5FNVB

A new complex structure of tubulin with an alpha-beta unsaturated lactone
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN ALPHA-1B CHAIN
publication title Pironetin Reacts Covalently with Cysteine-316 of Alpha-Tubulin to Destabilize Microtubule.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 172
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fnvB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5fnvB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5fnvB01
3JASB 4ZHQB 5LYJA 2R751 4X1YB 1RLUA 3JAKA 5MN5A 5LYJB 3VPAA 2VAWA 3JARA 5JCOA 3JATA 4O4IA 3R4VA 3JARB 1TUBB 4O4IB 5MN6A 5IJ9A 1W59A 3E22B 5M7EA 4TV9A 5IJ9B 4WBNA 5J2UB 4TV9B 4U3JA 4X20B 5LXTB 4O4HA 3VO8A 4WBNB 5CA1A 4U3JB 3M8KA 4O4HB 5CA1B 3JAWA 4I4TB 2VAMA 3RYHA 3JAWB 3WGMA 3VO9A 5GONA 1W5FA 4I55B 5FNVB 1SA0B 3JASA 3HKDA 3VOAA 4X1YA 5EZYA 4I50B 3HKDB 4O4JB 5ITZB 2VXYA 5EZYB 2XKAA 4F6RB 4XCQA 5LP6C 3V3TA 5CB4A 1TUBA 3ZIDA 5CB4B 4O4LB 3E22A 2XKBA 2RHHA 4FFBB 5LOVA 4O2AA 4B46A 3RYCA 5J2UA 4X20A 5LXTA 5LOVB 4O2AB 3RYCB 5C8YA 5CA0B 2BTQB 1Z5WA 5C8YB 4I4TA 4DRXA 4X1IA 1TVKA 4DRXB 4X1IB 4I55A 1TVKB 5FNVA 1SA0A 1W581 3UT5B 4I50A 3WGLA 4O4JA 5JH7A 5ITZA 4TV8A 5IJ0A 4F6RA 5JH7B 4TV8B 5IJ0B 2BTOA 5JCOC 1FSZA 3ZBQA 4TUYA 4X1KA 4LNUB 2GVIA 4DXDA 3HKEA 4TUYB 4X1KB 4EB6B 4O4LA 5J2TA 3C8LA 1FFXB 4FFBA 3HKEB 5JQGB 5IYZB 5J2TB 3CB2A 5KMGA 3RYFA 2Q1XA 5CA0A 4IIJA 4IHJB 2BTQA 5KMGB 3RYFB 4EI9A 3HKBB 4IIJB 4YJ2A 1W5AA 3VOBA 5MN4A 4YJ3A 5EYPB 4YJ2B 3WGKA 4EI7A 3M89A 4YJ3B 4ZOLB 3WGNA 3UT5A 1W5EA 4U39A 3HKCA 1RQ2A 3JAKB 4KWEA 3HKCB 1W5BA 3RYIA 4LNUA 4ZI7A 5KX5A 1OFUA 1RQ7A 5LP6A 3ZBPA 3JALA 4EB6A 5EIBD 3RYIB 4ZI7B 3JATB 5KX5B 2R6R1 1FFXA 5LA6A 3JALB 5JQGA 5JVDA 5LP6B 4B45A 5IYZA 5JVDB 3N2GA 5LA6B 2Q1YA 3N2GB 4IHJA 3HKBA 2RHJA 4EI8A 1Z5VA 4O2BA 3WGJA 5EYPA 2VAPA 3N2KA 4O2BB 4E6EA 4ZOLA 3N2KB 2RHOA 1JFFA 3RYHB 4HNAA 5EIBC 5BMVA 4M8IA 4ZHQA 5GONB 3RB8A 1JFFB 4HNAB 5BMVB 2RHLA
chains in the Genus database with same CATH superfamily
1S77D 2EJ7A 3HM2A 4RU1A 1SQFA 2XBMA 1DINA 2D4AA 2FW9A 2HR3A 1CB0A 3LRPA 6NULA 1QLHA 1LBIA 3HGTA 2PYJA 5K3FB 4BFYA 4BLWA 1UBHS 2OZLA 2ZJ0A 4P36A 5P8WA 4UE6A 2GN4A 2IHUA 2XPCA 1W9MA 2OP0A 4ER3A 4O59O 5H3LA 1XMSA 5CDYA 3E8MA 1G2IA 2OCXA 4H1HA 1J42A 3ZLVA 3PXBA 1PG0A 5GJWC 2N1MA 4M46A 3CHXA 1E63A 3GWGA 1YITF 3SJAA 1C9YA 4M1EA 4F8EA 1LJLA 5FPKA 4QDKA 3ICXA 3H0EA 1U9JA 2VBCA 4DQXA 4WXRA 2Z8ZA 4DMLA 2EQBA 4FLWA 3ADOA 3N2IA 4Y7DA 1U3LA 2XUPA 3RAGA 4MLZA 3O38A 4LTNA 2HMVA 2NU9B 3G5AA 4IJUA 2VDPB 2VT2A 3C3EA 4H17A 4P4SA 3H4VA 3LSUA 1PGOA 5HMMA 4ENVA 3AR8A 1PGNA 1GLVA 5HIJA 2A1TS 3QELB 3Q7PA 3IQIX 4WLUA 5JJ5A 4PXSA 4DV1O 2KG4A 4WBNB 4JSRA 1LZKA 1M8GA 2GDJA 4PA4A 1OZAA 3DNMA 3OO1A 2GZ3A 1TU0A 2ZVQX 2Y4UA 4AKEA 1GG2A 4A8PA 1V9CA 4IILA 5GIPE 1YC2A 1LWOA 3BRQA 2IEIA 1LRKA 1YH3A 4KR2A 3C1OA 1O2DA 1R9GA 5AVYA 1YJBA 2N75A 5B1EA 5ALTA 2ZBGA 4ZVOA 2J5XA 4XZ3A 1F4PA 3W5SA 2B82A 4RCYA 5EVCA 3D5TA 3H8WA 1KMIY 3DM9B 3JQ9A 4M89A 3U48A 4QHYA 4UE2A 1SDSA 1RBZA 3W3ZB 1N7HA 1OD6A 4TQAA 4MQFB 2JFOA 1H9AA 2RARA 3TH5A 3AJ8A 1Q74A 3CEAA 1XMJA 2R48A 1LVUA 3NYQA 1DC8A 3FUCA 1PWHA 5BOSA 2P9CA 2BEVA 3G2LA 1QLJA 5EKUA 5EP4A 4FTWA 2XYVA 1QBKC 2WU4A 2P9EA 5HIIA 3ONWA 2QZPA 10MHA 3ONNA 3V2GA 2F1JA 3P2EA 4LQDA 4BYGA 3GOQA 4S1PA 5HM6A 4FFPA 2YXPX 3L70H 1YE3A 4M86A 4MW0A 1AROP 3VJMA 4MYTA 2L18A 4J11A 1AQLA 1PV4A 4BT5A 1MJGM 3BGIA 4WXHA 3V7UA 2WHPB 4X1IB 1SESA 3H5TA 1LPBB 1KC8W 2F1IA 3HBNA 1YJNV 3CF2A 5JQGB 1FJHA 1GCAA 3RVMA 5IY5C 2JD0A 2WB2A 1QZUA 3E9CA 4BWFB 1YQEA 7AT1A 2H8CA 1IY9A 4H37A 4A1FA 5AVMA 4K28A 4LX8A 2QBYB 3LC1O 3O4IA 3HJFA 4S0XA 2Z1EA 3JWIA 4DCOA 1FZTA 4KYTA 4LK3A 3V55A 3GVMA 2QR3A 4MDEA 1N1GA 1CJUC 4AZ3A 2WSLA 3OZGA 4TRJA 3SLGA 1MA3A 4AUNA 1KNKA 2YEVA 4G5GA 4PAMA 4KFCA 3AETB 3JW8A 3UHJA 4FD3A 5ALQA 1ZRMA 4PIMA 3P9XA 1J39A 1ZAUA 4ZEOA 1TO6A 3ZDQA 5TVKA 3QEOA 3OCXA 3VYTC 4IXDA 4FSDA 3C5EA 2XEXA 1T25A 2Z95A 1QGDA 2GILA 4PSVA 3BX1A 5KU7A 1HLGA 3EZLA 3TL6A 2HEPA 1PLLA 2E55A 1UMDA 5G1OA 5ED4A 5JCOC 5AI9A 4LKRA 1PL7A 1K1EA 1Y1KE 2YOHA 4IL6Z 1RRVA 4A2QA 2OAP1 4FOTA 2BR4A 4QJIA 5JDIC 3LG2A 5JH7F 5K5EA 3VKGA 5DGXA 5KQRA 5IKPA 4M0DA 1N5KA 5LQAA 3F2IA 4EZEA 1Q7GA 1UBGA 5KYYB 1AVMA 4EVSA 1I51A 2Z1UA 4QHSA 4C6HA 1L0BA 3CZMA 2VNJA 4J7AA 1CJTC 1JYFA 5KREA 1AS0A 5CJJA 2EJCA 4G5FA 1ZH0A 2A9FA 1HE2A 3DOOA 3LVRE 3M81A 4I9HA 2G0AA 1N3LA 3FPAA 5KAIZ 1TM2A 4CH4A 1H0KA 1T3GA 2PRIA 2B1GA 4A0RA 4TXLA 2VSQA 1YZTA 3LDEA 2I03A 3EG9A 1XWFA 5LYJF 1SK9A 2CUNA 2OYRA 1I3NA 1II0A 3G4SF 3NASA 3MTAA 3GA0A 1P1FA 5FTKA 4B3RB 1OILA 4K0RA 4HDQB 5AK6A 1W7AA 3C3WA 3V46A 1H0HA 1J7HA 5GPBA 2XB2A 3ZMVA 4YCCA 3TCXB 2AF3C 3FCYA 4YJDA 3I9MA 1JPVA 3S0WA 1KSFX 2ALEA 2BKAA 4F1KA 1UKBA 1PBTA 1Z6XA 5TGZA 2AJ8A 1FFTB 1SKUA 3DUFA 2OZPA 3KT8A 3T0GA 3BMOB 1OWNA 2D5IA 3K08A 1C4OA 4AS3A 3TLXA 3F4LA 3H01A 3MMNA 4MUXA 1EAYA 4A92A 1E77A 4K0KO 2JIZG 1PR0A 5JZSA 4JQCA 4F4JA 1FVHA 3VO8A 1RQXA 3SPIA 1V8BA 2Y0BA 3PUKA 4AJLA 1HYBA 1EHYA 1KO7A 2EFGA 2VP3A 4U8GA 4RM3A 2QX4A 4QOGA 1V41E 1KQSU 1QQ7A 2ADMA 3EFOA 4K9NA 5E7QA 4OI1A 