJB 3QUSA 2X0RA 4IGKA 4ZMSA 1M8JA 1SIOA 3CEJA 5IKXA 3EXHB 2GRJA 2WQZA 2JCSA 3DTVD 4Q9DA 2W2NA 5ALTA 3IESA 3IA2A 3TG2A 3K4QA 5L7TA 4KK3A 3RKSA 3OOYA 3UG7A 5KX5B 4KIGA 3HTXA 5J5VA 4CETA 5F78A 1QIKA 1YBHA 1FLVA 1YZTA 4L3VA 4NC9A 3AY6A 1USVA 2D62A 4RPIA 3K0CA 2Z01A 3AEYA 1L4GA 2DPLA 2PLRA 4TL7A 2RHBA 3W8RA 4DM3A 4HXGA 5DMHA 2X1HA 5HMLA 1GILA 1J9GA 3A6GA 3FWNA 4LF7B 4K05A 2VHQA 2W2VA 4KRXA 5HZGA 3SZMA 4KX5A 5MFZA 3QPDA 4C81A 1V1MB 3UGKA 4K6KA 1FNMA 2V96A 5B37A 4REOA 5ALWA 5LPNA 5EP3A 5A0VA 4PTYA 4BV2A 2FFJA 2JI9A 2PIAA 1X1SA 4ZV4A 4G9BA 5AUOB 1JW9B 4GXQA 4KQFA 4LRUA 2DSTA 4NBTA 5CYPA 2W48A 1O1YA 1HRKA 2I6TA 2IOFK 2H1OA 3SX4A 1O57A 4J07A 4M0PA 1FQWA 1XMQB 2SKDA 1RJ9A 4PYLA 2HSDA 5HFJA 5B3JA 2Q4RA 2JJ2A 1M2WA 1ICEA 2CKMA 2ZB4A 3ZU6A 4C7XA 1LBSA 2YR0A 2PJUA 2G0AA 2QL9A 1CR0A 5COQA 1USUA 3JRNA 4Q4HB 5BW8A 1DKRA 2NO1A 1KRHA 1RS0A 4JU8A 2R2AA 1DUSA 3EYAA 2O8BB 1JKIA 2I7CA 2WBLC 5IJ9B 2V45A 3FH0A 3QLUA 1G8HA 3HSKA 1T29A 3IDOA 4FCCA 4FN4A 4JGBA 1BFKA 4JNCA 4MIOA 4XAQA 2OHJA 4AMYA 3U44B 4ALKA 5K0BA 2B0CA 1MRZA 1NBMA 4BV8A 3ZQ6A 3OJXA 2QN9A 2XRZA 1L4BA 5GVRA 1STOA 4BEJA 4RTLA 2Q3BA 3BC1A 2PRSA 4DRZA 4E94A 4Z5XA 2HLHA 3FDZA 3L04A 2VHWA 3N2IA 3FMVA 1VLMA 3QG5A 1M6YA 3AVOA 3ORFA 4G24A 1DUIA 5AM2A 1LV7A 2YOGA 2A67A 1KEZA 4QDZA 4LCKA 4B8WA 3D4NA 3E9YA 3UKOA 2P79A 1FMTA 5A6SB 3H87A 2VZ9A 2VWQA 4BASA 5I7RA 1OFGA 1TTHA 2BKAA 4DLVA 3PNLA 2J32A 1U9ZA 2A9KA 4RVSA 5JO9A 4D79A 3A06A 1U9IC 3AUJB 2FN8A 4RHXA 4CIWA 1SXQA 1DAFA 1XNRB 3B1YA 4F2DA 1KDPA 3RYFB 2F1IA 1CWUA 3IAAA 4GHWA 4LJ9A 1COWA 2HGSA 3HJNA 3ND6A 1BA2A 4MYHA 4ZK7A 1T13A 3PQFA 3S06A 3HKCA 2DAPA 3QFFA 4WXYB 4FP9A 4B46A 1QH8B 1A9YA 1IYZA 1EQ2A 3M8KA 4WOBA 5KWVA 1FP4A 1KQPA 1CN7A 1G18A 3AEUB 4RKEA 1GPJA 1A7JA 3L9XA 4GZMA 3MQ2A 1U3FA 1W42A 3ORRA 3N6RA 1I1OA 5EJ4A 1GWNA 1K3TA 1XLUA 4ENPA 3HE3A 3ZE6A 2QLTA 1QZXA 1MEEA 1LPAB 2QSUA 1AU9A 2W6NA 3L93A 4OGWA 5GGYA 5TJHA 2DUMA 2FDXA 