5FNVB

A new complex structure of tubulin with an alpha-beta unsaturated lactone
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
427
structure length
419
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN ALPHA-1B CHAIN
molecule tags Structural protein
source organism Gallus gallus
publication title Pironetin Reacts Covalently with Cysteine-316 of Alpha-Tubulin to Destabilize Microtubule.
pubmed doi rcsb
total genus 172
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fnvB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5fnvB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5fnvB01
4TV8B 5KMGA 5MN6A 3JASB 3RYFA 1Z5VA 2R6R1 2VAPA 3HKDA 5CB4B 4I4TB 3VO8A 3RB8A 4IIJB 3RYIA 4F6RB 4ZHQA 2BTQB 5JH7A 2GVIA 5FNVA 5J2TA 4F6RA 5J2UA 3RYIB 5LP6A 4TUYA 2XKAA 3HKCA 5J2UB 1W5AA 4FFBB 5CA0A 1W5EA 3WGKA 4ZOLA 5IYZB 4TV9B 4I50A 4O2AB 3RYHB 4EI9A 4X1YB 1FFXA 2XKBA 1TUBA 4I50B 3VPAA 4HNAB 3RYCB 4ZOLB 4O4JA 5EYPA 5BMVA 3VOAA 5LXTA 1SA0A 4YJ2B 1W5BA 5EYPB 5ITZA 2RHJA 4O4IB 4TV8A 4IHJA 3ZBPA 3ZIDA 4I55B 5C8YA 4ZI7A 5ITZB 3V3TA 4B46A 3M89A 4DXDA 3JAKB 4WBNA 3JARB 5MN5A 3WGJA 3JATB 5LOVB 1RLUA 4LNUA 3UT5B 1TUBB 5FNVB 5J2TB 4O2BB 5IJ0B 4KWEA 4U3JB 3JARA 2VXYA 3JATA 5LOVA 2Q1XA 3M8KA 4FFBA 3N2GB 4EI8A 3N2KB 1W581 1TVKA 4B45A 5KX5B 4IHJB 5JVDA 4X1IB 2BTQA 2RHHA 5LYJA 2VAMA 5IJ9A 5KX5A 4ZHQB 3JAWA 4X1KA 5JH7B 5IYZA 4WBNB 3VOBA 5JQGB 1OFUA 4EI7A 3JAKA 4XCQA 1JFFA 3HKCB 5LP6B 2R751 4U39A 4HNAA 3JAWB 4O4JB 5LP6C 5CA1A 4ZI7B 5C8YB 2VAWA 4O2AA 3RYHA 3VO9A 3CB2A 1TVKB 2RHLA 3HKDB 5EIBC 3E22A 4X20A 4EB6A 3R4VA 3ZBQA 5IJ9B 5JVDB 3JALA 4I4TA 4O4HA 4IIJA 1JFFB 3UT5A 3WGLA 5CA0B 4DRXB 5JQGA 5JCOC 4DRXA 4O4HB 5LYJB 5EIBD 5MN4A 5EZYA 4O2BA 4LNUB 5IJ0A 4O4LA 2Q1YA 4YJ3A 5GONB 5LA6B 3N2GA 1RQ7A 5LXTB 5CB4A 2BTOA 3N2KA 4M8IA 1SA0B 4YJ3B 5GONA 4TUYB 4YJ2A 5LA6A 4X1KB 3RYCA 3HKEB 1FSZA 1RQ2A 4X1IA 1W5FA 4I55A 3WGMA 3HKEA 3C8LA 1FFXB 3HKBB 4O4IA 5JCOA 3E22B 4X20B 4EB6B 3WGNA 5BMVB 1Z5WA 3HKBA 3JASA 3RYFB 5EZYB 2RHOA 4U3JA 5KMGB 4O4LB 5M7EA 3JALB 4X1YA 1W59A 4E6EA 4TV9A 5CA1B
chains in the Genus database with same CATH superfamily
4RWZA 1D03A 3D5TA 2RGYA 4ZAGA 3UAGA 4PA6A 1QVZA 2IYSA 2JFQA 1MG1A 3KX2A 4MSWC 2JIBA 2VATA 4XB2A 5BXQC 3AETA 3AM5A 3RFXA 2CSLA 2LCFA 2PH7A 3Q12A 2QN6A 4DPLA 4L8WB 4BAYA 1X77A 2EP5A 4D5EA 1ZSYA 4CIBA 1CIVA 2F1MA 1OLXA 2Y76A 1RWVA 3QO8A 2YRXA 1I0LA 1VHWA 1YB1A 2QVYX 5IP5A 2IIBA 5BT9A 4TROA 4FMPA 4Q4HA 2ZKLA 3PNQA 4CCAA 3F5TA 5AOBA 3L6UA 3RYHB 2D0PB 2PBLA 2RGDA 3DDSA 4LDNA 3NTLA 1ZD3A 4LS3A 1BSMA 3TS1A 5JJIA 2J3LA 4YY3B 3LWZA 1PW5A 2DMRA 3T0IA 1OILA 4BWGA 4RTRA 3CO0S 2BE3A 4A6XA 2WIFA 4BNLA 2GVZC 2CJXA 2FUEA 3AF2A 3L6EA 2QWRB 3NO4A 2ZTMA 2IXFA 4NZMA 3VXKA 4G4YA 3EVZA 5KREA 1K97A 4DV0B 4I66A 1N8SA 1EFRD 1TTHA 1H38A 4UAGA 5JPDA 3HSSA 2PM8A 4EVSA 3AHCA 5K8IA 5H5NA 1KGDA 1AKEA 5CFLA 4TVKA 4MKGA 2W4IA 3IJPA 4JBWA 1UKAA 1Y0BA 3K0GA 1TFRA 5KAIZ 4PI2A 1WAMA 2UYKA 2E4XA 1L1QA 2BI4A 3OPXA 2RCNA 2IUUA 3STXA 2P11A 3P4EA 4MP8A 1JNXX 4PZ0A 2QPAA 2AX3A 1YZYA 2BDEA 5IAKA 3SDBA 1F51E 1EEHA 3QX8A 4X1OA 3RS5A 3CNBA 1W6UA 3CEAA 3UHPA 1W36B 3PZBA 1A1VA 2NP7A 4BW9A 4MV0A 5AW2A 1LTQA 5DXAA 1Z15A 2IUYA 2C4KA 3DEKA 3K1JA 2JLYA 2A14A 3N39C 3Q8XB 2PUDA 1Q0LA 4R3WA 2JIRA 2PUGA 3FAVB 2E0IA 5EXSA 3U80A 2H8EA 1PGNA 3R5HA 3VUFA 2Q3BA 2H92A 3F4BA 4M0LA 5NULA 3TRFA 4B7AA 4EKEA 2FE1A 4B6PA 1QLEC 1II0A 4Y2JA 4C08A 3UENA 2B4YA 1BHSA 3HUUA 5FADA 4CIWA 2GJKA 1QO0D 2VDQB 4D5GA 2CLLB 3QLVC 1JBQA 4G9GA 1RCUA 4GG1A 2YIVX 4PO3X 1KR2A 3SJQC 4ENUA 5K0EA 2DUNA 2NO0A 4W9RA 1E1RD 3J7AU 1KJJA 2ZOVA 3EAGA 3G0BA 2HFKA 3NMUC 3IJ5A 3RVPA 2WMYA 1L4LA 2IFTA 3IO5A 4J03A 2PCJA 1OFVA 2Z4TA 3I9NA 2YWGA 4CTKA 4NCAA 3BRCA 1X70A 2VDMB 3ZHXA 4IR7A 3BK2A 3R6GA 1G6UA 1A32A 3VDNB 1A9ZA 4KVZA 2NUAB 4IDFA 4CDMA 4X44A 2YNMD 5AM4A 1DKRA 2BI7A 3FNHA 3H11B 4FBGA 1K9VF 4I4IA 4F3TA 4JJGA 3H3XA 3HB7A 2VJPA 4URFA 4POAA 1EFPA 4ZU1X 4C01A 1ZM2A 3SEFA 1W25A 5BY1A 1V5GA 3AZQA 4D81A 4FBLA 3FCSB 4E4EA 4TUYB 3A36A 1VHTA 1KZ6A 2IYUA 1Y6FA 2GDZA 1OV6A 2J6IA 4JP5A 1VJCA 2WA3A 5K6RA 4NCBA 2YRFA 4UOQA 5EE3A 4V0OA 5BVHB 1VQMF 1HSOA 1VBKA 2C4MA 3AKDA 4S24A 1TKBA 1Z38A 1H9BA 5F77A 2I29A 2BKEA 5FD8A 4HDCA 4GRAA 5KU7A 4X6XA 4XWWA 4OSEA 2C7RA 2L26A 3HH8A 3KKZA 1QFSA 2A0UA 4UBIA 5BSKA 5AW6A 1RLJA 4B5KA 1T4CA 3GLFE 1WP9A 1QG2A 5FPRA 4LYJA 5BR7A 1N9KA 1X0VA 2B8TA 3P1JA 5BNFA 3WP1B 1PSWA 2X86A 5IAAA 4DA4A 1NNEA 2ZYDA 3BWBA 3HABA 1ZIPA 1ND5A 1Q6IA 3QEMB 4YJKA 3JAMM 3QMMA 1ONSA 4BJ3A 1XPUA 1G41A 1DC7A 3AEZA 3FLBA 1W5EA 4RQBA 3OEEA 2ATVA 4BT4A 4RHAA 3RGWS 4E5VA 7REQB 2H4HA 3TECE 3KPYA 3UWOA 3MHTA 1B6SA 1TA4A 2WUFA 2BSXA 3OFKA 1UZLA 4G84A 4WN9B 4BFSA 2Q0SA 3VZRA 5LQJA 4MIKA 4A5UB 1YFZA 5JATA 2XVZA 1JLMA 1VHLA 1LBIA 4KDFA 2A1TR 1CJKC 1KAOA 4JFAA 3E86A 3KHTA 4MI1A 2BHTA 1MNQA 4YJHA 3WGVA 1Z62A 2QIOA 4DLWA 4PLYA 2DQYA 3ONVA 2O1SA 3MWLA 3QUSA 3RA5A 3V7UA 3W05A 5KNLA 2JL1A 3CJHB 3CMCO 5JSYA 2JFNA 5A71A 1MA1A 1NTKH 1WA8B 1Y3BE 1XP5A 2AZDA 2YYSA 4DUGA 3BD9A 1FTNA 1JTEA 4HBZA 4R3NA 4AJHA 4CODB 4EFKA 5C5DA 1R0YA 5FBWB 1XDDA 1GSAA 2ESRA 4B4UA 