4DFDA 4MV9A 1AM4D 4MVOA 5EERA 1O08A 1OH5A 3MXOA 1CX9B 1EBBA 2Z2ZA 4UCWA 4LXYA 3UH1A 2P7TC 4AILC 2OBLA 1THTA 3VZCA 2GOYA 1YT5A 1ITZA 2VDJA 4CNBA 1U3CA 4I9NA 3KB6A 3W6UA 2NVWA 3ZHXA 2BKEA 4GNRA 1FDUA 3BAAA 1UAGA 2JGFA 4WFGA 4REQB 1H9BA 5KEIA 3ON5A 1CP3A 2PHNA 1DLIA 3I2JA 1XIVA 4B0PA 4RVUA 4OK3A 3C48A 4I0XA 1JRLA 2MYTA 2QJTA 5IY5B 2O4UX 1L7AA 3DDWA 4R9VA 1A9OA 5BMVA 4MW7A 4ZHQB 1F2UB 2Z3WA 1KQFA 4P34A 2FXIA 4DUYB 2HDHA 2CLSA 1EX6A 1GKYA 3JXEA 1DKUA 3AFOA 4C89A 1VMDA 4X64O 1XXLA 1TCUA 4MQEA 1ZH8A 2HSGA 1FTNA 3D4BA 5M29A 1N6NA 2XNJA 1Q2UA 3BEHA 3GDHA 1Q82H 2XCIA 4LZWA 4HXFB 1CEXA 2Q5CA 5BYBA 5DYWA 4XD7A 2J0UA 1ZD3A 1B06A 4HAVA 3RHSA 4LYGA 1JDSA 3UAVA 1RZRA 1NKDA 4NTXA 3K06A 2XUDA 1GU1A 4KWEA 4ARAA 1D0IA 3EDRA 3WOVA 2HZBA 2HJGA 4J07A 1JDNA 4AMUA 2Z5UA 3AG1C 2IXDA 3QSGA 2X40A 5KA5A 4W5QA 3A9UA 5DHPA 1X59A 3NM5A 5EIWA 5KWVA 2UU9B 3CCEV 4YCAA 1UBOS 4RTRA 3FW1A 1NUHA 4J29A 2QZ9A 4YXWA 3FB4A 2PWYA 5KNCD 4KJZA 3IDFA 3Q15C 3TDNA 4MEBA 3IV9A 2GYWA 4ARUA 4QFCA 4RK0A 5CBFA 4YV7A 3TRDA 2GXUA 4L51A 4OPHA 3VC1A 3X1DA 2BTOA 3U3OA 4K5QA 4RHEA 2R66A 4G97A 1YCDA 1QRDA 1GV0A 4LYFA 2IEAA 3MMXA 4C78A 1VGRA 4XEUA 1T2VA 3T1YB 2R7NA 4CKWA 1Y6FA 1E7MA 2XB9A 3LVBA 2YZ2A 4EOGA 1EVQA 2IWRA 1SETA 4EG7A 4HNAA 1NSTA 3RB8A 1EFHA 2VDQB 3OPXA 1XB2A 2Q9LA 2WRZA 3CKKA 3PZRA 4UVBA 4JX9A 3NS7A 2HWWA 2VCYA 2CNWD 3WMEA 1WIWA 2XODA 4AZVA 1BA2A 2IEBA 1NQVA 3OC6A 2BFPA 5E9QA 1VQ6V 2QL6A 3RT3C 5LBTA 5IKMA 2QWQB 1L4UA 3BFVA 4JA2A 3HADA 3K0GA 1VZ3A 4RZSA 2XAJA 1HQKA 3GRCA 3IAS6 3HSSA 3PXAA 2NZXA 3DVRX 1YA6A 1NQ5A 3PCRB 4Y2JA 2DBRA 5T5QA 4QXAA 3C9UA 3J81A 4CR7A 2GETA 1LBSA 1JALA 3K71B 2HRDA 2Q3CA 2ON6A 3KYCB 2BZGA 2RBKA 1BNCA 5D01A 4DR3O 3VKVA 5J3JA 5FT9A 3T52A 4U5QA 1V8PA 3SQNA 2MTBA 3CCMF 4RQEA 1HDEA 5IT9A 2VAVA 3VVMA 3OCZA 4MRVA 1VM6A 4HYOA 3H2HA 3EZ6A 2FPOA 5EE1A 2QOEA 1HDRA 1B0PA 3H17A 4TLBA 1Y6GA 1AR4A 1NU8A 1U31A 2FW8A 2ZIXB 4WKCA 1GPBA 1R10A 3U60B 3CR7A 1M74A 3C8MA 4RF5A 1XZGA 1ABBA 2OTMA 1K89A 3DFZA 2QT9A 3V4OA 1L4NA 1L0LH 5HGXA 1ZL8A 3TINA 4R6XA 3LBAA 3KETA 2IF0A 3E2PA 5FF9A 1U8ZA 5IJXA 1D9XA 3Q72A 2DJ5A 2Q29A 3R0IA 2QAGB 2C4UA 3EGDA 5KYXB 1A2BA 1PBNA 1QBZA 1E8NA 1XPJA 3F47A 4D57A 2JDIA 2PNFA 2IOQA 2AK3A 1MD9A 1V16B 4OO3A 4TWBA 2L6LA 2TS1A 3P97A 3K9NA 3PEYA 1VG8A 4A7PA 1T2UA 4AAYA 4BKQA 1NP3A 5IVKA 4LBYA 3SPJA 1ND6A 3U3XA 2LPMA 3KEOA 3W05A 1RAAA 3NM6B 1ZEMA 3CPWU 1MKYA 4Q3AA 2CZCA 3WNZA 1PPJH 2PJUA 5D1NA 1ZBDA 1YB6A 5BNTA 3QFSA 2UVPA 1QVFU 1HRDA 1LI7A 3UJHA 1GUBA 1IY0A 2YQ4A 1IHYA 3W7TA 1GTSA 4PINA 4WZ6A 1IVSA 2VPXA 4I9GA 1AGXA 2QUZA 3DZ8A 2I71A 2AJDA 1EP9A 1WE2A 4ZWNA 2IW3A 2BGNA 1XMXA 3EJ6A 4EMSA 4WXPA 2ZB4A 2W93A 3P5BA 5FWYB 5FORA 2XDAA 4R1LA 3VA7A 2FN3A 5ALMA 3CCVF 2ZZMA 3DKPA 2P2YA 1TRKA 3EVNA 2BH9A 3MUEA 5L3VA 2WLLA 3CSXA 3LXXA 5FBZA 1AP6A 3UJ7A 2IZZA 3AV3A 4MSUA 4EQ6A 3TKYA 5EJ8A 3BDVA 4DSOA 5C46F 1XZDA 4NBTA 4H31A 1NWHA 5EESA 3ZBHA 3NWEA 2XA9A 3ZQKA 1EDOA 2BTEA 1TC2A 2RGYA 4IKOA 4KQFA 4J91A 4GW3A 3UT5B 2KMLA 1B1CA 2XMSA 4O02B 4MCJA 1UXOA 2WLIA 1FFSA 3LMEA 3VR0A 4JMPA 2W6NA 3FMPB 1G41A 2V97A 1AZTA 2GAJA 4RDCA 3VSCA 3WGHA 5AESA 3WL7A 5AW2A 2JW5A 4XI9A 3PQFA 5J9FA 1AI4A 3IP5A 3PU6A 2ONZA 4IUDS 4UVAA 3FGOA 3EEBA 2H4ZA 2EKQA 2FN4A 2FW6A 3JSNA 1YD7A 2QNIA 1NW6A 2W43A 1Z9BA 2W7TA 3KVOA 1HX7A 4CIWA 4P22A 2XAHA 3HYSA 3LYUA 4WGGA 4H35A 1QYIA 4FFMA 3OONA 4JI5B 1RC0A 4R81A 2BFBB 1AR5A 3LZCA 5JALA 4QUHA 2BBSA 1CJBA 2G83A 1FPQA 2VXOA 5E1OA 1KAHA 3E89A 4Q00A 1IH8A 5TIIA 3LIPA 5TT1A 1BFKA 4TROA 3TDKA 3HGMA 1UC5B 1E1DA 3SQOA 2XUQA 3JQDA 5KC8A 3JAMM 4HADA 1P0QA 2CDNA 4G1CA 4Q9LA 4GDFA 1SKYE 3ET5A 1ZONA 3DWEX 3OCVA 3I4FA 3OIFA 1N0VC 3H7IA 3QIAA 1JBKA 1S0VA 4DAEA 1I9GA 3WL5A 4Q15A 1EGQA 1VLLA 1WMFA 2HPAA 2AFIA 3HPQA 4MRMA 3Q40A 3NONA 1WCWA 2GB4A 5T6BA 2NU8A 3TYXA 5L3DA 3LH5A 2K6GA 1XZEA 5LMUB 1XZQA 3TEMA 3MHHC 4XFDA 2Z01A 5EZYA 3TTVA 1JJIA 2OORC 3A6LA 1DQSA 2PUBA 3KM0A 1C7QA 1YF2A 1M8KA 3OWXA 2WC1A 2QRVA 1F23A 5FNZA 2Q6LA 4RSHA 3D31A 4J7ZA 1RRMA 2GKGA 4YBZA 4IICA 1HNXO 2A1UA 4QQRA 3ZY2A 5HUQA 2A7XA 2VRNA 4BRWA 3TLCA 4LC9A 4G1UC 3NEJA 1LR1A 3QXSA 2W4IA 4LTMA 4DEXA 2FPPA 3IUYA 3FBWA 3V8RA 3DHNA 4EF6A 4I5IA 3ZIUA 3V8VA 2UVQA 4G5RA 3PJGA 4Q9AA 1Z17A 3GIWA 4R0NA 4OGFA 4P4SB 1SKVA 3T9BA 2H0QA 5AW1A 2Y3IA 3ZD6A 3O85A 4CQJA 2ZI9A 1ZOOA 4RTNA 3CPHA 1S72V 3FA2A 2OTCA 1UFVA 2OZEA 4JBLA 1H2AS 3L2OB 2R00C 1SQGA 3CD6V 4P30A 2RI6A 3V8BA 4E4TA 4XLTA 2PSDA 2IZOA 4UEOA 5FCDA 3K79A 4L7QA 2Z1DA 3K09C 4EFMA 1U90A 4COOA 5CJPA 3M7MX 5JI2E 3OW2F 3GJXC 1DK1A 3MW8A 4Y67A 4RDIA 3V3KA 1UH5A 4NY1A 1L5YA 1RLMA 1SG9A 2F1RA 5F1KA 3AHJA 5BRAA 3S06A 4U63A 3N7TA 4P3NA 4ZCRA 3LMKA 4ZAWA 2X1MA 4C0WA 4O4LA 4IDOA 3PHJA 1FNSA 3EHEA 5EJ5A 1ZXBA 3SOZA 3V1YA 2NVBA 4RABA 4U2DA 1R0LA 5CVTA 2XGOA 4R84A 5B57C 1W0KD 4W63A 2FEWB 5CA3A 4B6GA 3FOZA 3MT0A 4CKEB 4WJLA 5K8UA 3I30X 2AFHE 1IEWA 2YZGA 2WFLA 4LI0A 3ESXA 2JHPA 2SICE 4PN3A 4RFSA 2VDWB 3GLFE 2BEVB 1E3MA 4FFSA 4J2TA 4EJ2A 4RVOA 3ZJVA 1M2KA 4QRDA 2OM2A 4RMGA 3V1UA 4Y6LA 1LVGA 4EB8A 1P7GA 2YYSA 4AL4A 4KREA 4WN9A 2B78A 2ADFA 1L4YA 3WWPA 1I7DA 1PR1A 3B9PA 1I32A 1OWMA 