4G88A

Crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
SHMELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein Omp38
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g88A00
4B5CA 2LCAA 4G4XA 3IMPA 2W8BC 4R40B 4G4ZA 3LDTA 2ZVYA 4G4WA 4G4YA 3TD3A 3CYPB 4G88A 4RHAA 4ZHYB 4ZHWA 3TD5A 1R1MA 2KGWA 2ZVZA 2ZOVA 3WPWA 5EB1B 3S0WA 3S0YA 4PWTA 2L26A 3S03A 2LBTA 5EB0A 4B62A 4ERHA 3KHNA 2HQSC 4G4VA 2K1SA 3S06A 3TD4A 3S02A 2ZF8A 3CYQA 5EAZA 2MQEA 3OONA 4ZHVA 2AIZP 2N48A 3WPXA 3S0HA 1OAPA
chains in the Genus database with same CATH superfamily
2ALEA 2W8BC 3N2GB 3VI6A 3RYIB 5ITZA 2YXZA 1U3PA 4G88A 4M8IA 3WGKA 3J81M 1X52A 4TV8B 2FC3A 3LWVC 4X1KA 3VYUC 5CB4A 2L26A 1FFXA 2P6YA 1ODEA 3HKEA 4BT2A 1VQ8F 2IQQA 5CB4B 2GLZA 2HRUA 1FFXB 3E22B 4I55B 5LA6B 1N8RH 1YJ9F 4EB6A 2I6DA 3LYBA 5A2QM 4G4XA 5J2UA 4IHJB 2BO1A 4NUTA 1W5EA 5FJ4C 4O4HB 5LXTA 3ZOPA 4F6RA 1W55A 3RYCA 5GIOC 4DXDA 3M84A 1RQ7A 5LXTB 3M1XA 3F0FA 2HP0A 1FNJA 3V7EA 2HQSC 3VMFB 1CK2A 2H8EA 3P10A 3WPXA 3WJQA 4LNUB 5HY0A 2CVLA 3CCVF 5G4UC 1QD9A 3DC2A 1H7MA 4G4ZA 1KNKA 4G4WA 4G4YA 3J7AR 1M1KH 4TUYB 1VQ4F 2LBWA 2BTOA 2V9YA 4ZHWA 3HWUA 1R1MA 3MBMA 4U39A 3WGJA 2ZOVA 3F0GA 1KD1H 1K8AH 1T0KB 1QU9A 2UYNA 3VCZA 3PAFA 4YJ2B 1W581 4X1IA 3GTZA 4C8IA 3Q8HA 1TVKB 3C9SA 4O4LB 5IJ9A 4IIJA 5LP6C 1VQ9F 3HKBA 3RA6A 1KQSF 1FSZA 3TD4A 1RQ2A 3LFOA 5EWRA 5IJ9B 1VQ6F 2CSLA 4O2BB 3ESJA 3OBYA 3M4SA 1VQVA 3K14A 3IMPA 4XCQA 2GZLA 4WBNA 5GONB 1W59A 4TV9B 5EO3A 1YITF 4HNAB 3CXCF 3D00A 3CCUF 3JAMM 3CCSF 2AIFA 3JARA 1U3LA 2B33A 3S0YA 3S03A 2Q1YA 2LBTA 1W57A 3QTYA 1X7PA 5LOVA 5J2TB 1QVGF 3JASA 1IPAA 1Z5VA 2AIZP 1IV2A 2VAWA 2I6RA 1W2BF 4EI7A 1OAPA 1OFUA 5JVDA 1VQKF 1TUBB 3C9RA 4BVQA 1QVFF 5JVDB 1VHAA 5KMGA 4ZOLA 4BT5A 3NVIB 1PF5A 2QA4F 1IV1A 3AGKA 3HAXD 4FFBA 3WPWA 3MDOA 2H8CA 3JATB 1JFFB 5HP7A 5LP6B 1SA0A 1YJWF 4TZZA 5GINC 1H47A 3KHNA 1U43A 5HY4A 3N2KB 3K0TA 3ERNA 3JAKB 3RYFB 2QTPA 3C9UA 2CZWA 4ZI7B 1J7HA 3G4SF 3RE3A 5KX5B 3HJWC 2CHSA 3K12A 1YHQF 5JH7A 3IKFA 1K73H 1W40A 5ITZB 5EB1B 5JH7B 4C81A 3IEQA 3F0DA 3J80M 2RHLA 