4G88A

Crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
SHMELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords Outer membrane protein Omp38
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g88A00
3S02A 2N48A 4PWTA 3TD5A 3S0YA 4G4ZA 3CYPB 4RHAA 5EB1B 3TD3A 4ZHWA 2AIZP 3LDTA 4G4WA 3S0WA 2ZF8A 4G4YA 4B62A 3OONA 4G88A 3S0HA 4B5CA 2L26A 3TD4A 2LCAA 3WPXA 5EAZA 4ERHA 4R40B 2ZOVA 2HQSC 3IMPA 2ZVYA 2K1SA 1OAPA 4ZHVA 3S06A 4ZHYB 1R1MA 3WPWA 3CYQA 4G4VA 4G4XA 5EB0A 3KHNA 2KGWA 3S03A 2MQEA 2LBTA 2ZVZA 2W8BC
chains in the Genus database with same CATH superfamily
2UYNA 3HTNA 5BMVA 3AGKA 3CG6A 5KMGA 1JY8A 3WGKA 3ESJA 1H47A 2VGMA 2RHOA 1VQMF 3TD3A 2BTOA 3N2GA 3LDTA 1NJIH 2YYEA 1UI9A 3DDNA 1YHQF 4B5CA 3D00A 4ZI7B 3JALA 3ZP7A 1M1KH 5EAZA 4HNAB 2ZOVA 4EB6A 3VTIC 5GONA 3K14A 3GTZA 4C82A 1VQ8F 3C9TA 3WPWA 4IHJB 3E20B 4BY9D 2GZLA 4FFBA 3S03A 1YQNA 1YI2F 2NMUA 3S02A 2HRUA 2ZODA 3CCQF 4PWTA 4YJ3B 3OW2F 1VQKF 4U3JA 3JARB 3HAXD 1TVKA 4G4WA 1KC8H 1M90H 1KNKA 1W41A 3HKEB 2L26A 2BO1A 3I56F 3RYCA 3E22A 3Q8HA 3IKFA 3JCMM 4O4HA 2RHLA 1H7MA 1JFFB 3L7QA 3F0FA 5FNVA 4C8EA 1SA0A 3V7EA 1CK2A 3HKBB 3IEWA 3LWRC 2CHSA 5LP6C 5HWEA 3CCUF 1W3EX 3FFMA 2HP0A 4RHAA 5EZYA 4ZOLB 3JATB 3OONA 1W2BF 2Z1FA 1GO0A 2F9ZC 4ZK7A 3MCAB 2LBWA 5J2UA 1W40A 5C8YB 3WPXA 3WXMB 2HS4A 3G71F 1FNJA 3O85A 4I55A 2FGYA 3S06A 3VCZA 1CLIA 5JVDA 4G4VA 3JAKA 1W5BA 3C8LA 1YIJF 2LBTA 4O4IB 1QVFF 4X1YA 3T80A 4EI7A 1RQ2A 1XRGA 4YJ2B 3QTYA 3TD5A 2DYYA 5BMVB 2H8EA 3CCMF 4BVSA 1W42A 2VGNA 3LWOC 3I55F 1K73H 1QVGF 4LNUB 2OTJF 1FSZA 4X3LA 2VXYA 3F0GA 3MQWA 2I6DA 3EORA 2WALA 5HY0A 5ITZA 3D54A 4EB6B 5GONB 5JCOA 3LWVC 3RYIA 2CVLA 3VYTC 3C9RA 5EO3A 3B6NA 1VH8A 5LA6B 5J2TA 5AVMA 1GO1A 2HX0A 3RE3A 4BVQA 4I50A 1W5EA 5CA1A 3GYQA 3RYCB 3E22B 3VYUC 1K8AH 1X7OA 3V7QA 3VIUA 5EIBC 2ZVYA 2Q1YA 3I7TA 3NMUC 4DXDA 1IV1A 1ODEA 4IIJB 5JQGB 4TV8A 3N2KA 5KX5A 4X20A 2BTQB 4I4TA 5GANK 2KTVA 1ZWZA 1W5FA 2QA4F 3S0YA 4ZHQA 3J7AR 1YITF 3CPQA 3QUWA 4X1IB 3RYHA 3CPWF 2AIZP 4WBNB 2QEXF 4O4JB 3RYFA 1VQNF 3TD4A 1KNJA 4TV9A 1VQ7F 