2CGNA 3EWAA 3SBEA 1IBRA 3BDIA 4YAIA 1NUQA 1ECGA 1QVGU 2PGGA 4WNAA 3GF4A 3CVWA 1USKA 3O3NB 3E84A 1SXJA 1OV4A 2B4AA 3E15A 4XD7D 4YJ3A 1WMBA 1FUKA 2ZAYA 3RBVA 1IBLB 3RIXA 1XVIA 4WADA 1W0JD 1BXRA 2RGEA 4PGHA 5DNVA 4YP1A 3BQMB 1KA9H 3A4LA 2JHCA 2XBUA 4KSYA 1NVPB 2DY1A 3FJYA 2ASEA 3U11A 3TMKA 4IRMA 4EF5A 1ZK0A 4M4SA 3VHXA 4AZ3B 1EN5A 4PFJA 3SHFA 3VI4B 2YEVB 2O4CA 5BR1A 3I9NA 4WCEV 3VO9A 3TQOA 3L8CA 5EIFA 4QYSA 3KUXA 1VMAA 4YXWD 1JJ7A 2G6BA 5GVSA 2HVJC 1MB9A 2C61A 3A04A 2VJDA 2VFAA 1MZFA 3U4QA 4XYGA 2PK3A 2EBFX 1KH3A 2GZ1A 5FNVA 5EG5A 2G40A 2UYHA 2AV6A 1P49A 3KT0A 1TC1A 4IO1A 2J30A 1R4ZA 3ZMZA 1VQ7V 2O2ZA 3H9CA 2DCUA 1O5IA 2NYVA 2EFDB 2WHYA 5IKOA 2AHOA 3ZI4A 3TDMA 1JDTA 5KTMA 1GRCA 5JD6A 2I8CA 1N8KA 3O1JC 3H1GA 4X44A 1GA4A 3H2ZA 1HG1A 3D6HA 5AI4A 2W2XA 3I3FA 3LWPC 4XWTA 3H4MA 1FRNA 1MIOA 3BE5A 4YMGA 3TRKA 3F5DA 1MJ5A 3GC6A 3A70A 3N1UA 1U2SA 2AMVA 4KE7A 4KN9S 1MT3A 2PO7A 3HYCA 1QCEA 4NU6A 1AI6A 3CW8X 2PH1A 4M1TA 3HBMA 4DUGA 1KJNA 1CB7A 1GFZA 1Q7YH 3BFJA 1H0SA 1ZTEA 1XFAA 3UMCA 2F2TA 3ZD8A 5DHAA 1OBVA 3EG9B 3U4CA 4BQOA 3O3CA 2FLWA 2GRJA 5K8IA 2ODBA 3FOEC 1OX4A 4XPZA 1K6EA 2EZPA 3EQ9A 4V0RA 4FDAA 2ZAIA 4B6SA 4MKIA 1QAQA 2HUNA 1NPDA 3W78A 1GM5A 4PLPA 3TM4A 1WLSA 1EBFA 3O4GA 1N2CE 3CM0A 4L4SA 3X3HA 1NXPA 2C1ZA 3AI7A 1FFYA 4P3YA 3F0GA 3G2MA 3EGCA 5B5EZ 3C90A 1UT5A 2ZLBA 1A77A 3ZCSA 1Q91A 1OFUA 3QXHA 4D5GA 4YAOA 3IUQA 3DUFB 1NULA 4GVLA 2AEEA 1CE8A 4ZOAA 5F2VO 1N0JA 3SICE 1Z4PX 4OBEA 2YL2A 4ZREA 2P4EA 3WMWA 2J6BA 4B4VA 1STOA 4R2LA 1P17A 1A7JA 3PC8C 2O05A 1SD1A 3W0LB 1OQAA 3UMBA 2J4CA 2OCKA 5FPPA 2OHXA 2C8LA 4DWWA 3EFOB 4TZZA 3S0HA 3JY6A 5EK0A 5K6TA 2WV7A 1SPXA 3G82C 3T1OA 5D2CA 1XEWX 1AS2A 4RTQA 4LY9A 5EXPA 3VGJA 4OJTA 1CS0A 2QTNA 3R24A 1QTRA 3DQZA 3RUPA 3QU2A 3UKMA 4DL9A 2GV9A 3HM9A 1XV5A 3HUEA 2IQIA 1DIAA 4L28A 4M99A 3ASUA 2JDID 3MCVA 3GP5A 4BNMA 5E2AA 4FHZA 4CQMA 1L4KA 5BMVB 4XPIA 3JQBA 4YRFA 5JPDA 1QUFA 3W9SA 2HIHA 1U8CB 2X3YA 3CGWA 3BCRA 3P8ZA 3B3QA 2J6IA 1DVRA 3QA9A 3P2IA 2ZW9A 2PZGA 3P19A 3ZD9A 2VJMB 4L73A 2E74B 3ZOZA 4L8YA 3NOVA 2W2MA 2UYCA 4TMTA 3MWJA 1QQ5A 2YV1A 4MUEA 4MW3A 2IJGX 3P5SA 3E18A 4O6VA 4A16A 3SE0A 4KK4A 1ZK4A 1P91A 4MITA 4E12A 3Q9SA 3RS2A 1GR0A 2OD9A 1T3HA 1C0KA 3E82A 2REOA 5SZHB 1JJOA 3NC4A 5DYYA 5KBYA 4OG2A 1KRXA 1RAIA 2GVNA 3O8LA 4MO2A 3SXPA 3M9LA 5CR9A 3KE8A 2HMUA 5J4YA 1JY8A 3ABRB 1SMKA 5DHQA 4DR7B 4HWTA 1FNDA 5SICE 3K6JA 3BGVA 3AY6A 5HZHA 3B53X 3JWHA 2LV8A 1A7AA 1OGIA 3KB8A 1CUAA 4AMYA 3R8CA 5FLYA 3SS7X 4W9NA 3BICA 4ES6A 3CKYA 1TIPA 3M6FA 1CHNA 1QXSA 4WBNF 5LBQA 4MR7A 1TM7E 2BGRA 5IK2A 2ZDIC 2N48A 1XAIA 2WVJA 4DB2A 1R9NA 3VYWA 1M8JA 4CM4B 3JVIA 1ZN9A 2PD6A 1VPWA 3AZOA 2D1SA 4JZ2A 1KO4A 3PEUA 3GNLA 1TT5A 13PKA 3AUTA 2WZBA 5K8LA 2A4MA 2EW2A 3B8EA 5M3BA 1RI5A 3B7WA 3BWEA 1ETHA 1DPGA 1ZQ1A 4EB0A 2VHXA 5HRCA 2H11A 1XN4A 3S2FA 4ZVKA 4RIEA 3Q9LA 1A4XA 4O29A 5B6PA 4DJFC 4FQ8A 1YBMA 1M7GA 4CKWB 5HTKA 3EZXA 1T0HB 1VJTA 1S2MA 1Z5VA 1R7RA 3WVNA 3AR4A 2I1LA 5LQUA 5HNKA 5DGDA 1I4DD 4M8IA 2HCJB 4HNAB 3RUIA 3U0BA 2ZE5A 3VVLA 1H47A 3U7GA 2M6KA 3E22B 1O03A 1EBOA 3CU5A 1ZVVA 4D6PA 1ACJA 5JT1A 4I3HA 1A7KA 2L17A 4AN4A 3O9OA 1G5FA 1IXZA 3ASYA 1WDLA 3H1HH 1XSEA 3AGQA 3ZTTA 5A3QA 4D8WA 3OCWA 4PPFA 1CUFA 2XTMA 1DKOA 2GJSA 5K0ZA 4MKHA 3UJBA 4F1WA 4U6NA 5JI3E 2L26A 1WX1A 2W2KA 4FGSA 4TTRA 3EFBA 2IY7A 4YP9A 1F4NA 4JY7A 1E64A 4MX8A 1NLUA 1IV4A 3QYFA 1Z4QA 4J94A 1LZLA 2C0QA 4C3ZA 3C3SA 4MTCA 2ZE7A 4DR6B 4KR3A 4G26A 4QAJA 1I80A 3CC7V 1G38A 1BE0A 4B81A 1MZVA 1KECA 2O57A 2Q4DA 3H1LH 5C5EA 1OIXA 1N25A 2EG9A 3DCIA 5A9SA 5DHSA 3FAZA 1RPNA 3HXMA 1OR8A 4MZXA 1FQOA 4EYQA 2E1PA 3KAJA 2CYCA 2FGKA 3HFSA 5MGNA 5CVJA 1U8TA 3OZEA 2JI8A 2C4VA 1AXGA 5L4LA 1ZL8B 2XTJA 3G89A 4B35A 3UK7A 1YBHA 4CV1A 1TECE 1HFKA 2X0DA 4IOJA 2MJLA 4JNKA 3JQ8B 2YVAA 3VHLB 2G36A 1XQWA 2BCGY 4EPTA 4H77A 1P44A 4H44B 2GKOA 2VHCA 3NIGB 4HL6A 1Z39A 2PKEA 1ZCFA 2FW1A 1EFPA 3RF6A 3GEDA 3IPAA 2XMPA 4FX2A 5BW5A 4Z3DA 2V9CA 4LDQA 3K0BA 4JB2A 3HKDA 3ML1A 3NGLA 1RZVA 2FFAA 3L6DA 3HPLC 2UZAA 3LCJA 2NO1A 3FPJA 1CIJA 3UGKA 5L6MB 2UVPB 1OCOC 5CDFE 3EVDA 3IVGA 4P83A 2ZR0A 3NHBA 3TUJC 1PGJA 2V4UA 2OIEA 3PHIA 4L78A 5K8CA 3VR4A 5KNBH 4E94A 3LU1A 3PG5A 1VQMV 2C77A 2ZBUA 4XUGB 2G5PA 1VYHA 3ZU2A 3RO7A 4R2JA 4X91A 4XGKA 4PXAA 1H2KA 2JH9A 3ZN1A 3GGJA 1Q8RA 1SB8A 2FSSA 2RGAA 3TRJA 3IHTA 1VHLA 3K1AB 4C0QC 3DFKA 2G4CA 2N1BA 5FHRA 2D1TA 3QMWA 3DZGA 3JVDA 4GKVA 4BMXA 1WJGA 4Z2YA 2XGMA 2BMVA 3WSWA 2A0FA 2XKJE 4ZFNA 4L0CA 3GYQA 4F21A 1RRPA 3QFRA 2WLLB 1Z73A 3TOZA 1XVTA 1M2GA 4A2CA 2E5LB 5E95A 4U3JA 4BMVA 5JO9A 1ECPA 3B48A 5COQA 4OGGA 4WXMA 4F11A 3T7SA 4G6ZA 1I6WA 3JVEA 4P7BA 3AOEA 2JGNA 2PH3A 1G5TA 1ZSNA 3E81A 4ME6A 4OM7A 4MJ7A 3D2LA 3NIWA 4GM4A 4QYXA 3WS7A 4EKYA 1QGYA 1C0IA 2J4DA 1T9GR 4TM7A 1SU4A 1E2UA 1SUFA 2NV2B 3ZI7A 5EHNA 1W36B 3DOFA 4LMRA 1FS5A 1W5EA 1VQ8V 3N75A 5J5VA 4WMLA 2EP7A 4KV7A 1PFKA 3RRFA 4RUFA 1PJRA 5HPYB 3THRA 3AI3A 1Y1TA 3PNSA 1GFSA 2HCFA 2FLVA 4D8VA 3HP4A 1AUOA 3HB7A 4J10A 5IXYA 2NOAA 2RHLA 3H5NA 1A8UA 3KTOA 4RKFA 1GRNA 3ZHUA 5JYDA 3WL6A 3ZDXB 1QONA 4CH3A 2DUUA 1GQ2A 3N2NA 1PUIA 