3OT4A 3E58A 3HEAA 4ZOAA 4CR7A 1XZFA 4EHNA 3EMVA 1YUMA 5JSFA 2YDXA 1Q2XA 2YINC 4R68A 4YUWA 1XTJA 3C1TA 5E8RA 3G9XA 3I0ZA 2JVIA 4U1RA 3O4RA 5FH9A 3HI4A 3AG2C 3PNMA 4MVCA 4UHCA 4B3HA 1K8XB 4FOTA 3CP1A 3FUCA 4WFAV 2GI4A 4EI7A 3GEGA 1YKGA 2A7QA 2Z1NA 3HR4A 4ISBA 5EKUA 2IV2X 3S3WA 1IZ3A 5LP6C 3TD2A 5HOQA 8LDHA 1MT3A 4OLJA 1F8UA 2JBAA 1L7OA 4XLZA 4AJ9A 3PV0A 1RFLA 1PU2A 1MQSA 1M2OA 1FDIA 3KLNA 4I99A 2A9KA 3PCTA 1IRIA 1NURA 4PQGA 5IDVA 3F4LA 1X7GA 3V6MA 3ZV7A 3SF8B 3X1WA 4RHTA 1H2HA 8AT1A 2C61A 4TQUS 2HBZA 3W5CA 1THZA 3CEPB 4IV0A 1IJBA 4K3UA 4W5JA 3H2SA 4BP8A 1RQXA 2NO9A 1GUAA 4KITB 3ID6C 3VNSA 3DEZA 5BNTA 4C7BA 4HD8A 4UCSA 5EL0A 4FZ1A 5IKPA 3L92A 2O4CA 1SBCA 3QX3A 3AR7A 1N8KA 3WMFA 4FR5A 4QXPA 3UMRA 3F47A 3BPZA 1IOWA 2GK7A 3WL8A 3ZU2A 2CWJA 3ABIA 3T99A 4CNBA 4HZ3A 1TM2A 3JZFA 1BMFG 3EQ2A 4A91A 2FSVC 5TS2A 1ESDA 4FHFA 1BMDA 1BVYF 1KBOA 3LGAA 3UJ8A 2VQ3A 3ANXA 1W57A 3TR6A 1JHYA 3AIKA 2WLNA 1A4UA 1RU3A 3LX5A 4YJ2F 4I1PA 1OMOA 3LBIA 4ZRNA 3RN4A 3N7AA 1IURA 1VB3A 5JWRA 3OPYA 3DBLA 1UFYA 1NJ1A 1H94A 1TT5B 5KAFZ 2GN2A 1GEGA 4WKGA 2GKOA 4IIVA 4BB5A 4CKXA 4M22A 2I33A 4O6VA 5E1OA 2V3VA 3KB1A 4YQZA 3ZVMA 4RUEA 1WZ2A 4MRMB 4A1OA 3U7QB 1PD1A 2XYVA 1XXHA 4R8SA 4I36A 4CTMA 2ZPTX 4RWEA 1ZINA 4IIBA 2GPSA 4UATA 1NLMA 3ZXXA 3F3SA 3WGGA 3DMNA 2E5LO 1E2GA 1H8HG 2P0YA 3RO7A 1Y6GA 4MDFA 1KOJA 1BMTA 3U0VA 2Y1KA 2YRWA 3DNPA 4O8ZA 5ESRA 5IRCD 4OXXA 3GY0A 3AHIA 1IBLB 4RVFA 1PG5A 1KMCA 5KNBH 3KEGA 3LIIA 5BVGB 1XK7A 3KFVA 3S2FA 2Q6KA 4I50B 3VI4B 1LJLA 3OOEA 3CCLF 1SY7A 5EXTA 3S0WA 3MJCA 1NFFA 4CQMB 4F4IA 1WP7A 1N2IA 1BE1A 4WN3A 1Y1LA 4E4TA 4EL5A 2G9ZA 3OF2A 3VSBA 2W6QA 1CXZA 4AMVA 4OI0A 1SOMA 3SYTA 1DUVG 2WM2A 1CZLA 4R2XA 4MR7B 4XH9B 4B9EA 3BZBA 1S5LZ 1Q5PA 5LR6A 1UXIA 2OBBA 1XLTC 1G5RA 3L1JA 4RK7A 3Q3GE 4TKVB 3A6ZA 1JBKA 3D3IA 1Y1TA 1XMPA 3D59A 3N1UA 4I46A 3LY5A 4EB0A 4OQZA 1T25A 2GZDA 1JV2B 2DBYA 3NJ4A 4PG6A 3DWFA 2AUTA 3A7EA 4CQMD 3EIXA 1CUZA 1DJLA 5K0ZA 1R0CA 1Q6HA 3KQOA 1USWA 4ZQFA 1TCBA 5FXMA 7ABPA 1HYQA 3I5XA 1CR6A 3OP1A 4MV4A 3BHNA 4R9VA 5JD5A 3KV1A 4PBRA 4BC0A 5JD6A 2FSPA 1HV8A 3SJBC 2D54A 2MINA 1DL5A 4ZA2A 2ISCA 2PGJA 4FMBB 1WSDA 4WUTA 2ZIGA 3QIAA 3PENA 2FV8A 3UN1A 1D3AA 4ERXA 2YN4A 4FI3F 2XEDA 1WHTA 1PS8A 1FLNA 1L2TA 1E2IA 5BVGA 1EVZA 1QGED 4MKIA 3TW0A 2ODPA 4ALKA 4DLKA 3IAM6 4JC0A 1C50A 2SCUB 2XGOA 2LKCA 5IM5A 2JFZA 2WUWE 4PC2A 2N04A 1H4VB 4D41A 1Z7GA 4NMMA 4CFZA 4AFNA 2FWNA 5BW8A 3SPHA 2PV7A 2B1QA 1ZVVA 1ZMBA 4J75A 1PP9H 3T7CA 2OV2A 4R40B 1QP0A 4DR4O 2MWMA 3OQIA 1RRVA 1VPVA 4HEJA 5JBQA 2ROQA 3OTHA 4IIJA 2X6AA 2P1RA 2QGZA 5DHPA 1S9HA 5EE1A 3DL0A 3LVRE 2OZVA 1PX2A 5TNXA 2XAQA 1ORIA 3QNEA 2HTEA 1AJQA 1R00A 2QMQA 4DRXA 3SKXA 3DE3X 3TXYA 1V6SA 1TLLA 2CUNA 3GQBB 1P1FA 4DCGA 1OAPA 1PD3A 3P32A 2WHXA 4A6EA 3BHJA 4UHFA 4Y2QA 5G0SA 1SK8A 5C52B 1RWBA 2XX3A 3WNCA 4WZBE 1VQ4F 5F5XA 2PSJA 5G4KA 5FOVA 1GVNB 4XIJA 4HXFB 2FUNB 4DV3O 1G7TA 1Q92A 2FQYA 1RQ2A 2FSFA 3QBDA 5A5VA 4B7UA 3P0JA 3QWHA 2YWHA 3KSUA 1DS6A 2HHCA 5BQPA 5FBQB 3N2NA 4ZVQA 3RRZA 1CK2A 2E74B 5ITVA 3NBZC 2C1EA 4RACA 4GGMX 4DR6O 2PH1A 5EJ5A 2EIJB 1K3UB 4RTMA 4ZYWA 2YZKA 1KWKA 3W6UA 4N7RA 4YUVA 3BF7A 5DK4A 4ASUD 2ODWA 4RENA 2B99A 3B3GA 1QFZA 2ZZMA 2I4IA 3B89A 1VQ1A 4EW1A 2R6R1 1ZN9A 2EQBA 2Y1OA 5CB4B 4H7HA 4BVKA 2F3UA 5GOZA 4NU0A 3C45A 4O59O 5EWJA 2HMAA 3ZBTA 4OM7A 3ZXYA 2IXGA 5K8CA 1THMA 1VXOA 2XKKA 3HFGA 1FQJA 2LP4Y 2P3QA 1CLIA 4K35A 2AN3A 1CRQA 2QRVA 3C3EA 3FUWA 2VP3A 2XUAA 1H2BA 2CUKA 2PCLA 3QKWA 4YP0A 3RVSA 4LX0A 2QX6A 3D5QA 2EV9A 2ZXFA 4RPKA 4LOLA 4M99A 1J0AA 1FRZA 2GAJA 3LPCA 4RJTA 3HXMA 4HDMB 3AHFA 4WZAE 3D54A 2XUFA 3W06A 4C0BA 4KQFA 3TCUA 4D9HA 1CDEA 2PUTA 4P35A 4ZT2A 4UTRA 4O4JA 3U7EB 1R4ZA 3W0LB 2P62A 2CHFA 1Y9EA 2ETVA 1PNOA 2RCYA 3BILA 4WZBA 5EYPB 3PWTA 2JPDA 3K06A 1Q0QA 1YE8A 4A2PA 3TAUA 3CMEV 1XUQA 2HQSC 1PLLA 1QRRA 4I9FA 3FSGA 3FYUA 2VYFA 4JEIA 4MWOA 4A2WA 1DELA 2P2ZA 3D5EA 4DTCA 3J81M 1HZZA 4JELA 3QTLA 4NESA 4ZAFA 4J9ZB 1E4YA 2DBQA 3Q7TA 4KIGA 3N3BC 1ZJ6A 3OQVA 2AG6A 3GLIA 4KL1A 3T7IA 2HDNB 4CM4A 3OD4A 1SZCA 3FM9A 1C9JA 4KVFA 2F48A 1R6BX 4D44A 2NACA 1YOVA 2X0RA 3ACCA 4JC4A 1J24A 3KR9A 4ZKIA 3WIEA 4MTGA 3K09A 4NVPA 4ALNA 4N0DA 2OVFA 3N2KB 1XMOB 3U1VA 1BFDA 4C6HA 4CKYA 2VNKA 3BTUA 1L4UA 5KX5B 1RWNA 2J3KA 3D4LA 3NBYC 4P3NA 1N57A 4FYIA 2D3WA 3U62A 3KLBA 5LL6P 3ZCVA 4FN4A 1C8LA 1H5UA 4YTEA 4LXTA 3FR8A 5J63A 2X0KA 4OQPA 3VR4H 3JQ6A 1MRZA 1X3LA 4UMEA 1MLDA 1EVIA 4C43A 2GB4A 4URVR 4LA4A 4PWYA 3V9PA 2R6JA 4II3A 3QVWA 2PJRA 3O9MA 1EGHA 3W5UA 4OHUA 5B1DA 1XPOA 1DAFA 2YV1A 1AI6A 1XN1A 2O57A 1XXHB 2Y27A 4U2EA 4QYXA 3RS3A 1KD1W 1RD4A 4PI0A 1GPUA 1QHHB 1U8EA 4EQZA 2XXBA 4ZHWA 2GZMA 2GYVA 3AF1A 2ZPUA 3P0RA 2GVNA 4C4RA 5ALSA 4B3JA 3LM8A 4IHAA 2P22C 4MPDA 4AI8A 1EXVA 4MPPA 1GTVA 5L4SA 3ORYA 4KAFA 2OCCB 5F1YA 3GWZA 3IXMA 4RD1A 1OXSC 1F8XA 2M1XA 4X3OA 2AKEA 4RK1A 4FLMA 4EUNA 2IYAA 3AFHA 4FKZA 4NF2A 4P84A 3F0FA 3UAYA 5L45A 2MMCA 2X40A 4P82A 2QP3A 3BMCB 5KDDA 5K0SA 1PF7E 3BTSA 3EDYA 3FN4A 3N2KA 2CYCA 4TN1A 3S4YA 4MKXA 4BLUA 2WMOB 4HDNA 2VDPB 3ZY6A 4JI3O 1W2WB 2Z3ZA 4B3MO 2AFIE 3IMEA 3N0RA 4QXAA 2VP5A 4FDTA 2JGDB 