4LCKA 5CA0B 4O4LA 1YJ9F 1R1MA 3VOBA 3MBMA 5EYPA 1FFXA 3WJRA 1Q86H 3CC4F 3J81M 1X52A 3N4ZA 1TUBA 5LXTA 1JD1A 5LP6A 5IYZA 3DC2A 1JJ2F 3KJKA 3HKCA 2Z1UA 2CZWA 4U39A 5HP7A 5LOVA 1KD1H 1XV2A 3F6MA 3S0WA 1GX1A 1W5AA 4B46A 5MN6A 3M84A 1JN1A 1VQ4F 5FLXM 3WGMA 2OTLF 4O2AA 2AIFA 3JASA 3CC7F 3K2XA 2QTPA 2RHJA 4ZHYB 1VQOF 2HVYD 3RYIB 5A2QM 2ZAUA 5JH7B 5CB4A 1Z5VA 3JAWB 3FPIA 3ZOPA 3CCJF 5J2TB 4ZHWA 5G4UC 3E1YA 1KQSF 4BW0B 2DT4A 4O2BB 1VQPF 3HKDA 3C9UA 3NK7A 3I3FA 5IJ9B 2R751 4NQ3A 5HXZA 5HY4A 1S72F 3PAFA 1QAHA 1VQVA 2AMTA 3WGLA 5IJ0A 5KX5B 3N2KB 5GIPC 2QI2A 4I4TB 3IR9A 3G6EF 3NVKE 3CMAF 1N8RH 2FC3A 2UYNB 3KE1A 2VAWA 2GVIA 5KMGB 3ELCA 4B62A 2HP3A 3N2GB 1Q7YH 3RYFB 3M4SA 4HNAA 3JALB 4TV9B 3P10A 3VYSC 3ZO8A 4BT2A 1Q81H 3WJQA 2BTUA 2UYJA 1UFYA 1NQ3A 4O4LB 4IHJA 3JAMM 1Q8RA 1W59A 3BYQA 3LYBA 1FFXB 1COMA 2UYPA 2R6R1 3P0ZA 1T0AA 4FFBB 4TUYA 5G4VC 1VQ9F 5DCVA 1RLUA 2W8BC 3IEQA 2PHNA 2VAMA 4X1KA 4YJ3A 5LP6B 3JARA 4U3JB 5HY2A 4G4YA 1TVKB 3HKEA 5LYJA 3V4DA 1U3LA 2P6YA 2OTMA 1W581 4C81A 4O2AB 1JFFA 4O4HB 5HY1A 4M8IA 5FNVB 1SA0B 5MN4A 4C8IA 5EB0A 3HKBA 3MDOA 2IG8A 4BVTA 5CB4B 4X3MA 3D01A 2H6LA 2HP0B 3KJJA 5EZYB 1YJWF 4ZOLA 3J80M 3SIUA 1YJNF 3JATA 1PXWA 1SZQA 5C8YA 3C9SA 2LCAA 5J2UB 4R40B 5GINC 3LWQC 2HQSC 3N4YA 2IAFA 4B45A 4I55B 2Z01A 4XCQA 3WGNA 5JVDB 2OZBA 5IJ0B 4G4XA 3CB2A 1U3PA 1VQLF 3JAKB 3M1XA 4O4IA 3VO8A 2UZHA 4YJ2A 3KIZA 1IV4A 4X1YB 3F0EA 4BT5A 3CCLF 4KWEA 3G4SF 1DBFA 1E7KA 5FJ4C 1T0KB 1XBIA 3FD6A 1RLGA 4LNUA 3HJWC 3UT5A 3WGJA 2H8CA 1X7PA 5ITZB 2K1SA 2CHTA 2Z1EA 4F6RA 1W57A 4E6EA 3IKEA 3CMEF 3P4EA 4TUYB 4G4ZA 2LBXA 4X1KB 3K12A 2CW4A 3CYPB 5LA6A 2GLZA 3FBAA 4DRXA 1CN7A 1GZ0A 3V3TA 5LYJB 2HS3A 4I50B 1K9MH 3NVIB 2HS0A 3RA5A 5CA1B 3CCVF 4NUTA 3ERNA 3CCRF 4TZZA 3CYQA 4IIJA 4BT7A 5JQGA 2B33A 3SIVA 3KHNA 1Q82H 1VQ6F 2RHHA 1RQ7A 4TV8B 4X20B 4BT4A 1XHOA 3ZP4A 2N48A 1DT9A 3FD5A 3VI6A 1QU9A 1IV2A 4ZHQB 4X1IA 5B8FA 5IT9M 5HXUA 1IV3A 1W55A 3RYHB 1SDSA 4WBNA 5EWRA 1VK3A 4O4JA 3K0TA 4ZI7A 4RQOA 2CSLA 3R0PA 3CCEF 5HP8A 5CA0A 4BVRA 2HRYA 1QD9A 1U40A 5EYPB 1IPAA 3ON1A 3WJPA 