4F7DA 5AVUA 3PAFA 4ZI7F 2KYRA 5HP7A 1NXSA 2GHIA 2WFLA 3CLKA 3HRKA 1OV6A 5LBTA 3T4EA 3CCBA 4M8IA 1CR4A 3G4SF 1NVMB 5JXIA 1GUAA 3N7AA 5JYCA 3AKDA 3I32A 1ZN8A 1A50B 2PMBA 2B33A 1SCBA 2X6QA 3BSWA 3KSDO 3IP7A 3MTGA 4L8GA 4NMXB 3U5ZB 4KR3A 3R3ZA 3CB4A 3AVUA 5DX8A 1YOVB 2KTUA 1JIKA 2DECA 5FFMA 2VL7A 3GF4A 4GBED 2GF2A 2QGZA 3WKCA 4UNSA 1H6CA 1HYGA 1ZJ6A 4JDPA 2BYTA 3R5HA 3IQDB 1PJZA 1IRIA 3JQAA 4B35A 3A10A 5JS7A 2ZIGA 1LC3A 3T1YB 2I66A 2HRQA 3UFXB 1F2VA 3LJKA 1AS3A 1CLEA 2WQ6A 3BBLA 2N0SA 4KXFB 3WQBA 4BMSA 1SKMA 2ZDQA 3OEEA 4G07A 3DOIA 3VDMA 4CDMA 3EEOA 4M9SA 4BRWA 1QIFA 5BWBA 1TTQB 1RCFA 1B00A 1H6BA 3C8MA 1JDTA 1R4NB 1RPTA 4KACA 4Q3AA 1VHAA 2DH6A 2Z1TA 5EWJB 4RA6B 1TJNA 4L27A 2OV3A 2R6R1 2IVFA 4C03A 2CK3A 5K03A 1L5MA 1HORA 4DC9A 4EFMA 3P9ZA 2PX5A 2ODQA 2QN2A 3GCWA 2BP7B 1T1RA 2ZI9A 4QUHA 1X2BA 2A1UB 2PS9A 1UPCA 3S0HA 4BLRA 3A9RA 2ZBFA 3E2IA 3K9BA 5DKFA 2XDQB 1G8YA 1VQ5F 4AZ3A 2WNSA 4H1UA 1G59A 2BC9A 2J48A 4LJ6A 4RYDA 4CQJA 4GXNA 3AX6A 1C1XA 3MCQA 3P2JA 2P27A 3M4XA 4FJ0A 1Q95A 2OEPA 1NHGA 2JGRA 4PO9A 4RPKA 3BFPA 3UF0A 1A4RA 1MX1A 4ARZB 2C9BA 4RPCA 3V1TC 1A97A 2ERCA 3ON5A 3ONEA 3FRJA 1B16A 1XAGA 5HE8A 4BCDA 3U39A 4DDMA 1QCZA 4MB6A 1FNBA 4WEQA 5DRYA 3LIIA 1Z4PX 4BJ3A 3WYBA 1Q7TA 2XUAA 2JIRA 1TU0A 1DEHA 1OU4A 1TAHA 2ZBQA 4NYMR 2BKXA 1JALA 4G0OA 2GKGA 3O3MB 2OENG 4EHKA 1K7SN 4OJNA 2UYNB 5M3BA 1KMHA 4J7CA 1G9XA 2H8KA 4TXMA 3RGWS 1QVRA 4Y2PA 1Y3HA 3H9JA 4R8VA 2RHMA 2C2MA 2IC5A 2Y0EA 3M4YA 4QATA 3F5MA 3H11B 1RR6A 4FMDF 4P3YA 1Y5IA 1FTNA 4EEXA 2XA2A 3T7DA 3RWOA 3UFBA 1DAMA 2HWUA 3ENZA 1G5PA 3QKUA 5FJ4C 1LBTA 2VDMB 4G0NA 2FQXA 1QKIA 3BRWD 1XZLA 4US0R 3SE0A 5IXJA 3NRJA 4A26A 2QJOA 2HDOA 2LCFA 1SD1A 1N1MA 2QD1A 3BJZA 4FYYA 2WHXA 3HCWA 4HTFA 3LX5A 1U0LA 4I9FA 3IPXA 5T41A 1II0A 4LX0A 5BT8A 2CFTA 4WOPA 2QQ0A 3I92A 1MTZA 1J8FA 5IAAA 2RC6A 4OXNA 4WRRA 1Q1AA 3ZX5A 1XD8A 1QNLA 3IKFA 1L5NA 2QMQA 5E2IA 3VO2A 2QN3A 4RGBA 2HPHA 3K0HA 