4ZHQF 3C7CB 1X7DA 2P8JA 4FYWA 4JXZA 1K5SA 4Z7QB 1OV9A 2K7FA 1XCBA 4HV4A 1W46A 3W2EA 4MLPA 2UUBO 2M6YA 2YMMA 1GN3A 1UBFA 3IP6A 4KACA 3MS4A 1NVVQ 3T4UA 1Y33E 4V1CI 1GL9B 1YI8A 1G7RA 1LD3A 4UNQA 3C6KA 1KFJB 4PPQA 3FJ1A 2WDPA 1ML4A 4Y2XA 4GBGA 4KTVE 1X19A 4RYLA 2NO6A 1A9XA 2BSXA 3A25A 4QUDA 5EZSA 3U61B 1K75A 2E87A 4PG5A 3TLGA 2DPLA 3WMGA 2CNWA 5AM4A 2N0SA 1X39A 1YDHA 3KKPA 3QY0A 3F9CA 2K9PA 1LPNA 2PUGA 4AWXA 2RN9A 1U80A 4MIEA 3FCUB 2W6JA 1D07A 2AFIB 3RGWS 1JKFA 2ZRCA 2H00A 4KL8S 1V37A 1QV9A 4DUGD 2XUMA 3ZJTA 4M9SA 4LCUC 2E4XA 1NBEA 1T2AA 4QE7A 1SAYA 5EZYB 4HZUA 3QY9A 3DC2A 3AEQA 2YXZA 4U7PB 1C5KA 5LGUA 2ZWIA 4BNNA 1IZ0A 4DLUA 4HPXB 3STLC 4XDKA 1NY5A 1RI4A 1W6UA 2B2XA 2FF5A 3HVHA 3GMTA 1D1SA 3HHPA 3TAUA 4U0JA 3IQGX 2ZJFA 4IIJA 4DLAA 1J0AA 4NZNA 5GM2A 1ZBQA 5F5LA 2CNBA 4HPWA 1XXHE 3AR5A 4YMLA 3RAFC 2XQIA 4BIOA 5FTNA 3L1UA 5IM4A 1P5HA 3SBDA 2O5RA 1N9ZA 1KDOA 3FCCA 4NZPA 3EDQA 1XK7A 4EA8A 5EMMA 3S2SA 1YE8A 1K9MW 3BPZA 1QWOA 4QO8A 1VPDA 2EKDA 1XEXA 4D5EA 3CN7A 2I2WA 1Z88A 1MC5A 4UOEA 1ZCJA 2GHTA 4MVSA 4Z3OA 3L6EA 4IM7A 1BEEA 4JQYA 4LV5B 2CNDA 1FVXA 4FXPA 1Y5MA 4F6CA 2DERA 1K5HA 3FMIA 2ZR8A 4EJFA 4OQXA 2WJYA 4R41A 2ETNA 3PYMA 1Q3EA 3OX3A 1G3MA 4MRSA 1PUJA 3A9WA 1HTTA 3LXUX 2I7TA 2GEBA 1DNPA 4E88A 2OMEA 1CY6A 2WYHA 3THWA 4JA0A 3G8AA 5K9ZA 1NYTA 2EDCA 3F78A 4GXTA 1VLJA 3DE5X 2AEFA 5BV1A 2WFLB 1NOJA 4Z4IA 4JJ8A 4UBLA 5AM1A 4CQMD 3FHJA 4RFSB 3REFA 4Z4QA 1T2CA 1W87A 5DCVA 4YP5A 3BXEA 3HBAA 4GD3Q 5KSYA 1EI9A 5GONA 2RKWA 4QZVA 2DHQA 4WN9B 1M34A 3ETHA 4UCOA 2AYZA 1TZJA 4DLZA 1MN6A 4WNAB 5TF4A 4RZIA 3W8EA 1I7NA 2C7BA 4AG5A 1BAPA 1E3EA 4QBTA 4IGAA 2ZE8A 5H9VA 3P2OA 3JQRA 1SXJB 1E0AA 5HK9A 3K31A 3L7OA 1P1IA 4FXOA 3Q10A 4F2WA 4GEKA 4YJ3B 3SK0A 3KJZA 1JG4A 3FD8A 2PPLA 3USZA 3H5VA 4DS3A 3FSEA 3WGTA 3Q3VA 1UPGA 1M5IA 4EMTA 4CBCA 3WKBA 1FNNA 1AI7A 3P27A 1P33A 3UFBA 1RZUA 4K3UA 2O54A 3VHXB 2ZJ7A 4ZCIA 1P7WA 2FGYA 3AF4A 2Y92A 3KUUA 1X80B 4PYIA 3LBHA 4ZTUB 3RVLA 4OSPA 3SIRA 1N5OX 1NIPA 4WOCA 3WKEA 1FVFA 4ML3A 1G8MA 1EA7A 1XAJA 2POCA 1E2FA 5IK2D 5DLEA 3IL2A 3VOTA 1YQTA 2JBAA 4NJEA 1J0DA 4Y0AA 3RSQA 5DP1A 2NZUG 3TJMA 1P9LA 3L06A 3G71F 1MPXA 1RXUA 2NU7A 2PRSA 1Z8DA 4GG1A 1C9DB 1FS6A 5KVSA 3CZ9A 4LF6O 2I6XA 1V11B 1TRHA 4QU9A 4E2LA 1QP0A 4Q3EA 2VI5A 2R86A 2P06A 1W9HA 3BN3A 1DO8A 5CA1A 1JLKA 3HEAA 3IEXA 2FEXA 4DV5O 3TAHA 1QR9A 1C8VB 3VZSA 5HKOA 1QR6A 4X8HA 2X86A 1SS3A 4IIVA 2EARA 2WAYA 5KO2A 3B36A 3H8JA 2HNBA 1REQA 4MA4A 5LFAA 1M2VA 4WXYB 2JFZA 4CCWA 2ZYGA 3MT7A 3VTIC 4E3ZA 4B84A 3WLPA 2OA0A 3CMAV 4DJDC 4JF3A 3B52X 2Z1NA 4Q5IA 1R3LC 4YECA 2BGTA 4ZAFA 1VIMA 1CE8B 3QKIA 1UK9A 1P7CA 2J6CA 2OSBA 5C9ZA 3DFFA 4FDTA 3F5MA 1QO7A 3FTPA 2HP0A 4PG8A 2F1MA 4C8EA 1PT5A 2B4YA 2XW6A 1CJMA 2OOKA 3GLSA 2AXNA 1N2OA 4M2LA 4D4JA 4LW8A 3D3KA 4FYHA 3CNEA 1MA1A 3DLAA 2HTFA 3C3XA 1W2GA 3O73A 3GD5A 2OCLA 3QOWA 4W4TA 2F8TA 4Q16A 3C9TA 3GLGA 3PC6A 1S2DA 1EJBA 4H3SA 2GHQA 2CVFA 1Q22A 3HAXD 2O3JA 2WF8A 2FOIA 4EG5A 2QE7G 3V1KA 3RKSA 3NHZA 4RPKA 2OUIA 1U3GA 1CS0B 4MGKR 2AOWA 2VWGA 3A27A 3CO5A 4BWGA 2VNAA 5ULLA 1D4OA 1KS2A 2O3RA 4KODA 3EPPA 3K1TA 5KYKA 2ZQYA 1SM4A 1NQWA 3UBTA 1RHUA 3TQHA 3GQBA 3K2XA 4NV3A 4AJJA 1WZCA 2ORVA 3WGJA 4NYKA 4QJFB 1E2HA 4UAGA 3FCAA 3L7IA 2P6MA 3L6CA 4AECA 1KB9F 5BNZA 5K6RA 3THYA 2O1WA 2OKCA 3OBWA 3GJZA 3P0JA 3A06A 3VPXA 1OZHA 3RSCA 5HKKA 1YR2A 2OGUA 5T7BA 1ZM9A 1EM8A 3PGJA 1EXDA 2PJRA 2DYKA 3MJ4A 4TLLB 4MPRA 1OF1A 2QXTA 1J9ZA 4HYEA 2XCUA 4D9MA 3TD9A 2PYIA 3C5VA 1T4BA 1W0KA 2VT6A 4HB0A 4X00A 4O2LA 2AVDA 4LPKA 1YA4A 1C9EA 1LNQA 2VJPA 2CHSA 4L9AA 3WG9A 2P9FA 3VO1A 3VR4D 1KPIA 1EJ2A 3AI1A 3L3BA 3UJCA 3VV2A 2XUOA 5H6RA 4M38A 5DN9A 2ROQA 1QB8A 3KPJA 4TYMA 5K2OA 1S3GA 4OU4A 4A4DA 4TLDA 3FRIA 4JXJA 1U0EA 2YV4A 1IPHA 4WH0A 3WQRA 3NHPA 1DWOA 5EYPA 1D2MA 4E6EA 2AC2A 4OK5A 4KFSA 2RGGA 4V0SA 1JMYA 5KAFZ 2WINI 2MSEB 1NW7A 2YWFA 2VJYA 2QAGC 2Z04A 2GEDA 1FSSA 1KAOA 5FUYA 3T7KA 1OBHA 3PFBA 3MFQA 2DETA 2YMQA 4MJ3A 5JJBA 3K1ZA 3K59A 2ZT8A 3U3RA 5AXDA 4MR7B 2CDYA 4CBVA 2ONJA 2C9DA 1I2BA 4DW1A 2O7VA 1FDIA 4QOFA 1W0JA 5JMPA 1K7SN 3G9UA 3LHKA 4G25A 1FBNA 4EH1A 1DX6A 3OOEA 3F7NA 4GECA 4H7FA 1GAWA 2YQZA 4EI9A 3A3NA 4LWSA 5K7SA 5A7HA 1UKYA 2VF4X 4HB2A 2C5BA 3PT9A 1T9HA 3RYTC 3UBMA 2X0NA 2B94A 4K6MA 3W5IA 5A2QA 5AVRA 4K9SA 3JYOA 1OU4A 2FKNA 5LZ8A 1TUEA 4QHTA 4JI6B 3JU3A 3GCGA 5AOAA 5EWMA 2NUAB 2YS8A 1DIHA 1USUA 4HFRA 4NQRA 3EVZA 3K53A 2DLDA 4WCFA 4DLNA 1CUEA 2BE7A 2ASVA 4PG6A 1US8B 1W75A 3A6JA 2JIDA 4UBJA 1B8OA 3L77A 4FEGA 8LDHA 3ZW9A 2CJYA 1XAHA 4EW6A 2QB5A 3PRYA 3LCVB 1XCLA 1XZFA 2W2KB 3KKOA 3PFNA 4R8CA 1GTMA 1PJBA 1OXBB 4DEYA 3GU3A 3JCZA 5CU7A 2QDOA 5G4KA 3SOPA 1XRRA 3DMHA 3NQ41 2PRYA 4FHGA 2DFVA 2W2OA 1VG9B 4L16A 4PZDA 4BLVA 1QNMA 1P4SA 4A9AA 3L75H 3E9DA 2FR8A 1EYZA 2V1UA 4Q47A 1DG1G 1E2PA 4MS4A 4EGSA 1Y37A 4HPJB 2J5KA 1XT6A 4I99A 2W6JD 2DFNA 2XT6A 2Z0AA 1L2TA 2Q21A 1U4SA 1L1QA 5F7ZA 1HYEA 3GJ5A 4Y3UA 1R16A 4GMFA 5J43A 1JH9A 2VXYA 1E0JA 3I2YX 4O5OA 1EH5A 5A1TA 3F49S 1CK2A 1KZYC 5EA2A 4C1NA 4G28B 1GUFA 2CW5A 4TVSA 2LWIA 1YU9A 3DOJA 3OGIB 4FLZA 1X1EA 4FQ5A 1XILA 1EINA 2EKLA 2EWWA 