1RA4A 4BT6A 2MQEA 2KG4A 2EWCA 1NMUB 3OBWA 1TUBB 2OHWA 3HWUA 5LXTB 2VAPA 2G9IA 5EB1B 5IYZB 3HKCB 1J7HA 1H48A 5LOVB 2ZF8A 2RB9A 1VQ5F 3S0HA 1U43A 1YGYA 3LMEA 2UYKA 2JNBA 2Q1XA 2I6RA 3RA6A 3UT5B 3LFOA 3VOAA 3NK6A 3VMFB 4BT3A 5MN5A 3OBYA 3CC2F 3JASB 2CWJA 4F6RB 4C8GA 2YXZA 1PF5A 3QHDA 5GIOC 5JH7A 2IQQA 3JAWA 4NWOB 1FNKA 4G88A 3CD6F 3PLAC 5GAPK 2PMPA 3CCSF 3LWPC 3GHZA 1OFUA 4DRXB 2KTUA 1ONIA 1Z5WA 4O2BA 2ALEA 2V9YA 4EI9A 3F0DA 4ERHA 3HKDB 3U0OA 5EIBD 5IJ9A 3IMPA 3JVHA 5JCOC 1OAPA 4ZHVA 4C4WC 3CXCF 1X25A 2Z1TA 4EI8A 1VHAA 3MCQA 2KGWA 2ZVZA
chains in the Genus database with same CATH topology
3S02A 2N48A 4PWTA 3TD5A 3S0YA 4G4ZA 3CYPB 4RHAA 5EB1B 3TD3A 4ZHWA 2AIZP 3LDTA 4G4WA 3S0WA 2ZF8A 4G4YA 4B62A 3OONA 4G88A 3S0HA 4B5CA 2L26A 3TD4A 2LCAA 3WPXA 5EAZA 4ERHA 4R40B 2ZOVA 2HQSC 3IMPA 2ZVYA 2K1SA 1OAPA 4ZHVA 3S06A 4ZHYB 1R1MA 3WPWA 3CYQA 4G4VA 4G4XA 5EB0A 3KHNA 2KGWA 3S03A 2MQEA 2LBTA 2ZVZA 2W8BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S02 A;  2N48 A;  4PWT A;  3TD5 A;  3S0Y A;  4G4Z A;  3CYP B;  4RHA A;  5EB1 B;  3TD3 A;  4ZHW A;  2AIZ P;  3LDT A;  4G4W A;  3S0W A;  2ZF8 A;  4G4Y A;  4B62 A;  3OON A;  4G88 A;  3S0H A;  4B5C A;  2L26 A;  3TD4 A;  2LCA A;  3WPX A;  5EAZ A;  4ERH A;  4R40 B;  2ZOV A;  2HQS C;  3IMP A;  2ZVY A;  2K1S A;  1OAP A;  4ZHV A;  3S06 A;  4ZHY B;  1R1M A;  3WPW A;  3CYQ A;  4G4V A;  4G4X A;  5EB0 A;  3KHN A;  2KGW A;  3S03 A;  2MQE A;  2LBT A;  2ZVZ A;  2W8B C; 
#chains in the Genus database with same CATH topology
 2UYN A;  3HTN A;  5BMV A;  3AGK A;  3CG6 A;  5KMG A;  1JY8 A;  3WGK A;  3ESJ A;  1H47 A;  2VGM A;  2RHO A;  1VQM F;  3TD3 A;  2BTO A;  3N2G A;  3LDT A;  1NJI H;  2YYE A;  1UI9 A;  3DDN A;  1YHQ F;  4B5C A;  3D00 A;  4ZI7 B;  3JAL A;  3ZP7 A;  1M1K H;  5EAZ A;  4HNA B;  2ZOV A;  4EB6 A;  3VTI C;  5GON A;  3K14 A;  3GTZ A;  4C82 A;  1VQ8 F;  3C9T A;  3WPW A;  4IHJ B;  3E20 B;  4BY9 D;  2GZL A;  4FFB A;  3S03 A;  1YQN A;  1YI2 F;  2NMU A;  3S02 A;  2HRU A;  2ZOD A;  3CCQ F;  4PWT A;  4YJ3 B;  3OW2 F;  1VQK