3P0ZA 1GO0A 2OTMA 4X3LA 4G4VA 1E7KA 2AMTA 4X1KB 3KE1A 5MN6A 3VYTC 3HKEB 1W3EX 4C8EA 5HY1A 3N4ZA 4EI8A 1K9MH 3I56F 1KNJA 3IEWA 5IYZA 1H48A 3NVKE 5HY2A 4RHAA 4BT3A 5EIBD 4EB6B 1XV2A 4I50A 1W41A 3JAWA 5EYPA 5J2UB 3KJKA 2VAPA 4I50B 5EYPB 4F6RB 3RYCB 4C82A 5MN4A 2PHNA 2QI2A 2HP3A 2K1SA 3FD5A 2OTJF 2HP0B 3CCLF 1YQNA 3T80A 1Q7YH 5LYJA 3WJPA 2IAFA 4E6EA 3WJRA 4BVTA 2R751 1SZQA 2Z1UA 1Q8RA 5CA1A 3LWPC 1VQPF 3ELCA 3MCAB 1M90H 3PLAC 1Q81H 5FNVA 1VQMF 1CN7A 1RLGA 2Z1EA 2DT4A 3C8LA 3CPWF 5FNVB 1X7OA 1JN1A 3N4YA 1W5AA 2LBXA 2UYKA 5G4VC 3UT5A 3MQWA 2UYNB 3S02A 4X1IB 3OBWA 5DCVA 1QAHA 3RYHA 3D01A 4IIJB 5IJ0A 3O85A 3HKBB 2JNBA 3LWQC 3OW2F 5GANK 1Z5WA 5IJ0B 1IV4A 3NK6A 3GHZA 4WBNB 3SIUA 2ZAUA 3I3FA 2VGNA 3VTIC 1DBFA 1UFYA 2UZHA 2CW4A 4ZK7A 3S0WA 4PWTA 5CA0A 5HWEA 3U0OA 4I4TA 3JARB 1VQLF 3CCMF 3VO8A 1NMUB 2CWJA 4ZHQA 4X3MA 2Z1TA 1RLUA 2DYYA 5LOVB 2HS3A 3JASB 3I7TA 4ZHQB 1S72F 2WALA 2BTUA 3E1YA 4ZHYB 2NMUA 4X1YA 3CPQA 3I55F 2ZVZA 1JD1A 3HKCA 4X20A 1VK3A 5B8FA 3SIVA 3G6EF 1X25A 2RHHA 3CMEF 5BMVA 4U3JA 4ZOLB 5KMGB 3CD6F 4B62A 3CMAF 2RB9A 3CCRF 3V7QA 4ERHA 4RQOA 4FFBB 2VGMA 4O4JA 3WXMB 4NWOB 3S06A 4C4WC 1XBIA 1YI2F 5BMVB 3VYSC 1SA0B 2OZBA 1YJNF 4O4JB 3HTNA 2HX0A 4C8GA 5JQGA 1UI9A 1CLIA 3R0PA 1W5FA 5EZYA 4BVRA 5JCOA 3FPIA 3FD6A 5EIBC 3CC4F 3NK7A 3IKEA 5HXUA 3HKDA 3K2XA 4DRXA 2HVYD 3F0EA 3LMEA 3HKDB 3JCMM 4BT4A 4BT6A 2ZF8A 3CYQA 3N2GA 3P4EA 3RYIA 2HRYA 5C8YA 2BTQB 3F6MA 1VQ5F 3S0HA 4TV8A 5C8YB 1JJ2F 2VXYA 1GZ0A 2UYJA 5IYZB 4O4IA 3ZP4A 3FFMA 3VOBA 5HXZA 3E22A 2KTUA 4I55A 5LA6A 4O4IB 3JAWB 3VIUA 1VQNF 5GAPK 2CHTA 1XRGA 2OHWA 4EI9A 3WGMA 5EAZA 2MQEA 1YGYA 4IHJA 1VQOF 3DDNA 3TD3A 4O4HA 2Z1FA 3OONA 2G9IA 4B45A 1XHOA 3LDTA 2ZVYA 2VAMA 5LYJB 1KC8H 3L7QA 1GO1A 4LCKA 3WGNA 3TD5A 1NJIH 1IV3A 5CA1B 2R6R1 3JVHA 2YYEA 1T0AA 3BYQA 3KJJA 4LNUA 4BVSA 4ZHVA 3EORA 3C9TA 3WGLA 3UT5B 3D54A 2QEXF 4TUYA 5GIPC 4KWEA 4B5CA 3RYHB 3CYPB 3ZP7A 3ON1A 4YJ2A 3CCJF 3IR9A 3V3TA 1YIJF 1VQ7F 2KGWA 1TVKA 3JALA 4O4LA 2FGYA 4BW0B 3CCQF 5FLXM 3JALB 5EB0A 5JCOC 4O2BA 3LWRC 2RHJA 1DT9A 2KG4A 1FNKA 