5FNVB

A new complex structure of tubulin with an alpha-beta unsaturated lactone
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pironetin Reacts Covalently with Cysteine-316 of Alpha-Tubulin to Destabilize Microtubule.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords TUBULIN ALPHA-1B CHAIN
total genus 172
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fnvB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5fnvB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5fnvB01
3RYHA 5LYJA 5KMGA 2R751 3VOBA 4X1IA 2VAWA 3VOAA 4M8IA 3JAKA 3JARB 5IYZB 3WGKA 5LXTA 4U3JB 3E22A 4B46A 4I4TB 2RHJA 4LNUB 3RYIB 1TVKB 4DRXA 5LP6A 5LOVB 4O4HA 4TV9B 4YJ2A 5MN4A 3WGLA 4I4TA 1SA0A 3HKCA 5LXTB 3JARA 3JAKB 4X20B 5EZYB 4X1IB 2GVIA 4O4HB 1FFXA 4TV9A 4TV8A 5J2TB 1W5AA 4LNUA 5LOVA 4U3JA 5JH7A 5MN5A 1JFFA 3HKBB 4HNAA 5J2UB 5CB4B 1FSZA 4EB6B 4O2AA 3ZBQA 1Z5WA 5M7EA 3RYCB 5ITZA 4ZI7A 1W5BA 3N2KA 1W581 3JALB 2BTQA 4TUYB 5JVDB 5EYPB 5LA6B 3RYFB 5CA1A 5IJ9B 5FNVB 2RHLA 3VPAA 4FFBB 4O4IA 5JCOA 3WGNA 5ITZB 3WGMA 3ZBPA 4EI9A 3VO9A 3VO8A 4I55B 1W5FA 1TUBA 3JAWB 4IHJA 5CA0B 4WBNB 2VAPA 4O4IB 4YJ3B 2Q1XA 3UT5A 4ZOLA 5IJ0B 3M89A 1FFXB 4TV8B 5CA1B 5IJ9A 5EZYA 3JALA 4TUYA 4XCQA 1W59A 3V3TA 4O4JA 3HKDA 1OFUA 4ZI7B 1SA0B 2XKAA 4F6RB 5KX5A 3R4VA 4YJ2B 3RYIA 4DRXB 3JASB 4HNAB 5J2UA 3HKBA 3HKEA 2Q1YA 5JH7B 4X1YB 5LYJB 2R6R1 4O2BA 4O2BB 2XKBA 5J2TA 4X1YA 4O4LA 4X20A 5EIBC 3HKEB 1RQ2A 4EI7A 4O4JB 3JASA 5GONB 3HKCB 1RLUA 4F6RA 5KX5B 1W5EA 5BMVA 1TVKA 3UT5B 5LP6B 4DXDA 5EIBD 1RQ7A 3E22B 3HKDB 3ZIDA 3CB2A 4X1KA 5IYZA 4EI8A 4U39A 5JQGB 4B45A 4WBNA 4I50A 3RYHB 5KMGB 4ZOLB 1TUBB 3JAWA 4IHJB 4IIJA 5CA0A 5C8YB 5IJ0A 4YJ3A 5JCOC 3JATB 3N2GB 4KWEA 4ZHQA 4ZHQB 3C8LA 3WGJA 5C8YA 4I55A 5MN6A 4I50B 2BTQB 5JVDA 2RHHA 5JQGA 4E6EA 4X1KB 4FFBA 3M8KA 3RYCA 5FNVA 5BMVB 2RHOA 4O2AB 5EYPA 5LA6A 2BTOA 3RYFA 2VAMA 4EB6A 3N2KB 5GONA 5LP6C 5CB4A 3RB8A 1JFFB 4O4LB 3JATA 3N2GA 2VXYA 4IIJB 1Z5VA
chains in the Genus database with same CATH superfamily
2AS0A 2W8BA 3GJTA 1W94A 3QX7A 5BPFA 3JAKA 3DONA 3WL3A 2Q1WA 4JCOA 3J81k 3KOYA 1RJDA 1MV8A 1XKXA 4FOPA 4BO5A 3WLTA 1BL8A 2XAGA 1ISJA 3FTDA 3PNOA 4LNAA 4DZRA 2QRUA 1QGOA 3P0ZA 2GVDC 3QEMB 1M2GA 1JA1A 3MGCA 3Q41A 2YHSA 3HB4X 3LTEA 1UANA 1BYUA 5BSUA 3DZBA 1K98A 2KG4A 1ICIA 5ELLA 1Z8FA 2ZBUA 5I48A 2GPJA 4R2JA 2ZQZA 4MP8A 3LQYA 4X92A 4ZU6X 1PVDA 4YALA 1PFWA 4WRRA 1FYFA 1TO2E 1ZCAA 2QX9A 3OZBA 3PUXA 1IURA 1G55A 2P79A 2OFFA 3UAXA 2D7CA 3VH2A 4ZMSA 1I0LA 2WTEA 1FS5A 2JDIA 3IOYA 2X7RB 4WJZA 3SSMA 4GI7A 1U02A 1NVVQ 3DBLA 4Z7QB 1H5UA 3HO8A 3SX0A 2XT6A 2AG0A 1IZ7A 1CUGA 2HQOA 4GMGA 3LA8A 5JHHB 1EUYA 1QVFF 1AJNA 1K68A 3ONWA 1EGMB 2WKPA 4Z2AA 3TRHA 1G1AA 9MHTA 4FFBB 4IO0A 5F9MA 1S96A 3VDQA 1B73A 4W4KA 1EFAA 5BXZA 2LBWA 2ILMA 5K8LA 1SCNE 2I22A 1PZNA 4JI6O 4K40A 3V8MA 4EG0A 1IBMO 4I55B 4FW8A 3UJ6A 1LC3A 3QWBA 4PX3A 5KWSA 3CNNA 3W05A 4O59O 4CCWA 4Q6GA 3L6RA 4W9MC 3H83A 2ZDIA 4GF5A 3M2TA 4RHYA 3CLSD 3M49A 5BV2P 2C83A 3OEWA 4EA7A 4UOZA 1U6JA 5EZ6B 5HUJA 2O8CB 1Z0DA 3GJ7A 3O83A 3O92A 4MWGA 4XYMA 5A05A 4N12A 4W7IA 3ZXXA 1U1IA 4M55A 4AP5A 4YIOA 2JW5A 4OGGA 4F9TA 1PHPA 4FEYA 3LC7O 2F1HA 4GMDA 3RK4A 4F1KA 1A9OA 4YP0A 4HAUA 2XECA 1G17A 5EHIA 3R7WB 2XGSA 3T7DA 4HNAB 1X1TA 2R85A 2P2LA 5EUMA 3KFXA 2QP3A 4Q02A 3K32A 5DWVA 5G4KB 1KARA 2R47A 4HZUB 2XLCA 4BFWA 3CG0A 1JP7A 1U3GA 1NTOA 2AEMA 3KIPA 1LBHA 1DC5A 2APJA 2OFXA 2E7ZA 3EIQA 4W1SA 1FOEB 4Y9RA 2QD5A 1O58A 2GUWA 1OT3A 4G5QA 2YVKA 3SPJA 5B3SB 4QHTA 1C0LA 3HYNA 2D1RA 1KKMA 4ZP1A 3BREA 3WFIA 2P41A 2EX4A 3LBYA 1Z2PX 1O2DA 2ISSD 4TS9A 2O3UA 2R7MA 3WS7A 3B7GA 3IQEA 2DU8A 3W1EA 1WMDA 1YQXA 4BMVA 3JQBC 2JFFA 5K0TA 4F86A 2OENG 1SUSA 5ER6A 5LQAA 5KHIA 1U2ZA 3BWDD 1Q83A 4N65A 2LKCA 4QD3A 2B30A 4R8KA 3HO1A 2VYCA 3EPPA 3DE0X 4PQRA 4UM7A 1VF5B 1QGAA 1HSOA 4QLOA 3TTXA 1NVXQ 2ZETA 5IDWA 2G4VA 2HEIA 2HCTA 5EIHA 4ARBA 5LJIA 4R2KA 1HDYA 1G4AE 2HPAA 3PZBA 3T4PA 1XNHA 1DK1A 2OCAA 2WKWA 4B6JA 3JAMN 1KK3A 3BIXA 1JT9A 2W0MA 3PUWA 4PGFA 5G1NA 3ECAA 5I45A 4W1RA 4TYNA 2P69A 1NNI1 1NPTO 2XZTA 2Q41A 4XQGA 4JBHA 1U7OA 2FSUA 2JEZA 3LZCA 4DCUA 1E9RA 2XJ9A 3R6LA 2Q7EA 2OTJF 1SXIA 1XRMA 5K2MA 3WYBA 3RVZA 3T80A 2NYUA 1C1HA 4FEEA 3TB4A 5JSZB 4Q39A 5BOSB 4PZLA 2Q7DA 3QU4A 3DL7A 2WQ7A 1S72V 4TTPA 4M9RA 4FD2A 3WK6A 1RRPA 3ZV3A 1P9NA 2VATA 4KIJA 2ATEA 3JAKB 3WRXA 1XZFA 1IOZA 2B2CA 3TE6A 3IHLA 4LSMA 1LI7A 3BXEA 1M0SA 4IF4A 1WF6A 4MTGA 4Q12A 4PNEA 5J9PC 3FWKA 3ZWCA 4KE8A 1E1DA 1DO2A 3C8ZA 4LQLA 5C35A 1XNGA 4EJSA 3BF7A 4JXKA 1GKIA 2P2ZA 2IPAB 3A70A 5JRZA 5LMNO 4YRNA 1I3KA 2D2CB 4CL0A 2CTPA 3VTIC 2VA8A 4EHJA 3BA9A 3F7NA 4MR8B 3ABMB 1JS1X 2NO0A 2CT8A 5DN6D 1D2DA 1UEIA 3SJBC 1E3IA 3SJAC 1L4LA 2F3TA 2VRBA 2VHCA 2FRXA 2YHUA 3E9ZA 1IIBA 4V2UA 4PLYA 3S1LA 2NUTB 2YW9A 1WCWA 3K2EA 3KJJA 2Z3YA 1XZDA 1LR1A 2GA9A 1XLWA 3E9QA 2IWHA 1U7XA 1B1AA 3CJTA 2G9RA 5J1TB 3UJ8A 2FFHA 3M6IA 1XKTA 4HPJB 3DZDA 2OBLA 4K28A 1T4CA 2YBEA 3HG7A 