F;  4U3J A;  3JAR B;  3HAX D;  1TVK A;  4G4W A;  1KC8 H;  1M90 H;  1KNK A;  1W41 A;  3HKE B;  2L26 A;  2BO1 A;  3I56 F;  3RYC A;  3E22 A;  3Q8H A;  3IKF A;  3JCM M;  4O4H A;  2RHL A;  1H7M A;  1JFF B;  3L7Q A;  3F0F A;  5FNV A;  4C8E A;  1SA0 A;  3V7E A;  1CK2 A;  3HKB B;  3IEW A;  3LWR C;  2CHS A;  5LP6 C;  5HWE A;  3CCU F;  1W3E X;  3FFM A;  2HP0 A;  4RHA A;  5EZY A;  4ZOL B;  3JAT B;  3OON A;  1W2B F;  2Z1F A;  1GO0 A;  2F9Z C;  4ZK7 A;  3MCA B;  2LBW A;  5J2U A;  1W40 A;  5C8Y B;  3WPX A;  3WXM B;  2HS4 A;  3G71 F;  1FNJ A;  3O85 A;  4I55 A;  2FGY A;  3S06 A;  3VCZ A;  1CLI A;  5JVD A;  4G4V A;  3JAK A;  1W5B A;  3C8L A;  1YIJ F;  2LBT A;  4O4I B;  1QVF F;  4X1Y A;  3T80 A;  4EI7 A;  1RQ2 A;  1XRG A;  4YJ2 B;  3QTY A;  3TD5 A;  2DYY A;  5BMV B;  2H8E A;  3CCM F;  4BVS A;  1W42 A;  2VGN A;  3LWO C;  3I55 F;  1K73 H;  1QVG F;  4LNU B;  2OTJ F;  1FSZ A;  4X3L A;  2VXY A;  3F0G A;  3MQW A;  2I6D A;  3EOR A;  2WAL A;  5HY0 A;  5ITZ A;  3D54 A;  4EB6 B;  5GON B;  5JCO A;  3LWV C;  3RYI A;  2CVL A;  3VYT C;  3C9R A;  5EO3 A;  3B6N A;  1VH8 A;  5LA6 B;  5J2T A;  5AVM A;  1GO1 A;  2HX0 A;  3RE3 A;  4BVQ A;  4I50 A;  1W5E A;  5CA1 A;  3GYQ A;  3RYC B;  3E22 B;  3VYU C;  1K8A H;  1X7O A;  3V7Q A;  3VIU A;  5EIB C;  2ZVY A;  2Q1Y A;  3I7T A;  3NMU C;  4DXD A;  1IV1 A;  1ODE A;  4IIJ B;  5JQG B;  4TV8 A;  3N2K A;  5KX5 A;  4X20 A;  2BTQ B;  4I4T A;  5GAN K;  2KTV A;  1ZWZ A;  1W5F A;  2QA4 F;  3S0Y A;  4ZHQ A;  3J7A R;  1YIT F;  3CPQ A;  3QUW A;  4X1I B;  3RYH A;  3CPW F;  2AIZ P;  4WBN B;  2QEX F;  4O4J B;  3RYF A;  1VQN F;  3TD4 A;  1KNJ A;  4TV9 A;  1VQ7 F;  4LCK A;  5CA0 B;  4O4L A;  1YJ9 F;  1R1M A;  3VOB A;  3MBM A;  5EYP A;  1FFX A;  3WJR A;  1Q86 H;  3CC4 F;  3J81 M;  1X52 A;  3N4Z A;  1TUB A;  5LXT A;  1JD1 A;  5LP6 A;  5IYZ A;  3DC2 A;  1JJ2 F;  3KJK A;  3HKC A;  2Z1U A;  2CZW A;  4U39 A;  5HP7 A;  5LOV A;  1KD1 H;  1XV2 A;  3F6M A;  3S0W A;  1GX1 A;  1W5A A;  4B46 A;  5MN6 A;  3M84 A;  1JN1 A;  1VQ4 F;  5FLX M;  3WGM A;  2OTL F;  4O2A