3RUPA 3TQRA 1DPGA 5DHFA 2KTVA 1D6NA 3CUYA 3LX4A 4MWDA 3V4RA 4F3CA 1C41A 2RB4A 4PLVA 3AUFA 1EXWA 4YT8A 1SC6A 3GRUA 3HY4A 4KDFA 3ZVRA 2NQ8A 2WC1A 2OHIA 3DYBA 4G2NA 4DCJA 5TQ0A 1XJCA 1XTZA 3VSDA 5E6SB 4II3A 2X8AA 3A05A 2VDPB 1SK9A 5CXXA 4WECA 1KJNA 5TB5A 4DJTA 4UHKA 1Q15A 2G09A 4PLWA 5PNTA 4HWTA 4C88A 1IWOA 2EZ9A 5AT1A 5AOCA 3DFMA 1NVKA 4UOQA 4QGFA 1K6EA 4FFBA 4WT7A 4JK3A 4QREA 1XPRA 4MWZA 1TVKB 5TARA 4FR5A 1YE8A 4Z0PA 1R4AA 4RD0A 3CXRA 2DTDA 3OPQA 2Q6OA 3VR6A 4YT4A 4TVOA 3S02A 2EEZA 4AY6A 1UODA 4EPWA 3THYB 2V4MA 1VQ6F 1MMFB 1OXUA 4O63O 1J56A 3HVIA 3COWA 1BW9B 1GKIA 3GJTA 4HDCA 4R40A 5AK6A 5NLLA 1L7NA 1T5SA 3Q3CA 4J1SA 2ZAOA 1YQXA 4UM9D 3T7KA 3TW0A 1ZP6A 4DADA 3AB3A 3PPWA 3TI9A 2TSYB 1X70A 2VOJA 3TE7A 4BOYA 4DNXA 1XLTA 1VPWA 3NDBB 3KR1A 3M3HA 3RHFA 3AVQA 1DQZA 2RHRA 4IGFA 5KQMA 2XZLA 3OIGA 3GDFA 1I0LA 2NVBA 1MX3A 4LTDA 4LC1A 4LQDA 1DHTA 5TQVA 5JY6A 2D0IA 2FSPA 2QQGA 1WMSA 4MMYB 4RY9A 3OCJA 1JXOA 3D7LA 2BFFB 2OOSA 3H5OA 3PSHA 2VTKA 4ZCIA 1QXSA 1BXGA 1WSAA 2ZIXA 2AGVA 4BFUA 2VT6A 4OPMA 3S2EA 4TMWA 4U4AA 1Y3CE 3UMJA 3S2GA 2PKRA 3QF4B 3EZLA 2VJBA 3PGXA 2IPOA 3RVOA 4C0WA 4GXTA 3F49S 1R0BA 3FPFA 1Q7RA 1LPPA 3QXJA 3W9SA 4RK1A 3CG0A 1CIVA 1QFXA 1Q2XA 1I3KA 4UJ3A 2GCGA 3GDOA 5A5VA 4MR8B 1SC4A 4K9OA 1W2HA 3OCZA 2H11A 3PGKA 1P60A 3MIZA 2OQRA 5FBQB 3WL4A 4UBJA 2B37A 4FXOA 2C4NA 3HKEB 3SBEA 1IPHA 3SFVA 3W4KA 3KYIB 3BL5A 3OZSA 4J0JA 4WK2B 3V4LA 5LJLA 1OWPA 1S2IA 2V9YA 1ORTA 1W29A 3IC5A 1S2LA 2NYUA 3SF8A 3I37X 2ZQYA 2UZ0A 2NNLD 2QAJA 2SNIE 4FILA 1IC6A 1I5OA 4XWAA 2WM2A 5FBWB 3NK6A 3D4BA 4D8XA 4EA6A 4OP3A 5D5HA 4PZDA 1GVNB 1KSFX 5B3KA 4FMCF 3TOCA 1K5PA 4ZDWA 3KOZA 5SY4A 3E6AA 3JQFC 3B3GA 2RH8A 4E7OA 4B83A 4D9EA 4F1WA 1YA8A 3ZE0B 4Y6RA 2XMCA 2AUTA 1MRSA 4CLRA 4DHEA 2JJYA 3IVMA 1HT3A 5DYTA 1EXMA 4DFDA 4ZRMA 4NZ9A 1XEXB 4BNWA 3GBVA 4YJ3A 4NFYA 1BN6A 2YV2A 1ZNYA 1C9DB 2MYTA 3KIPA 1RE1A 1T5OA 2YWJA 1YACA 3EGEA 1KU0A 4WX2B 1K8XB 