3CUVA 1YV9A 4Q1EA 5CK5A 1LW6E 3LP5A 4PQGA 3K0AA 4A91A 2OCXA 5BVHA 3S1AB 4S12A 1KSGA 5IYZF 1CIVA 3RRXA 3K0FA 1ZL8A 5IY5C 5FLXN 1A77A 2DHEA 2Z6UA 4NBVA 4CKCA 4YAJA 1UPFA 1Y34E 4GE0A 4I6JA 4V0ME 3UK6A 3MOSA 1ORTA 3OONA 4MNTA 3UHAA 2IS4A 3C7DB 3KEQA 1E5QA 3KQTA 3CGGA 1MV5A 2FF5A 1EA5A 3KB1A 1U3CA 1YZFA 1X8KA 1JMKC 2WLIA 2ZWMA 2IW5A 4ZAFA 4EPRA 3OQOA 5ALNA 2YJ4A 2GBCA 5DTRA 1WXXA 2BN4A 5K51A 3UUGA 3OR6C 1XMSA 1I2MA 3EW7A 3O3MB 2W6ZA 3PFCA 2RKOA 3RBXA 2F9MA 2FUCA 1NFFA 1RXYA 3OEHA 4OXKA 5D2CA 4NY1A 3F97A 4AZ3B 4EBFA 3I62A 3OBWA 1T2NA 1SU6A 2P6MA 5DSZA 1JJAA 3B3AA 4G4SO 4QYIA 2CB9A 4Q19A 3QBDA 3EGVA 1UCFA 2RB5A 5F3RA 4TLDA 4MA0A 3RAPR 4BDSA 3TF5A 4J0QA 1PZHA 2ZRMA 1MABB 4MZDA 2F1RA 2I76A 1UPAA 3EGOA 3KCQA 4PFSA 1WSDA 4MLCA 5CVVA 4DABA 221PA 1TCCA 1X42A 2B1RA 2GSMB 1CLIA 2DPLA 2ZT8A 3I9MA 1QB8A 3AP2A 4KIUA 4NG4A 5J5VA 4D0GA 4PIPA 3HCWA 3EXHA 1X8LA 4PO9A 4LX8A 5H0IA 2HCRA 2DQKA 4ICIA 4CLEA 4OXQA 1C7FA 4FMBB 1DJNA 2IYZA 1CY1A 3PXXA 4IIBA 2VDWA 4FLVA 2XXBA 4LFAO 2QX7A 5C5IA 5JC1A 2Z43A 3JSXA 3AJDA 5EG5A 5EIWA 4UD6A 4R68A 3F74A 3HYTA 3C90A 1XEXA 1E7WA 1PQ4A 3VNAA 1ZL0A 2R751 2IEBA 3KG2A 1VQLV 1CY8A 1P74A 3AERA 4KE6A 4Q7LA 5FO0A 2PH1A 5SYAA 1Z2OX 3OZFA 1V5FA 3RFVA 2WSSA 1D2EA 2OQ2A 4H0LB 3A26A 3EZGA 2RHCA 2NU9B 3U7GA 3RYIB 2G83A 1JXOA 3AUUA 3IJ5A 4DBZA 1FYDA 3UFXA 3LWQC 4H60A 4KN8A 2YDEA 2RJNA 3GN2A 2X0KA 5JNUA 3C5HA 5C46F 4DQUA 2XWSA 1T3ZA 4JQOA 5DT9A 4F5WA 3MNFA 4G56A 5AKHA 2BR4A 4L0QA 3E7XA 3DO6A 3ZDZB 5D5QA 3HXPA 5MN5A 3OT5A 5I7VA 3DAOA 4YWHA 2H1LA 3ZXSA 4EMUA 2V6IA 4EPXA 3E89A 1YB4A 2FW6A 4OREX 1I9GA 4DCPA 5EKDA 5F9FA 3G8AA 5AICA 1ZMOA 4EY7A 4JB0A 2OYQA 3OZ7A 1N2XA 3VPBA 1M56B 2ZB8A 4H9GA 3BWBA 5GTHZ 4LE0A 1OZ0A 3IOBA 3K2IA 2QUKA 2O3JA 4MS3A 1TT7A 1U4SA 4WKCA 2JJYA 4HLUC 4E5NA 7GPBA 3NB0A 1JFVA 2Q4DA 5GJVC 1CQWA 1WUIS 1AOXA 1VMKA 2AQKA 2PLRA 5EMKA 4KUHA 2BCJQ 3VC2A 4EZIA 2GVNA 4XKJA 1U1DA 4XJSA 1CW2B 2M32A 4M7OA 4FLXA 1O96A 2Y1XA 3OE4A 4H0FA 4Z9XA 3L04A 3R0ZA 4Q7MB 3TN7A 4B3FX 4BE9A 3C3YA 1E9DA 3WMWA 1YCDA 1W8DA 4E32A 2R2AA 3MUEA 2G07A 2QVCA 3IUYA 3S2SA 2XITA 1O89A 2F9FA 2Q1XA 3AF4A 4WD3A 3O8OB 4UQPA 2WFMA 1S5JA 2DMXA 4HSGA 2GBOA 1IULA 1PLKA 4BFCA 1IRXA 1GZ6A 1QTRA 2ZK7A 4YWJA 3PGVA 2OORA 2HA5A 2OCBA 4XPZA 1P0QA 4P4GA 4GEKA 5F2KA 1IN4A 5LU9A 3OPYI 3L73H 4GE3A 3V55A 1A32A 4EF4A 2ZUCA 4OQFA 3ESXA 3RHTA 5BNWA 4O2BA 2XUGA 1W49A 2GILA 3AIOA 3NATA 4Z86A 2UZ4A 3VR4A 2E4WA 1TRKA 1ZCZA 5JCPA 2NQ8A 2EC5A 4IXDA 1QH9A 2CY0A 2JAPA 2LBPA 2R4UA 3ESRA 4IJKA 1FYWA 4ZFNA 5KYXB 2VRNA 3BGOS 2XVZA 3OJCA 5JO0A 2WTBA 3K0GA 2PZ8A 1LVGA 3GT0A 4UFZA 2E75B 5JYBA 1JEJA 4NJEA 4RZ3A 3LWNA 1G6OA 4MVSA 2QE6A 4DCJA 1TK2A 4J94A 4KWEA 1Y3FE 3ADOA 3F5WC 4D7TA 2ZWOA 1ZFNA 2WVAA 3I04M 5LFAA 1P62B 2P9QA 1XKQA 4NE2A 4PZZA 4CMHA 5JXHA 3TWOA 1JA9A 5JXIA 4XQCA 1WY7A 3JQ7A 2NLJC 1B74A 3NM5A 1N0WA 2QTFA 4JEIA 4C0WA 4KFCA 2CMKA 3UTCA 2RGXA 4NICA 2VDMB 1FJXA 3TMKA 1N8TA 4RMNA 1JCHA 1A76A 1BS1A 2GCGA 1FP2A 3QX9A 1A96A 1UBKS 4I14A 4I19A 4A8TA 1ZW6A 4ND3A 3O8DA 5DI9A 3PT9A 3AVYA 4TTVA 3L8FA 3T99A 2VXCA 4LC9A 5T7BA 2C9BA 4AJHA 3TLBA 4QPNA 5K8VA 3GOQA 1YR6A 4YXWA 3IXQA 3WISA 3H5IA 2PMWB 3I1IA 4ZODA 2WAYA 2XYQA 3G2KA 4XE5A 4B3TO 1PBTA 1XXHE 5TR9A 2QGNA 3ELUA 3NANA 1I6WA 1KYZA 1Z6GA 1RIIA 2HCBA 2IHUA 2N1MA 4MQ5A 4ISBA 3BGIA 3HY6A 3NNSA 2X2PA 2WLNA 4CTJA 5HYVA 4TV9A 1L8DA 3CVXA 4R8RA 5EVCA 2QLTA 2XEXA 3MWFA 1R3KC 5TT1A 2GZMA 3JAMM 1C1DB 1HGXA 3HFJA 4JC5A 1C5KA 2JI9A 5AJXA 5KNBH 3ABQB 3DQQA 2CWWA 2VK1A 4YH1A 4KGVA 4AUNA 4UB8Z 1LV8A 4OO3A 5IBRA 4QZVA 5LJLA 2C9DA 2CVLA 4H7KA 4HTFB 4KQIA 1OQAA 1M54A 4C08A 5T41A 1D6MA 1I4OA 2DFDA 4ZGBA 3D6TB 2G82A 1JZSA 4JBIA 5ALZA 3HM9A 1SQ5A 1J8FA 1Z6YA 2B0CA 2ECQA 2WHPB 3AI1A 3EC1A 1KYOF 1W3EX 3PHBE 4IJQA 1CY7A 1IZYA 4IGIA 2XMRA 4IUDS 4TZKA 4OUKX 3SR2C 3G71F 3SLKA 1NRJB 1O54A 3ZCRA 4YYZA 5ALVA 3FPGA 4LWSB 3FFXA 2V7QA 3GNTA 4MIOA 2W4MA 3BCHA 3H87A 4D8YA 5C2JB 3L0PA 5CA1B 1WV1A 2PO7A 3QA9A 1G6UA 3MZ0A 5EJGA 2FQYA 2FW7A 2WM2A 3D8UA 4YQYA 4B6GA 1Q0TA 2DHQA 1SA0B 1X7OA 2QEQA 4IL6Z 3Q88A 3AHCA 4OA5A 3R09A 2CJYA 3W5UA 1G7RA 3IODA 4PA4A 1KMQA 2IUFA 4LHVA 2EL7A 2GD2A 3FPFA 4LMRA 4WLNA 4BJ3A 4AF6A 1YIAA 2QY9A 4QOJA 2JFUA 1Y3BE 1XT6A 2PFSA 1Y3IA 3G8YA 4OQZA 3WQSB 4YLYA 3SZRA 1BE3H 4HDRB 5J2TA 2MQEA 5GM2A 2C8LA 4OSOA 3FFQA 2B5WA 4QUBA 3TZBA 3IUNA 4RX1A 5DX1A 2GEJA 2MWMA 3V4RA 1EFDN 1V9SA 2X4LA 3I05A 4BNXA 2AMVA 3MS2A 3D6MA 3FB8C 3CPQA 1YRQA 2FVYA 1EFPA 1CUHA 4DUZB 1BCRA 4MRMA 4RA9A 1PV0A 2G5GX 5CCDA 1OI3A 5AKLA 1LDYA 4GRAA 4YUZA 2XSZA 1T4GA 2JHFA 4M9XA 3M4YA 5KSPA 2ZRKA 2FW0A 1S1MA 2EF0A 5JCOC 3LSYA 3UWMA 5C8YB 2PNFA 5A1JA 5B2EA 1R6XA 1M34E 3PXUA 4P53A 3SXUB 2HHHO 4PW0A 1F4VA 3LRPA 4B0PA 4RK5A 4O4HF 5G4UC 1CZRA 4J7XA 3L46A 4MINA 4MWCA 3AF3A 2H08A 4Q3KA 5JSHA 1S5PA 4RJIA 4KVZA 1R6VA 2Y9MB 2Z3VA 1DUSA 2QT0A 3ANNA 4WOBA 5IBCA 2MW2B 1TKRA 2HUPA 3UWOA 4HFNA 1Y9ZA 3BZUA 4BYMA 4LF4B 1MKYA 2GPSA 4NVPA 3PPYA 2QMYA 2VJPA 3TRFA 4ENPA 1VP7A 