1J2YA 1EQAA 1GP2A 3PICA 1L1RA 1OE0A 1SUWA 2YY7A 1JBEA 1I7NA 3R3ZA 3EUAA 4S1VA 5FL7D 3S2YA 2ZRQA 5JNWA 2QSUA 5EHQA 3TO5A 3LUHA 2R97A 1AKYA 1CYDA 1EVKA 2XNSA 5DGDA 2OPBA 4BT7A 2IYWA 3CPEA 1B0PA 3QW4B 4OAPA 5CIQA 2GPAA 4BN0A 1A9QA 2UU9B 4U4AA 1UJNA 3PIIA 4FTWA 3U9TA 3JTMA 3IC7A 1J8DA 4DCVA 4JZGA 1OCRC 1SO8A 3H2JA 4FEEA 2EKLA 1IBMO 4ITUA 3B6EA 4JBLA 1PV4A 1ZITA 2CC2A 3AHGA 3B7PA 2YHAA 1YGPA 2A7XA 1DTEA 3CZCA 3NFYA 4HAOA 4YAFA 5BR1A 5ICSA 2VI5A 1NBIA 2QB5A 2CFIA 2RI0A 4AF8A 1W85B 3ZWKA 3WFVA 1U0HC 4YV0A 1CB0A 3EG9A 2HHHO 3PG5A 2P75A 3VU8A 3BMNB 1V4VA 2ZBVA 1CTQA 4HQNA 4AO6A 2ONCA 4W1SA 2G7ZA 3OCVA 4ZOLA 2GJ4A 2QLTA 2V4ZA 3JZMA 3QUAA 3TSWA 4CEIB 3OOJA 1N2HA 5KTSA 2R00A 4N41A 4I2VA 1IATA 1Y81A 3K8YA 1J90A 1JDTA 3CVYA 1NTMH 1PQUA 1Y9ZA 2WYWA 4FKMA 1ORWA 1AQUA 4JWKA 2WUVA 1F7VA 2L69A 1U8AA 1SBZA 3KJHA 9GPBA 1M6HA 3ZE0B 4ML3A 3KJFA 1T1JA 2D1FA 1REQA 3G8AA 4O3FA 4B2LA 3VKWA 1S3JA 3O65A 1NGSA 4OXIA 4YRDA 4YXWG 5JAZA 2G40A 1KP3A 4D9CA 1RXWA 3CE2A 4HAUA 4E22A 3WL6A 3I53A 4EHAA 1T5HX 2NO6A 3THWB 4K3AA 4LWSB 2OENG 3OZVA 4ICGA 4L0DA 4J49A 4WW0A 4LJSA 5D85A 5DSXA 2NU9B 5BR4A 5L40A 4ABTA 5KQGA 3Q8LA 4D9JA 1JSLA 4ES6A 3DR3A 4PR0A 4B6JA 3H0KA 3K3PA 1QSGA 1U0SY 4JVSB 1LS6A 3FVWA 1JSRA 4IDQA 3ETQA 3WBKA 3WJAA 4BFXA 1QIJA 4HAWA 2Q3HA 3LDAA 1HI9A 5DHFA 4I3HA 3RAPR 2Z95A 1QH8A 1UODA 4ZMBA 4ZYXA 5I8PA 4MW4A 2RH5A 4TRNA 1CHNA 3BMNA 2L42A 2XWBF 1SUSA 4UULA 3K35A 3RV4A 2OORC 2VOEA 4RK5A 4TLMB 2P77A 4BBZA 3EIHA 2C77A 2O8VA 1Z75A 4HL6A 4UJ3A 3NGXA 1DAHA 4X93A 1QIGA 3IEXA 3FFTA 1E2EA 3M7MX 3J81A 2WNIA 1O1YA 3O4VA 3FD5A 1JZTA 2CL7X 2F1JA 4XOUA 1QUEA 1YS9A 3CNLA 4MIEA 2QUBA 3KKOA 3MTEA 1HNWB 1RRGA 1QIDA 2ZRFA 3PNYA 4I2NA 4IHKA 2QUIA 2CEKA 2UDPA 1MG0A 3CLRC 3K5MA 5F5NA 4YRJA 5LKAA 2UZ4A 4DG9A 4BVGA 4QT4A 1RC8A 3EUEA 4JBGA 2GFIA 1KJIA 4UCXA 1T6NA 4GGOA 5AW5A 4A5OA 1KI6B 2W4MA 3PB3A 4YBRA 1XDGA 1Q82H 1OFTA 2QJOA 4JA0A 4DM7A 1RQGA 5C5IA 2BGJA 3PNPA 2VSYA 4HDKA 3DC7A 3EAFA 5JARA 3OZEA 5KNBD 3BL6A 2ET6A 5JFOA 2G08A 4YUXA 3CMMA 1I10A 3W2FA 5HBRA 4PX9A 5EAIA 1SCDA 4DM3A 3VMMA 3E4CA 4G25A 2HWWA 1IQUA 3CKYA 2R4UA 4ROSA 4Q7JB 3DOFA 3PA8A 5IC5A 1UKCA 2CDYA 4KH1A 3HKBA 4H33A 2H0QA 2M6RA 4M0FA 5WRFA 4PNPA 4MW6A 2WABA 4DMMA 1CHDA 2AJ8A 3WMWA 5HIJA 2QVGA 1EA5A 1TQ8A 1YDHA 3B4SA 4MLDA 1JY8A 4IF4A 4UPDA 1T1IA 5CT5A 5B37A 3HVUA 1JMKC 1D5NA 3RE3A 1QH9A 4ZCTA 2NAPA 4LBZA 3VR5A 2WIBA 4A8TA 1QHEA 3G5MA 3KWJA 5IAOA 4OHWA 1JQDA 1YB2A 3QBVA 1ZN8A 3GJ0A 2A67A 3H4VA 4LXQA 4K88A 3WK5A 1GTSA 5C4GB 1Z2GA 2ZJ0A 1HDOA 2BP7A 3RT1A 4AN0A 1P45A 3GFTA 4V03A 1C3OB 1VARA 1T5EA 2RKOA 1SQVH 1KYQA 5AM5A 4X3LA 1T0IA 3IALA 1N3BA 4YRTA 1HPLA 4OQNA 5KWVA 1JQEA 1P7VA 3PR2B 3Q9LA 1AD2A 1E2PA 3FPKA 2RGXA 2J0SA 3TNDA 2DOKA 5EFOA 3M1YA 1K4YA 3RT3C 3TNJA 1T0AA 4N65A 2HI0A 2I5PO 3GOHA 3LE8A 1ZW1A 4TV8A 4V0QA 2ZP1A 1QGAA 3D1LA 4BVFA 3KYIB 2WF7A 3RT9A 2ZVDA 2ITCC 5BN5B 721PA 4CTNA 5L7WA 3O93A 4UVCA 1N1GA 2VWQA 5EKSA 4JQCA 5JXGA 1LBTA 1E79G 5E9QA 3M1XA 1C3JA 5MN5A 1Z5PA 2V7BA 3IQZA 1TYDE 4CZ2A 4HFNA 1BS9A 1U4SA 3NATA 3LWOC 3S03A 4F85A 4RKYA 1MOSA 1YR8A 3D6NB 3TM5A 2ZJ4A 5CFZA 4N5MA 2BUCA 1YRWA 3AF0A 3BDIA 4CMJA 3M34A 1RR6A 3T7RA 4IGGA 4CXMA 2CNWD 1D0IA 2RMKB 1AS2A 2ZUBA 5FO0A 1AXEA 3LYHA 1ETUA 4QU9A 3B1YA 2COEA 1QYDA 4M21A 2AZXA 2QX8A 3KJQA 3FKSG 2WNHA 4X0EA 4WY2A 3QG1A 3W34A 1NXTA 1JJ2U 2JJ1D 2VP9A 2PRKA 2JJ1G 1ABEA 1O87A 2VP4A 3GDOA 5EHGA 1XZQA 4LGMA 3J80M 3TQOA 2G1PA 1KETA 1W4ZA 2QDXA 1A8IA 3L0ZA 1JEDA 1HDRA 3FTEA 4JI7B 4U2CA 5EMLA 5LGTA 1JXQA 1Z2OX 3LL7A 5LVAA 5KYUA 4Q34A 4C4TA 3W7WA 4FFKA 3V1LA 3KR0A 1PJCA 1U31A 1DBVO 1XD9A 2C31A 4B73A 1VYUA 4M7PA 2H7YA 1IUNA 1J9GA 2IYRA 2HHJA 4DC0A 1TT7A 3EODA 1NAHA 3VH3A 2AOUA 1Z5ZA 2IKSA 1OYYA 1QANA 1PUXA 3K8QA 5FORA 3ZHVA 5JSKA 4ZYTA 2MTBA 4EECA 3BGDA 4PHFA 4LDAA 1N2CE 1G5PA 2ADMA 3NM4A 4Q4JA 5C18A 1E3EA 1KYYA 2J9ZB 4KN9S 5EVCA 3SHOA 1K5DA 4H6WA 4CL3A 1T13A 1KA9H 2C9MA 5GONB 4GS5A 5IKMA 1VLZA 3TTSA 3KOUA 4YJ3B 1D1QA 3LJKA 5JSZB 4YV2A 1Z22A 1JR2A 2IU6A 3PQ4A 2V7GA 1F9EA 4GZ5A 4RAIA 3N2EA 2DQSA 3OLQA 3G2MA 1HM5A 5FULA 3SLGA 4W8GA 1JEQB 4NBSA 4M6WB 2BKLA 2FSHA 3W9YA 1PT8A 4QDOA 1Z0JA 5E2IA 1QU3A 2PI4A 5L95A 5FQNA 4UREA 2AR9A 4F5ZA 3T5AA 4MYCA 2ZYUX 3HDHA 2Q62A 3KCQA 3HNPA 1WLEA 1E3TA 1I4LD 2JEYA 3DEYX 1MO3A 3U39A 3GJ5A 5J3JA 1DQPA 2J7PD 1PYDA 1VIAA 2FFHA 4NAUA 4RQUA 1YJ9V 1ZM7A 3OM3B 1CV2A 1SEPA 1SXJD 4FLXA 2IU4A 2JI9A 4NSNA 2YQZA 3KAJA 1XNRO 5AQEA 1ONIA 4F2HA 1VPWA 1W1IA 1TA9A 1FDOA 2A1UA 3D54D 3E7DA 5JD4A 2Q7HA 5KTKA 4MB2A 5JJNB 1M76A 1OKKA 1XOUA 1NG9A 3DL4A 4NNJA 3CCEV 2OQ2A 3NBUA 4EFDA 1AC5A 1QIFA 3TOVA 4UMFA 1P2DA 2DFKB 4JBIA 4QATA 2FPPB 3S6JA 3QGMA 2NU6A 1PJQA 2YWRA 4GBJA 4R0MA 1SXJA 1P1IA 1DKNA 1U6JA 1A50B 2DFTA 3W7XA 5KO2A 3FUVA 2CUZA 2QN8A 3HBFA 5FKJA 1OB5A 3DTUB 4K8XA 1JLSA 4AS3A 3T0GA 4C20A 2QT9A 1W0KG 1XL1A 3LSSA 3C43A 4KRXA 4NK4A 2FWAA 4TQGA 4LP8A 5EZ6B 4PHZA 1SKAA 2JH3A 2Y1XA 3GWGA 3I6YA 5BSWA 1G6HA 2B8NA 4RE5A 1E3SA 1CQIA 4L0MA 4X7PA 1FYXA 5LBIA 2PF4E 4E21A 3TDNA 3R3UA 2VK4A 5I01A 2VQDA 4JUCA 5IAEA 4H7FA 3M6UA 2I1VB 5J1TB 1DT3A 1SS3A 2M9MA 4JIGA 5BW6B 3M8KA 3Q5EA 