1XRQA 1GGKA 1XCOA 1W88B 2KW5A 2XE6A 4FEEA 4ZV7A 1F5NA 1Z39A 1G2QA 1BEZA 2V6FA 1AF4A 2XI4A 3R0ZA 2G06A 4NG5A 4CM1A 1QK3A 2OXEA 3VR2D 3IS3A 3HYTA 4URZR 1ZO8A 1YH3A 3PDJA 5E8JA 3CYQA 5C5EA 3T5PA 4BXOB 4JX9A 4UHDA 4JL8A 4E5KA 3D43A 1AZLA 3LPMA 1JAZA 2A84A 2MDTA 5FL7A 4XRGA 1BYUA 5JSZA 1KNJA 4IHJA 2HWYA 1MC1A 1DJOA 1QYXA 2J3DA 3DB2A 3VC7A 4LDAA 1Y33E 2FPGA 1UBKS 4P7KA 3OZBA 4WFIA 2PXXA 3I5MA 1IXZA 5JAPA 2DHDA 2QM8A 1NFQA 2I80A 3C7TA 4F9FA 2MSCB 3WNDA 4REMA 2EJVA 5CM2Z 1F2UA 4FC6A 1ONNA 2B82A 3R6WA 4DCSA 1XQXA 2W8BC 1OXMA 5GAPK 1NR1A 1XU4A 3IFSA 4H7JA 1VIVA 2X1VA 4QOEA 1VHJA 2J67A 3O4JA 3CUTA 1UAGA 3VZSA 3I2KA 2HM7A 3HBJA 3V4SA 1E4YA 1GQOA 1GQRA 4EO9A 3TF5A 1ZW6A 4RH0A 5LA6F 3QKRB 4WJLA 3QWFA 1KERA 1OI2A 4EB6A 3EGDB 3IJRA 2VHJA 1BWPA 4E31A 4ABYA 1UKAA 1TD1A 2Q9BA 3CJTA 3EZYA 4GWKA 5INTA 2R6ZA 2ZUWA 4I1OA 5JMOA 4JGIA 3DWEX 1XWFA 3PG5A 4HDOB 3VTFA 1GEEA 1ZS9A 4UNRA 3UAGA 5K8VA 3KS9A 1E94E 1W36C 1MW8X 2AJ8A 2W6JA 1L9XA 4UARA 5IVKA 4BT4A 3EORA 5IEJA 2O8FB 1X8LA 4LWQA 1GG9A 4BEBA 4G4VA 4M98A 3NLLA 1WWKA 4Z7NB 1KDYA 4ND5A 1IZ0A 5FBZA 1IHXA 1Y63A 1F9AA 4HFRA 2P1ZA 2VTVA 4N49A 1UPFA 1TVEA 2OYCA 3RTEA 4L22A 1J0EA 2FOXA 3LHFA 3HB0A 5I8PA 2FTKE 1EX9A 4GOKA 2IUEA 2NTEA 2XT9A 4E5NA 3I5XA 2WFMA 3VH3A 1U6IA 1DC4A 3BTVA 1XBIA 3KPWA 3KOOA 3JQBA 3E1SA 1DCFA 5DZSA 3ZV7A 2O50A 4ADSG 3V46A 2Q1XA 2J5KA 4HLCA 2IZ5A 3SC2A 5EB0A 1JHQA 3K8OE 4PZPA 5JDCA 1X1EA 1A9SA 2Y93A 4TQGA 1P4RA 5KIAA 4HNAB 5FPSA 5KQRA 5KTPA 1GKKA 1UWCA 3MCZA 4XJSA 2RFLA 2JAPA 2BIFA 1SD5A 4E51A 1DELA 3MCAA 2YOFA 3CWQA 2BGLA 1YMVA 3VAZA 2SHKA 1CUHA 2DUUA 1JQDA 2XVAA 3IP8A 1U8YA 4J49A 3GEEA 3M6VA 1H2RS 3OQBA 4YO8A 4TVSA 4MP8A 4OHYA 5A06A 1U2PA 3IEMA 2WAAA 3KAJA 3JARB 2H7YA 2C92A 1LW7A 1IHOA 1QH0A 4H7DA 3PWZA 3ETNA 4YRPA 4ESHA 1IN1A 4AL4A 1CUAA 1BX1A 4JH0A 3ZDYB 3K4PA 1OCEA 4MKRA 5KTRA 3E9MA 5EMJA 4ZHWA 1J49A 1T0IA 3ULKA 2ET6A 4RNCA 3TRHA 4E2ZA 1C5KA 3LFHA 4FLEA 1N3IA 