4BT7A 5GONA 1SDSA 2N48A 5CA0B 4TV9A 2IG8A 4I4TB 4HNAA 2OTLF 2LCAA 3GYQA 4NQ3A 1PXWA 3QUWA 3QHDA 2UYPA 5J2TA 1VH8A 3B6NA 1W5BA 4X1YB 5AVMA 3NMUC 4YJ3A 4X20B 3HKCB 4O2AA 1GX1A 2PMPA 4YJ3B 4U3JB 1U40A 3G71F 3FBAA 1TUBA 4O2AB 1JY8A 3V4DA 5IT9M 1RA4A 2H6LA 2HS0A 3CC2F 2Z01A 2EWCA 1NQ3A 2KTVA 4R40B 3LWOC 2GVIA 5HP8A 5MN5A 1Q82H 3CC7F 3JATA 3CG6A 1JFFA 1ZWZA 2HS4A 5LP6A 5JQGB 3MCQA 2RHOA 5EZYB 3CB2A 2ZODA 1Q86H 2F9ZC 3N2KA 3KIZA 3JAKA 3RYFA 4ZI7A 4B46A 3ZO8A 4BY9D 2Q1XA 1W42A 5KX5A 3E20B 4DRXB 3RA5A 1ONIA 3CCEF 3VOAA 1COMA
chains in the Genus database with same CATH topology
4B5CA 2LCAA 4G4XA 3IMPA 2W8BC 4R40B 4G4ZA 3LDTA 2ZVYA 4G4WA 4G4YA 3TD3A 3CYPB 4G88A 4RHAA 4ZHYB 4ZHWA 3TD5A 1R1MA 2KGWA 2ZVZA 2ZOVA 3WPWA 5EB1B 3S0WA 3S0YA 4PWTA 2L26A 3S03A 2LBTA 5EB0A 4B62A 4ERHA 3KHNA 2HQSC 4G4VA 2K1SA 3S06A 3TD4A 3S02A 2ZF8A 3CYQA 5EAZA 2MQEA 3OONA 4ZHVA 2AIZP 2N48A 3WPXA 3S0HA 1OAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5C A;  2LCA A;  4G4X A;  3IMP A;  2W8B C;  4R40 B;  4G4Z A;  3LDT A;  2ZVY A;  4G4W A;  4G4Y A;  3TD3 A;  3CYP B;  4G88 A;  4RHA A;  4ZHY B;  4ZHW A;  3TD5 A;  1R1M A;  2KGW A;  2ZVZ A;  2ZOV A;  3WPW A;  5EB1 B;  3S0W A;  3S0Y A;  4PWT A;  2L26 A;  3S03 A;  2LBT A;  5EB0 A;  4B62 A;  4ERH A;  3KHN A;  2HQS C;  4G4V A;  2K1S A;  3S06 A;  3TD4 A;  3S02 A;  2ZF8 A;  3CYQ A;  5EAZ A;  2MQE A;  3OON A;  4ZHV A;  2AIZ P;  2N48 A;  3WPX A;  3S0H A;  1OAP A; 
#chains in the Genus database with same CATH topology
 2ALE A;  2W8B C;  3N2G B;  3VI6 A;  3RYI B;  5ITZ A;  2YXZ A;  1U3P A;  4G88 A;  4M8I A;  3WGK A;  3J81 M;  1X52 A;  4TV8 B;  2FC3 A;  3LWV C;  4X1K A;  3VYU C;  5CB4 A;  2L26 A;  1FFX A;  2P6Y A;  1ODE A;  3HKE A;  4BT2 A;  1VQ8 F;  2IQQ A;  5CB4 B;  2GLZ A;  2HRU A;  1FFX B;  3E22 B;  4I55 B;  5LA6 B;  1N8R H;  1YJ9 F;  4EB6 A;  2I6D A;  3LYB A;  5A2Q M;  4G4X A;  5J2U A;  4IHJ B;  2BO1 A;  4NUT A;  1W5E A;  5FJ4 C;  4O4H B;  5LXT A;  3ZOP A;  4F6R A;  1W55 A;  3RYC A;  5GIO C;  4DXD A;  3M84 A;  1RQ7 A;  5LXT B;  