1HE4A 2OGUA 5AWFC 1TTTA 4FKBA 4G0ZA 1F4LA 3AX6A 2Q69A 4LNHA 2O2ZA 4L8JA 5E2AA 3NVAA 2OCYC 4DIDA 4MZXA 2QVBA 3PQ3A 1ZTEA 3ZZMA 1Y4SA 1H2FA 4YGXB 3TZEA 3RUDA 3PWZA 5B1SA 5IJ9A 4DSNA 3H97A 1YBMA 1E2NA 2PWZA 3ZN1A 5EQFA 1IN7A 4G2NA 1SCAA 3MGKA 2RONA 3IHTA 4M1WA 3GL9A 2LCIA 5CH5A 4CM7A 1ZW6A 1B3RA 3F78A 3OUFA 3B09A 1JEEA 1QCDA 3I8XA 4MVJG 2HSWA 4RVOA 4MV8A 3ZCXA 4C7JA 3EWIA 4OD0A 4IVQA 3MDSA 3PJGA 4WT7A 5DASA 3EJWA 2GJAA 1PLKA 2BGIA 4Y2VA 1QYWA 2PI5A 4K81B 1LBEA 1EUCB 1JHRA 2J4CA 4WD3A 1T8WA 2HU7A 4E13A 3KQHA 1AKQA 3LUFA 1N8RW 4LFAO 4BLOA 4JQOA 2F4VO 4EEZA 4JJFA 2I3GA 1EE9A 1VE5A 1CVRA 1JI3A 3T1HB 2UUAO 2N42A 4JP2A 5FI1B 5KVQA 1XZDA 5THQA 1E1MA 4JU8A 5TDHA 4AMBA 1XCLA 1BIFA 1Y42X 1CEQA 1VE9A 1IY0A 3TXAA 4WA7A 5JANA 1SH7A 3DCIA 1EK5A 4BIIA 1TUGA 4DW0A 1OXKB 2G5TA 1A77A 2PX3A 2Q4EA 2VP0A 3E2IA 4RPCA 4PPGA 1L8OA 2J0VA 3HP4A 4O5OA 2CHQA 2XW6A 1VKRA 1ZAKA 1JDPA 2YXBA 2CHEA 2ZBFA 3QVTA 4HFJA 5CHEA 3B1ZA 1JTFA 2XECA 2I91A 1JDBC 3CX8A 1F2DA 5IAGA 4LF6O 4NOKA 3CSXA 4IH1A 4P3KA 4RLSA 3K79A 4BMZA 4XFKA 1GRCA 1ZK3A 1UPFA 3C5VA 3COWA 1AK1A 4N0PA 3QUTA 1GPJA 4KO3S 4RXTA 5GIOE 3PLAC 1M8PA 4O4LB 3T15A 4NTYA 3NLLA 4N21A 3ELCA 4EUFA 3AY7A 2I6XA 3PFCA 1PZXA 3W2IA 4YRZA 3F7TA 3JASB 2N46A 5AVVA 5DM60 2JGJA 4AO7A 5K8LA 2F8SA 1M5TA 2WY2D 4XYBA 1A7AA 4DY4A 3PAFA 5BMVF 3H5OA 4QHSA 1OX4A 4CM8B 1E92A 4TMTA 1X8XA 1CDZA 1PGQA 2I3BA 2IY7A 3FKSA 4MKRA 3D6VA 4XQCA 3ND7A 3IE1A 3FRIA 3IEVA 3IKMB 1H3NA 2H2HA 5KYTA 2XDQA 1QHFA 3FCOA 1NW9B 5J2UB 2MU1A 2C00A 1E8NA 1NVVR 5JUWA 1U02A 4GLXA 2PANA 4WFIA 4XBFA 1GPNA 4BIUA 2QRQA 4NU5A 1WQ3A 3C3PA 4BC1A 5ADHA 1I51A 3ENVA 4PZDA 4PA9A 4PD4F 3VOUA 2XRMA 1AUOA 4BMSA 5KYVA 4K9PA 5LD2B 1OLUA 1K7YA 1AB3A 2PBZA 3C3DA 3RWRD 1YAHA 3IPXA 4IO1A 4PSKA 3CC4V 3IUNA 4RMIA 1QBGA 3RSFA 1I2CA 4MVJI 4D1YA 5JJEB 3RC1A 3HTNA 1WXQA 3PC6A 2A84A 4LV8B 1B93A 2R11A 3ROXA 2C3MA 2C2GA 1YCIA 1K6MA 3K9GA 4HEQA 2GSDA 3ON1A 1ZN2A 2PUEA 4LHYA 3JWGA 2P9FA 4ZOEA 1EPUA 2B35A 1FTQA 2ENUA 1UMBA 2X5KO 3AEQA 2BLNA 2WJAA 4B6RA 4QBGB 4CDRA 3QNUA 5B1HA 5JSZA 3HYTA 2ARKA 2QE7D 1QTNA 5FYDA 1CY6A 5DKFA 5I7EA 2XTAA 2QPLA 3D6UA 4DR3B 1M57C 1KSHA 5B57C 1BXRB 2Z2YA 4FHDA 3VX3A 4II7A 4C88A 3A1VA 5CD1A 5GJBA 3NNNA 2XGMA 5FR2A 3VPDA 5EINA 3QYAA 4XUEA 1UOOA 2PXXA 1MN6A 3A70A 1COZA 3AUTA 3E9EA 4ITVA 2ZI3A 3A1WA 3LTEA 3B1JA 3C90A 1KJZA 2YBEA 1OZGA 5KIAA 4R1UA 3CUYA 3U7FB 4Z53A 1DRUA 4M49A 1OXXK 1VA4A 5CVCA 5TX7A 4GPIB 3WKEA 4M7WA 1YS1X 5F3WB 4BCBA 1NTRA 5JEDA 2IGTA 2CE7A 3RREA 1I4TD 1J42A 1WW2A 3AHEA 4IZHA 4Q19A 4TKUA 1QOQB 4A2CA 4BLPA 2PGOA 2BW0A 1PR4A 3I2GA 1QGOA 2XNCA 4B7CA 5FUVA 2PD4A 4P4SB 4RCYA 5FLYA 2HHHB 3A2LA 2PO7A 4GRDA 2NU8A 2J6BA 5MN4A 2Q5EA 1LLQA 1RXCA 4W8HA 2A2ZA 4YYEA 3MWDB 4MW1A 4F4DA 3JVVA 2G07A 3U17A 3TSCA 3PKJA 5DN6A 4K6KA 4HWRA 4V3BA 2NU7B 3GP8A 2AXTZ 1CS0A 3NMUF 2H4WA 2QTAA 2QAIA 4X1KB 2EJRA 3CHXA 5K0JA 2CVHA 1E89A 5F3RA 3U19A 2E1PA 1D9XA 3VZDA 3W5IA 1GU7A 3CCBA 1FDWA 4YDRA 3UJAA 4M46A 2BEUB 4RABA 5LZ5A 3S81A 1QPZA 2ZIXA 1G4AE 3SQNA 4DA8A 2F1HA 1W8DA 2IEZA 5BRNA 4BNNA 4EJ0A 2CV2A 1E9DA 4IZ6A 3SVZA 5M7EA 1ADJA 3GBSA 3TB6A 4FGKA 1CCWA 1T5DX 4E5SA 1YB5A 2FZLA 1JQBA 2PUAA 4PO1A 4QG3A 4I4TB 1Y8QB 6NULA 3SJZA 4N18A 4EO7A 1NRJB 2WE8A 3I56V 2RHGB 3BZUA 4M1KA 5AXBA 3W3AD 5KNCA 2ZJ8A 1KMIY 1TGOA 4AM8A 1VMAA 2ATCA 1XKLA 1W94A 2G8NA 5EKXA 4YQEA 4UHEA 5IDYA 4Z51A 5KSZA 4TZ6A 2X1VA 4EBFA 1YI2F 2Z83A 1YI1A 3I30X 1FVFA 1VXRA 5KI6A 2QSZA 1IVYA 1YIAA 5L3EA 1V9PA 4L27A 1B2RA 1KKLA 2DG2A 5D3ZA 1H3FA 5DM4A 1B4DA 4M8KA 4CDNA 2NSHA 5L4LA 5BSGA 4P30A 5LXTA 1CFJA 3W3AA 5CK5A 2K5UA 3T1VA 1XBLA 3VVMA 1GFIA 3DMYA 1PJ2A 1SZPA 3HTXA 3DO6A 1WZIA 1GPYA 3KLPX 1CY2A 2WWYA 2ZPAA 2ZUWA 4FD2A 5TPWB 2I2FA 1NRIA 4Z3KA 2GZAA 3EN0A 1B15A 3A2FA 1SHJA 2QR4A 1J33A 2W2OA 2X8WA 3DEHA 1XLTA 1PJRA 3E05A 4IVRA 2XOEA 4OBEA 5EMHA 3U10A 1NYRA 1GGFA 5KYWB 2Q1SA 3M8AA 4NCJA 2VDKB 1C7IA 3RSLA 3WLEA 4F3CA 1EXDA 3R6TA 1IBMB 1FDVA 9LDBA 2FW9A 1M9NA 1PEDA 1XMOO 3NWPA 4B45A 2H4JA 2PMKA 2Z9BA 2QJTA 3BFVA 3BH0A 3RJ9A 4DIMA 5ICFA 1DT5A 2I6TA 5ICMA 5LPNA 4MRRA 5DNVA 4RJLA 5KOYA 1LZKA 3KPJA 3GLVA 4KE6A 3EFEA 3WLPA 3NBQA 1V11B 3S2SA 4DVGA 4BGEA 4F56A 4ZJPA 4MVSA 3QQ5A 2GCGA 4AZ3A 1AMUA 4LVCA 1FPOA 3CIOA 3JAWB 3OPMA 4XAQA 1KDOA 2VPWA 4GX5A 4AJEA 1QBKC 4JR1A 2ZINA 4N3CA 4OXSA 5T5QA 5IT0A 3KZOA 5KC8A 4W7IA 1TPYA 3HWUA 1EZ4A 4IJ5A 1Y7LA 4FR0A 3DOEA 4WFKA 2G5CA 5P8WA 4B32A 1GL7A 3CLUD 1K98A 5BV0A 2F66C 1UDAA 1KMQA 2BMFA 2PA3A 1FBNA 4N47A 1V6AA 4K46A 5AVQA 4EWLA 5M5BA 2W0XA 4YRLA 1XI2A 16PKA 3KLMX 1GITA 1ACJA 3AIIA 3MBMA 5DTQA 2D0OB 5KYWA 1NVVQ 2NYAA 3KELA 3PDUA 4EHDA 1IYZA 3THSA 1DG9A 3NUQA 1NBME 4LQLA 4IVPA 3EDOA 5JAUA 2CDCA 4MYDA 1EB8A 1OLUB 3AR2A 4OH7A 3ADOA 3JSXA 3RA6A 2FX3A 2YVQA 2PIDA 4QHTA 3DQZA 3L0PA 4CHGA 2YZ7A 2XMDA 4NUTA 2YHUA 3HACA 4Y9DA 3MWFA 3PHBE 3PGKA 3BXXA 5DLQC 4RHEA 3UM9A 3VKVA 2ZFUA 3ZDXB 5TVGA 3S1AA 5L3SA 1QV9A 3AM3A 5LQCA 3V4ZA 1V16B 3BS4A 4GBED 5LUAA 4G0NA 3K1AA 1OT5A 3ZGVA 5CXSA 3M1AA 2YWDA 1M56C 1YO6A 2JDIG 2P6MA 3FXAA 1WXIA 3MLBA 5EIWA 4DZTA 5K6TA 4CBVA 2V9YA 2B37A 3EFBA 5TPZD 4P0QB 3RUPA 3M83A 4BKRA 2HRQA 