4JLUA 1QV9A 1XBTA 5FA6A 2PD6A 4TKVA 4EJ6A 1FP2A 1AQLA 4LJ8A 4D7AA 1NASA 1XTSA 4EHIA 2ZIVB 5DWVA 5KYWB 1ODTC 4EB3A 4RVNA 4B47A 3O8NA 4J0IA 3CUEF 3ELCA 1QGYA 1M90H 1TQ4A 2OO5C 3IBGA 4JP3A 4GZ6A 5CXUA 1DX4A 2FEWB 3OIYA 4OI1A 5GV8A 1ZC3A 1Z3CA 1K66A 4LHEA 3SSOA 4A92A 3JVDA 1P1FA 3CZAA 1BGVA 4FFOA 2XNCA 4HZIA 4WJKB 1PYGA 1UM9A 2J7PD 3V4PB 3WYFA 1B23P 3N5KA 4ND8A 3LBAA 1WVMA 3IH5A 3WHIA 3DO6A 2ZRGA 1ONSA 2PZJA 1PF7E 1AO0A 1GPBA 4LYAA 1E2LA 1QGAA 2PVSA 1UMKA 2VT2A 4LEIA 2E1RA 2K2QB 3PNYA 2WWGA 3UPDA 4G37A 4YAFA 2G9RA 1HZJA 2OMKA 3GUHA 4RHCA 3T41A 4YFVA 5A4KA 5TE9A 4IMIB 4K40A 5BN4B 3E7DA 1FSPA 3QOYA 3RSOA 2C0CA 1KNKA 1MOZA 2AQHA 4AN4A 4P98A 4XGRA 4C1NA 1T9GS 3B70A 3R4VA 4RQUA 3MF4A 3EZGA 4OHBA 5K4HA 3P1JA 2F59A 3A3KA 3RFFA 2H07A 3GEDA 3M9LA 4PN7A 2HU8A 4IYJA 1C29B 4M89A 4QHYA 3DEAA 4X85A 2P5YA 4GP7A 3RPEA 1VG0B 3P5SA 5DHRA 3RJZA 3SF0A 1P6QA 3UJ7A 5BVHB 2AI2A 3HI4A 2VLBA 3U7RA 5H81A 4MKHA 1B1CA 1NMUB 3VPSA 3GVXA 1E9CA 4H7FA 1DT3A 4MR7A 3UAYA 3MTQA 2O0KA 4GMXA 1LBQA 1WMEA 4B43A 3PB3A 3AYXB 3PJDA 1L4HA 1A95A 1UP7A 2YNMC 1P4SA 2HIHA 3EXIA 3F96A 5TEVA 2JJ8A 2QZSA 5IVPA 3P52A 1E2QA 1Z73A 2C9OA 3GHHA 5K3EA 3OONA 1RKXA 1AMUA 5C35A 5LMNB 3AF4A 4LYEA 4MVJE 3G02A 2JGDA 3IQGX 2HJWA 1TC1A 2ZYTX 4BPBA 4KHPB 1KAGA 2ZRKA 3G89A 1WKBA 2QZ4A 4IMJB 4BRSA 1P75A 4I5IA 3GRKA 3E20B 4LZWA 1F48A 5JFTA 2OM6A 4MV1A 3IQXA 3QH4A 3MG9A 2PGDA 2RG1A 4EPTA 1KZ4A 4IR7A 4CF6A 1DEAA 4D81A 3LCRA 3TVYA 3NBMA 2ZJOA 4I55B 2VPPA 4PYKA 1SG9A 2Q3LA 4KGZA 2C2GA 4DRXB 3QVMA 5T4BA 2XYRA 4TN5A 3BL8A 1O77A 2D7JA 3O2NA 4QHSA 1PZHA 1P4JA 2BKEA 4N5HX 1RLTA 2DUNA 4P81A 5D1HA 5L7YA 4BB6A 1SN7A 4JC4A 4L73A 1BXKA 3PVZA 1NF2A 4BP1A 3PXAA 4U5XA 2IY8A 4ZPXA 1JXQA 3W9BA 3ZLUA 3G8CA 3GRYA 4A2PA 4IIJB 2A78A 1C8KA 2HD4A 2SICE 4XYMA 5HQ3A 1F12A 2G1KA 1EHCA 1H2HA 1KVRA 5C5DA 4GI1A 4JROA 5D5QA 3TTVA 3ELUA 5JSYA 1Q22A 4M1ZA 1T5HX 1X52A 4TV8B 1O7JA 2NADA 4RF5A 3Q4GA 5G3ZA 