1A9TA 4DXAA 3BB3A 4ZEXA 2J3MA 1X2BA 3WLRA 3EY4A 4OHYA 2REQA 3IR7A 3HVUA 2DUWA 3ER8A 3LT5A 2PY6A 4H7JA 4G9BA 5K3CA 4ZGBA 1TFRA 3PPVA 5IMBA 1XO1A 3HEMA 4FM9A 4V0QA 1WB5A 1AY0A 3CW9A 4WK2B 2ZTUA 1WTAA 1DDGA 2QAIA 1NW5A 4TQDA 1S89A 1DUVG 4JGBA 2B3TA 4HFMA 4M1SA 2CVZA 2FSHA 3VR3D 3UK0A 3LOQA 2FP4A 2P69A 3I3SR 3K0AA 2ZUSA 4BU0A 1OE0A 3UUFA 4JQOA 5LIPA 3HKDB 1C3XA 2HFJA 3MMPA 1GNTA 4DLSA 3VPSA 1NLZA 4P35A 1VQPV 1JE0A 3CYFA 1JDPA 2OTLF 9LDBA 2HU8A 1MC8A 2YVKA 5BXZA 3WFJA 5HY2A 3R0XA 3SC3A 1EK5A 5EMJA 5COBA 1R9JA 4HLCA 5DNDA 3DSQA 2MMGA 3DV2A 3HJRA 3OU7A 5F78A 1GAJA 1IEXA 2P2NA 3MBIA 8GPBA 4MW4A 5EMNA 1PI3A 3R0VA 4LRSB 5D5HA 2ZROA 1KBQA 5DYTA 2VNHA 4FFLA 3BZWA 3W8NA 3SJAC 3V6LA 4EHBA 4JUDX 4MH0R 3WGGA 4Q4AA 3ZRXA 3G6KA 3LPMA 5EJ2A 1N33O 5I7VA 3EOZA 4M3NA 3RT7A 4U3JB 1H4SA 1TQ8A 2BM1A 4EG0A 1E1QA 3MS2A 3DBLB 2GF9A 4PTLA 3G8BA 3LC0A 4KQJA 3CB4A 2OVBA 3FPKA 1VCMA 3RRJA 8ATCA 4CM6A 2I66A 4K03A 2FPWA 4RE6A 3QX9A 3UB3A 3R41A 3A05A 4K1LA 4B6FA 2KKWA 3KDSE 1R6AA 1E9EA 2W5UA 5C18A 4JLDA 1KMHA 1F4VA 5MN4A 3GRAA 1KHHA 1R64A 3FWZA 3SYRA 3GZNA 5DT9A 4XYLA 2FG5A 3G2NA 2FQQA 2JKVA 1GPJA 3REQA 2QMYA 4YASA 4F5EA 5DI9A 1MO4A 3R9WA 3F3YA 4WFAV 5BY1A 1CZKA 4M49A 2CXPA 3MHTA 4XX1A 2HXYA 3IODA 5BWCA 5BMVF 5MDHA 1J8DA 5A0TA 1HMPA 3JQ9C 3KTDA 5E0OA 3G9QA 4AKSA 1JXAA 4IJVA 3WLSA 4R9RA 3UKOA 3A1FA 1YQQA 2XMGA 2CHGA 4NBVA 1QR2A 1T24A 4BIUA 1VQ9F 1A8SA 3DZIA 3V4LA 1G9SA 5LDHA 2Y1OA 4YFVA 1L7PA 3T5TA 1K9VF 4Y2RA 3PUIA 1T35A 2JGDA 4B44A 3EEIA 1L3CA 1SQXH 1UMBB 1XA4A 4KDRA 3L4EA 1A9XB 2FG7C 1ZRHA 3HPRA 2CGEA 3M1YA 2NP7A 4IQ4A 4H15A 3RUFA 2HX1A 4DSAA 4U1RA 2I3GA 1M75A 2F9ZC 1GG5A 1NYLA 4RZHA 1YJ5A 3WLNA 3VJKA 3UPTA 1L5KA 3W8FA 4RAOA 5ITSA 3STXA 3DGEA 1YJCA 3COJA 1AJEA 4HGPA 3T99A 2X6TA 4UTPA 3SC6A 1K3FA 4BFXA 3G49A 1ZGAA 4N3NA 3T3DA 1KY3A 1GTJ1 4KC0A 1TJ3A 1YRHA 3NHMA 3IGFA 1UPXA 1YI1A 5C5IA 3K5IA 4AQ7A 4J7KA 2PGIA 3IT0A 5TT0A 1FNJA 1QPZA 5DW3A 2PX3A 1S7GA 4RQTA 4BO1A 4AXXA 1ULUA 3AHGA 3TW4A 3SC2B 3O21A 1XU4A 3V8QA 4A10A 4MRAA 4B5KA 3LI2A 5TISZ 4IIJB 4OLBA 3FG9A 1DP4A 1VMGA 1K3TA 4I5DA 4MJLA 4U9HS 1KI3A 3MGKA 4ETIA 4TVOA 3H9UA 1JQEA 2ODQA 3NO4A 3R2JA 2WWYA 5G53C 1P9RA 4CTOA 4PHZA 1JI3A 1PFYA 2OZLB 5AK3A 1KRWA 2FQWA 2VDNB 3G68A 3OT5A 2WF5A 2Z6QA 2A0UA 3Q8XB 1JDJA 3NVMB 2ZVDA 4QUKA 1UBJS 2UXDB 3N5CA 4FT4A 4TT8A 5ENDA 4ZCLA 1CN7A 1X7ZA 4YQEA 2XE7A 1LQ2A 1ODSA 1ZY2A 5ALFA 3BKWA 3JSXA 4BZPA 4AJIA 5EIOA 5KSPA 3B1VA 1KO5A 2HF8A 4XSVA 2GLTA 1AKEA 1NJGA 1Q3KA 1XU7A 5LLTA 9ATCA 1MEJA 4BQEA 4RXTA 2ZSKA 3WL8A 4J0IA 4GMGA 1ZNQO 3KIPA 3EXIA 2VWKA 4HS9A 1OAKA 3SPHA 3AL0C 2NXJA 1KU6A 4FFOA 3X1JA 2H8EA 3QX7A 2GN8A 4W5HA 4HZIA 2OUKA 1SZJG 4MWBA 4ZVQA 2PLRA 5H4GA 5LA6A 2PXHA 1YRQA 5HZKA 4UB6Z 1E3TA 1XZAA 3FZGA 4IUBS 4MW9A 4F04A 3T1HO 2QDKA 1RLUA 3W1EA 4X88A 3LXMA 2H1WA 1TA9A 4OXIA 4ZDIA 4GR5A 1KD1H 1TIKA 1VCHA 2HBZA 3FSJX 3HUTA 3Q7RA 3OURA 2XI4A 1TFUA 3L7QA 3W06A 4DJEC 3KKEA 4RGVA 4EG6A 5HKKD 1M34B 1E3SA 2J87A 4XVHA 1XZBA 3WLMA 4UUAA 3AB3A 2I4TA 5HF8A 3GLIA 1YL7A 2JGKA 1Q12A 3KDPA 4V0MA 3JWPA 3PXXA 3E3AA 3T5GA 3T4DA 1W8DA 1CQJA 1OASA 3NV9A 1GGVA 1U5CA 2Y0IA 5BOSB 4BAGA 2JBWA 4CCYA 4F86A 4TMZA 3RT1A 3FFAA 3N28A 4BV3A 3SF8A 1S1CA 4FW9A 1GXSA 3HU2A 4JV5O 2YYAA 3AGPA 5EGSA 2ID8A 4UU7A 1JQDA 2O8DA 4B7KA 3C39A 2Q2VA 4RHTA 2F3QA 1Z29A 1C9KA 3FFQA 1SVNA 3SLRA 3NTQA 4OQFA 3I5XA 5A4FS 3CSSA 4MNTA 4NABA 2BGIA 3VISA 8ABPA 1EIZA 2L0XA 4WY2A 3BZBA 4OA8A 4D4IA 4FS8A 4LDJA 1NVWQ 1L3BA 3AMVA 2B0CA 2AQKA 4A5SA 1QHTA 5L3BA 2O3QA 5IE9A 2VUTA 1J25A 2JBAB 4BIMA 4NJEB 4GU5A 4O3MA 4IIGA 5AR1A 1E9CA 3T06B 5BWOA 5REQA 2NNUA 4MVJH 3OESA 1W96A 3RVKA 2WSBA 2NU7B 4B80A 2PGAA 3FMVA 3AZQA 3KZCA 1IUNA 4IIUA 1GN4A 5G02A 4XWYA 1G8HA 1QO9A 2F43A 2R3SA 1QIIA 1D6MA 5HFNA 4XM1A 2FUEA 1C8BA 5BSKA 3QEKA 3P94A 4WN3A 3E5NA 3BSSA 2AMLA 1GK9A 3ZX5A 2YN4A 5CA1B 4COKA 4EFDA 3I4LA 5CFOA 1IY1A 1UMDB 2UUPA 3OCYA 2KGWA 3SX2A 3IBSA 1QVWA 4PZEA 1GN9A 5AVVA 3PD1A 4QTTB 4F4IA 1NBMD 1Q0RA 4OAPA 3GFOA 2GFHA 1ZGGA 4MGEA 4JODA 1X74A 5AI8A 2WTAA 2Q6KA 5J1TB 4OBBA 3B6KA 3HCDA 4TSRA 1DELA 3LUCA 4WE3A 1KNXA 2XBLA 4QUIA 3N7AA 4BP9A 4XASA 1CDEA 3LT2A 4Q6WA 3RF7A 1PEAA 5DTJA 4KK3A 3WWYA 3HI6A 1HFWA 4DNOA 2ZR2A 4F5ZA 4KFUA 2JZCA 3I1JA 1VXOA 1N0UA 4JELA 3STVA 1XQ8A 2C9CA 4EY3A 1X9IA 1XLTA 2C3YA 2C5SA 3AK4A 1KHTA 1BIFA 5FTWA 1XRGA 4EYOA 4G1BA 3A1SA 2HP0B 4PAWA 2X9VA 1ZN8A 5HDQA 4V0KA 2BGUA 5KNDH 5B1IA 1I01A 2BRUA 3K2QA 5U4XA 1AQUA 3SDZA 4BW5A 1BE3H 3L7KA 5LPNA 2NSYA 2C4WA 4ZT2A 1AN0A 5CK5A 2Q8NA 2GTPA 2PX2A 4W5TA 1YC5A 3LFOA 2DWEC 1YE5A 4H7IA 2R96A 3MHPA 3O31A 3EPJA 4KRYA 1K8AW 2NTEA 1QVAA 5IAOA 1OA1A 1SVSA 4MGYR 3KLMX 3AH8A 2J3QA 4ERHA 2FUKA 3PNQA 1FX0A 3GQBB 3S1LA 2RH4A 1N1DA 3ZWMA 5EUCA 1VYVA 3QEAZ 5DBEX 3OUUA 4LK2A 5INTA 1ESZA 4ACAA 2UZHA 2KTVA 1ISJA 2VXCA 1IHUA 3AIOA 1W59A 3THYB 1Z68A 5LUAA 3AF1A 2PDAA 1EWTA 5SZJA 2NTNA 1RQPA 3LQ1A 2NTYC 1GKUB 4XQGA 1TUBA 4FFKA 2CYAA 2P4KA 5ELMA 1IN1A 3QOXA 1O95A 5EZYF 2RCYA 5HIMA 1J00A 2MR6A 4P9OA 3EXFA 2QP4A 4NS4A 4HBNA 2PZAA 4AFNA 3FPGA 4I0XB 2WLSA 2CFTA 4EABA 4M21A 2GCGA 2VL7A 5LWHA 1UFRA 4BKMA 2ZRIA 