4WNAA 1Q1BA 4D4KA 3INGA 3D6HA 1SQBH 1M2FA 1XAJA 2CE7A 2E3JA 2JIDA 4M9CA 4WACA 4PZEA 4QOHA 5KMGA 5LYJA 4BBZA 1E1RG 4KWTA 1SQ0A 1HDRA 2O7NA 1RZRA 4CCSA 4MUFA 1XCGB 2AOTA 1BMQA 1PYDA 3WRWA 1EPUA 1SVNA 3DTNA 1QFXA 4HMPA 3BJMA 4RW0A 3SD7A 4FM9A 2JHGA 4DC1A 2FHSA 3GGGA 1VLZA 4O5OA 4RXMA 2VNIA 3WVNA 1BJKA 1UT6A 3CCUV 1SBZA 2Z95A 4MW5A 4TKLA 4NXNB 4QPZA 1SETA 1QQ7A 3DKVA 4I9FA 2OTMA 2EZ9A 5FNVF 3AQ4A 3WK7A 1Z6TA 3MLBA 4LXHA 1KY3A 2ZUUA 1JQLB 2RHRA 2W2PA 2GZAA 3QVTA 5L4LA 1E8NA 4MKXA 1U99A 3A6KA 3UUEA 1ZVVA 1C8LA 1L1RA 3CNHA 3VV3A 5JYCA 1TKAA 2QD4A 1CUBA 3K70D 1SRYA 1Z4QA 2XAHA 3ETLA 4QXRA 5J59A 2PI5A 3IAYA 2ROQA 4XVCA 2EW2A 4NABA 4R83A 5F5XA 1RKBA 1NMEA 1YQGA 2ERYA 4MKZA 5AM2A 3KWLA 5K0ZA 4GR4A 2FJUA 2R1VA 4FLFA 5KS2A 2OTLV 4R7CA 3AUXA 3ANTA 5JCOA 5BW4A 2PXHA 4FEAA 3R75A 3QQPA 1FPOA 3F4KA 3CNBA 4RTOA 3N4ZA 3D8NA 4B5LA 3LBAA 4X0EA 4E3ZA 3WJ1A 1BQ4A 2AVDA 4HRYA 1Q0HA 3RW9A 5JU6A 1STOA 3CRCA 1TGOA 2YXNA 3G1TA 2RK4A 1QKJA 4OIFA 5LLTA 3GP5A 3TE7A 2IP4A 1UWKA 1XLTC 1YA6A 4TMTA 4MP6A 2IZ5A 1RPTA 4RMGA 4O4JA 3QA3E 1MQ9A 1BCRB 1FUKA 3AI7A 1KAQA 1SCBA 4R98A 3H19A 2A0WA 1P39A 5AT1A 4EZBA 4DGSA 4QRDA 2PSHA 4JZKA 5B3AA 3I61A 1RRFA 1SD2A 1SVUA 4IR7A 1FUYB 1CJTC 3LWPC 2CLSA 2OAP1 2QF7A 2WDZA 5CFRA 1Q92A 1RR6A 1VQ1A 4D7SA 4Q3NA 4UAGA 4X8MA 2P3QA 2XDWA 4K6KA 4CIDA 4FILA 5FT9A 1QC5B 4LCBA 4EY4A 4IWYA 3W6UA 4GVPA 4M98A 3PC2A 2JLWA 1C4WA 3MJVA 2QMQA 4FD3A 2CDCA 2GCEA 3IP8A 3HNOA 2PH7A 4XB1A 3OX1A 1PJ4A 3IB6A 3C3DA 4OK6A 3AEYA 3OMNB 5CDSA 1RJ9B 4DK0A 2PZSA 4JNCA 2XBUA 1NNEA 2QLBA 2QKAA 2AZ0A 2BLNA 3TNLA 1YZNA 2PUWA 2P3SA 3CLHA 3LXUX 5AM0A 1WE2A 5EJ6A 1BMFA 2O2JA 2GA8A 5KHKA 2W71A 3FMGA 3IP3A 3LUKA 2ZBDA 3RKRA 1D0IA 3OE5A 2QLLA 1QOQB 2Y0BA 3EZ7A 4O08A 4M0FA 3PEWA 2P2DA 3HR4A 2GK3A 2AWOA 4X63A 3WGQA 4FIDA 4BBJA 2G9QA 3ZIAD 2I0FA 2B35A 2C31A 2MK3A 3B6JA 3C3EA 4JVNA 1OAAA 2QI9F 4KYIB 2D2EA 3TR0A 2X42A 3H3FA 3OQJA 2AC7A 4L51A 1Q7EA 3FPJA 4TSFA 2F67A 1UKZA 1BMTA 3GVCA 4PAWA 3DEIA 3KB6A 3ZHCA 4PTYA 4LX0A 5TQ2B 2ZJ8A 2GTPA 2ZG6A 3A6ZA 4F56A 2VP6A 3V1NA 5H2FZ 3E7FA 3U3ZA 4GQBA 2AMLA 2IRWA 3FLMA 4DIDA 3HJHA 1Z26A 4OQMA 2VDOB 3IA7A 4HPWA 5EAIA 1H2WA 1QV6A 3H8SA 4J29A 3SBOA 4ZKIA 1NATA 1RYDA 3QBTA 5CDUA 1YJWV 4FCWA 3T61A 4FJ0A 1N0UA 4A8JA 4AKGA 3SYMA 3BFVA 3CX7A 4BAUA 4EY8A 5HZHA 4OBWA 3CCMF 4OGLA 3LX5A 4IMRA 4CMEA 4DKXA 2KSQA 4DM3A 2PGJA 4X66B 2A2ZA 3OCCA 3PJDA 2Q5CA 1YAJA 3ENWA 3F6RA 3DQZA 3IQIX 4LJ6A 4MHSA 1W5AA 3IMPA 3MMZA 5KU7A 2JVJA 3OSZA 1P4GA 3J7AU 3N6VA 1GPMA 2HK7A 3DZ8A 3UT6A 4C7KA 1K5GA 3U4AA 3LCJA 3W9BA 5EWLB 1I4WA 1OXBB 2LR0A 4QYMA 1WDLA 3HPQA 1PK9A 2G6TA 1GKUB 1R10A 2J7KA 1WJGA 3QXHA 4DLTA 2ISQA 4KVAA 2E74B 2UYNB 1ZGJA 2VHQA 2QR4A 3FUVA 5EJ2A 1AKTA 4OAQA 1UIRA 3QPUA 3LKVA 4MPDA 2B2NA 1CUJA 1X80A 2CN1A 2DC1A 2M6SA 3QKIA 4GD3Q 4BDTA 4E3WA 4JY7A 2FK8A 4IRUB 4BGVA 4UMDA 3CUSA 3HJGA 5KKNB 1THZA 2XY4A 4NOKA 1PHRA 3CCFA 5JS7A 2P4KA 1YIJF 3R5KA 1Z0FA 4MUBA 4Q93A 3ABIA 3TL2A 1OVGA 3ZE8A 3OQPA 3DD5A 4LXQA 1CUUA 4FBGA 3DWEX 1TCBA 2GERA 2XNCA 3AONB 4URHA 1ONOA 1QG6A 5F1YA 1R18A 2OGTA 3I9FA 3LPMA 3TAUA 3ZK8A 4AAYA 4HDNA 4ZOLA 2O59A 5KYUA 2BSKB 2GO1A 4FBMA 2IK8A 1ZEMA 3W90A 3PP8A 2L17A 4PIMA 3ZNOA 3G8CA 5FWYB 1H4SA 3LIPA 5BVGA 1L8LA 1U8XX 1WXGA 1SCJA 2BZGA 2HIHA 3LY7A 3U19A 2WUFA 5KUKA 2QPLA 4RK6A 4RKFA 3SIPA 3DBHB 5I7UA 2W2LD 1LA2A 3ETQA 1Y4ZA 3BXGA 1X15A 1XPJA 2V8BA 3H13A 3I6BA 5B1AC 1RI4A 3ZOPA 2I6UA 2Y0DA 3IA2A 2J0UA 2C4VA 1DPFA 2A9RA 3CLRD 2XAUA 4R4JA 2PUAA 2HQRA 3C5CA 5HIMA 3C1TA 1E2BA 4O2BB 1EZVH 1Z0ZA 5MDHA 3VX3A 1NFRA 4ZHVA 1IHOA 1V1RA 5DULA 4CMAA 2VSFA 1PNLA 2EGUA 1TQHA 3K5LA 3OOEA 2J0SA 3OWOA 3F0FA 1XA0A 1L0BA 4QX6A 1QVAA 2HMYB 3DULA 1YI2F 4I3FA 1E32A 2B7LA 5B3JC 4J4TA 2FTKE 5LP6B 3UT5B 4OXRA 5HOQA 3GVMA 3TFQA 5KNBA 1W0JA 1P84F 1NIJA 3B2QA 5IKMA 1TQ2A 1USVA 1FUUA 3NEJA 1VQ9F 2AKAB 2QORA 3P52A 2LP4Y 4LVNA 2RCNA 1D9XA 2W98A 4G88A 2OBXA 3TD4A 1BU8A 1YKSA 2OYSA 2Q27A 1DC7A 2XVAA 3IAM1 1EZJA 3MCQA 4QBFA 4ZAYA 3I09A 2M2IA 3IXMA 1QLHA 3QQ5A 5E9AA 2EARA 5KWJA 1F2DA 4UCXA 1YEWA 3BM5A 4QUKA 3T9CA 1HP8A 13PKA 1GZUA 5H4HA 2BCGY 2OORC 4H1WA 4C4ZA 3QTYA 1NVDA 1N4DA 3GGSA 2VTBA 4AI8A 3CKYA 4FMCF 3HH8A 4RTLA 4DE5A 2A9KA 1FRFS 2C04A 4R05A 3QNMA 1Y8QB 3IEQA 2J9FA 2XB6A 4OHCA 4WK2B 3CUTA 4RGQA 4D6XA 4H6PA 2ONKA 5CW2A 1X70A 2RHTA 2I9PA 3QG1A 3OT1A 3DWGA 2VQ6A 2C2HA 2XUIA 3GARA 1N5MA 3QYAA 5JRJA 2JJ2G 1HYQA 2VXBA 3KZNA 2HA0A 1G8JA 4AQ7A 1CRZA 2WVJA 1FLNA 1SBNE 1OWPA 3HMQA 3L7JA 4P35A 5C5EA 1OH8A 3NTQA 4E5UA 1A9QA 3ICQB 3MMPA 5BSWA 2ZAIA 3DEFA 3IEIA 4GPAA 2ZSKA 5SZKB 3U0VA 3W34A 1EFRA 1NNLA 2I6QA 3B8EA 4X1IB 2O50A 3K53A 1YRHA 3AFNA 4LOLA 2A92A 4U3JA 1H48A 4L8VA 1PDWA 4IIVA 1EK2A 3QUSA 4IEIA 5DN6G 5CB4F 2LFRA 3R8CA 2HA6A 1ADCA 4EB8A 4FZ0A 2C7GA 2IZ1A 1PEYA 2XHBA 1G5RA 2WJZB 5D6NA 1K6EA 2F8LA 5F35A 1JEYA 1ZU5A 2CJWB 2OXIA 2CZWA 1FFEA 1MH1A 1WNTA 1L7EA 1XDWA 3HPLC 2KX7A 2Q5EA 3CMEF 1A8QA 4LV8B 3RHSA 1JSXA 1KI8A 5I9NA 4OPAA 2XDQA 3ZCCA 