4C20A 2WLSA 5CFQA 2FWNA 2FSHA 5FOQA 2D0OB 1FBTA 2Q3FA 4WL0A 2Q6TA 3LCCA 3IV7A 4RGQA 2G1JA 1JEQA 4G23A 1UBJS 2B6HA 1JILA 3CG6A 5C80A 4EAQA 1P8AA 1KQFA 1QQ5A 4LZAA 2OFWA 2Q9UA 3RBAA 1CTQA 2N9UA 1NTRA 2YFKA 3KBBA 4KFUA 4QTTB 5L3QB 3D64A 3BXHA 4J75A 3A58B 5DTEA 2ZB8A 3FZGA 1FTQA 4GDMA 4O2RA 3M4NA 4D9HA 1VZ3A 4JQZA 5B1EA 3FCOA 4JITA 2ZSIA 1DU4A 2ZYSA 3UUGA 1JIXA 1MCZA 4ZYYA 1JJ2F 1M2VB 2G0NA 3AR3A 3BORA 5CBPB 3EZ6A 2ONCA 4EQ6B 2Z09A 1X7HA 5ADHA 3BMCB 4H3KB 2R8XA 5TIIA 2XA9A 1V37A 2FRXA 1W2WB 3MUEA 4UATA 3DTYA 4OQPA 3QUWA 2VP2A 5K2OA 1HFKA 4LMBA 3TD2A 3UM9A 4QO8A 2XSZD 3DXFA 4QT0A 5DBOA 4XRRA 3ZIAD 1USWA 1E99A 5CDSA 4F5DA 3FUTA 4G5HA 2HSGA 2YKGA 1Q0QA 2UUBB 3QXHA 3WV5A 4YXWA 2J5BA 1OH6A 3F0EA 2C98A 4IIDA 2HT6A 5JBIA 3LOUA 3K1YA 3G13A 1EZ1A 1SVSA 1YJQA 3WR5A 1U31A 2CVLA 3O1HB 5IVIA 1GGNA 2QAGA 4URWR 5CVDA 2J3EA 5BYAA 5LLDA 1ND6A 3Q0IA 3NYIA 1CY0A 3OHSX 4EG0A 2QVGA 3COSA 4MKXA 2ZTHA 2FFBA 4NJMB 2B8EA 1MH1A 4PBTA 3M7IA 3OT1B 4J90A 3VBEA 5K6AA 1QGUA 4OP1A 5CH3A 2FFQA 4J7AA 3AL2A 2QA5A 3SJBA 1S2MA 3B78A 2EFJA 3AUYA 4CTJA 1WXDA 3W2HA 3ZWVA 3OPYB 2A88A 2BELA 5DEIA 4RTSA 2YV5A 1QD9A 3DDCA 2IG8A 2H5LA 1VBMA 5AK4A 2Y3IA 1EBUA 4NV3A 4CL8A 3IAEA 3ZYZA 3ESYA 4R2JA 1E32A 3IBYA 4X64B 4UPEA 2QGNA 2MINB 1JVBA 2VH5R 4RKQA 2IP4A 3CQ9A 1M6HA 2V98A 3RVRA 1D04A 5AJWA 5ELLA 5ICFA 4CQLA 4CU5A 4DNOA 3CCUF 1IFXA 1Z15A 1ZWKA 3ENKA 4OQFA 1NUQA 4FSDA 5CJJA 4LDRA 3OHPA 1WABA 2AD1A 3KSMA 2CZCA 4R1NA 1JQLB 1GO2A 1XF1A 4JBHA 3A4TA 4GPD1 4CF4A 4DE5A 4S05A 1QC5A 1IBMB 2H8EA 1DQYA 1JSRA 3TCKA 4EY6A 5KYUB 1BE8A 1XA4A 2WV7A 1Y4AE 4J16C 4TXLA 3PNSA 4IDCA 2AYZA 1K8YB 3AK4A 4NBUA 3SCZA 1RWXA 3ADOA 1DO8A 2PL3A 3CH5A 3GL9A 3O3CA 4YJFB 3FDIA 2CHQA 3HLYA 4QAJA 1U2GA 2HZ7A 3QQ5A 3RH0A 4Q34A 3V34A 5H68A 4GYWA 1RHJA 1V9CA 3QUQA 4RK4A 4CIAA 3DONA 1Y1KE 2C2YA 4KXYA 4ZRDA 1DOAA 3ILHA 2VQSA 2WM9B 1C4OA 4R8RA 3RODA 4CLHA 3FYUA 4PR3A 4UMVA 4RIHA 4BHTA 4D9BA 5AW7A 