3M1X A;  3F0F A;  2HP0 A;  1FNJ A;  3V7E A;  2HQS C;  3VMF B;  1CK2 A;  2H8E A;  3P10 A;  3WPX A;  3WJQ A;  4LNU B;  5HY0 A;  2CVL A;  3CCV F;  5G4U C;  1QD9 A;  3DC2 A;  1H7M A;  4G4Z A;  1KNK A;  4G4W A;  4G4Y A;  3J7A R;  1M1K H;  4TUY B;  1VQ4 F;  2LBW A;  2BTO A;  2V9Y A;  4ZHW A;  3HWU A;  1R1M A;  3MBM A;  4U39 A;  3WGJ A;  2ZOV A;  3F0G A;  1KD1 H;  1K8A H;  1T0K B;  1QU9 A;  2UYN A;  3VCZ A;  3PAF A;  4YJ2 B;  1W58 1;  4X1I A;  3GTZ A;  4C8I A;  3Q8H A;  1TVK B;  3C9S A;  4O4L B;  5IJ9 A;  4IIJ A;  5LP6 C;  1VQ9 F;  3HKB A;  3RA6 A;  1KQS F;  1FSZ A;  3TD4 A;  1RQ2 A;  3LFO A;  5EWR A;  5IJ9 B;  1VQ6 F;  2CSL A;  4O2B B;  3ESJ A;  3OBY A;  3M4S A;  1VQV A;  3K14 A;  3IMP A;  4XCQ A;  2GZL A;  4WBN A;  5GON B;  1W59 A;  4TV9 B;  5EO3 A;  1YIT F;  4HNA B;  3CXC F;  3D00 A;  3CCU F;  3JAM M;  3CCS F;  2AIF A;  3JAR A;  1U3L A;  2B33 A;  3S0Y A;  3S03 A;  2Q1Y A;  2LBT A;  1W57 A;  3QTY A;  1X7P A;  5LOV A;  5J2T B;  1QVG F;  3JAS A;  1IPA A;  1Z5V A;  2AIZ P;  1IV2 A;  2VAW A;  2I6R A;  1W2B F;  4EI7 A;  1OAP A;  1OFU A;  5JVD A;  1VQK F;  1TUB B;  3C9R A;  4BVQ A;  1QVF F;  5JVD B;  1VHA A;  5KMG A;  4ZOL A;  4BT5 A;  3NVI B;  1PF5 A;  2QA4 F;  1IV1 A;  3AGK A;  3HAX D;  4FFB A;  3WPW A;  3MDO A;  2H8C A;  3JAT B;  1JFF B;  5HP7 A;  5LP6 B;  1SA0 A;  1YJW F;  4TZZ A;  5GIN C;  1H47 A;  3KHN A;  1U43 A;  5HY4 A;  3N2K B;  3K0T A;  3ERN A;  3JAK B;  3RYF B;  2QTP A;  3C9U A;  2CZW A;  4ZI7 B;  1J7H A;  3G4S F;  3RE3 A;  5KX5 B;  3HJW C;  2CHS A;  3K12 A;  1YHQ F;  5JH7 A;  3IKF A;  1K73 H;  1W40 A;  5ITZ B;  5EB1 B;  5JH7 B;  4C81 A;  3IEQ A;  3F0D A;  3J80 M;  2RHL A;  3P0Z A;  1GO0 A;  2OTM A;  4X3L A;  4G4V A;  1E7K A;  2AMT A;  4X1K B;  3KE1 A;  5MN6 A;  3VYT C;  3HKE B;  1W3E X;  4C8E A;  5HY1 A;  3N4Z A;  4EI8 A;  1K9M H;  3I56 F;  1KNJ A;  3IEW A;  5IYZ A;  1H48 A;  3NVK E;  5HY2 A;  4RHA A;  4BT3 A;  5EIB D;  4EB6 B;  1XV2 A;  4I50 A;  1W41 A;  3JAW A;  5EYP A;  5J2U B;  3KJK A;  2VAP A;  4I50 B;  5EYP B;  4F6R B;  3RYC