A;  2AIF A;  3JAS A;  3CC7 F;  3K2X A;  2QTP A;  2RHJ A;  4ZHY B;  1VQO F;  2HVY D;  3RYI B;  5A2Q M;  2ZAU A;  5JH7 B;  5CB4 A;  1Z5V A;  3JAW B;  3FPI A;  3ZOP A;  3CCJ F;  5J2T B;  4ZHW A;  5G4U C;  3E1Y A;  1KQS F;  4BW0 B;  2DT4 A;  4O2B B;  1VQP F;  3HKD A;  3C9U A;  3NK7 A;  3I3F A;  5IJ9 B;  2R75 1;  4NQ3 A;  5HXZ A;  5HY4 A;  1S72 F;  3PAF A;  1QAH A;  1VQV A;  2AMT A;  3WGL A;  5IJ0 A;  5KX5 B;  3N2K B;  5GIP C;  2QI2 A;  4I4T B;  3IR9 A;  3G6E F;  3NVK E;  3CMA F;  1N8R H;  2FC3 A;  2UYN B;  3KE1 A;  2VAW A;  2GVI A;  5KMG B;  3ELC A;  4B62 A;  2HP3 A;  3N2G B;  1Q7Y H;  3RYF B;  3M4S A;  4HNA A;  3JAL B;  4TV9 B;  3P10 A;  3VYS C;  3ZO8 A;  4BT2 A;  1Q81 H;  3WJQ A;  2BTU A;  2UYJ A;  1UFY A;  1NQ3 A;  4O4L B;  4IHJ A;  3JAM M;  1Q8R A;  1W59 A;  3BYQ A;  3LYB A;  1FFX B;  1COM A;  2UYP A;  2R6R 1;  3P0Z A;  1T0A A;  4FFB B;  4TUY A;  5G4V C;  1VQ9 F;  5DCV A;  1RLU A;  2W8B C;  3IEQ A;  2PHN A;  2VAM A;  4X1K A;  4YJ3 A;  5LP6 B;  3JAR A;  4U3J B;  5HY2 A;  4G4Y A;  1TVK B;  3HKE A;  5LYJ A;  3V4D A;  1U3L A;  2P6Y A;  2OTM A;  1W58 1;  4C81 A;  4O2A B;  1JFF A;  4O4H B;  5HY1 A;  4M8I A;  5FNV B;  1SA0 B;  5MN4 A;  4C8I A;  5EB0 A;  3HKB A;  3MDO A;  2IG8 A;  4BVT A;  5CB4 B;  4X3M A;  3D01 A;  2H6L A;  2HP0 B;  3KJJ A;  5EZY B;  1YJW F;  4ZOL A;  3J80 M;  3SIU A;  1YJN F;  3JAT A;  1PXW A;  1SZQ A;  5C8Y A;  3C9S A;  2LCA A;  5J2U B;  4R40 B;  5GIN C;  3LWQ C;  2HQS C;  3N4Y A;  2IAF A;  4B45 A;  4I55 B;  2Z01 A;  4XCQ A;  3WGN A;  5JVD B;  2OZB A;  5IJ0 B;  4G4X A;  3CB2 A;  1U3P A;  1VQL F;  3JAK B;  3M1X A;  4O4I A;  3VO8 A;  2UZH A;  4YJ2 A;  3KIZ A;  1IV4 A;  4X1Y B;  3F0E A;  4BT5 A;  3CCL F;  4KWE A;  3G4S F;  1DBF A;  1E7K A;  5FJ4 C;  1T0K B;  1XBI A;  3FD6 A;  1RLG A;  4LNU A;  3HJW C;  3UT5 A;  3WGJ A;  2H8C A;  1X7P A;  5ITZ B;  2K1S A;  2CHT A;  2Z1E A;  4F6R A;  1W57 A;  4E6E A;  3IKE A;  3CME F;  3P4E A;  4TUY B;  4G4Z A;  2LBX A;  4X1K B;  3K12 A;  2CW4 A;  3CYP B;  5LA6 A;  2GLZ A;  3FBA A;  4DRX A;  1CN7 