3VDNB 3COVA 3C98A 3QELB 1KYZA 5HGJA 3I56F 2GUWA 1U2EA 4PSVA 4CTOA 4A0FA 4UQLA 1YBVA 2VQ6A 5H4GA 5LNK6 2QDXA 4JLDA 1YI1A 1QSGA 3TJZA 2ODWA 4TTIA 3G6KA 4FLFA 1WPRA 1B8NA 1GUFA 2PH7A 4OQYA 1NF9A 1UI9A 4JT2A 1XCBA 1FRZA 2DX7A 3TZKA 2CLSA 1HM5A 1OFVA 1D8AA 1ODJA 2H16A 4J0HA 5G1PA 4DR1B 1YOBA 2PUEA 2EOAA 4MDFA 2ZBVA 3MFQA 1P9RA 1ZY2A 4G0WA 2O5CA 4RIGA 3HJFA 4JJKA 1NU6A 1ODSA 1S3GA 3UMMA 4EBBA 1P9OA 2PWAA 3IP6A 2PJRA 2J3QA 1Q91A 3CPJB 3IX7A 4UTNA 4HP8A 4TROA 1OIWA 3BSFA 1JTEA 5EIEA 2B4TO 1DJNA 7ABPA 2WD7B 5L9AA 2D54A 2ORWA 2WABA 4REQA 4BX8A 5GJBA 3D9QX 3HTNA 4UASA 2CVHA 2HIGA 5GMOA 3WVNA 4V02A 4HNVA 2FLKA 3W6ZA 2VC2B 1Y98A 4LY6A 1DTWB 4U7FA 1QJCA 2ZM6B 4FYIA 1V26A 3ASZA 3TDMA 3KQOA 4BQIA 3VVBA 3TD6A 3ZIUA 1V39A 3SE7A 4NATA 3FD6A 1B2RA 2K2WA 1OWNA 1PSZA 1UJBA 1KZ6A 2Q2WA 2R87A 2R68A 3FIUA 3OIVA 4TL9A 5A7HA 1R6XA 2XXAA 1E3JA 2GILA 2ZWIA 2JIOA 2HS0A 3I04A 1W6RA 4WNCA 4EVSA 4NULA 2PKWA 3ZBPA 5JVDB 1RWVA 2OY0A 5E7MA 1E4EA 3NYRA 2OC4A 1T9KA 1YV9A 3E81A 4FDTA 4ZDJA 1HH4A 3QIVA 1YZYA 2ZCJA 4G0XA 1JR6A 3V55A 4GF5A 3QXGA 1CJSA 3OX4A 5HG0A 2YN2A 3AM4A 4M53A 4ER0A 3WRVA 1T9DA 2RH4A 1VIYA 4U00A 4YEDA 2CL0X 3PX2A 1QWSA 1CUEA 2CSUA 4TX1A 2BFOA 3MAJA 4L8LA 1M73E 4PNPA 2GM5A 3O9VA 4N41A 1DDOA 3WLRA 5J47A 1HT0A 4EI7A 1QGED 2NACA 3GFGA 3QVKA 4RPGA 1DC6A 1BRMA 1OFHA 2CVQA 2PS0A 4WLVA 2WFAA 2X9VA 1NP7A 4OCZA 2M6LA 1XQVA 4INOA 5FT9A 3TZLA 2VNIA 3GMTA 1EZZA 4XEHA 3WNZA 4EABA 1H5UA 5C8YA 2PX3A 4WCDA 4OU5A 2RHCA 1S6YA 5K0NA 2P9CA 1DZIA 4QBTA 1DCMA 5J4KA 3R8FA 1VG1A 1RAHA 1BYIA 3ZP4A 2QE6A 2JCYA 3VTIC 4TGLA 3ME5A 5ENZA 4KE8A 4V0QA 4J6EA 3AMVA 1LDYA 1VQKF 5LP6F 3N2GB 2YXLA 1RABA 1WXGA 2XKBA 3UMBA 1MQ8B 2YHSA 4IRUB 4CMEC 4E5MA 3AEKB 4NZNA 1UBEA 5IUNC 4CKWA 5C9ZA 4C4YA 3KZCA 3AHFA 3B8HA 3B7WA 3ELDA 5F2OA 3NEJA 3WZ2A 4BWVA 3CF0A 1Z8NA 3SMVA 4CUKA 2VQFB 1L7VC 1O89A 1V47A 3TKYA 5TGZA 4J8PA 3G6WA 1LK0A 4LV6A 4MW5A 1WXFA 4AKTA 3W5AA 2BCEA 2X2FA 