B;  4C82 A;  5MN4 A;  2PHN A;  2QI2 A;  2HP3 A;  2K1S A;  3FD5 A;  2OTJ F;  2HP0 B;  3CCL F;  1YQN A;  3T80 A;  1Q7Y H;  5LYJ A;  3WJP A;  2IAF A;  4E6E A;  3WJR A;  4BVT A;  2R75 1;  1SZQ A;  2Z1U A;  1Q8R A;  5CA1 A;  3LWP C;  1VQP F;  3ELC A;  3MCA B;  1M90 H;  3PLA C;  1Q81 H;  5FNV A;  1VQM F;  1CN7 A;  1RLG A;  2Z1E A;  2DT4 A;  3C8L A;  3CPW F;  5FNV B;  1X7O A;  1JN1 A;  3N4Y A;  1W5A A;  2LBX A;  2UYK A;  5G4V C;  3UT5 A;  3MQW A;  2UYN B;  3S02 A;  4X1I B;  3OBW A;  5DCV A;  1QAH A;  3RYH A;  3D01 A;  4IIJ B;  5IJ0 A;  3O85 A;  3HKB B;  2JNB A;  3LWQ C;  3OW2 F;  5GAN K;  1Z5W A;  5IJ0 B;  1IV4 A;  3NK6 A;  3GHZ A;  4WBN B;  3SIU A;  2ZAU A;  3I3F A;  2VGN A;  3VTI C;  1DBF A;  1UFY A;  2UZH A;  2CW4 A;  4ZK7 A;  3S0W A;  4PWT A;  5CA0 A;  5HWE A;  3U0O A;  4I4T A;  3JAR B;  1VQL F;  3CCM F;  3VO8 A;  1NMU B;  2CWJ A;  4ZHQ A;  4X3M A;  2Z1T A;  1RLU A;  2DYY A;  5LOV B;  2HS3 A;  3JAS B;  3I7T A;  4ZHQ B;  1S72 F;  2WAL A;  2BTU A;  3E1Y A;  4ZHY B;  2NMU A;  4X1Y A;  3CPQ A;  3I55 F;  2ZVZ A;  1JD1 A;  3HKC A;  4X20 A;  1VK3 A;  5B8F A;  3SIV A;  3G6E F;  1X25 A;  2RHH A;  3CME F;  5BMV A;  4U3J A;  4ZOL B;  5KMG B;  3CD6 F;  4B62 A;  3CMA F;  2RB9 A;  3CCR F;  3V7Q A;  4ERH A;  4RQO A;  4FFB B;  2VGM A;  4O4J A;  3WXM B;  4NWO B;  3S06 A;  4C4W C;  1XBI A;  1YI2 F;  5BMV B;  3VYS C;  1SA0 B;  2OZB A;  1YJN F;  4O4J B;  3HTN A;  2HX0 A;  4C8G A;  5JQG A;  1UI9 A;  1CLI A;  3R0P A;  1W5F A;  5EZY A;  4BVR A;  5JCO A;  3FPI A;  3FD6 A;  5EIB C;  3CC4 F;  3NK7 A;  3IKE A;  5HXU A;  3HKD A;  3K2X A;  4DRX A;  2HVY D;  3F0E A;  3LME A;  3HKD B;  3JCM M;  4BT4 A;  4BT6 A;  2ZF8 A;  3CYQ A;  3N2G A;  3P4E A;  3RYI A;  2HRY A;  5C8Y A;  2BTQ B;  3F6M A;  1VQ5 F;  3S0H A;  4TV8 A;  5C8Y B;  1JJ2 F;  2VXY A;  1GZ0 A;  2UYJ A;  5IYZ B;  4O4I A;  3ZP4 A;  3FFM A;  3VOB A;  5HXZ A;  3E22 A;  2KTU A;  4I55 A;  5LA6 A;  4O4I B;  3JAW B;  3VIU A;  1VQN F;  5GAP K;  2CHT A;  1XRG A;  2OHW A;  4EI9 A;  3WGM A;  5EAZ A;  2MQE A;  1YGY A;  