A;  1GZ0 A;  3V3T A;  5LYJ B;  2HS3 A;  4I50 B;  1K9M H;  3NVI B;  2HS0 A;  3RA5 A;  5CA1 B;  3CCV F;  4NUT A;  3ERN A;  3CCR F;  4TZZ A;  3CYQ A;  4IIJ A;  4BT7 A;  5JQG A;  2B33 A;  3SIV A;  3KHN A;  1Q82 H;  1VQ6 F;  2RHH A;  1RQ7 A;  4TV8 B;  4X20 B;  4BT4 A;  1XHO A;  3ZP4 A;  2N48 A;  1DT9 A;  3FD5 A;  3VI6 A;  1QU9 A;  1IV2 A;  4ZHQ B;  4X1I A;  5B8F A;  5IT9 M;  5HXU A;  1IV3 A;  1W55 A;  3RYH B;  1SDS A;  4WBN A;  5EWR A;  1VK3 A;  4O4J A;  3K0T A;  4ZI7 A;  4RQO A;  2CSL A;  3R0P A;  3CCE F;  5HP8 A;  5CA0 A;  4BVR A;  2HRY A;  1QD9 A;  1U40 A;  5EYP B;  1IPA A;  3ON1 A;  3WJP A;  1RA4 A;  4BT6 A;  2MQE A;  2KG4 A;  2EWC A;  1NMU B;  3OBW A;  1TUB B;  2OHW A;  3HWU A;  5LXT B;  2VAP A;  2G9I A;  5EB1 B;  5IYZ B;  3HKC B;  1J7H A;  1H48 A;  5LOV B;  2ZF8 A;  2RB9 A;  1VQ5 F;  3S0H A;  1U43 A;  1YGY A;  3LME A;  2UYK A;  2JNB A;  2Q1X A;  2I6R A;  3RA6 A;  3UT5 B;  3LFO A;  3VOA A;  3NK6 A;  3VMF B;  4BT3 A;  5MN5 A;  3OBY A;  3CC2 F;  3JAS B;  2CWJ A;  4F6R B;  4C8G A;  2YXZ A;  1PF5 A;  3QHD A;  5GIO C;  5JH7 A;  2IQQ A;  3JAW A;  4NWO B;  1FNK A;  4G88 A;  3CD6 F;  3PLA C;  5GAP K;  2PMP A;  3CCS F;  3LWP C;  3GHZ A;  1OFU A;  4DRX B;  2KTU A;  1ONI A;  1Z5W A;  4O2B A;  2ALE A;  2V9Y A;  4EI9 A;  3F0D A;  4ERH A;  3HKD B;  3U0O A;  5EIB D;  5IJ9 A;  3IMP A;  3JVH A;  5JCO C;  1OAP A;  4ZHV A;  4C4W C;  3CXC F;  1X25 A;  2Z1T A;  4EI8 A;  1VHA A;  3MCQ A;  2KGW A;  2ZVZ A; 
#chains in the Genus database with same CATH homology
 3S02 A;  2N48 A;  4PWT A;  3TD5 A;  3S0Y A;  4G4Z A;  3CYP B;  4RHA A;  5EB1 B;  3TD3 A;  4ZHW A;  2AIZ P;  3LDT A;  4G4W A;  3S0W A;  2ZF8 A;  4G4Y A;  4B62 A;  3OON A;  4G88 A;  3S0H A;  4B5C A;  2L26 A;  3TD4 A;  2LCA A;  3WPX A;  5EAZ A;  4ERH A;  4R40 B;  2ZOV A;  2HQS C;  3IMP A;  2ZVY A;  2K1S A;  1OAP A;  4ZHV A;  3S06 A;  4ZHY B;  1R1M A;  3WPW A;  3CYQ A;  4G4V A;  4G4X A;  5EB0 A;  3KHN A;  2KGW A;  3S03 A;  2MQE A;  2LBT A;  2ZVZ A;  2W8B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...