5FR2A 4B6GA 3SHOA 2AG1A 2OK7A 5HDQA 4TUYF 1SUPA 2QOEA 1MQSA 5FLKA 1R0XA 1D6SA 5CVVA 3OZRA 4EQZA 1UXIA 3X1JA 1EGMB 5ER9A 1KVTA 1GZ5A 1MB3A 1JKJB 1CQJB 5J2UF 2QB5A 1LBHA 2O7VA 1O97C 4TYMA 3SS7X 3HMKA 3RREA 3B7PA 3LLCA 3IHTA 3S8YA 2HXYA 3PVSA 2C77A 1VI6A 3ELYA 4NFLA 3IURA 2HA4A 4C0LA 4M7OA 4N7BA 3AKEA 1NF8A 4JMPA 3VSCA 2HREA 4X8LA 4BB5A 5T7BA 1LCIA 2UYQA 2QNIA 5EPUA 4XGIA 3RLIA 2IBTA 2GA8A 2RDMA 4QFDA 3L7LA 2UZAA 3C97A 3T34A 4M55A 1ACMA 4RM3A 4WXRA 1NOIA 2RGNA 4MUNA 3NP9A 4N4AA 3TLEA 4WVLA 3TQTA 4ZYUA 1WXIA 3EZ2A 3TAXA 1TA0A 1BWQA 3FRHA 1IM8A 4NBKA 4I8DA 5BN3A 3E1YA 2DFLA 2FN4A 3FBTA 3NANA 3R5FA 2FEXA 1TAGA 4NMMA 5B4VA 2QG4A 2Z8YM 3ICOA 3OEED 3KZOA 1IV2A 2G88A 4GX5A 4MZXA 5G41A 1FSZA 3CLTC 4X8HA 1MNQA 3F4LA 4Y2HA 1Q7YH 1JHUA 3ANTA 3D2BA 5EE5B 3VH2A 1PVOA 5JCZA 1DQNA 1IOZA 4EVQA 1RIIA 2ZWMA 5D7NA 4BX9A 1UT6A 4NDNE 1TLLA 3U4DA 2PO7A 3UXYA 4BATA 1E3MA 1Y6GA 2CK3D 2H1LA 1F2TB 1NMXA 3A9TA 1UBUS 1OVGA 1RCUA 2WSYB 1Z6GA 5AKYA 3KYCB 3SG0A 4DLWA 4Z53A 1E3EA 3A7EA 2AFIB 4NZMA 1COMA 3IBSA 3SVTA 2M6KA 4D6PA 4D3XA 3ZV3A 4YCAA 2BMFA 2NTVA 5I7OA 1AUPA 1T2NA 3VI6A 2QX4A 1L7OA 1HLDA 4S3MA 5H82A 3BRQA 3ZK7A 4YUWA 1E2PA 1MQ9A 2RGUA 1BG6A 3DGEC 3IQEA 3S1SA 2ZAMA 4TLMB 2DR2A 1L5WA 1W52X 2P9TA 3WJRA 1NXXA 2DJ5A 3PICA 4RVOA 1SPXA 2X3YA 5GJVC 1W4LA 3VBCA 4CUJA 3UKDA 4XR9A 4ZK2A 4TVKA 2PM8A 1VPDA 2YHIA 4KWTA 2DPMA 4WKPA 2OBLA 3VU9B 3F2VA 2FMTA 3V9PA 4MYCA 3H5WA 2XMSA 4O4LB 1QO0A 4WLOA 4DMLA 1FUYB 1XB2A 3Q15C 5KU1A 1R16A 5CAEA 1G8JA 5CIYA 2JLQA 2VJAA 4I1IA 5IH7A 6REQB 3C1AA 1ATZA 1EYZA 1U3TA 3ORQA 3N4YA 4NAHA 3ZGVA 1JJFA 1Q1ZA 2BFAA 2CVFA 1AN9A 1DOHA 2GM9A 3AWDA 3D8HA 2F17A 4GWGA 2QRUA 4IFBA 4OB7A 3NKLA 2H31A 2QU8A 3VHLB 1F8UA 4LJRA 1W8IA 4FQ7A 1KHTA 4JI5B 2VJKA 4ICIA 5C1PA 2Z1UA 2DM6A 5B5SA 3KQNA 4M4SA 4DLZA 2N42A 4MGEA 3S0YA 4ZQCB 3TLYA 3KJJA 1MABB 4LWPA 1JE1A 1VP3A 3H1PA 5FLYA 1A1SA 4NE7A 1O8BA 3S3TA 1JFFB 4G56A 1GQQA 2J3MA 2WVGA