5F2OA 3CPWU 1DAEA 4G86A 5JJKA 2OBNA 4BECA 3K1YA 1N3IA 2E6UX 5C80A 1THTA 1XX6A 4V1CB 1SQQH 4DW0A 1XP5A 1S3SA 2CHEA 5CA0B 5AI0A 3GLIE 3HBLA 4BX2A 1AZSC 1G2IA 2CLDX 3C8UA 3GPIA 3H0CA 5K0BA 1YC5A 1TPZA 2CNLA 1HE4A 1C7ZA 3NBQA 3E82A 1Q8IA 2HIGA 1I7LA 2DYRB 4WLEA 2ZGVA 5BNZA 1QM5A 4GQAA 3K4QA 3DAYA 1NTZH 4XGNA 3CCQV 3R3ZA 4BEBA 4TMVA 4L7QA 3NG1A 3PTZA 5AW2A 3CVUA 4RPIA 1MHTA 4HNUA 3GROA 3N6XA 1NMXA 1YI0A 3ZMSA 2BBOA 2AL7A 4LZZA 3TGPA 5KDLA 1YSCA 4RLFA 3D7LA 3EF1A 3N53A 3FLBA 2ONJA 1KOGA 2B0JA 2Z4RA 1H8HA 1RPOA 4KO1S 4M9SA 5JNTA 1QD9A 3OM1A 2XUKA 2CLLB 3VX4A 3KAJA 3FPBA 1MZFA 4YR9A 2BFEA 5AVYA 2OGSA 5EN4A 3PR2B 3EGDB 3VO1A 2ZS9A 4RLSA 5ERGB 3A9RA 1J09A 3SYRA 1NW4A 4MYCA 1P7BA 1M2OB 2YBDA 4UUPA 4M3NA 4ZVTA 1DGQA 1VHWA 2BL4A 3NTLA 2AJTA 3R9IA 1I7SB 3OU7A 3BG5A 3GELA 3VU9B 4Z7NB 1XZQA 1RHRA 1T91A 4ON9A 3RYHB 4FB5A 3QUQA 3UYKA 2XWPA 2D6FA 3RA5A 2ZE7A 4IYIA 1IPEA 1F51E 1N8RH 3LLMA 1DLJA 1V7ZA 2WYHA 3DR3A 4URYR 4KCGA 1CK4A 5HKAA 5FPKA 3E27A 1Y81A 3I9JA 3ONVA 2J46A 4CC5A 3PE4A 3SF8B 4BIZA 1OYVA 1RS0A 4DYLA 4IWXA 2QVBA 3F0GA 1SUDA 3T12A 4L0CA 2AIFA 1C3XA 3LVQE 4UD2A 4KE7A 1JH8A 1K3TA 2NR5A 1IFXA 3N75A 3NC4A 1DZ3A 1GZSA 4FIZA 4QOEA 1JR9A 4WXEA 1QBGA 1K7DA 4IQ0A 4RDIA 3E23A 1P1JA 5BPHA 3TPFA 4F2GA 4EMTA 3F3MA 4EX6A 2OD2A 1K86A 3SYQA 3FRJA 1GFSA 3S1SA 2YWEA 2V7QD 1JDPA 2IX9A 2ECFA 4RMJA 2OZLA 3W5AA 1PQYA 2RAPA 4HYYA 2QRPA 4JBYA 4LHZA 2X8JB 3PHIA 2QL7A 3MT8A 3NWEA 1RJWA 3LQRA 3EQ7A 3G6EF 1J8YF 1YMVA 2HSGA 3JCZA 1RM1B 4GKJB 2VZ0A 2BFCA 2YVAA 1BN7A 3E8HA 2GM3A 1V9CA 3NQ41 2IH4A 3I8SA 3KSAC 1ABFA 5LNK1 4RY9A 4GYWA 2A3RA 3CYPB 1WPQA 1IJEA 2Z2JA 3EZ2A 2QD3A 2ALJA 3ZNQA 5GZ6A 1IOWA 3ZI0A 4DZZA 2WICA 3LE8A 3GFPA 4IQ8A 1NP6A 5KZMB 5BSEA 1AT1A 4IGAA 4M21A 2C3UA 1YU6A 4P0TA 4WXMA 4J0JA 4ZV9A 5CVTA 1FW6A 1OI4A 3AWIA 3HWX1 4JI1B 3RUCA 1C30B 4FMDF 1T8TA 1A2OA 3KBBA 5ES4B 3LUCA 3RARA 3E84A 3DO5A 4E30A 3RNOA 4RPJA 1MVNA 1JG1A 4EFNA 3A0BZ 1OB2A 3ASZA 3P2OA 2AR7A 4L6IA 4L50A 4LGCA 1QJ4A 1F1JA 4MKIA 3PWSA 4HMOA 5AVKA 4BE4A 5I9LA 5EP3A 2VQFO 1I7PA 1N1DA 3B85A 2GJ9A 4L9SA 1XGKA 3GEEA 4D98A 4WY2A 1M10A 1Q95A 2ZUWA 1L7AA 3CA8A 3IH5A 4CKWB 4ESEA 5JZVA 2E4VA 1BWQA 3WU2Z 3P2MA 3Q3VA 4B6SA 4PZAA 3OOHA 5JCJA 4ZEMA 2JFOA 3H2SA 1ABEA 1Z29A 1IY0A 1JDNA 2OP0A 2PZBA 2QN7A 1T1IA 3MFYA 2X3YA 3U4IA 1VYHA 3WG7C 3ADDA 4IGFA 4L8LA 3RSHA 3R4VA 1TJ5A 4EG1A 3LGSA 3V42A 4DMMA 3FD5A 5KTMA 1FIUA 1QCZA 2VQFB 1BHO1 4ZJYA 2V1XA 2GHRA 3JZAA 3PJEA 4HFRA 4B7AA 1FFTB 5LYJB 1RHUA 1T29A 1PX0A 1Y6XA 2QGZA 3IE2A 3RF6A 5EJ9A 3K70C 2AJ8A 3PLRA 2KJQA 3DEJA 5L3CA 1FSPA 1RBQA 5JFGA 4N21A 2ANBA 4G26A 4IZ6A 2PLFA 4K8RB 3R0JA 4MW0A 2ZVZA 2PUGA 5DM1A 3E8MA 1XXLA 4PPNA 4CR8A 5HXZA 1W5EA 4EG8A 5KNBD 1ZBDA 1T3LA 1J7KA 4R7ZA 2IODA 2O0HA 3MMXA 4YFVA 2ZSIA 3W7SA 2WNSA 3MFQA 4RHTA 3JWEA 1HNWB 3L8EA 3O6VA 3FMIA 2OCLA 2EWVA 1FNSA 2JGLA 3NHPA 2PUSA 3U3XA 5B58T 5FLXA 2IQQA 5TPZA 1M1UA 4DRZA 1RXIA 3ANYB 4BNLA 3DVQX 5BN3A 2ORIA 1Z7GA 3TUJC 1KHHA 1MFPA 3BTUA 4Z1MA 1C2TA 4FI3C 3MXOA 2NNUA 3GPBA 3FAKA 3H5RA 3ZY2A 4Z9AA 1JW9B 3OC0A 3BCSA 2HLDG 2O20A 2OXCA 3IPLA 1T3SA 4CM5A 1XUQA 2DQYA 2NN3C 5AK4A 2PANA 1O6CA 2PX2A 5ENZA 5GGYA 3C6MA 1C0PA 1T3HA 4RS4A 2WVHA 3HM2A 3GUYA 2WJGA 1X7ZA 3RYFA 3A1EA 3KKMA 2PH5A 2X6BA 4HN4B 5REQB 3PX2A 4W8OA 3V1TC 4BVEA 3EUEA 4CUZA 4Q47A 3Q5GA 3R41A 5MFPA 1CRPA 1MJHA 5D3MA 4RF3A 1VA4A 1I0ZA 2YS6A 4OV6B 3DMYA 3B78A 1DG1G 4FZRA 4B4WA 3CEAA 1TMOA 4JI8B 4MITA 4PTZA 2EW1A 4DXAA 1WB4A 1VHAA 4CT0A 3IALA 4DPLA 1FE8A 2BKAA 5LXTA 4BVQA 2VRWA 3L2OB 5E1BA 4EHLA 1HQCA 4FOSA 2DFVA 3W6ZA 1KYTA 3DE3X 4A8JB 4F5DA 3EDMA 3P5SA 4AN1A 3P4EA 4HAYA 3OPXA 1DKLA 2H51A 5E2AA 4DGQA 1JJFA 1GD1O 2HP0A 4JLMA 3ZXYA 4AKSA 2I4RA 4U7FA 4BTVA 2CJPA 1T5BA 4PRKA 5I9BA 1JPNA 1HWYA 1TL7C 4Y2RA 1GT91 4WVLA 4OLAA 3KHNA 3CC7F 2O2YA 3TRIA 2V7UA 2V74B 1EJ2A 1WW3A 2ZRAA 5GM1A 3V4PB 3NTOA 3RM3A 3W78A 2EIKC 4EB6B 2H2GA 1RAGA 1VMGA 2B9EA 3IQZA 4Z5XA 3RKUA 4R40A 2FZ5A 5H5JA 3GLKA 3CXUA 1QFYA 2VYVA 1K4DC 3PCRB 4D3DA 4D5GA 4JTAB 4W4LA 2V6JA 3FX7A 3IMGA 4DLNA 4FI3F 4UCQA 3WHPA 1PNQA 3U09A 1RI1A 2EP5A 2ZBGA 1RAHA 2GJ8A 1RCTE 2DKOA 5FPSA 3EZ9A 2XWBF 4J41A 4MGKR 4X1OA 4BVGA 4BFUA 2B98A 3AUTA 2JVDA 3EK2A 5DCVA 4HQLA 3AV3A 3COWA 2B92A 2RHMA 1E3JA 1LV7A 1PQUA 3Q3CA 5K3AA 2NQTA 5M5BA 2ZU0C 1Z6QA 1GK9A 5B5SA 2PVCA 1R2QA 3WB1A 4P22A 3G49A 1H9CA 1DC8A 5E7QA 4WOJA 4KIWA 1KYVA 4JB8A 4BC0A 2NZVG 1KZ6A 3IR5A 2VPYA 3EUWA 2PSSA 5AW5A 3DFKA 4O2AF 2AN9A 2XOKD 3JQ8B 3U48A 5C8DA 3H4IA 1RRMA 1T8RA 4W5OA 3K1ZA 2YWHA 2IEZA 5L53A 3QFHA 5U1PA 3D3IA 1S7GA 1KI7A 3O94A 4QYTA 2QA5A 3VZQA 2LWIA 3USES 4JI0B 1E99A 1KJIA 2JCYA 5T4HA 1V9LA 4B2IA 2PTGA 3F46A 1ZH0A 2W2KB 3JQ9C 4FX2A 3GLFB 1QIMA 1MRSA 2HQBA 3FDIA 3H5WA 2F3SA 4CETA 4O29A 1Z45A 1GEEA 3F9IA 2V5AA 1MSDA 3NEYA 3FUTA 4X20A 2Q4PA 2ERXA 2WFZA 3HYLA 4DMLA 1W42A 4L8YA 1ADGA 2YYYA 3NVDA 4FGUA 4UFNA 5EZSA 4FYPA 1MTOA 2IHYA 3P9NA 3UATA 4U2EA 3TTVA 4AT1A 2JS5A 5AQEA 4LH6A 2WE8A 3SR0A 2P6NA 