3D3WB 1ZD9A 1J2EA 3NHSA 2G6BA 4IXNA 1WXHA 4PRLA 3WSTA 5KNBA 2R7LA 1DTWA 4I4LA 4I8DA 1Z37A 4GKJB 3L7LA 3WV4A 1PUIA 5G02A 1HNXB 3AFIA 2O2SA 4IKPA 5JDIA 1NW7A 1ZI8A 2RG1A 3P2EA 2WICA 4XYEA 1OWMA 3T4EA 5KHOC 4TSFA 3QVNA 1T9DA 2BOVA 3LX6A 3BKWA 2I3AA 5AK5A 5EQTA 2YUTA 2AW5A 4QL3A 5AM3A 1JN1A 5KDOA 1XN4A 4Q3NA 3S99A 4NZZA 4JF3A 4ZIBA 1KMIZ 2HRYA 1HYHA 1DWOA 3G1WA 3OF5A 4MS4A 4U2KA 1QJ4A 1XTRA 3T9AA 5CEFA 5J23A 5EKTA 1RXUA 1D8TA 1U8XX 4QBHA 4NMXB 1FFBA 3BGWA 3INTA 1JYEA 4TZTA 4J3NA 1E0AA 3KQVA 2HWKA 3GOQA 9ABPA 1EM1A 1J97A 1RRMA 2J31A 1UMCB 1RA4A 2JCYA 1Y5RA 1DBFA 1U3TA 1XMIA 2PGIA 4JT9A 4BLTA 3W1EA 2MW2B 4JI6B 4E11A 4WCFA 5BMOA 3QITA 3THOA 5M2QA 3D43A 2WOOA 3A31A 5AVOA 4DR7B 1X19A 2W37A 4P4SA 1HA3A 4PZEA 1BYIA 1UBGA 2EZ9A 4YT2A 1UWLA 3DZJA 1WP4A 2ZXWB 4PZUA 2RH8A 1C9DB 4IDBA 1L5OA 4WXRA 3GP5A 5F9MA 2X22A 3K4HA 2KTVA 5BXZA 2YFHA 4X65B 3PNLA 3C7KA 4DQXA 2YHIA 1SETA 3Q4GA 5DM0A 2YOGA 4HNUA 1OH5A 2A3NA 3QO5A 1ZGBA 2QTZA 3KFLA 4UBMA 2WAYA 4RF3A 3LMKA 3N7TA 1PSZA 3VTFA 2AK3A 3CT4A 4QICA 3WY9A 1I33A 4YAWA 4YJ3F 3T95A 3ZDEA 4U3FH 1M8JA 2RGEA 4B4WA 4C7MA 3DQPA 1RZRD 4GLOA 5IYDO 2CNNA 2YMMA 2FYTA 1JJOA 4WNIA 3BIFA 3VJKA 4D97A 1XEQA 5TGZA 3LKVA 1QP8A 4C2UA 1AX9A 2FZWA 5E3HA 1BJTA 3E9ZA 4E08A 4PX2A 4FOSA 4XUCA 4JDUA 3FB4A 1NH2B 4ZOLF 3WBBA 4CM5A 3TW6A 5C80A 2W6NA 4L57A 4QYTA 5LB2A 5ICGA 5JZVA 3BSYA 1NFQA 2GVDC 3W2EA 5CBPA 2XIQA 4A16A 1F2TA 1HDIA 3N0XA 4LEIA 3KT6A 4MVJA 5B1NA 1DUIA 4WLOA 3SS8A 3TF5A 4H7IA 2ZYRA 3ED1A 3MM4A 4F9FA 2GYUA 4KX5A 2ZB7A 4UAUA 2PQ6A 4HWPA 2QM4A 1KJNA 4G56A 4K40A 1B6QA 2FR8C 4OTZA 2BBTA 5AW9A 1A8PA 1CE8B 3K5OA 1J8QA 4JUBA 5FPYA 2DBRA 4Q82A 3UQYS 1RWXA 4DAEA 4G4ZA 1U8TA 4DLUA 5EWRA 4HS4A 4QQKA 5ED4A 1YB4A 2PX5A 2WLSA 3CWZA 4J9YB 2BP7B 4GVLA 5HGJA 4BIMA 5COBA 4CQMA 4LK3A 1ZD5A 3H8WA 3K0CC 4QUGA 3HKEB 2Z5LA 4G1MB 4GI7A 4HC4A 4ZALA 2FMFA 2NZ8A 3GGCA 1J1IA 1I13A 1U7TA 5FPOA 1XQXA 1GMGA 1H2WA 3WL5A 1SRYA 3IP5A 1FXKC 5DRYA 4KV9A 1UUFA 3PNBA 3UUEA 2RHOA 1NUHA 1A8SA 3OT7A 1E7MA 3F5FA 3VPBA 3AEUA 1KEEA 3IL2A 4PLWA 2P78A 1XK6A 3G2IA 1E1YA 1J5XA 2BY4A 3RYTC 5AW3A 3SPCA 2E1RA 2WKQA 2X5XA 1NE2A 3B6IA 3I1YA 3IMGA 4OGLA 4WCVA 4XSGA 3ZWPA 4DZZA 5DNYB 1K5HA 1YDGA 4G1CA 5JMTA 3DE2X 3F6CA 1GV0A 2ATEA 2WINI 1F2TB 3SPGA 4FONA 3X1DA 1C80A 1KY3A 1U7OA 4O0LA 4A03A 3KC2A 4WXEA 2MJLA 2XASA 1XMSA 3TE7A 3V7YA 1MBZA 1FU4A 3Q1LA 1XD8A 1FS0G 3FKQA 1VHQA 1H0RA 3F9RA 2G4CA 4BPRA 4UFPA 4EJ6A 2HF9A 3L01A 1PNMA 1DAKA 2RG7A 5HZKA 3SXUA 3GVHA 5HTOA 2DBZA 3LBAA 4OSPA 2DFLA 5BN4A 1U81A 2ZT7A 4OYRA 3W1VA 4RDHA 4RY8A 3STYA 2VJYA 1BOFA 1NM5A 3K9FC 4DUYB 5AK6A 4GMKA 4FLFA 3AG1B 3LNTA 4GI2A 1AI7A 1TTPB 3G67A 1PGPA 4OP1A 3IUQA 3JQ8A 2DWPA 3CSUA 3RG8A 4TTTS 4GPBA 1K06A 2OLKA 2X41A 3KUCA 4GZRB 1QS0B 5B3AA 1SXGA 4Z2WA 1JKJA 3MRSA 4F4LA 2Q2NA 2ZLBA 3CJRA 1ORRA 2OCCC 4R8RA 4WKPA 5FI5A 2QRLA 5C37A 2E6KA 4UMVA 1SXIA 2VZ8A 3D8CA 1MX5A 1Y4UA 2HPVA 3C6YA 4PYQA 5JQWA 2IV7A 2JB9A 1ONNA 1NNSA 4IWXA 2HQSA 4OLHA 1UC9A 2A4MA 2FA9A 2VTBA 2AMTA 2BM8A 3GLKA 2GPWA 4HQRA 4KPEC 3QZUA 4PLPA 2QE7G 4PTLA 1ZVQA 5EZQA 5KNCD 2FW6A 2X7JA 3RKUA 5A7HA 2YX1A 4L8VA 3RVJA 1KKUA 3BQMB 2LBPA 3HEBA 2OL4A 3GUHA 3WWZA 3ZCRA 3INNA 3R0QA 5FWDA 1Z4QA 3UTCA 1OFUA 1FNDA 1ZM9A 4RUKA 1J39A 4BJ5A 4CEHB 2IBSA 1GGNA 3OSUA 5FEMA 5FPKA 1QDUA 1RADA 1KJQA 2KHZA 5B30A 3UOWA 1G1MA 3OX3A 1GUBA 3VGPA 4YNBA 3FROA 4C6SA 1R1DA 1OJHA 2WZCA 3EWAA 3WYGA 3T4DA 2V7WA 4KREA 1JA1A 1ADFA 1TOAA 2GTSA 5IJXA 3R9XA 4KMRA 3OIDA 3ANMA 3DMTA 5SY9A 4NH4A 3ZE2B 1D2NA 3VSEA 1YZGA 2Z08A 3N5CA 1O7JA 4DBVO 1S8AA 2FHPA 1F4NA 2GT1A 2W2PA 3DVRX 4ZHSA 5JJBA 5TVKA 2AD1A 1O94D 2IH5A 3BIOA 1NR1A 3OCUA 3CCUV 1Y7TA 3APOA 3D4OA 3QVVA 4LF7B 4Q66C 2AN1A 4R2HA 2HMYB 1PG2A 2QSYA 1F14A 1VSBA 2FY8A 3NWOA 4L8GA 4RPLA 3VMFA 3WISA 2ZDHA 4JJZA 1FRFS 5H68A 4YCJA 1NQUA 3C8DA 5LMUO 5SICE 5TV2A 2JFUA 2XGJA 5D1HA 5E3IA 2WAAA 4RD3A 1U8YA 3OHMA 4KK3A 4XYLA 1JTVA 4I1IA 3H2HA 2CJFA 1X80B 1VQ6F 2ODBA 1XO1A 3MLAA 1DCMA 4WCFB 3W3AH 5LDDC 1BD4A 3KZXA 3IEUA 2NXEA 2K6GA 3AY3A 3HCOA 1A27A 5JBNA 3ZRWB 3ESJA 2EINB 3RTEA 1P6UA 5JT1A 1T4MA 4PYOA 3DZKA 5FBRB 5IH3A 4J0JA 1O2DA 1PZFA 2R87A 2V65A 1KO5A 4I8IA 3VR4A 3JALB 2QDOA 2CFTA 2Q99A 2RHWA 1P7YA 3NVIB 1UANA 5B1EA 3C8ZA 1HDEA 3RYFA 2OLEA 3HBNA 1HW7A 2AS0A 1O4WA 1VE3A 3U5ZB 3S8MA 3T3HA 3GARA 3IBCA 5GM2A 3G6EV 2XE4A 4YMHA 3EY9A 1E6EA 3T1OA 3QE0A 2ZI5A 1OGYA 4FP9A 4LWOA 4XCXA 4Y8VA 1EFHA 2DRIA 5IBPA 1ZR2A 1EUYA 1PGJA 3GMDA 1QAMA 1B00A 1V7CA 1SKYB 2CFRA 4DV6O 2ODQA 4J10A 1O9HA 2ZM6B 1R16A 1C29B 1J0BA 1N0HA 2C54A 3QVKA 4HF7A 4NU6A 2VHVA 1JQ5A 3HRHA 5EMMA 5K3FA 3VDQA 3X1KA 4I08A 4MUAA 4CGZA 1SHTX 5IT4A 4K9NA 3JQQA 2OCHA 1I80A 1B7GO 4UZEA 4PNEA 2PH3A 4RYDA 3WK9A 4D9NA 4GPZA 3NONA 4GX0A 4XXHA 1SU7A 4C30A 3AFOA 4CF6A 4TWBA 4CLOA 1OBHA 4PC7A 2BEVB 1Q7RA 2WUDA 5L3FA 1DO2A 2F95B 2GJ9A 3U3ZA 4KGXA 4C0SA 3STWA 3TQFA 2G0NA 3ZBPA 1X80A 2FEXA 4UXJA 3RNLA 1Z0IA 3DC5A 3HAXD 1GQRA 1P29A 2H52A 5HFLA 3NWBA 1F1BA 1V8ZA 4AWXA 4MB0A 1HRKA 3OR6C 2FB5A 5DULA 2R70A 1QDLB 2GF2A 2EL9A 5F76A 3OWXA 4C8GA 1G8SA 2F3TA 3ZH9B 4UVHA 2EBHX 4YP5A 1PE0A 3JYPA 3UPUA 4LE0A 3L70H 