4Y7CA 2ZPTX 2I1WA 5JC1A 1OCRC 1Z6ZA 4J1TA 4JT9A 2VQSA 4MYRA 4BLTA 2GS9A 4Q3NA 2I2XB 5C81A 4M9UA 4EAQA 3KQSA 2C7GA 1IE3A 4ZZ2A 1UL1X 1XOUA 3PXUA 2BFOA 4E13A 5C2JB 4C0AC 2R9VA 4WFEA 1XDCA 1J8VA 4BT2A 3BRWD 2HN9A 3QVVA 5KYVA 2FZGA 3L7NA 3NBXX 1GJRA 4MQEB 4URYR 5ALGA 2QTRA 3KHTA 5ESXA 2RH8A 5BPHA 1UDRA 3N39C 2VNSA 1PT9A 2Q2QA 3PRKE 1XVVA 3X2QB 1E1QD 3U3DA 1G6Q1 1GQOA 4C1BA 4HUQA 2UUAO 4QQKA 4CYMA 2Y93A 1SKMA 2J0UB 5LZ5A 1V5IA 2OP1A 4E5KA 1IB0A 1DBFA 4ZVUA 2H4FA 4Y6QA 2QKYA 1XNRO 4ADSG 2W2QA 1PM9A 3BORA 1EVZA 4UAUA 3DEJA 2J3LA 2ZS7A 4LYJA 4XKJA 4LWSB 2QTCA 5D8DA 2XZOA 1Z4NA 5CLHA 3AP3A 1HDJA 4O4LF 1NRIA 1KNJA 2HGZA 4M8KA 4H6PA 1J2UA 3ANMA 3IULA 2RKOA 2RHDA 5AKLA 1ZHHA 1TUEB 1E0DA 2YWRA 1F7UA 2EV9A 2I6UA 2F8SA 3FFTA 1ORHA 4BTVA 4C7VA 5EEGA 2EATA 3ODPA 3LSSA 2ZWVA 3TSYA 3AKZA 1KZHA 1BSVA 2RGNA 1J07A 2EFHB 4QXOA 3F6YA 4QUBA 5EQDA 4QOJA 1G2QA 5G4UC 4ZDJA 1N34O 2CVLA 3QENA 4G41A 1LUAA 4NAVA 3UO8B 3V32A 2CVQA 1YACA 3JWGA 3GT3A 3FPHA 3NP9A 3C8HA 2VHWA 3M6MD 3HABA 1ANKA 4GQAA 1RDFA 5E38A 1FQJA 2CBGA 1T0KB 3H16A 3MQ2A 1QYVA 3TEFA 1ZCZA 1W57A 1QYDA 2CVHA 3NX4A 4RULA 3OEEA 1ZN2A 2R2AA 4QU8A 1IJEA 4YJ3F 1VJRA 4F4FA 1CNEA 5IDQA 1JEDA 1YB5A 3N6XA 1D1TA 3NYRA 1QIFA 4MS4B 1MG1A 1OBCA 4TWRA 1W36C 4UHCA 3MEQA 1RBMA 2V4DA 1GQRA 2AQ8A 5FOVA 2AWOA 3FOAA 4OJNA 3EWNA 3O2JA 1R5OA 1SOMA 4KTTE 1GAQA 2QE6A 5ADHA 4WXEA 3S44A 5EBLC 4IEEA 3GVPA 5FO1A 3SAJA 2X8LA 2ZR7A 2VDVE 2LD4A 4DXDA 3GYBA 4OB7A 4ENRA 4WKBA 1HBJA 3GRVA 3KAPA 5CAEA 3R77A 5FNVF 2BMEA 2MQEA 1KETA 2DH5A 2X4IA 2REQB 2IS4A 1ZVJA 2Z09A 4DA6A 1NVUQ 4KO3S 4KAXA 3BIOA 4F38A 2G38A 2RHCA 4GGMX 2RB4A 3C6ZA 3DOEA 4MQUA 4ZYLA 2E89A 3LX5A 1ZM7A 5IAGA 2PJDA 4WOKA 3ZKAA 1RYZA 5K3EA 1ZMXA 1ICEA 3H05A 5KZMB 2B35A 1CY1A 1SUAA 2ZUWA 3G6BA 3O03A 1OCRB 4MVQA 4N54A 1T4DA 4KAAA 5L9AA 1MAVA 3WK6A 3K0AB 2P6YA 3A0HZ 4ZYXA 2O3SA 5EWLA 3HB4X 1DQYA 4TSFA 3VPGA 2HWYA 1IG0A 5IXSA 3KEFA 2IX9A 5LHHA 3NLLA 4AS2A 4XCQA 4A8JA 4PFKA 4LJ9A 1UFYA 2DQZA 5CBKA 2Q41A 3AEXA 4CTJA 3H42B 4QJ5A 1LW6E 1WHTA 2YCLA 3SF0A 1OTYA 3EGDB 2EU8A 5H5JA 3CC2V 5IT5A 1FS0G 2QKSA 2WABA 5DWVA 3DAOA 3QOFA 2C58A 4XCVA 4QELA 1W0KG 1J1ZA 4IDEA 1C3VA 7MHTA 1ZICA 4QDZA 3HY6A 3CVXA 2GKSA 3SP1A 4B74A 3A1TA 5AHXA 2R7AA 4BS9A 4JCCA 2ZR9A 4KPUA 5FWXA 1VYUA 5DTQA 1RYMA 4BVTA 1L4FA 3ACCA 2UUCO 1J2JA 3C7DB 1MNAA 1JKMA 2HQRA 2GWRA 2F67A 1KOJA 1GL6A 3FFWA 3OIUA 1E7YA 3HCRA 4FT2A 4M9XA 4UBOA 2P5YA 4Q4AB 5GZ1A 2ZYVX 1TUIA 4PYLA 4YRJA 1GM7A 5ILGA 1GY8A 4P92A 1VQNF 3IEVA 2RG7A 1WMSA 2YJ3A 4TYYA 1EBUA 4ALMA 4GGPA 3C9RA 4V0OA 5BV8A 1P5RA 4NBWA 5FBQB 4IFTA 3BB1A 1EGAA 4F8JA 1AT1A 2OOSA 1S2LA 1VGQA 1FQWA 1GA6A 4NK4A 3AUXA 1UKEA 1XOIA 4BFSA 3ELYA 4WJKB 5CIWA 2VC2B 1C2YA 1X4TA 1W0JG 2FMUA 3FBTA 3GEMA 4QARA 2AG1A 1FLVA 1XDWA 2VUIB 4DPMA 4FMBB 1Y7TA 3EK2A 2I6TA 1PFQA 1G4YB 1H2GA 2Q6VA 4YMWA 1VSTA 3ZDEA 1P4GA 4ESEA 2WIGA 4YAEA 2PF4E 1SZQA 1WZIA 1SB9A 1MA0A 3ZCXA 3GZNB 4EQ6B 1L4HA 3REQB 3H4IA 2L42A 2RCVA 5ALJA 3F9RA 1UQTA 3TWOA 3Q3GE 3U1BA 3ORFA 2EJWA 5IHXA 1VQOF 2AGAA 4F8YA 4YXWG 4NMLA 3AHDA 5BSWA 5A4KA 1GYQA 2EIMC 4F92B 2WVAA 3DEIA 2GMWA 1C9MA 4JI7O 4BATA 2AK2A 3QE2A 2WLIB 5AK4A 2ZCEA 2DYRC 4P0QB 5JNVA 3NKFA 1T8TA 3P0EA 3UC9A 1BKDR 4TTJA 4MT8A 4X94A 4MVXA 4RTPA 4Y1RA 5DYGA 2KSDA 2INGX 4QGFA 3VYVA 2CBXA 1Z5ZA 3E86A 1CUZA 3ZBQA 1A71A 2ZQMA 1LDMA 3DXXA 4RADA 2F17A 1JAXA 2EG5A 2VBGA 4M0KA 3N0TA 1UKAA 3IQFA 1JHQA 1U2QA 2FSPA 3UUWA 4CC5A 2QIOA 1PWEA 1NQXA 3M3HA 5F77A 1FLAA 3H9EO 3PUVA 4C2AA 1KPHA 5KDOA 4OD0A 4N49A 3G17A 3H83A 4DZTA 2X9NA 2O6HA 1SXJC 2X0RA 3WQHA 1KJ8A 3GFTA 1EN4A 3S2YA 3HXLA 1V3VA 3KLBA 5K0SA 2F95B 1MNGA 4CIVA 1QTNA 2VJOA 5ELXA 4YY3O 2REBA 1K92A 4BKPA 1YI2V 4L1KA 2N74A 2X6AA 5F73A 2XMRA 2IFTA 3M6UA 4U7GA 4D0RA 4GPZA 3L7YA 2C0PA 2VS0A 5I9MA 3EWSA 3BGWA 3JCUZ 2HF7A 5GOZA 4MTGA 3AINA 2ACEA 3PTZA 5JJJB 2DPMA 2OIGA 4QYMA 4DCPA 4RXUA 4XRRA 4CMHA 5AVUA 4ZC8A 4RF4A 4DDKA 1OSNA 4MRMB 4DMRA 1R1DA 2G82A 4J03A 2NU8B 4AX8A 2FCAA 1PK7A 1K7FB 2CAZC 3L0BA 2ODNA 1GU0A 3A10A 4G09A 4Q3OA 3LUGA 3FB8C 2P67A 1U7PA 4RHAA 4JU8A 1OCEA 3UJ9A 1P9WA 3C3MA 4R0VA 2F1OA 2FEAA 5LKRA 2AW5A 5A4AA 2QRVB 4HAIA 1NH2D 4QTUB 1M33A 1OYVA 1X7ZB 1NMYA 5DK4A 2OESA 2A1UB 1SC6A 2QJOA 2XTNA 4D96A 1TVEA 3B1WA 4H4DA 3IVRA 4EG3A 1U9IA 5EIXA 3FTQA 3NI2A 4FK5C 4YJFA 5DLDA 1V48A 3FGPA 4CF3A 3I04M 2DSTA 5DISB 3SZMA 2FPPB 3HE3A 1KEVA 4EUFA 4TYNA 3AVVA 1Y8CA 1DOHA 1DU4A 2JDIG 4UVHA 2YNMA 3EXIB 4ZOEA 4EI7A 1A9RA 3VR3A 2YXYA 4BTLA 1JNXX 5DGCA 4YO8A 2NGRA 1KVTA 4DPKA 2H1VA 3GVXA 2MR5A 1XU9A 5LA6B 1GPWB 3MD9A 4KFMA 4NPAA 2RCNA 1U8XX 3FUXA 3EIUA 1TYBE 4P2ZA 4HNQA 1NFQA 1U3FA 3N4ZA 2GN9A 2GHYA 4ZALA 2BBTA 2WMNB 4CU2A 1AQ6A 4NEHB 2QL5A 3NWPA 4HWOA 1Z5GA 4XGNA 3PC2A 4JYAB 3ZHZA 4YACA 4O4LB 4KGDA 4BNIA 2Y0DA 4RK1A 4H1WA 2EIMB 4PWYA 2GARA 2I3DA 1U8FO 1D2DA 1O95D 1WNSA 4RNCA 3Q2OA 4INZA 1ZC4A 3GB7C 4B85A 1GZ7A 4DTIA 221PA 2DYRB 1N0IA 1EE9A 2ZF8A 1IFXA 1CQJB 3JR3A 4NFSA 3URKA 2RE8A 3T1CA 3GG2A 3LL4A 5EEHA 2OCBA 1FXKA 4C4XA 4WZAA 3TGPA 2VJQA 3RODA 4PSCA 3SHQA 3VSBA 1KJWA 2Q2OA 3PL1A 2OHWA 1TGOA 3I0NA 3SF8B 5TF0A 1GXSB 4MYHA 