4U39A 4LDAA 3UH0A 1JDZA 3O8BA 3PFHA 1WM1A 4UARA 5JUWA 5CG2A 2JGEA 3OZWA 4XPIB 5KYUB 2O06A 5KOIA 3SLRA 1KK1A 4YCDA 4AO6A 1OLXA 2WF8A 4YDQA 2K2QB 2YWXA 3FOCA 1NE2A 1URPA 4MYSA 1I4TD 1XLVA 4HO1X 3QEKA 2RHHA 3IBGA 4BVHA 1Z17A 4KL8S 4RTSA 5EP4A 3AEKB 4EENA 4B3JA 3THWB 3CRMA 2NACA 3WKAA 1SWWA 5GTIZ 3DR5A 1HLPA 1MGOA 3NBAA 3QFSA 1SZDA 5ELXA 3LDCA 4QTUB 4EEQA 1X0XA 2W2OA 1NM5A 2X40A 5CJJA 4OM8A 4CQLB 3E18A 1C30A 1MX9A 3TPCA 3WNDA 1R15A 3FFTA 3PPWA 3MK31 4E03A 2H1OA 1U0RA 3A14A 1OZHA 3N8IA 1PF5A 1XAGA 2TMYA 4MMYB 2YC0A 3TLKA 4BO9A 3GOHA 4ZGWA 1DAOA 4ZBMA 3VOAA 1M6YA 2NU6B 4HDCA 4MV4A 2XRFA 5CT8A 2A4MA 2J5QA 2OCCB 3BQMB 2JBHA 3EVGA 3ZW8A 4UTPA 4GKAA 4YB8A 3ZZUA 4MAFA 4E7PA 4TV9B 2QOEA 3HR8A 4YRKA 5FBQB 5HF8A 2CXOA 4LKOA 3UB2A 2O14A 3LT5A 1EVYA 3ZCSA 2FDRA 1QNMA 4RK4A 4MWBA 1MUUA 4TLEA 1TA0A 1U8FO 2GVIA 4JVSB 2D4HA 4QEZA 2EQ5A 4JVMA 4QBIA 1N77A 2WT9A 2X8JA 2R00C 3TMAA 3RWRD 4MCAA 3N28A 2PRJA 2A0YA 2EBHX 3P9RA 1SERA 3AR2A 5LIPA 3ZRWB 5DLPA 1I5RA 1KI6A 2CHGA 1HXHA 3RS0A 1CT9A 2GHQA 4GCZA 2DFNA 5HILA 4AFNA 4A92A 1VQ6V 1HTTA 3PR3A 4J03A 3TGLA 2JFPA 2XA9A 1D4OA 1QIFA 3EDCA 2J31A 4Z2WA 4ZU3A 4WKOA 1V95A 2CLKB 4L0DA 2E89A 3KJGA 4EF6A 4LQCA 3KVYA 4UU1A 5CFZA 4PGMA 3PLNA 3ZU6A 1VQOV 5FUXA 3ROFA 1ZD9A 1US8A 4S1OA 5AOVA 2FWAA 3D3EA 4RFLA 4B7CA 3HJRA 2ZBQA 2HZBA 3FWZA 4KVGA 4U00A 4ISCA 5JQWA 4R3UC 4BWFB 2QUZA 1IDN1 1Z07A 3AVTA 1COWG 3W8NA 3IRUA 4ZTUB 3PNYA 1CULC 1SHLA 3HN2A 3DMRA 3AV0B 5BQOA 1UXIA 4YJ2B 1XROA 3O38A 5HE9A 1JJOA 1SZTA 5CA1F 1Z4KA 3TSAA 3TFOA 1JJ2F 3LSTA 3PNVA 1VE5A 1YZVA 1UXHA 3PWZA 2MMGA 2ZQMA 2WMYA 3R44A 2BGMA 3W8FA 3ZXUB 4PG7A 1VF6A 3EIUA 3SJ7A 4C7XA 4JD5A 1VHJA 1H2XA 1M6HA 1KTIA 1OTHA 2ESRA 2IQ5A 2OT3B 2QI9C 3H18A 1UBRS 1OI2A 1U2TA 2GCNA 4W5NA 4KHPO 3CVVA 4BCBA 3NIGB 1K3FA 1CRLA 3KFVA 3H16A 1MVLA 2F3RA 4Y8VA 1LY1A 1B43A 4BO4A 1DOZA 2A06H 9ATCA 4ZRNA 1W96A 4BNJA 5IVPA 2CGNA 3QWFA 5LCXA 3UKOA 4MV7A 2QN3A 1N2CA 1M2NA 1UOQA 4LDQA 1ZGGA 4L9RA 1LI4A 3ZLBA 5T4BA 4YXFA 3IVXA 4K3AA 2EJ7A 1NY5A 4K0RA 2DUNA 5EVJA 3ROQA 3V2GA 1AQJA 1IXRC 1EB8A 4PLWA 4RAQA 4KYTA 3SQOA 4X90A 4N1AA 1XP8A 4HFJA 3LQ4A 2GPAA 3GZNA 3I5UA 2XDQB 4KMRA 5CBPB 4E15A 3TLGA 2ZPUA 3WQBA 4TKUA 4M1SA 4YP1A 3WIUA 3WRYA 4BJ5A 2UYKA 1TIPA 4B3XA 2RGNA 4BO8A 4AS2A 1IXZA 1QR8A 1ONNA 4GVXA 5ALUA 1VG1A 1KZHA 4Y98A 3MHSC 4G0VA 4RAOA 1EE9A 1Z5UA 4B76A 1NAIA 5F2VO 2W6JA 1L0LH 3G6EV 1B8UA 3CRAA 2WJHA 2XEDA 4FJCC 4U3JB 5H02A 5IXSA 3ZHQA 1W0CA 2V98A 2JFVA 1NI3A 3PWKA 5SZIA 3ZLVA 4KR6A 4NQ3A 1GPBA 3R7FA 4L9AA 2BM1A 4BIOA 4Z2YA 3QLTA 3E58A 4UXJA 3RS8A 3I9KA 1CPYA 1N0HA 3VYWA 4WZAB 2CNNA 4JDUA 4HGNA 4PCAA 1OA1A 4YUWA 4P3XA 4GRDA 4PF1A 1UP6A 4D79A 3VR2D 3KAKA 1MTZA 1DAFA 1S0UA 3LF1A 2DHRA 3I6YA 1XU9A 1JVSA 3AFIA 4UFPA 4QELA 4W9NA 5JAZA 1TIBA 1FVOA 1H2FA 1N6KA 4NESA 1B76A 2JLQA 2OQRA 1DEOA 2LJ2A 3CJQA 5LN1A 3I5XA 1QFJA 5CB6A 2J5BA 3TX6A 4OI1A 1JVBA 3R6GA 1HETA 2VT3A 3EMVA 1XRPA 5EWLA 4PHCA 1XDSA 2WSLA 4BKOA 5C7LO 1L5OA 4PX5A 1EUQA 1G21A 4P4UA 4YPFA 4Z4CA 5ECYA 4ND8A 2H0QA 1ODTC 3AM3A 3IEXA 1F8UA 3T7CA 3PQCA 2AWNA 4C89A 1N9GB 2Z9DA 3K0EA 2Q2QA 3IJRA 2AXPA 1KEKA 3JVHA 4EFLA 3AEUB 1PL7A 2NV0A 3GJRA 4J42A 2GAOA 5CVJA 2IYFA 3GLFE 3T54A 2QRVB 3KKLA 1P75A 4GZ3A 5KTYA 4EO4A 2AC4A 4HXYA 4W5JA 1PZFA 3QU9A 3ND9A 3JALA 3N74A 4UDNA 2AHOA 1SG0A 4P1ZA 4ZO4A 5BV8A 4N5MA 1QCCA 3V3TA 1QVFU 2JCVA 5AW0A 2YNMD 2ZWPA 4QE7A 3UM7A 2A33A 3QPVA 5CUQA 2GKOA 5F73A 5K03A 3R6TA 1FCJA 2WWHA 2XE6A 4AUMA 1NVGA 5HK8A 4F0JA 5IUNC 3PAFA 1RQLA 3WWOA 1HRKA 2NTJA 2X0DA 2OQVA 4LVOA 1Z0JA 1CZOA 4OHMA 4G1BA 4FM0A 4NAHA 1T4MA 4BEJA 1RLIA 1RKXA 1VI2A 1FLVA 2YWBA 1EK6A 3L18A 3ZMZA 3RT7A 4JKIA 2DOKA 1TJPB 1PG0A 4FLEA 2DH5A 2QRKA 3EH1A 5BT9A 4EI7A 3CXCU 4KWHA 1G66A 1SVSA 1SOMA 2OHXA 4MGHA 3FSGA 3DNPA 2GGSA 4YAWA 2O1WA 3R0PA 3EGEA 1DADA 2Y1CA 1XQXA 5IKEA 3U7HB 2UXNA 2JH8A 4N3AA 5I8WA 2HV8A 3QHAA 3OPYA 5F7XA 2P2NA 5JEDA 4QAJA 1C7IA 3L1KA 3GZTB 4IF6A 4Z1MG 3TI9A 3C2QA 2P2GA 4L4XA 4GS5A 4QBGB 2ETNA 1SDSA 2QG4A 3OPQA 3ZOZA 2ZJYA 4ANFA 1ZIYA 3EH2A 4BMZA 4I5FA 3N6RA 3GLHB 4JJEA 4EP1A 1UM9B 3DZIA 3RIMA 3H42B 3P3PA 1L8OA 2ACEA 4ZQHA 3GD7A 1HFJA 3KDSE 1TM2A 2J08A 1EK0A 2O8DA 3WJRA 3NVKI 3BDIA 1LPBB 5LQRA 4TYYA 4GUNA 4FKBA 3ZYZA 4D3ZA 1WZCA 5G41A 1Z39A 3R4CA 4LJKA 3CCRV 1D03A 3EJ6A 4B3TB 1AB3A 2JFZA 3NU1A 2XNDA 2DH6A 2B1GA 3FCYA 3KSDO 3QOXA 4LJYA 4P31A 4Q15A 3UA4A 2DYSB 3ASOC 2VTKA 2BMJA 1EX9A 3ZWVA 1J7JA 3L41A 1GAJA 1O8BA 3DVAB 2OFPA 4QXPA 1B23P 3YASA 3LHFA 3Q2IA 1T0BA 3UHFA 1RI3A 4C5CA 4QRHA 2I1LA 3O7WA 1FFYA 1SJ9A 2OYRA 1NXXA 1RYMA 1XCJA 1YFKA 3L6CA 2N05A 4UBLA 1BROA 3KAQA 4ZTZB 1H2MA 5FAKA 1VSUA 4GRIA 4ZZ2A 1KJQA 5L7YA 1L3CA 1PUXA 1PNRA 2PNJA 2XQIA 3TLAA 3O4FA 2QX4A 3DUFB 3P9SA 4LS3A 2BELA 3KJXA 5DRYA 1MOFA 1N0NA 2XLBA 1U3FA 1XRRA 3VPHA 5EIEA 3MYRA 5F98A 3WRYC 1CLEA 1VQPF 1YQUA 4MEJA 3WXMA 4F9FA 4MRVA 2ZNJA 3CJHA 4JAVA 2V5VA 4PV7A 5J4HA 1DAKA 2IOYA 3H2JA 4UB6Z 4QEDA 1XWFA 1VQLF 821PA 4KFUA 1FYXA 2BOVA 2NVBA 