1E1RG 1CU1A 1PV0A 1Z6XA 1YR2A 2XWJI 1YI8A 5A3JA 3AEXA 2FFJA 2X58A 1T8RA 4NABA 2LO1A 3P7MA 2RHTA 5P21A 4B7EA 2GZ2A 5JJKA 4RHUA 3EXHC 4TKVA 1ST2A 2R5FA 1CZKA 4RVNA 5C53B 1P5ZB 3OQIB 1QAOA 3S68A 4HDNB 4E1BA 3LUPA 3GQVA 2CTWA 3MB8A 4TOIA 5D00A 1V0JA 4GECA 5GADl 2EL7A 5BOSA 5LYYA 2EW1A 3B9PA 3EXEB 1HMYA 2RCVA 2R8XA 5IMBA 3I39X 3RAJA 3VVBA 5JV5A 3F8SA 3EXHA 1E7KA 1TLFA 4V0RA 5L53A 1GWNA 1HETA 4ZQIA 1U1DA 5B7QA 3GQBA 1EVQA 1C7QA 1T9AA 3ROPA 5BSUA 1G2IA 3R9IA 2FWMX 5KPJA 1KQNA 4URWR 3KXKA 2CL0X 3U4QB 1LDEA 4P22A 2MMGA 4BLSA 1QRUA 4MW9A 3IPLA 4LF5O 5KSWB 4LDJA 1BGYH 5CBHA 1UAAA 2JGEA 2UXNA 3H3JA 3IR5A 3WDLA 2PV0A 3LCVB 1Z28A 3SJ7A 4CLRB 1QQTA 3Q15C 5DYYA 4Z9YA 3ZDRA 1V3QE 1JHXA 2EP7A 2GEBA 1IMOA 2H1RA 2VS1A 2WU1A 3IQIX 4OGWA 4ZT3A 4H3HB 1KK2A 3F97A 2G17A 1U6IA 4AG5A 2W6ZA 1O94C 5CDTA 4F96A 2HDOA 2YL2A 5EZYA 5AIBA 1Z68A 5K3BA 1PSDA 2O2EA 4NS1A 3B48A 4PA7A 1UJ4A 3SBDA 1WSAA 3H5IA 3KKPA 4ZAVA 1KR5A 3VYSB 3GJXC 4ZEXA 4K1XA 1N9GB 3WJ1A 4XGRA 1WVMA 3WICA 3WHPA 4BYGA 2FWIA 5F12A 1XZIA 4IFTA 4YMWA 4RVGA 3WQHA 2KX7A 3AVWA 4RIGA 1MW9X 3PX2A 4TS9A 4XJTA 1H8EG 1X9IA 5BOSB 1TYCA 4BFLA 3E61A 1FBTA 2IQIA 1M6YA 3DBRA 2JAPA 4J8PA 4KWTA 1N0VC 3W6ZA 3HM9A 2VTBB 3BA6A 1ZRSA 3FNIA 4J41A 4WN9A 3V5NA 3K92A 2PFKA 3LKZA 1MSWD 3THWA 3A9RA 2IZ5A 1EX7A 4IJKA 1JDJA 3U4QA 3RVBA 4U7GA 1E1QD 4MUIA 3I55F 3HE3A 3CS5A 1SQ6A 4HWGA 1DC6A 4MYSA 2XUQA 5GMOA 1R6UA 2EFEB 1KH2A 4G0PA 4NDNE 2JGUA 1ODLA 3NAZA 1P72A 2HH9A 3A0RB 2I6GA 2VSNA 3G5AA 3ZCTA 3GPIA 5DM1A 2AN9A 2CMGA 4CEHA 3GO4A 1UXOA 2E87A 3HA5A 3WG7C 2OM2A 4URYR 1PJZA 2HV9A 3KHNA 1O57A 4EUEA 2EW8A 2R8OA 3L0IB 4BTLA 4HB4A 4M7OA 2AG0A 4YP9A 2DC1A 3SQLA 3UATA 2UZ3A 4CIAA 2QD4A 3GCDA 2C9ZA 3TQSA 1JU9A 3ABLB 1FFAA 1T8PA 2FX2A 2QTTA 1D5CA 3MJDA 4RAOA 1JEOA 2ASEA 3TJRA 2WP0A 1B3BA 1QZXA 5EWMA 5JZMA 2NV2B 5JNVA 5LOVF 3WYEA 1Q0TA 1EU1A 1ADYA 5BW4A 5JAPA 2V6JA 3WMEA 1CB7A 1TDJA 5I9SA 3OKAA 5JMOA 1E63A 4DXDA 1WPBA 1SVKA 3KOMA 1BFUA 1MENA 1AKTA 1A69A 1OFIA 1R3DA 3U2QA 3ZWXA 3GJ7A 3EULA 3LWPC 5L7TA 2GM4A 3QY0A 1VPDA 2C20A 2XGGA 2DPLA 2C9DA 3HA7A 3FZYA 4ZYYA 2JBAB 4KWEA 3I0MA 2EYQA 3IUJA 1NYLA 1K5SA 1WCIB 4ND6A 5BOVA 4CQNA 2MSKA 4YQYA 1KEKA 3FFMA 1LDYA 3BBPA 1JFSA 3DZDA 2OT5A 2IPNA 4QWMA 3WJ7A 2VJCA 2PUHA 4OI1A 3WLQA 1LLCA 3GHZA 1A0OA 4XX0A 4BRSA 1E5LA 5HUQA 3NP9A 1RWOA 4E31A 2NU8B 1WQ1R 3KKYA 2EGGA 2EJUA 3KXPA 1CRZA 3NIDB 3OM9A 5UKDA 1H5NA 4ZVKA 5IYZA 2I6RA 1BWRA 4QGAA 2CLHB 2DWCA 4MVJF 5CT9A 1NHWA 2RHRA 1F38A 2J9FB 1M2KA 2W2MA 4FGJA 3UMFA 2FB9A 2YWCA 1QH1A 4GYYA 4B8ZA 3EGWA 1N1EA 1XAGA 2HMVA 2QYHA 2BKVA 4OM8A 2JIZA 3LI2A 4AMYA 2Y0DA 1JA8A 1YRHA 1OZ0A 4FYYA 4MJ7A 4RGVA 3RC8A 3ZGZA 4NZPA 1SC9A 3DJYA 2FWJA 4UUPA 4JJKA 2DPYA 2KBEA 5T67A 2BEUA 2JK1A 2ZR7A 2GTPA 4RQOA 5EPEA 3SDLA 5DU2A 2NPFA 4BZZA 3BABA 4Y3UA 4EKWA 2ONKA 5CDFE 1N5JA 3GIWA 4WK6A 5K3OA 2FU5C 3WGLA 5HG0A 2D1SA 1PNLA 3ITDA 2I4LA 4I5IA 1RMTA 1CJTC 4NFHA 4ZT7A 1K5QA 5HMLA 5KKNB 2F59A 1I0ZA 4G8DA 3KUUA 2C96A 1EFPB 2ZDIC 5B1AC 2XWQA 1GAEO 4EGAA 1NIJA 3J7AR 1ZSVA 2XUDA 4FGWA 4HXGA 4TKMA 4OFWA 2A58A 5FUYA 5C1IA 4IDAA 3UVEA 3VZSA 4JJEA 4YHBA 3NDBB 5KTOA 4GVXA 2N47A 4X65O 4U5QA 1F4VA 1B6TA 1LQUA 3NKVA 1NBAA 2V6MA 4GR4A 5LZ8A 4Z4IA 5CDFA 3L4EA 3DVAA 1TU4A 4CMCA 2R7NA 1U2DA 2NQ2C 2IE8A 3Q9NA 1SU8A 4F1WA 3MS2A 1YR9A 4UNSA 5CHYA 2A30A 2O8EB 3ZY5A 5AI6A 4C7OA 5AMXA 5C32A 5K0FA 1S2OA 3OAAA 3AQ4A 2GUZB 5B58C 1RPAA 3IP9A 3K0KA 2HNKA 3F5QA 1G6OA 1AF7A 4N5LA 4RTLA 3ZVKA 1I36A 1X1BA 3EGEA 4J91A 2BYTA 4N3GA 3P97A 1FX0B 2P2YA 1SEVA 2VAXA 3I6ZA 3WV5A 4JLVA 2CTRA 2QVZX 4JI2O 3F6EX 5K3CA 1Z0AA 4CQLA 4YAGA 5LDHA 3FWPA 1NSFA 3UAXA 4UE3S 4JYAB 4UNIA 1DXOA 2H5IA 3ENQA 4HWOA 5AVWA 3S2ZA 4UEKA 4G5SA 5LUBA 5LXTF 1K8RA 2XHEA 3FDZA 3K0CA 3LRPA 4XW2A 4DJ5X 1YF3A 1RWQA 3T7SA 4TYWA 4OCZA 1RPTA 5D86A 1V11A 4C4AA 1VEWA 1HUQA 5AQ1A 3T5GA 3DF9A 3ETGA 4BN4A 5J2UF 1L4EA 1BVUA 1EJ0A 1NVWQ 3X1ZA 3ROFA 1JDZA 3ZOKA 1AILA 3BC1A 3PCRB 4DCTA 3LU1A 2G9UA 4D3YA 4X62B 3EPRA 1NJFA 4IUCS 2POCA 3B38A 1RWMA 4BWVA 3E5RA 4W5QA 2AQIA 2GD2A 3BCRA 3FSRA 4LPSA 4C7OB 3HCNA 3WU2Z 1L5HB 2E75B 3SIVA 2RGBA 2L82A 3CGWA 3DFZA 1YCGA 1O97C 3I83A 2JK0A 1J99A 2FMLA 3A8TA 1W4LA 3ASVA 3CONA 3NPAA 1W88B 4OYLA 2EIMC 4JS0A 1GDTA 4YQFA 4K26A 1FX0A 1RLGA 1JPUA 1WVGA 1QO7A 1NF3A 1R5OA 2A0LA 1G4HA 1Z26A 4FOPA 4AUKA 1MAUA 1XQVA 5B2EA 2CZCA 4Z4QA 1FUKA 4D8UA 3EVTA 4FS3A 5KA6A 3KOOA 2DTDA 5D87A 4AZ0B 4Q01A 1SR8A 2C8JA 4RM2A 4BT5A 4OJMX 3E89A 4JJAA 3KAQA 2IC5A 4MQ4A 2E5LB 2VT6A 2RK3A 4TT3A 4CMIB 5FR1A 4C82A 3A1CA 4BNMA 3I12A 1JVMA 2XZPA 1OI2A 1Z2CA 1UFIA 2XT6A 3OUZA 1G3UA 3R0XA 3RRBA 4D0RA 5KB3A 3WHLA 1A95A 2PX0A 3R4VA 4JODA 4NG5A 5KDLA 4BX2A 1MR3F 1QLWA 3DGEC 4C6TB 3DOCA 1OZFA 3ZD8A 3OEYA 5C93A 3S8EA 2ZI4A 2QTOA 4RKRA 5AKKA 4A8JA 1L5WA 3MS7A 1FIUA 1XRSB 1WCV1 4ZGGA 4EYSA 2IP4A 1Q1BA 1Z45A 4DNPA 4IIHA 3UJDA 5DGHA 1KYOF 3FB1A 5KOHB 1JR6A 3VYUB 1LY1A 2YZMA 2WLLB 3QOYA 4JL8A 1MX1A 2G71A 3HB0A 3HCAA 4NBTA 5E2BA 3N05A 5JO9A 3WLOA 4BMPB 3EZ6A 3EVKA 1HY3A 2BOBC 5DIZA 1E4EA 4B3SO 2QM8A 1K92A 4BXOA 3C98A 2JF0A 5LA6A 3MELA 1O8BA 5IFKA 3WHKA 2QM0A 3E0XA 1RT9A 2I7CA 3FCCA 