1R6TA 3AU8A 1UZMA 4O1IA 2I2CA 4XDJA 3NOQA 5D3MA 4JSYA 1UK7A 2O8DB 2O8BA 2HB6A 1T5BA 3AUJB 2XF8A 421PA 4HX2A 4QUAA 3AG7A 1DTSA 4BNUA 5JXWA 5E8JA 4OYHA 3HU3A 2HA0A 3NU1A 2V8OA 2GUWA 1YZUA 4DMKA 3BE8A 4QEDA 1LK0A 4OXRA 4RQFA 5HRUA 2O2GA 1W4ZA 5AI0A 4PC7A 3ZCUA 5KTYA 3JQBC 1V4BA 1YITV 1NVBA 4F9FA 1QRAA 2DWCA 1BXRB 3GJTA 4R1TA 2QN6A 4RENA 5DHRA 4DMGA 4RVSA 5IANA 2PQ0A 2EINB 5ILQA 1ZA1A 4NHEA 4LBVA 3VQXA 1NJSA 1O9BA 2P75A 2LJ2A 1H2YA 3DEAA 2JFQA 3I09A 4RD4A 1N0HA 3GHHA 3ITDA 1BVYF 4AMBA 2DUNA 2O7SA 2HLPA 1QUEA 2F43B 3BSFA 2B98A 3D7SA 2AUMA 1IHPA 3RAPR 2HFEC 1N32B 2P6OA 3U4QB 2GRUA 4CMIA 1AKTA 1X8KA 4L5CA 5FNVB 1EU1A 3LCCA 2PKXA 2D54A 4C4AA 4D41A 3SZGA 1IY8A 1L8LA 4UDOA 4G67A 1MIOB 2C8VA 4PYKA 3CRNA 3LKZA 3S8MA 3SG0A 4M7WA 4JP2A 4C2TA 2VK1A 2JIMA 3REOA 3O8BA 5FAKA 4V0LA 3EFEA 2HWUA 2C03A 3TG8A 4W9NC 1ORRA 1KY4A 2H5LA 3EGXA 3MF4A 3RBZA 4B3SB 5MFZA 1XMQO 3WRVA 2C2KA 4MV5A 2GN6A 5FA8A 1G6OA 3GNQA 3OEED 1QOPB 3MTJA 5KNBD 4OHOA 2YFYA 2XQJA 3WPXA 2DHCA 2ZUBA 3L05A 3OMLA 2DT8A 3AUYA 4Z1OA 1OX4B 2HMWA 5FV4A 1VF7A 3MLAA 1GCIA 1DJPA 2SKDA 4YRPA 4DIEA 2P5UA 4TKLA 3HFGA 4UCQA 1YRLA 1APBA 1W4CA 2VF2A 3KV1A 3CX3A 5J2UA 4ZVTA 3N59A 3IEQA 3ACDA 3IKLA 3KJEA 5DBFA 2Q0AA 4MMYB 3ZIAA 2WJ4A 4UFNA 2Q3HA 3VOUA 3GDGA 4UREA 1UPBA 2ZUDA 4IOKA 2VF7A 3KP1A 2OV3A 2GAIA 3I58A 1EVKA 1VCIA 2PR7A 4UCTA 5HKBA 1GARA 4AWAA 4G24A 5JS2A 4Q7LA 4HAUA 1KOLA 3LC7O 4HGOA 3T7JA 1H4QA 3OA2A 4UZEA 2HD4A 4B87A 2RGUA 1NONA 5AM3A 4FJ1A 1Z06A 4C82A 4G9GA 1NTRA 2PUSA 2PBZA 3B3GA 1EG2A 2PL5A 4JGSA 2QS9A 3TGWA 1NRXA 4BO3A 6ABPA 2JLUA 3KKKA 2VQFO 4DW0A 2DUJA 3OZRA 4FZ1A 3IRUA 1GT6A 4TSFD 3DLTA 2YI9A 3QG1A 5HW0A 4AJKA 1OXKB 3KR0A 4O8CA 4JWKA 1YAHA 1NU1H 1PL6A 3S28A 2XRMA 5DX8A 3R5KA 2RH5A 4HNHA 4W6QA 1AB3A 3ZV4A 1U7WA 2ZIFA 2H17A 3EC1A 5K0EA 1KKMA 2NUTA 4AXBA 2Z2IA 3LK6A 4JUAA 3ACBA 2ISSD 3W5CA 3DTUB 4CQMB 2YXNA 4HOYA 4XPIB 5DHFA 5JQWA 4OPMA 1JIUA 4IIJF 5CFLA 4JC5A 1R00A 1KYVA 1TQ6A 1CS4C 1SQ5A 4FC6A 2GA8A 4N9QA 3PYLA 4FQ7A 3UWDA 4OQYA 1XCOA 4FLTA 4RPCA 5FA6A 5IM4F 4G86A 1NTKH 4BVBA 3UV3A 1PJZA 1P73A 2K1EA 2B7LA 3FPEA 2QM0A 4LYAA 1ML3A 1K6MA 5E3HA 3ICOA 1ESCA 4PBTA 4BKRA 3IEWA 4OXKA 5B12A 4FU0A 3G4SV 1G7TA 3MGGA 2YHSA 3BH7A 4EL5A 16PKA 2IYLD 1PR2A 3LD9A 5C1IA 4YGYA 1BYIA 5L8VA 3B2EE 3Q85A 2ZRNA 4LWPA 3DEYX 3HCEA 3HHEA 1EB8A 4E5MA 1Q1AA 2HJVA 4JDPA 1ZISA 3I76A 3DS8A 4UHDA 2IYFA 4YRLA 2F4VB 3NDIA 3DT6A 1UOPA 4BMYA 4WK0B 4I66A 2ZUFA 4XQEA 4E4EA 3L92A 3JQFA 1E9DA 1BDJA 5LDDC 2WJHA 3RVOA 1BX3A 3WIDA 2G4VA 4JLOA 1O57A 2EL7A 3P9RA 3UAGA 3OJWA 3VYRB 1BCRA 3D7MA 2F43G 2WKQA 3KZKA 2CKMA 4KXNA 2AOUA 4OV6B 1AZSC 3STYA 1TT5B 3LY9A 1ZLYA 4CPDA 3ETQA 5BO5A 2Q6AA 1JFVA 4W5RA 3PK0A 1RU3A 2IY8A 2ACWA 1QZXA 2PUDA 4RKYA 1E2IA 5GONF 2HBRA 5HS4A 5JZVA 3EZYA 1A82A 1GGEA 1HL3A 2FYUH 4ABYA 1VF5B 2H9IA 2WFZA 1XGKA 2VVTA 2QENA 4NH0A 1ZJ5A 4LCEA 3SJBA 3ANTA 4ZQIA 4EB6A 1JU4A 3AOEC 4I9UA 3MWKA 4OIMA 1Y3AA 1KY5A 4RVCA 2GTAA 1GLNA 4BQNA 3QUWA 2FFQA 2ZI4A 1PS0A 1SBHA 4UCXA 1QIHA 1NBMA 3W04A 5GAPK 3ZRWA 4C06A 1M90H 4PLTA 4EZIA 3NP7A 1N77A 3I73A 3E23A 3DHWC 1IB6A 3SZUA 4BO8A 2JAOA 3D1VA 3TZLA 4RS4A 3R3XA 4KAJA 3LDDA 2C9OA 3AP1A 1IATA 5B58C 1P9NA 5IH3A 1BHSA 3PLAE 4C6SA 4J80A 4DY6A 3G2PA 3HDVA 2FEMA 1JVSA 3OTOB 4L3VA 4DR1B 4DA4A 1PNRA 4TUYA 2BI8A 5C35A 3IP8A 4LXQA 4PNEA 1TZMA 2GN2A 5HOEA 3ADCA 4US0R 2NO7A 4EA7A 1Z2DA 2C99A 1ZFNA 1VGVA 3MTBA 4RK5A 1BS9A 4E07A 5A9SB 1ZCBA 1OFTA 4AVYA 4JNCA 4MV7A 4RDXA 3O8OA 1HT0A 4ZDKA 4K9RA 4RLFA 2LE0A 4OHWA 3L0PA 3LOUA 2C59A 3LHSA 2HA6A 3EIHA 5G41A 2IEYA 5BXQC 1VE1A 3CZAA 2FUG6 3G7UA 3I92A 3WADA 1P74A 4XUEA 3N87A 3ZBUA 2WVHA 1R0XA 1FUUA 4MAMA 4I1IA 2HYDA 4A8JB 5KU1A 2JCXA 5CA1F 5HP8A 3GEHA 1WHTB 1WXQA 2DLCX 3ZWWA 1DE0A 4KXWA 1XPOA 1DFHA 4L8GA 5CYGA 4F6RA 1BGVA 4RSGA 2P35A 3Q4HA 3ABIA 3PL5A 3SKYA 1F7VA 7ABPA 2YNMD 4QIWF 4KPUB 1P2GA 1EFPB 1JDVA 5FWXB 3QUBA 5EKSA 5EFZA 3SSNA 3PFCA 3M9WA 3BMCA 2QP3A 4K81B 1JTVA 3H13A 4KDEA 4IV5A 1Q0TA 1SCDA 1CYEA 3C4QA 4H18A 3W4JA 3NCHA 1HLFA 3R4CA 5KQLA 2P6RA 1E2JA 4UUMA 1E5TA 3DQPA 3ZK7A 3E2IA 3RSZA 3UENA 1YZKA 3M4XA 1GHTA 5CNJA 2XADA 1OH6A 3TLKA 4TZ0A 1DUIA 3GPCA 5KJ6A 1J8MF 4Z9BA 1FRVA 1DT5A 2LDBA 2F93B 2RHWA 3EZ2A 1JXMA 3ON1A 2ISCA 1H9CA 4H4CA 3UA3A 3ZDZB 2GF0A 4JWTA 2P77A 1RLJA 3BRWA 4TWKA 1JHRA 3BHMA 5CT4A 1ZD4A 3OLVA 4C0LA 3A0UA 1FU8A 1NP7A 3SEAA 4RS3A 4HEJA 3RTGA 4PVCA 1QAOA 4QTYA 5KHGA 1RP1A 3CCMV 3LFHA 2WA1A 3O93A 5EOVA 3TQTA 5EWRA 3PJRA 5DT2A 1Q0HA 3ADPA 3R0ZA 4CH5A 2PUAA 1EVLA 1PZXA 1V6AA 4FDMA 4XWOA 3BSYA 1CEQA 1KBHA 4E1VA 4IYRA 1B16A 2FMTA 2VPZA 2JFWA 1NC3A 2R6HA 1XZKA 4X7RA 1XREA 5K3OA 2PR2A 1HNWO 4CM5A 4RGBA 4B7UA 5JO0A 1NHGA 3INTA 4IDHA 3HI4A 2HS0A 5EN4A 4RV4A 2DMXA 2XAQA 3ZO8A 3ELDA 3RIHA 3AESA 5CN0A 4UVCA 2Y68A 2RHTA 3ITKA 3EISA 5AJUA 3L18A 4WFFA 1YK1A 3EYWA 1K7EB 2VZLA 4CHGA 2RGBA 3E7WA 4DQLA 3U10A 3V7NA 1JSCA 4FIDA 1PW7A 1B15A 3CHYA 3G9ZA 4JLSA 2C7QA 2A14A 4DCGA 4NXMO 3ZDAA 1PNLA 2QU8A 4Q7JB 1EFTA 2J9ZB 4MCIA 4FZ3A 1YGPA 5H5NA 4OA5A 2P1ZA 3SJZA 4EATA 2G76A 2HRCA 3RNLA 4K2AA 5HA5A 3FYSA 4JC0A 1QCDA 1T5OA 2O19A 4D46A 1VFPA 1IBMO 