5EGSA 2NVUB 3EVBA 4D44A 1A9XA 5H81A 3QWAA 2WQ6A 1Z15A 1ZSPA 5MF6A 5G1OA 1JQKA 1BXZA 5B2ZA 4EVSA 3WGIA 1YQEA 3PUKA 1PD0A 4LECA 4OQDA 5EJFA 3UK2A 2ZBPA 4LFBO 1Q3TA 3CC4F 2YYEA 3EDRA 3UVEA 2F8SA 1MABA 4NJOA 3G67A 1RXUA 2FEWB 3E0XA 4JZYA 1NZ6A 5B1SA 4DSUA 4XR9A 2CMGA 2CVHA 2CZQA 2VJDA 1DC3A 2XD4A 2DN9A 3K3WA 2JI7A 2QUJA 3VR1A 1G4UR 3S70A 2CMDA 2GT1A 1U3VA 2XMBA 2ACKA 4M1KA 1K8AH 1G20A 4O63O 4N7BA 4CEHA 1VQPV 1LKZA 2MSCB 1NRWA 4EUNA 4XDGA 4RNCA 5DYGA 3DGFC 4B75A 2WIDA 1HSZA 2Y6VA 2JC3A 4JFRA 2IU0A 1KH1A 3OZSA 4JJ8A 3S5UA 1XDGA 2GBGA 2ZT7A 3MJHA 3LNNA 3OCUA 4HL6A 2EERA 2HD4A 1U0LA 2Q1YA 1HL7A 1IK6A 3A31A 3PDWA 2Y92A 1D2NA 3AJ9A 4WFHA 4MQMA 2RAFA 3MQWA 3EZFA 3V8NA 3CW9A 2GCOB 1FU7A 1GX1A 4JI4O 3N27A 2YUTA 5ICSA 3JASA 2RG7A 1DFIA 1U2SA 4TTSA 4QEKA 3TAXA 2ZE5A 5K45A 5B7GA 2C9YA 2QRHA 2VJAA 3RJTA 2BSKA 1JI3A 4K9DA 2C5HA 2X58A 4KQHA 4CGYA 3F0EA 5JJIA 3WL6A 3K0TA 1SQ6A 1U8AA 4Q9DA 5TNXA 4CRWB 1GUYA 1E58A 1E64A 5KHLB 3M1IA 3WDKA 5IYCO 1T4BA 1VLLA 1W85A 2P6OA 4WBNA 1ZOPA 3D3NA 1Z16A 1R8YA 2JZCA 5DEOA 4PBTA 4U7JA 4HP8A 3WHIA 1XJ5A 3LM8A 4ENTA 1DKOA 2R8OA 5G53C 2C7OA 1TZMA 3LQQA 3LWRC 3A36A 1MIOB 4FK8A 3C5VA 4JLVA 3UAWA 2YINC 1AUVA 1DL5A 1PJSA 3KZ1E 3LLVA 2YJNA 2P65A 1MMMA 3AG3B 5B55A 5JY6A 4O2AB 3C9TA 2Q4EA 1WP7A 3MWGA 4GLLA 4HBZA 4IINA 4QU9A 1SKQA 4H44B 2OHIA 2R3SA 4GOLD 4YTEA 3NALA 2BHTA 2C42A 3CLRC 3HUTA 4PQEA 3PKIA 2UXCB 2O2ZA 1DRKA 1P8AA 3UXEA 2W42A 4R2MA 4PICA 1WZIA 2G3YA 2RAVA 5EPOA 2XSZD 3NH6A 4YP7A 2GF2A 2XQJA 4KFSA 3ZP4A 3RAGA 5HGXA 1NF3A 3MQFA 4FMPA 4RIIA 1G60A 3KR0A 2YYSA 3KQKA 1IJFA 3D01A 4QGHA 3QELA 4UEJA 1TEXA 1EFRD 1LNSA 3RU3A 3GWGA 4I4TB 4R41A 3ICCA 4BT7A 3QEAZ 1PWXA 1SK9A 5LP6A 4JI2O 4JMPA 3K7EA 3DLHA 4R8CA 3OWHA 4UJ3A 3GRUA 4NTWA 1E9CA 2FQXA 3EIHA 3NVIB 3N7UA 1YE3A 4IHAA 4TX1A 3RU9A 4F21A 4K2HA 2HBRA 421PA 1NF9A 1X59A 2R9VA 5ADVA 2UKDA 1WA5A 4AUKA 5A0VA 2CTWA 1Z68A 1VQ7V 1V1JA 3LX6A 2LQTA 2XMQA 3S0JA 2A58A 2NZUG 3QVJA 4C20A 1NNUA 3LPCA 3ORSA 1YRBA 4RD6A 5TMEA 1FNBA 3H2GA 5I7OA 3D2AA 1DBIA 1OCCB 1JPVA 1PZEA 4WNAB 1AD2A 2B2XA 4B6FA 4DDWA 2LDXA 4BLUA 4NZNA 4KVFA 1J90A 1Z8DA 2HWXA 2CEAA 4P38A 3SOZA 3ZHBA 2Z8YA 4LOAA 3ZDEA 2AW3A 4Q4HB 4PD4F 5EMHA 5AR1A 3SEQA 5IT5A 1XN4A 2DBYA 1WL8A 4WNYA 1N2SA 1P2BA 4J16A 4P3OA 3W7AA 4R1OA 2C29D 4FOLA 1BXRB 1ZQ9A 2EF1A 4WW0A 3U3MA 4B31A 4BKMA 1LDBA 1BH6A 2HBQA 2HA4A 3DKPA 3ONEA 5EB1B 1ZD5A 2JZOA 1DHRA 2YZMA 4GM0A 2J6CA 4ZCMA 2NUTA 1N7GA 5FOWA 3RVMA 5AIAA 4LAFA 5HIKA 4QATA 3CMMA 4TYWA 1K6XA 2FE4A 1TGVA 3GHHA 1KP3A 1XIVA 2BM9A 4TUYA 2GF0A 3CKKA 1MG0A 4C0KA 2NYVA 4JKOA 1L5QA 1ZNZA 3VH4A 2HJHA 2G1PA 1YFZA 4WWHA 2PUDA 4P0QB 5CGZA 3F8WA 3K0DA 1MG5A 4Q0MA 3CLTC 4OUDA 1SC3A 2DFKB 2Z56A 5KNCH 4MB2A 2HQSA 5ALGA 1X77A 4X3OA 4YJKA 3HKEA 5AJUA 1G7TA 3FUWA 3AB8A 3I72A 4DV7B 4B2LA 3P96A 3CXCF 2AYXA 5DB4A 5JVDF 1ADFA 1ILWA 3C6QA 1NVTA 3A9VA 3I1JA 4HEHA 5ALIA 1USWA 2Q6KA 4PA9A 4G0PA 3EC7A 3JYQA 1LRLA 1U4NA 3TXXA 4QIWF 2G04A 4IKOA 4Q05A 3SF0A 4DCGA 2ASEA 3QG5A 1I94B 1D2CA 2H48A 3AF5A 5AXBA 4P84A 2QVYX 3DV0B 1ZAUA 1Y8RA 3DWIA 3TNDA 3V3KA 4F3KA 5LQDA 1UP7A 2CUZA 4H3VA 1B7GO 4Q4AA 5JNRA 3CGWA 4G4GA 4A5UB 3I56V 4O3MA 3ROMA 3QGMA 3C8HA 1GSAA 3H84A 3C3SA 4CGZA 1W2WB 1IC6A 1U90A 2RMKB 1P0PA 4K0KB 4IQGA 4X45A 2AFHB 1M4UA 4XB6B 1Q12A 4G0QA 1EEHA 1JKJA 3J7AR 5KYKA 1UDRA 3S8EA 1P5ZB 4QGPA 3TQHA 4KTTE 2JLUA 3CX3A 3KQOA 1XEQA 5JAPA 3L92A 3BX1A 4HQ0A 4HGOA 1ACMA 1TEVA 4KKXB 4YREA 4JEMA 2CDNA 1TU0A 1NHGA 3FDZA 5EMJA 3LYAA 1YIJV 1NU8A 4V0NA 1EGAA 3VYTC 1BGVA 1OFVA 4G8JA 1IEQA 1AI7A 3UO3A 3H11B 5COAA 1AKYA 4KZKA 5JMWA 1QRUA 1ZY2A 3NP9A 4R0MA 1T3TA 4D8VA 3WB9A 1EWYA 1PR4A 3OIUA 3OD5A 4HWKA 4JQSA 1FP4B 3FCAA 4BWAA 3Q8HA 4P2BA 5IC5A 2YIVX 4XIFA 3SAJA 5A4JA 1J97A 4KNVA 4L85A 4WERA 3QMWA 2Y1FA 5IP5A 2HP0B 4UTRA 2GEFA 3MBIA 3SJAA 3U4GA 2OB1A 1S2LA 4P5EA 1W36D 4C43A 4QQKA 1BSMA 1R88A 3KTAA 4ZYYA 2QM0A 3NFRA 3UB3A 4R2XA 5EXDA 3EIOA 3WLHA 3LWOC 3AW9A 4BUZA 4MTXA 2AMFA 1NSTA 1RSZA 2X5XA 3LT4A 3OEEA 4S1TA 1FFXA 1PT6A 1HNNA 2BI7A 2VAVA 4MLZA 4B8WA 1OBCA 4R16A 4ALKA 1E0DA 4NPHA 4URFA 5C4MA 3PQEA 1DTSA 1ISFA 3FG9A 2GUZB 1M1KH 2GJAA 4WCFC 1P5JA 3H99A 1Q7YW 2AXTZ 4K3UA 5KKAA 3U80A 1WD7A 2I4TA 1XZJA 2Q69A 3U5ZB 1M0WA 1GM5A 4ZI7A 3NJ4A 4J10A 3VMFB 3ESDA 4FFWA 3BTSA 4GI5A 1G1MA 2PLAA 2QVXX 1LLCA 1VLHA 3LY8A 3NAGA 1BDBA 4LRSB 4UBJA 3OY7A 3EWIA 3DHWC 1GTL1 2A1IA 2AG8A 1P44A 2IF0A 3F98A 3HBFA 1KIFA 3RS2A 3TCKA 5KTKA 3DF9A 3SEAA 2CGOA 1CZNA 2QR5A 5TDHA 3FB5C 5I7HA 1G59A 3TIGA 1TUBA 4TXLA 3TW0A 1G2OA 2DULA 2CW4A 3CE6A 5CPFA 4YR7A 1JLMA 3QE4A 3ABTA 1T8PA 4EITA 1P3DA 3SR4A 1HE8B 4PQFA 2WWFA 2YV5A 1Z4MA 4YUYA 4EJ2A 2Q7GA 2FEPA 4Z3KA 1KFCB 4BW5A 1ZHHA 2I8AA 1NVVR 4RGVA 5JWRA 2HN9A 1OJHA 2QZ9A 2GJ4A 4XIYA 4NYMR 4EAAA 1RSOB 3QIAA 4ZI2A 5KSOA 3DAGA 1S2GA 1WD5A 4IEEA 1JECA 3PNLA 2EBOA 1E1CB 1U11A 1YA8A 3GT4A 5IH7A 1I9CA 1XI2A 5GGXA 4NBSA 4MTOA 1WZUA 1QQ6A 2IIVA 4L02A 5FCDA 2CHUA 1YASA 2O3SA 1K66A 2YJ6A 3B2NA 3FB7C 