3HB1A 2R84A 1MDFA 2FSUA 1XZMA 3EC1A 3ND8A 2PKWA 2RAVA 3OBBA 4MS4B 2ZU6A 5LZ2A 1YBFA 3WWEA 4A9AA 4OQQA 2X4DA 3LY9A 3RSZA 3GVMA 1FNNA 2B8WA 1HE8B 3RVZA 1B26A 4GPTA 1AGNA 1JYSA 2ZWMA 4O2LA 5DHSA 1NNI1 2H00A 1Q3KA 1Z82A 3DWGA 1EM6A 3EIOA 3H84A 4FFRA 1NXQA 4FT4A 1NMUB 3MAAC 4KO4S 1SQBH 3MINA 1KBZA 1OBCA 2ZJZA 3CX3A 3H01A 3DT6A 1CQIB 1YTFB 3K0TA 4YHHB 4NDZA 4EF5A 1S6YA 4US0R 3MEQA 2HEGA 1YS6A 2Z1MA 3UG7A 4BEJA 1KFKB 3IBYA 3SFZA 4DLXA 2Y69C 1A7JA 1SUCA 3TQCA 4FCWA 3ESAA 2Q6IA 3E48A 3OAAG 1ZHOA 1K6JA 3DXYA 1NVTA 3RU2A 4F6LA 1H4SA 3PR3A 2X4GA 4BX8A 5HQ3A 4ZO7A 3L8GA 2WM9B 4U2GA 2FGYA 5I3ZA 1QIIA 1XZBA 1HLGA 3ZE8A 4I4CA 3Q9UA 4I50A 1DB3A 3QI7A 5EO3A 5ICEA 4Z4CA 2VBFA 4OATA 2NADA 4R71A 5GZ3A 1Q0UA 1FXWA 1V25A 3FD6A 1T5BA 2XADA 3NBFA 3QOFA 2E55A 4FZ3A 4K7JA 4LTDA 4UCRA 4QOSA 4TX1A 5JJCA 4BXOB 4IGEA 3RABA 3D2AA 4B79A 2BCEA 4BMNA 3N2YA 4REOA 2QWXA 2QN3A 3L8CA 4L5IA 3UFXB 1M74A 2CXPA 3LLVA 3WQQA 1U1IA 2LV8A 4IMJB 3CX5F 3CNHA 1R37A 3GFQA 5CM8B 4DR3O 5ENZA 1SC1A 2ORED 2R7MA 4U7DA 3JARB 2FNAA 4EMUA 3QELA 4PGHA 2PKCA 1NU8A 1PZHA 2GK4A 1TAQA 4YPOA 5B5SA 3B9QA 5JALA 2ZIAA 2TYSB 1D04A 2FMKA 3OCWA 3R3SA 4RU1A 1BMFA 3L5KA 4LN1A 2FTKE 3T12A 1EIZA 5KKAA 3NR7A 4JC5A 2CGOA 3FMFA 4J7UA 2ACKA 2HLDD 4LYGA 4RVUA 3TLCA 2GZ3A 3SP1A 2ZW9A 2ZE7A 2FDCA 1YXBA 3NHKA 4QSHA 4Z54A 1Z34A 2BZ1A 2JIZG 5DTEA 4YWJA 3FPEA 2V1UA 5KSYA 2CWWA 3SC2B 1Q7GA 3DE4X 1Z6YA 1SRRA 3BAFA 5FA5A 3CCRV 5E1MA 3VHRA 1ISHA 1H05A 3NH9A 4X71A 3GFRA 1QR2A 1PKXA 4Q15A 5DXFA 4D98A 2AXEA 3CCMF 4B4KA 4G4VA 2HLPA 3KSBC 4NMWA 1YIDA 1DRJA 5GOTA 3OX2A 4ISCA 1XFDA 4MMZB 1I6KA 1PYGA 1GGKA 1V41E 5F2KA 3BWVA 4EHFA 3B13B 2DECA 2VXCA 1JE0A 1AXGA 2E37A 3O8NA 3I9KA 2JGDA 1MQ9A 3L7YA 2R79A 1OH7A 3ZWCA 1AS3A 2UUCO 4CH3A 4DRXB 2O2XA 1XC7A 5CNIA 1XVTA 1ZUQA 3SLRA 2YC0A 4FQ5A 2ZJ7A 4IHQA 4UHDA 3RIGA 2WMDA 1COWA 4W8OA 4DPMA 3ZE7A 2TMDA 2HBRA 3H9CA 4GQIA 5KNDD 3ZDDA 4O2BA 3QVJA 3QX9A 1Y66A 2Q1YA 4W1PA 2NTEA 5EUCA 4AULA 2Z2JA 4DPKA 2ZRKA 1YBAA 3MCQA 2I71A 2QI9F 3N2GA 2UKDA 5G4KB 5HJEA 3LCJA 3ULKA 4QG7A 3EY4A 4BCCA 1W6RA 1FTSA 2PG3A 5AJHA 4X91A 3UNXA 1YITF 4DXAA 3WNVA 4Q05A 3ZLUA 4HRYA 1ZXLA 3WAGA 2DSTA 1SRQA 2DPMA 2HVYD 2V7TA 2VJMB 3LWBA 3PE6A 4L6CA 4Q7EA 4ZEWA 4GKKB 3QHDA 2VTKA 3EUFA 3X2SA 2ZQMA 1J0DA 1F0KA 1ZJZA 5CU7A 2GH1A 4B3TB 3NYQA 4UARA 4YLGA 2BRUC 1DZIA 4KQ1A 521PA 3GUVA 3GXBA 3DXXA 2I4MA 2V9ZA 5L3GA 2GHTA 1YJBA 4O5AA 2YWXA 5E9WA 1AF4A 3N0VA 3IVAA 4UBKA 3TIGA 1UMBB 2HPZA 1EXMA 1W52X 1UC5B 2CSUA 2K2QB 5JXIA 2CJWB 1YC5A 2CCGA 4JQSA 3V1UA 1DKOA 3ZWYA 1YU9A 5AH0A 4QU0A 4ON9A 2NNWB 1H7MA 2WTXA 4I8XA 4KO8A 2C88A 2WIJA 3SFTA 1RSOA 1IBKB 4XR4A 1I2AA 4RNCA 2FW8A 2GF0A 5F2NA 2CK3G 2AYXA 4YAJA 1FFXA 2NU9A 3IT0A 1GNTA 2JBHA 5FFMA 3KSDO 3VPAA 3HYCA 3G7UA 5JI2E 2JAOA 3VHXB 4W7SA 5EYPA 2C7GA 4BEBA 4B47A 4EHLA 1R88A 1VP7A 3IPRA 2CXSA 3EPHA 1JNYA 4O4IB 1JJBA 3BDVA 3GT4A 1KZ1A 3A6EA 4TTVA 4ZWNA 1G20E 1XWFA 2WIKA 4GUAA 2V59A 3PNSA 4JBYA 1JAXA 4QOJA 4ZZ3A 5A04A 2VFAA 4UB6Z 2P41A 1EP1B 3T7TA 3NHYA 1PQ4A 1D8AA 1LRKA 3D6JA 1DU4A 1KI2A 1Q1EA 1L5YA 3QVSA 4INOA 4QUHA 4BQPA 4DLVA 4F4HA 2H3HA 3UWSA 2IZOA 3E53A 1G8GA 4RVSA 4LXXA 2XUIA 3WXBA 3GLGB 3I5MA 4P93A 1MUUA 3SD7A 1CUIA 1WBBA 5A3SA 1H4TA 1NF2A 1H2GA 1DG1G 2FZ4A 3K5WA 4NQRA 2OCKA 4V1CA 2HR1A 1RCTE 4DMRA 2BHSA 2W6JG 4RORA 5CMLA 1XQ8A 3RW0A 2UZIR 1TYAE 4CCSA 3TFOA 1KYTA 5C1BA 2ZR9A 5KHIA 1ZESA 3PHIA 4FX5A 1U96A 2CJWA 2JCVA 4K6FA 2VK2A 3G82C 4OA5A 1ROPA 3GNQA 3PRYA 2UZ1A 4JLWA 5EEHA 5C8DA 1NVFA 4EVIA 1Q2UA 1Z6TA 2XA2A 3OE4A 2AD5A 4IDNA 5BQOA 3PYLA 2ZROA 3FPGA 4GU5A 4G0YA 4UUNA 4Z7OB 2EQAA 3A1SA 4V39A 4D6XA 4M1ZA 2KSDA 2Z09A 3LXMA 2VQFB 4R05A 1J9ZA 4RC9A 2TECE 3ROGA 3GIDA 4B3IA 1U2SA 4P3YA 2J6CA 1FJGB 4OHXA 4Y2PA 2VYQA 1BTOA 4HBNA 3JQPA 1E1LA 4KQWA 3VX4A 1NP3A 4R9UC 3A0UA 4F71A 4I4TA 2BMVA 2F4NA 1FU7A 3KKLA 4PA3A 2HA3A 4G8BA 4KLAA 3AL2A 3OO1A 3GRZA 3QXSA 5A7GA 3SY8A 1VI2A 2P4VA 3N5KA 4US2R 3AI1A 1AK2A 3IO3A 1DBQA 1O54A 2ECFA 3FWNA 4O2AF 3VTKA 5B3LA 3N27A 3HBMA 2NSJA 3FIJA 5CTAA 4Q1EA 2FW7A 2ODNA 3CF2A 2YV2A 3OTQA 1T2EA 4OX9Y 3AI3A 3UXMA 2IEAA 3VYSC 4RF5A 3TJTA 4S2UA 2PT6A 2IOHA 2ZYHA 2PNFA 1SUPA 2QN2A 2EBOA 2FMUA 1KZHA 3DAFA 3HGTA 4EKGA 3RS8A 2OGWA 4Z3OA 3SBEA 1TT5A 2FR8A 3H5WA 4UNNA 4AIRA 1YHQV 1N0WA 3USCS 4Q4LA 4WNYA 2F23A 3B8HA 4ZICA 5JNSA 1TM3E 4YCNA 3E2PA 3L02A 1M2FA 3BVPA 3JQAB 2F43B 1PTJA 4LNAA 1IV1A 1JA9A 1VMDA 1H0KA 2ZIOA 4PYRA 4ARCA 1WWKA 2C1ZA 3QU9A 5KMGA 1JX6A 3STZC 1L6IA 2PLAA 3TFQA 4XR9A 4BIZA 1BEZA 2UZHA 1EGAA 2CLOB 2UZAA 4DY6A 3SQWA 5A5GA 1D4AA 1X1AA 4PGMA 2YV4A 5KJEA 2GEDA 3MUOA 1VQ4V 4K87A 5ALQA 4F60A 1AB6A 1C8BA 4QM6A 2VIIA 1QGUB 5JTTA 2JDIA 5LMCA 1FLDA 3OSZA 5EC8A 4ZYUA 1IPFA 2GN4A 4I81A 2ZYAA 1KAGA 2B25A 4OHMA 1J70A 5J58A 1B8OA 3NHFA 3UF0A 5A5DA 2NT4A 1YITV 2R86A 4X85A 3KB6A 3ZDFA 4DR7O 1IXYA 3GBVA 3RKRA 3QEBZ 3DDCA 4TTRA 1VJ0A 4IWYA 2IS1A 1JIUA 5BMVA 3F4KA 4RQFA 1WXWA 4BNKA 2NO4A 4AWAA 1XZGA 3QFRA 4U6NA 3TLEA 1N75A 1S7GA 2RMKA 3NM6B 1EK2A 2VDWA 4UVGA 4DEXA 3G1TA 1NG1A 2WALA 3FZNA 3G9TA 3P5SA 1EG2A 3TD5A 2ID9A 3P2MA 4X8OA 2W2NA 4XJXA 4JNKA 1ZK2A 1N32O 1GT91 3DE7X 4N76A 3GB9A 