3PLNA 2OFFA 5E9WA 1WN7A 2GSWA 1GA1A 1LY1A 2X2PA 3RWRD 2GCPA 4R6ZA 2GD2A 1W94A 2O0KA 4J9VA 1IPAA 2CDCA 3P20A 4D9BA 1AH2A 1AJNA 4OLHA 3EG5A 5G4VC 2C4TA 1XQXA 3FI9A 3OLZA 4TM8A 4BV8A 3Q8LA 2AZ0A 2PUFA 3ZU6A 4MQLA 3K70D 2V45A 1VMKA 2QM7A 2WMDA 2VTKA 1I36A 2K5UA 4Z53A 4B3FX 4AN1A 4ZOCA 3WRXA 5KQPA 2AZ2A 3C1UA 3UAXA 3ZCPA 3TLGB 4DDWA 1N2BA 4OKSA 5H9WA 2LDXA 3WP0A 4NICA 3EX7C 2LCQA 3T9FA 3K03A 5AJYA 5TQ0A 2XZLA 4CIDA 2UZIR 3D02A 5EIBD 1USGA 1K97A 1KFCB 2EZ8A 3A0BZ 3BCUA 3CCVV 1BXGA 5LGNA 4E09A 2ZZKA 2V5UA 1DDOA 1BU5A 3S5UA 3UOWA 5EY5B 2N42A 3A2KA 4HZUB 1JAHA 3ZR4B 3O1HB 3AEQB 5BWMA 4GVXA 3IBYA 2D3WA 1EK0A 2D06A 4N65A 1TEZA 4LF5B 5E4TA 1ECLA 1FXVA 3B7PA 3BTUA 3OJLA 2OD2A 2GN1A 1CRZA 4B2YA 2QQ0A 1ZPDA 4ZVPA 3C87A 2VJBA 4YJFB 4FDUA 1ABFA 3ZIAD 4D45A 3DLHA 3FCSB 1PNQA 5TPWA 2HADA 3OUZA 3ZJUA 4LBEC 4V2IA 4QASA 1CR0A 1WUHS 4BUCA 2EDAA 1ZXXA 3OR7C 3EWIA 4URHA 2FF7A 2GX6A 4PZYA 2W71A 4R71A 2XLBA 4NHOA 1RQ7A 4RO0A 2X9LA 3BXGA 4H27A 1JYSA 1H2ZA 4NZZA 1XEXB 1JPUA 3NNSA 4NSNA 2B61A 1A95A 2OPBA 4JC4A 4O33A 1E8DA 4BMDA 3B13B 1H5NA 3N8KA 2GGSA 5AD1A 2C2GA 5BR7A 3VNUA 4MVJA 4QYIA 2GI4A 4IDBA 3QVKA 3F6PA 5CT9A 1FLDA 2GF2A 1YIDA 1TTQB 4U7DA 1PJQA 1LQTA 1U2RA 2HJ9A 1VKHA 1EM1A 4D3SA 3L7LA 4DLPA 2Q9BA 4WERA 2O7QA 3L5OA 1Q86W 3BK1A 5NULA 4A8TA 4KUGA 2R44A 1RQNA 4G1MB 1OMOA 1QZZA 4TKUA 3E9YA 1T5SA 3IMEA 3THWB 3VTAA 1DARA 1KGDA 3WIUA 5AJWA 5KHHA 2K7ZA 5ECWA 2YV3A 2I6RA 5DZSA 2QM3A 4CXMA 3CH6A 5T8KA 3UXMA 2OHGA 4WNIA 1JIVA 1SBNE 3QI2A 4WZAB 1R6BX 3EAFA 3OBIA 4JYBA 1EWYA 4HH0A 5EP3A 3GG9A 4OXXA 2Y0PA 5GONB 2PXAA 5A0VA 2HSZA 1HKUA 3HU5A 4NFYA 2NIPA 5D3MB 1Z34A 3PQDA 3H65A 1N6IA 2O8BB 2BMWA 4LUCA 3VI3B 2R5FA 1BKSB 4B4WA 4PDVA 3V00A 4D43A 3QGMA 3AXSA 2X2EA 3FIUA 2IPXA 1D2AA 1FNKA 2LRHA 5D6OA 1WUKS 1CERA 5K4GA 3F6SA 2CMFA 2ZDQA 5KNDA 3MTIA 3HDHA 1ISRA 4BRZA 2C04A 3VTKA 4O0MA 3UHOA 2Q4EA 5E0KB 3RQSA 3BH0A 4GOND 5SYNA 5IBQA 2D2XA 6CHYA 4PLHA 4RVFA 2JAUA 5KSZA 1MB3A 1GRQA 3KX2A 1H3NA 4ITRC 4AB1A 2GCIA 1AKNA 5CFZA 2WUGA 1L1RA 1PVVA 3DZKA 3WKAA 4P4GA 1U04A 1JS1X 3FKSD 3KQOA 1IXSB 3PYXA 1YVUA 4RCVA 2YJZA 3I2KA 3DWFA 4CMIB 3I1FA 4N5DA 4D4LA 4JEUA 4HI0E 2Q5LA 1TJYA 5SY4A 5FOWA 3DZJA 3U37A 3L0OA 2TMKA 5C8YA 2P4UA 4OMFG 1DCKA 2B69A 3HU1A 3D36A 1IVYA 3C3PA 4DLKA 1I4TD 3O9ZA 3PKIA 5JAOA 3PPIA 2IHJA 3G5MA 3HA5A 3M34A 2H3HA 1SHZA 2Y1KA 4P1ZA 5JYBA 2HA4A 1JHAA 2H63A 3DAPA 1IJFA 3X2QC 2BCJQ 2XGSA 4OX9B 3M4SA 3G8YA 1V5EA 4HDNA 3QMVA 5IYZA 4U6SA 1RRCA 1PHPA 1ZD5A 2W6JG 3HSKA 2GWHA 3E7DA 1J56A 2ZGVA 2P90A 2JGJA 2WJWA 4K87A 5AJVB 2N3ZA 4FFWA 4MRRA 3T0FA 3QU9A 4N12A 4OHKA 2BY4A 3MELA 1NI4A 3IURA 1JTEA 4GL2A 5AVWA 3ICQB 2Q9UA 3CX8A 1XTBA 3WY9A 1REQB 1GITA 1T9BA 2B5WA 4W4LA 2BWJA 4WF9V 1HNZO 4LZZA 1M2VB 4P7JA 3VX4A 4LFAB 3BFKA 1TE2A 1Y3DE 4C3OB 1F2DA 5EE9A 3T3MB 4Y1FA 2J5BA 1BHAA 3UUGA 1L1EA 4BB5A 4D79A 3ZVMA 3DXRA 2EKZA 4QVKA 4DADA 3X1ZA 2WEKA 3W7UA 2PSFA 1J20A 4NYIQ 5FPHA 2C96A 1MO2A 2JA1A 3A9SA 3BK7A 4OOEA 2XRFA 5D5QA 4Z0NA 1G20A 5JD5A 1RZ3A 1Q6ZA 4FJCC 3J80A 3F7OA 1CVLA 2ZKIA 3IIIA 2HUPA 1GR1A 5ALLA 1T9GS 3I6ZA 1JOYA 4FLYA 4Z49A 5A5GA 1JR3E 3EQ8A 3GPIA 4NZYA 2ZCVA 3GLGB 1A97A 1HTWA 4PTYA 4DK1A 3S7TA 5K3AA 5BQ3A 4PYNA 5LMNB 3BIJA 4UUOA 3RVNA 3KQYA 3M2PA 3QNEA 1Z75A 4A23A 2E18A 2FR8C 3TSWA 1M2NA 1A69A 3SM3A 5CLLA 1P2VA 1CW2B 3MQWA 5EWJA 3W6ZA 4ZYTA 4W1RA 1VLHA 3MDOA 1G8AA 1YR9A 4R4JA 1GZUA 1DQPA 4J4BA 3MQFA 3G67A 2PA0A 3ZE6A 4DO2A 4UBIA 2XHEA 4IJ5A 4AF7A 4K8RB 3EVKA 2AL7A 3A9VA 4FJ2A 5AIAA 3SIPA 4CT5A 1ONBA 2ANCA 5GZ6A 4YO7A 2GZ2A 3NANA 1EM8B 2XMQA 4ECEA 2UYOA 1TW2A 1N6LA 3ZYCA 1K7DA 5IAKA 4U9UA 3SYOA 5AYVA 1WXGA 3JYHA 4I6JA 4UOZA 1H3FA 1E2GA 1U3DA 2P40A 2HY7A 4LF7B 2O7RA 3Q0IA 3SXJA 1GUAA 3BXXA 4FZRA 4LJSA 2EF1A 2QXYA 2Q3EA 4AQYB 5TGTA 2HRRA 1KZ9A 3WZ2A 2BDUA 2IQQA 3QVJA 1G21E 3E9MA 1G9XA 3M33A 2GJ4A 1OROA 3GROA 4HS4A 1KZ7B 1YFJA 5A3RA 3DJYA 5EYPB 2C2MA 1ZNZA 1J33A 2WFMA 2FZCA 5JROA 2V55B 1WMDA 5L4SA 3RNOA 1MJNA 4L08A 2V9YA 1ZJ6A 1VP3A 3AUFA 2Q5HA 2RGRA 5JSFA 5EC2C 2ZB2A 3D6AA 4ZQFA 3DO5A 5LA6F 4C6TA 2CBZA 1F51A 3QPCA 1Q7RA 1TNDA 2A88A 3CWBH 5TSDA 4H0CA 4DCNA 5CW1A 3PJDA 4FM0A 3E53A 2AOUB 1ZH6A 5DM0A 2FMLA 2AW9A 4NOKA 5FWNA 2DXIA 5KKNB 1PVDA 3FVQA 3L1IA 2G1AA 3OTIA 3SIVA 2ZPUA 5JAIA 1KZ6A 2J9FA 1KQSF 4B4DA 1UXHA 3I9V6 2ZNIA 4GVPA 4LPSA 3NJRA 2V7BA 4LJYA 1URFA 4QOIA 2ECQA 5ALEA 1I30A 3VKWA 4PX9A 1M2EA 1OPRA 1MMFB 1F0PA 5FI5A 5EWMB 2DKFA 2VZEA 3W1VA 4FWIB 3R3UA 2FP3A 1LA2A 2OBXA 1VH8A 1P2TA 3W5VA 4U9IS 4WCFB 4XVRA 1F9AA 1H65A 2BE3A 3P4YA 1EFUA 4LSWA 4KRGA 4YAFA 2A9KA 2ECFA 5FO0A 2BIFA 4JP3A 1FOEB 3Q6MA 3ICCA 5KOHA 4ARVA 3LHFA 3O91A 1GFWA 5DWDA 1RHKA 2PGNA 3RARA 3MCAA 2CLDX 2R97A 1K8ZB 4HEA6 4MP6A 1FCJA 2QGNA 1U0RA 3TRHA 4XDLA 3O5AA 2GPSA 2LCIA 5DMXA 1SXGA 1A8IA 1KK1A 5C7OO 2ZTMA 1Z12A 4N0PA 2DHRA 3EDMA 4H1TA 4J2OA 2PG3A 2BP7A 1BOFA 5G4KB 3GH1A 2GYUA 2PN1A 5CJ2A 5EAZA 4JJGA 2EULA 4FHDA 4TUYB 4R69A 5KNBA 1M6NA 2QN7A 1S5LZ 4L50A 3ZV3A 3AWDA 4GPIB 3BOSA 4AJOA 3VSDA 4CM3A 4LVNA 3WAKA 3P1JA 1NFRA 3LAWA 4KX5A 3F5TA 3GEPA 3TD3A 3GGGA 4AG6A 2M9MA 1RWPA 3HWSA 2V0GA 4FDVA 2HPHA 3RCBA