4XXHA 3NR7A 1M5UA 4FE3A 2XCTB 4UUJC 1FSFA 2ZIXB 2RCVA 3G13A 4DG8A 1YONA 2BKLA 5HTKA 3E4DA 1GG5A 3G02A 3C5WP 4M54A 1EVIA 3IP7A 1OI7A 1MAAA 5EHXA 2ZDIC 3HTNA 1JXAA 1X2BA 4D8TA 4IH1A 3L4SO 5B1AB 4IYRA 5E8RA 3UAVA 4CKXA 1EUDA 1JF8A 2CD9A 1A7AA 2BKVA 5K2OA 3NC0C 4MI6A 5G0VA 4B7UA 3D6AA 4PDLA 2COUA 1H7MA 2PA3A 2HZ7A 3DZFA 1MLDA 1JUDA 5DCUA 1YCIA 1HO3A 3F7VC 5C5CA 1P0FA 1KFBB 1N8SA 2QTLA 3EGCA 3NKFA 3ABKB 4PAQA 4J1SA 5DEIA 1IH8A 2ARKA 5DNWA 1XD2B 2IGTA 2IY9A 3JYOA 1MW9X 5HXUA 1XDDA 4IPTA 2RBKA 3ZMVA 5BWNA 2H3HA 4NZYA 5G4VC 2ZJOA 1JBEA 2K87A 3A1FA 3K9HA 1IQ0A 1J8MF 1YR9A 1RXSA 2FZVA 3ROKA 3T1NA 5HRAA 3P3NA 2VS1A 4ZYZA 2FP4B 1NQOA 3HB3B 1PEKE 2OD9A 3CEPB 1P2FA 1BE0A 1YBVA 3SM3A 3UIEA 2HAEA 4C3ZA 3TXQA 1CTQA 4YRBA 2LW1A 1FP7A 1RXCA 2DHDA 2I2CA 4I81A 2Y77A 2EW8A 1GQYA 2VPQA 3AIIA 3LBNA 4PRYA 3GFRA 2ZRIA 4AUEA 5KKCA 4WGFA 4B6EA 3DOUA 3WYGA 4E5MA 4GR5A 5KQLA 5DRTA 1NYLA 1JNYA 2FPLA 1BW9A 1C81A 4KQFA 4XSVA 3CVJA 3I52A 1I2ZA 1NJIW 2C95A 1TTPB 3ILYA 3I28A 4AULA 3E22A 1NBHA 3JPYA 2IXFA 4BZPA 1NN0A 1J42A 1ZK1A 3C3PA 2W70A 2Y0PA 5LZ2A 2JGDB 3U4QA 2DPMA 1YAHA 1ZVQA 5EKSA 3DEHA 3T7TA 2HT1A 1U0NA 4FX5A 2VPTA 1RP3B 2A9FA 1SIBE 1F0KA 2BMFA 2KPOA 1L4UA 3CF4G 3QLUA 1J0AA 3LHIA 2XT9A 1P9OA 5JW6A 2V3CC 4WKPA 1ZWIC 3LUTB 3V33A 4ZU1X 1BN6A 3VU0A 3BC1A 1EWVA 1F6BA 3PJGA 3MQ4A 1GN8A 3GLQA 1QPGA 3DB2A 3AUSA 1D5NA 4CNQA 2IYVA 3C4VA 1EZ4A 2GRUA 4ZVVA 1O7JA 2WC1A 4C1BA 2J32A 3AM4A 1V11A 3QITA 2Z9BA 5CLIA 4TLCA 4UKDA 2P5TB 4CMIA 1WDTA 1ZU4A 4FCTA 3C14C 5HQTA 2WPDA 1KI2A 2SHKA 1D04A 2WWIA 1EEXB 3DD1A 2ORED 1G3UA 1JI0A 5T4FA 3ISVA 4X8LA 2FZCA 1KJJA 1KGSA 1BQ0A 4P3NA 4W6QA 3JQRA 5EQJB 2GSDA 4JI4B 2XF2A 4BT2A 3LC1O 4DPMA 3UCSC 1IB6A 2WU3A 3CSDA 3IE0A 4NV3A 2JKYA 3NDBB 1H8HD 1NKVA 3CUYA 2H0AA 1X52A 3HN6A 3DOJA 5FXMA 1O9HA 5EZYA 1SUPA 3EFEA 3CWZA 1GSOA 4BFYA 3OIFA 2Z01A 1XNJA 1G1XB 1VCHA 5ABPA 4AZ3A 3IHWA 1XHEA 5IBPA 4XR4A 5FNZA 4LH7A 2ZINA 3W5JA 3WGGA 3ZZ1A 4DHWA 3K9SA 4LVCA 1Z8NA 3R77A 4KSCA 2C92A 3OQMA 3IC5A 3DKRA 3VPGA 2FFQA 4FZJA 5HHTA 2Q3FA 5BORA 4DSNA 3ENQA 4RGBA 1D8AA 1G8PA 2F1OA 2V3WA 3FTFA 2F6RA 4MVJD 2EEPA 2VP4A 2NSJA 4LF6O 4GHWA 3U4DA 2PBZA 3ZIAG 3T1YB 3UCXA 1YD7A 1DTWB 4TMFA 2ZVYA 1X9GA 3E3NA 2IU3A 1P3JA 3GI1A 2E76B 1BT8A 3KZIZ 3HKDB 3WIBA 2I54A 1KZ1A 1ZL8B 2LGJA 3QRWA 4OQYA 4CYMA 2QJTA 2CHVA 1SQPH 3GK3A 1D6SA 3G1UA 1M8JA 1UC9A 2XVXA 4NYMQ 2BZSA 4E12A 2CXNA 2GR9A 3PVZA 3EX7C 2RMKA 2P7HA 1PCXA 3L0IB 2P62A 3NX4A 4MW2A 4NAUA 2VJMB 2YWGA 2HSJA 3GXBA 3WK5A 4RIGA 1PQPA 1WEHA 5IVIA 3MS7A 1R0RE 3ZJZA 4BP8A 5ICCA 4YK7A 1K8YB 1PR3A 2JVKA 3LNMB 4D92A 4PQYA 4E6EA 3TW4A 4P58A 5CJPA 1QMPA 4BFTA 2QKSA 3SPIA 1OB5A 1P9LA 1Q14A 4C03A 1LBSA 2IL1A 4U7GA 5E0OA 3IV9A 3RRBA 5FJJA 5JCZA 1PK8A 2DLNA 1UC8A 5AKIA 4NYIR 2CDRA 5H9CA 5DO9A 3ABLB 2X7JA 3AIMA 2IPNA 4QUDA 1UC4B 3L7AA 4IDBA 3RFFA 1EGVB 2I4LA 4L75A 2A0LA 4UNPA 4WCDA 3BRCA 2XA1A 4I2VA 2AK3A 3I9V6 3PA8A 3UFBA 3N7TA 2NT3A 3F6SA 2ZR9A 3MMNA 5DDIP 1QYDA 4KN5A 3IIMA 3RVQA 3LS2A 3P71T 1GN9A 1QHGA 3ZHRA 5AHRA 5FRDA 1QHYA 1UMBB 2Y1LA 2B6HA 4J7AA 5FX2A 3DLBA 3KKQA 4G36A 4J91A 3HK2A 2OV2A 3FCCA 3T41A 4V02A 2E85A 2AUTA 4JI3B 5TC4A 5LB2A 1RWVA 3VI4B 5JXGA 2WJIA 3OECA 4NE7A 4OAOA 1XMPA 4FCVA 5LZ5A 2XZPA 4MZXA 2NTYC 4RVDA 3CMAV 3OE7A 3OJWA 3UJHA 1VGRA 1DEXA 1AU9A 4A8JC 4MVMA 2REXB 6YASA 1DIOB 3EYAA 1P61B 3QVKA 1YI2V 2X0LA 2W6IG 3MLAA 3WKBA 1Y7HA 1Y5MA 4CTKA 1PT9A 5E38A 2R1TA 4E2ZA 3GLGA 3WSWA 5JDCA 3D1JA 4XCXA 2FEAA 5E4JA 5IPFA 1WY5A 4NEQA 1Z4LA 5I9SA 5AVRA 3O1HB 4WKBA 1J06A 5EHGA 4DF3A 1ODSA 4PLVA 1XTVA 5C1DA 2XH8A 3HBNA 4BFVA 2UXDB 3DA8A 4KB5A 4CH3A 4HGZA 2CLMB 4PPGA 4BL5A 1ISGA 1JMVA 8ADHA 2L0XA 4A82A 4MVJE 4IV8A 4MS4B 2HLDA 3MIZA 1U2GC 1V3UA 2PPLA 4QYIB 1OT5A 5ALFA 2J9ZB 1E9VA 3OZAA 4RK1A 3OHSX 4WF9V 3UXHA 3AW8A 2Q9LA 2RK6A 3EULA 4OLFA 5FA8A 1KDVA 4AVYA 3SQWA 1EIWA 4I50F 1R8QA 1A5SB 4JBLA 4AMGA 4Z4FA 3NETA 1SXJC 3EDOA 4IDHA 4UMEA 2O6HA 2ZJ2A 1V8DA 1DWUA 4JQZA 4TMWA 3IJPA 4PHFA 1VKNA 5AKGA 3V1UA 3QHQA 5T8KA 4KPYA 5A3QA 3EZLA 1H38A 2A67A 1C0KA 4S35A 4UEKA 5JH7B 2YWFA 1VQ6F 3FMPB 4J3JA 1TJNA 3ZCXA 4CI9A 2Q28A 4O6VA 1ZUD1 5I3CA 3ZJVA 3D31A 1UC5B 2H57A 3AR9A 3RIXA 1Z35A 2HS0A 2VZ8A 1V3VA 3MLEA 1AB5A 2XJ4A 3PQDA 1ZGBA 2XADA 3DE4X 4DDKA 3W8EA 1EXVA 4RPLA 3W7XA 5F7ZA 1XTPA 4EVRA 1W46A 1WP8A 3QIVA 5IWAB 5DNEA 1SUCA 2HDNB 4G0MA 1CR6A 2GZ3A 1B8VA 1PTKA 4C0XA 1LXCA 3KOMA 4DY4A 3HSSA 1D7AA 5LVAA 2CZCA 3FY4A 3OMWA 4U1RA 1VL6A 3BQNB 5H83A 3SKVA 3CN7A 3ZY5A 3OA0A 1R6NA 3KPYA 2YUIA 2R6DA 3WLLA 2X19A 1EK1A 4E1AA 2UZHA 4GOJA 1RQGA 2JJ2D 5IDJA 1G41A 1E6LA 1C1XB 2C2KA 3HB0A 3GAMA 4GUAA 4WUVA 1QIKA 4AYXA 4LRTB 3P1JA 3DAHA 6ABPA 2UYNA 5DBFA 1MORA 2B6NA 1E1KA 5LWQA 5ITWA 1TTTA 4Q9NA 4BCCA 3SS8A 3O2JA 1SO8A 3DBRB 3W9UA 4EJSB 1L7BA 1IN7A 3H1LH 2DKNA 4KZPA 1I7FA 4OQPA 4D25A 1Y1RA 3B52X 1A9RA 3ZJ4A 1HYHA 3QENA 3HTXA 4WLVA 4D9FA 1WMEA 2FSPA 1I6KA 2YXYA 1DXQA 5M34A 3ZGNA 3ZGZA 4OGQB 3BFRA 3KZKA 1NXSA 3CLUD 3T4XA 2KGWA 