1QX4A 4TYYA 5AD1A 4Y2RA 3DC2A 3K08A 1LSOA 2OCPA 4DUPA 2CMDA 1I0IA 2EVWX 3G5UA 1T0JB 4LGCA 1N5DA 5HJ2A 4I9QA 3RU9A 2XCOA 3MYRA 4PAWA 1S3SA 1W9MA 2XB8A 1BGVA 3EQ9A 2DKNA 1MB2A 3SC3A 1BYUA 3WL3A 1UKZA 4QT0A 1KVQA 4R84A 1SMKA 1KNXA 3BHIA 2Z56A 3GBPA 4D7SA 1GYRA 3A28A 2C3OA 3LFTA 5E8JA 3ZWMA 1A72A 1N0NA 1WUJS 3L7CA 5PGMA 2OV8A 4WBNB 1N5MA 1U7UA 2P9QA 1JDNA 2AN4A 2ERYA 2NMUA 2HSZA 1DJMA 3G9QA 3OETA 5F2EA 1A4XA 1LSSA 5BZBA 1ZI9A 3HFRA 2NVUB 5JRJA 1JKIA 1IXZA 1TM7E 2Y1FA 1ZSNA 3ETNA 2BJHA 3KYBA 1GA6A 2VR1A 4GMXA 3ZNQA 3WLJA 4QUAA 4QYSA 1NMXA 1WPGA 1C30A 1U1GA 2HZBA 2Q8PA 4BFYA 3RTDA 1GG2A 1AM4D 4YXWD 1MJFA 1SVWA 2XF8A 1VSVA 1K33A 2COUA 4RSMA 4C6RA 4Z1MA 4FE3A 1W4RA 4MHOA 2OXEA 4NKGB 2NSYA 2FRDA 2QLMA 2CLEB 2FCAA 4UUQA 3SKVA 4BP9A 3TLBA 5K8VA 3L0OA 3E7XA 4EYOA 3HYRA 1JILA 1C9KA 1WB8A 1EJ2A 2GA8A 1NQAO 4YRQA 2ACVA 2R60A 3KL4A 3MFYA 4Q3OA 5HKKD 1UPCA 4FZJA 1XTTA 3L72H 1U4OA 4YCCA 1N7IA 4GM4A 4YEDA 1K2VN 4EFEA 1L4BA 4Q37A 3ZQ6A 2ZUFA 1M1UA 4FXPA 1XHXA 1B74A 4YMVA 1LUVA 1U5CA 1SDSA 4L87A 3ORSA 1JLLB 5E4YA 1H1TA 2LRHA 4Q1BA 5FV4A 3TGPA 2KTUA 1U6KA 4MCHA 2R0QC 1SKUA 3VISA 4X00A 5CPFA 1TUEB 2HMSA 1UXJA 1M54A 5DT2A 4JENA 4L9WA 1AUXA 1JG1A 1QHNA 4NG4A 4RESA 3HDQA 1J1UA 3ZKAA 2CT8A 3ABSB 4U7HA 4MVJM 2HK7A 1P0PA 2O7VA 3LQYA 3WGHA 2Y4OA 3C14C 4UTOA 2FPPA 2YJTD 3QUWA 1TCCA 3QFCA 2QI2A 4TV9A 3R76A 3SEAA 4HNHA 2C9YA 1Z4KA 1ZO8A 4MARA 5SY6A 1ZFNA 3T4ZA 2VDLB 2WF5A 4XCVA 1Y67A 1II9A 3U3DA 4F2GA 2VBCA 1J7JA 3LG2A 3WLKX 2BMDA 3C1UA 3DP7A 3ENWA 3U3RA 4ZRDA 4KVGA 3DZGA 1JR4A 4LE1A 3ZY4A 5EBLC 2JIMA 3EIQA 2XSZD 2WHQA 4ZEOA 3KZ1E 2RSLA 3DCNA 3HU2A 3O47A 2XKAA 2WYUA 4NBNA 1D5AA 2YIBA 1B41A 2RQ6A 3HR8A 2MYUA 5CNJA 2Y48A 2O07A 2J3MA 2PXHA 4MR8A 1UQUA 2YYYA 1WJZA 2O7SA 3OM1A 1M5UA 1TK3A 3ONNA 3PL1A 1ISJA 1XDUA 4AXXA 4K3VA 1XBTA 4HQLA 3JAMA 1QIMA 2PMEA 4EHKA 1NMYA 4O2BF 1OD6A 5HQTA 1UBEA 4FYMA 2QKAA 3REFA 1TI7A 4PLCA 2AC7A 4GZ3A 2DUUA 3M3DA 4IV5A 2QK4A 1BS1A 1YUNA 2H48A 4MDHA 5DYTA 3ZW7A 4BVJA 1GD1O 4HVAA 4ESEA 5EJ7A 3U7HB 4QU8A 3CTPA 2VCHA 3LUCA 3NNSA 4NY1A 3Q87B 4KG7A 2LZ0A 4F3NA 2RK4A 2QHXA 5SY4A 5LLSA 2R68A 3VZQA 4AURA 3LDGA 5K2MA 3WE7A 5L3QA 5I7AA 4Q4DA 4RW0A 2MSLA 3KO8A 2GN1A 1HQKA 3H6GA 4L73A 1OIXA 2H2FA 3N8GA 4GEGA 4NOLA 3J80A 3DC6A 5ALVA 3KOZA 1Y9DA 3AO0B 3K5PA 3KDAA 4RV5A 4ZREA 1SBIA 4LCUC 1U7PA 4DV4O 2C9CA 3WJPA 2DWOA 2I78A 2OFWA 3NIBA 4FWIB 4N01A 4FEAA 4C03A 3JAKA 1HP8A 3OKPA 2BAGA 1CEEA 3BN3A 3U0ZA 3BFRA 1ZA2A 2OC4A 1UEJA 3DBVO 4IBOA 1SIWA 3IQFA 4TMZA 1ZWKA 3IBFA 4JGSA 3QHPA 1L4GA 5KNDH 2EXXA 2F1KA 2QM3A 3LHDA 4MLCA 4MUNA 3M99B 2WFAA 2KSQA 1BZKA 1MF7A 2QRJA 3G0CA 3H8JA 5K0LA 2CNDA 4XB6B 3AF5A 4HEHA 4D9EA 4X62O 1DO8A 1UC8A 5JG7A 4I0XB 4BTVA 4LSMA 4Q9HA 4KBYA 4Z1VA 4M76B 2WUEA 4OI2A 5JXJA 3BD7A 2AF4C 5J40A 1NN0A 3GRCA 5ED0A 5I5EA 4DV7B 2WJ3A 2OLJA 1B8VA 3C74A 3VR6A 1BRMA 3K0FA 2ZSFA 2BFCB 2FZEA 1K0UA 4YJ3A 2REXB 3F90A 3G5LA 3U0OA 3NNDA 1P4JA 4ABYA 1SA0B 1IY8A 4PYMA 3CZMA 3LPLA 1P0MA 3OR7C 1OHHA 2ATKC 3IAEA 3LLSA 2IQ5A 1LF0A 1SKYE 2M6KA 1N7HA 3WK8A 2FMTA 2O5VA 3C9RA 3CCMV 1Z4OA 1D0VA 2H5JA 3KDPA 3K5IA 4J0HA 5F78A 4R2KA 2ZTVA 2RH9B 3VV3A 3WLTA 2GJSA 5BW5A 3M4NA 1Z5WA 1RP7A 3OIWA 1JKJB 1KC8H 3TQHA 3FDIA 4CM3A 1JDVA 3O8QB 1H2NA 2ZVZA 5CJ2A 1CZHA 1ISRA 1ZUIA 1C0KA 1IZYA 1EZZA 1OVMA 2H29A 4LBEC 2PGXA 2VJLA 3RAFC 1W85A 3SF0A 2DWDC 1Q86W 3TUJC 1RXIA 2CXXA 1O5IA 1T91A 2IT1A 2P5YA 4JYYA 1GAXA 2QN7A 3AONB 2FDXA 4IIFA 4YT4A 5CGQB 3P26A 2DWUA 1VE6A 1S02A 1HFWA 2ISQA 2OVBA 2ZYGA 3COVA 3AG3B 3AWIA 4FIPC 3OURA 4RVHA 5DHAA 5KHAA 3ZH2A 3JWJA 2FPWA 2O6HA 1P4GA 1YL5A 3PI7A 5HRAA 1Z39A 3KP1A 3QNWA 4G86A 2RE8A 4B3BA 2ZR2A 1U40A 2FFQA 2P4EA 3I92A 2PN1A 4P54A 1LB1B 2DQ4A 3AXTA 4RQAA 4KRYA 2SKDA 4H0LB 3ZBUA 1DQZA 5CITA 2EZTA 2NZXA 2PT7A 3ER8A 5F64A 1QFYA 2IUFA 5ITZA 1IWOA 2LDXA 3IR6A 4UV9A 2LTAA 1OI3A 3BICA 4HTAA 4IJMA 4MAMA 4LAFA 2QLFA 4PYJA 4CF3A 3GEHA 3QYJA 1RKUA 4LWSA 1PIWA 1NR7A 3PLNA 4PYIA 3ZWQA 2O9JA 4AQYB 3R0PA 2MHCA 2ZUCA 4H08A 3QF7A 5LOVB 5HFJA 3CZAA 1GKIA 5J4LA 2JRLA 2LPMA 3Q6NA 3IQXA 2JD0A 1C9MA 3S2GA 5H3LA 5C4MA 4HS9A 4BFTA 3KQUA 4X92A 2OTJV 4C1BA 1T9KA 3A9SA 5I8WA 2VS0A 2ST1A 3NC1C 2ODTX 2GAIA 1ZZGA 3KRTA 1DADA 1DJPA 1WF3A 3ZUPA 3CLUC 1UBFA 2C2BA 2VNHA 2XYHA 2ZR8A 4M87A 4GZLA 4S12A 4DA9A 3H5TA 4TKUB 3FYCA 2C0QA 1VRVA 3JQFA 2CVOA 2Q27A 4TS4A 3GRFA 3SE7A 3HO1A 1G3RA 1G5FA 1KFBB 2VL7A 4FFDA 1A5ZA 1A98A 1T0PA 3IT1A 4QJ4A 2UVQA 5JHHB 5HUJA 2QM7A 4D3ZA 3T1YO 5B3KA 1H69A 2JG3A 1I7PA 3PFBA 4QGBA 5I47A 4O2AA 1V95A 3OO0A 1M1KW 1K08A 4OU4A 1EUCA 1W48A 3FBWA 3GWOA 2PDAA 3OOSA 3QW2A 4BMVA 5FWNA 2QZSA 1FFSA 1OV9A 1W0KD 2VLIA 1YQDA 1NZJA 3FHTA 3SBOA 1L5FA 2VT3A 2I65A 2WV9A 1C0EA 1XF1A 3H7IA 4PQRA 1G21A 3KKEA 4N7BA 5AUNB 3UMMA 3CKKA 2M7WA 5JQGA 4CH5A 5CT4A 4Y30A 1F8GA 3RC3A 8ABPA 3OE1A 3WNQA 3U09A 3NYWA 4YONB 3L46A 3H2YA 4BFCA 5LYJB 2EIMB 2QTLA 1L5GB 3UJPA 3NX4A 3PPIA 5B7NA 4UJ5A 2OYSA 1QK3A 1QU7A 1KHHA 4YMSA 1I5RA 5F9FA 2DT5A 1NVDA 3BK1A 4L50A 1XRLA 2B34A 1I4DD 5EXEA 2JEXA 2I2BA 3JTEA 4AX4A 4WHMA 3E6AA 4DLSA 4DO2A 5AKEA 4YT8A 1VJ1A 3USES 3UOGA 3OLVA 3BA9A 4Y1RA 2YDEA 4TM7A 4AJJ