4IHJ A;  1VQO F;  3DDN A;  3TD3 A;  4O4H A;  2Z1F A;  3OON A;  2G9I A;  4B45 A;  1XHO A;  3LDT A;  2ZVY A;  2VAM A;  5LYJ B;  1KC8 H;  3L7Q A;  1GO1 A;  4LCK A;  3WGN A;  3TD5 A;  1NJI H;  1IV3 A;  5CA1 B;  2R6R 1;  3JVH A;  2YYE A;  1T0A A;  3BYQ A;  3KJJ A;  4LNU A;  4BVS A;  4ZHV A;  3EOR A;  3C9T A;  3WGL A;  3UT5 B;  3D54 A;  2QEX F;  4TUY A;  5GIP C;  4KWE A;  4B5C A;  3RYH B;  3CYP B;  3ZP7 A;  3ON1 A;  4YJ2 A;  3CCJ F;  3IR9 A;  3V3T A;  1YIJ F;  1VQ7 F;  2KGW A;  1TVK A;  3JAL A;  4O4L A;  2FGY A;  4BW0 B;  3CCQ F;  5FLX M;  3JAL B;  5EB0 A;  5JCO C;  4O2B A;  3LWR C;  2RHJ A;  1DT9 A;  2KG4 A;  1FNK A;  4BT7 A;  5GON A;  1SDS A;  2N48 A;  5CA0 B;  4TV9 A;  2IG8 A;  4I4T B;  4HNA A;  2OTL F;  2LCA A;  3GYQ A;  4NQ3 A;  1PXW A;  3QUW A;  3QHD A;  2UYP A;  5J2T A;  1VH8 A;  3B6N A;  1W5B A;  4X1Y B;  5AVM A;  3NMU C;  4YJ3 A;  4X20 B;  3HKC B;  4O2A A;  1GX1 A;  2PMP A;  4YJ3 B;  4U3J B;  1U40 A;  3G71 F;  3FBA A;  1TUB A;  4O2A B;  1JY8 A;  3V4D A;  5IT9 M;  1RA4 A;  2H6L A;  2HS0 A;  3CC2 F;  2Z01 A;  2EWC A;  1NQ3 A;  2KTV A;  4R40 B;  3LWO C;  2GVI A;  5HP8 A;  5MN5 A;  1Q82 H;  3CC7 F;  3JAT A;  3CG6 A;  1JFF A;  1ZWZ A;  2HS4 A;  5LP6 A;  5JQG B;  3MCQ A;  2RHO A;  5EZY B;  3CB2 A;  2ZOD A;  1Q86 H;  2F9Z C;  3N2K A;  3KIZ A;  3JAK A;  3RYF A;  4ZI7 A;  4B46 A;  3ZO8 A;  4BY9 D;  2Q1X A;  1W42 A;  5KX5 A;  3E20 B;  4DRX B;  3RA5 A;  1ONI A;  3CCE F;  3VOA A;  1COM A; 
#chains in the Genus database with same CATH homology
 4B5C A;  2LCA A;  4G4X A;  3IMP A;  2W8B C;  4R40 B;  4G4Z A;  3LDT A;  2ZVY A;  4G4W A;  4G4Y A;  3TD3 A;  3CYP B;  4G88 A;  4RHA A;  4ZHY B;  4ZHW A;  3TD5 A;  1R1M A;  2KGW A;  2ZVZ A;  2ZOV A;  3WPW A;  5EB1 B;  3S0W A;  3S0Y A;  4PWT A;  2L26 A;  3S03 A;  2LBT A;  5EB0 A;  4B62 A;  4ERH A;  3KHN A;  2HQS C;  4G4V A;  2K1S A;  3S06 A;  3TD4 A;  3S02 A;  2ZF8 A;  3CYQ A;  5EAZ A;  2MQE A;  3OON A;  4ZHV A;  2AIZ P;  2N48 A;  3WPX A;  3S0H A;  1OAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...