2FB9A 1Y7PA 1NN3A 1DBSA 1U0FA 1U3DA 3IP5A 3L1HA 4ND1A 1G38A 2D74A 1FXVA 4J7CA 5DGIA 4EKIA 1UBJS 2GLZA 2EZPA 1QQTA 2HPHA 1XV2A 3GH3A 1Z25A 4NBUA 3DCIA 4LWOA 4XLLA 3AL0C 2HU5A 4FOOA 4LBEC 2D7JA 3BF8A 4G65A 3UMFA 4D8UA 2V3VA 1RPZA 3O21A 3G0OA 4Q82A 3PGA1 4B62A 3UPDA 3KQNA 1MBZA 1H1DA 2OGWA 4N23A 2IV7A 3CVWA 2P4EA 2FDXA 4U6NA 2JLZA 4AG5A 4F5ZA 2ZOVA 5FFMA 4D74A 1EKXA 1LFAA 3AGQA 2HBYA 1BVYF 2WAXA 2QYOA 2X8AA 3L7IA 5BR8B 1Q77A 1ZNXA 3LCRA 2C97A 3Q6MA 3ESZA 4K6OA 4NK5A 3SZ3A 3GJQA 4KFMA 3ABKC 3GFGA 2NXCA 5E6UB 4R8SA 1MB2A 1R6DA 2CVOA 1NRIA 5HRUA 3LDGA 4LOHA 2BI8A 3H4MA 4LV5B 3UBMA 4NZPA 3VO9A 1FA9A 2O7VA 1U2DA 3AVPA 2I1WA 2EJVA 3C97A 3KVNA 4IFTA 1G8AA 4IOMA 4G9BA 3NDJA 4JENA 2XUOA 4RIHA 2FP3A 4MQ6A 5CTJA 1AURA 2DUWA 2FCRA 3OEED 3AY7A 4GM1A 3TKLA 3VKVA 2GN6A 2X6QA 3CPEA 2BFPA 3AVQA 3FPSA 3PXBA 1F4MA 5IJ0B 4XM1A 1I6MA 3E9EA 2HCJB 4WZBA 2A0KA 3IR9A 1N75A 4WESB 1II9A 3MAJA 5DP1A 4EA6A 1YJNF 1OFUA 2JNBA 1OE0A 4MTFA 1ZXXA 2PUJA 3GJ8A 3GPCA 5CDFA 1EFPB 1PWZA 4RA9B 3SYCA 2QY6A 3JW8A 3MCTA 5D7BA 3V2UA 2PAAA 3ZUGA 2WLMA 4QQ8A 2OLJA 4QM6A 1SC1A 1Y42X 4WFJA 3JASB 1DC6A 1LJUA 4JI7O 1E63A 1UFVA 1I3CA 1UK7A 1VQ4V 2Z2ZA 4J1TA 5AHOA 4D81A 4CF3A 5F23A 2JGUA 1CUFA 1DG9A 3CE9A 2Z4SA 3ETCA 4DG5A 5AW7A 4G63A 1GNTA 1VQ9V 1FX1A 2CLOB 3DT6A 4DQ0A 1TFRA 4G4ZA 1WHTB 1YVWA 3EYWA 4WFFA 1MO2A 1XVAA 3IRVA 4UHCA 3W5SA 4ZN6A 4EUFA 5JARA 4NXNO 3M81A 4F2HA 4IMPA 4BWVA 1JIQA 1K9SA 4A1OA 3RIEA 4XUDA 4IRXA 4U7HA 3K0BA 4RL6A 1DX6A 1FXUA 5IKPA 3B3FA 1BJTA 4WK6A 5JALA 1GZDA 5JJ5A 2O5RA 4OP2A 3OM8A 5FBZA 1Z3IX 4YQZA 1NRXA 4EY3A 1U7ZA 4H1HA 4DHEA 2G76A 4V3CA 1M1YA 4Z0NA 1B8OA 1C3EA 5CLGA 5C93A 3IFSA 3STZC 2GCIA 3EVFA 3Q6NA 1DT9A 1UWLA 1GOTA 3OE7G 4C8IA 1WP4A 1ZQ1A 3CW2A 3P0RA 3SG0A 4M7PA 2FW8A 4CZZA 3I3OA 2JH9A 4AYWA 3Q0IA 4QO8A 5FNVA 1S8OA 1YR1A 3GYQA 3IP6A 4YRPA 3OTQA 3W5VA 2G9ZA 2DWUA 3O8QA 4BAZA 4QULA 2Y4OA 3WYFA 3WAGA 2VDPB 3TYXA 3LKBA 1Q74A 3NWPA 2ITCC 3LOQA 3SOPA 3WLSA 2YXHA 1AK9A 1G3QA 2P35A 4EJ6A 3R40A 2NW6A 4R2LA 2MSKA 4LXUA 3WBFA 1JQ3A 4KHZA 4AJJA 2CAZC 2H2WA 1PU2A 3CF4A 2J4FA 1EN6A 1J8QA 1YMUA 3U3DA 2R8ZA 3SJZA 3LUFA 1SELA 3T15A 2X23A 2WT4A 4V0KA 4C87A 4YUXA 3N8DA 5JANA 3T7RA 5TLSA 4Z4GA 2P6YA 4FS8A 1XELA 1B0UA 5BUCA 3JZDA 4JYMA 1O9BA 5I9MA 3AR6A 3LVFO 3ZQKA 4HDMB 3E5NA 4NZZA 2G1AA 3RLFA 2PKQP 3MTEA 4DJ5X 5AHXA 5EBWC 3BWEA 3K2QA 5I47A 1SVKA 1C9DB 2VHTA 2Z08A 1FD9A 4Q1DA 3DDHA 3RSFA 1IV2A 1R9GA 3ABSB 1QS0B 3IUPA 3EG5A 4FYKA 3GBVA 4HQFA 5GIOC 5ITSA 2AZ4A 3LDFA 3RS4A 2J0EA 4F2WA 2VYND 1ESCA 1VE9A 3EQ8A 5TS3A 4HRVA 1C7JA 4JLDA 2YIBA 2QIPA 4WESA 2HMSA 3GAAA 3PGJA 3ST7A 1C9EA 2ZSBA 3HUFA 4UVEA 4Q1AA 2E4ZA 2H2HA 2YX1A 3K9AA 1HTWA 3AKDA 3N59A 3O47A 3OP1A 4MVJM 4OF4A 2XBMA 4N41A 1V54C 5FTMA 1CQZA 3UAZA 2D8MA 2OOKA 1JX6A 3UNXA 4XQ0A 3RK0A 2UXBB 3VBCA 2HNAA 2PTHA 1WV0A 1JQEA 3NK6A 4OB8A 4D4LA 4RXUA 1ZIPA 2OBFA 4M8SA 4NYKA 1G6KA 2FGKA 4AZ0A 3OEEG 5I5GA 2PUVA 4TV8B 4HGPA 1M2VA 1EZ1A 3G2IA 3GBPA 1YDEA 2AW9A 4XCQA 3CR3C 3V4ZA 3KXDA 5G2OA 3W9SA 4WEQA 1ODIA 2WIAA 3DDNA 4FGWA 5HF9A 3D7NA 1NAHA 2OUKA 4ZC8A 2JGDA 5LDDC 4RF4A 3ZO8A 3TEFA 2CE2X 3FGOA 3PVCA 2XB8A 4B3IA 5IANA 3A4IA 2X6TA 3EVNA 5F3DA 1CQPA 3TVYA 4ADSG 2VHWA 1NMQA 4EATA 3MXTA 5LUAA 1BWPA 1ULTA 2DBVO 1UKCA 1O6FA 2Q3HA 5JD5A 4PVCA 2ODNA 4DLUA 1QP0A 1CR2A 4JXXA 2ABWA 4X7RA 3MJDA 4B4UA 5CLQA 4E14A 2Q0SA 1E7KA 2QZJA 4LRQA 1LUWA 1TLLA 3BFXA 5HY2A 1E7MA 2JFNA 5B66Z 2VTEA 1M90H 4J9ZB 1HNWO 2BEVB 3UKMA 2BEJA 1ZI6A 3F6BX 1AGNA 1JQDA 2YEVA 2G08A 3FKJA 3INYA 1U97A 4KH1A 2JEOA 4HWOA 3LDAA 4BVLA 5KREA 2AOTB 4RZQA 4F96A 5J4YA 1N2OA 3NIFB 5THQA 1Q86H 1DFHA 4GC9A 4HB2A 3A3KA 1JQJC 2VJQA 4I50A 3AHHA 2J9RA 3KQYA 2D2IA 3R76A 4CVNA 2A9VA 1CY0A 3MBMA 3M5PA 2ZRNA 1B0ZA 4D6TH 1K5PA 2PA0A 5K3FB 3WNVA 1JKXA 1O6ZA 3PRYA 4Z0PA 1E3SA 4F71A 4H6VA 4I1UA 3O3CA 4DV4O 1LJLA 4GP6A 2G5PA 3UKDA 1C0IA 2FSVA 3DQPA 1SKMA 3OEHD 1FYVA 3O9VA 4DMRA 1B6QA 1HT3A 3QKRB 1E5XA 5BV1A 3RAFC 1WB9A 3U3JA 3OY2A 2OESA 3CZ4A 1T8WA 1ULUA 3EVEA 1HNZO 1PWEA 2JK1A 1VMEA 4PRLA 4FGKA 1NVBA 1GXSB 4N49A 3TCNA 4UTVA 4GIBA 3BSSA 1P7YA 5KLVH 3E53A 4WECA 4JWKA 4FEGA 2FRDC 2IHBA 1CBUA 3CCCA 3OT4A 4LI0A 1NLUA 2AFIB 1XQ8A 3SBXA 5ENVA 1CY6A 1LQTA 3HJNA 1N6NA 1VRWA 3HUDA 4H77A 2DQZA 4HWSA 3K0SA 4JGBA 5LUBA 3WDMA 5TX7A 3WLIA 1XYGA 2BSXA 3AP1A 2RHBA 3PXEA 1LQUA 2J9GA 5DHQA 3FGZA 4G4WA 1A3CA 1L4EA 2OCKA 1F5SA 2V7BA 1HOXA 3CR8A 4M89A 3ZX5A 1ZG3A 4DLLA 5GPBA 3ZLJA 3S0YA 2JARA 3L49A 4F4JA 1YF3A 1JXMA 1XQVA 3TVTA 2Y2UA 1E8DA 2F3UA 5DI3A 3DXRB 3QLUC 4C30A 3UO2A 1FDSA 3CQ9A 2NWQA 2WP8J 2IM9A 1NM5C 3SSOA 3X1JA 3OFVA 5CCEA 3TJTA 3ZD9A 3FR7A 4BV9A 3QVMA 2DBQA 2E4YA 2C1EA 1CY4A 3ZWXA 3TK1A 1XZ8A 2UZ0A 1ZKDA 4LGMA 4PG8A 5HF5A 5HXAA 4NU6A 4X44A 1AR5A 5ALEA 1Y5IA 5C52B 4CEHB 2D2VA 4GZLA 4ZO7A 1ACJA 4FGZA 2XCIA 3RR2A 1EB9A 1NE7A 5FLYA 3SF8A 2OECA 5FJIA 3QEBZ 5FOSA 3EXHB 2F1JA 1Q21A 1S2IA 2DBRA 3CVOA 1XU4A 1TMKA 3ZRWA 1WF3A 5KHHA 1KYQA 2HU8A 2R68A 2OP1A 3QYPA 1Z3CA 4J8PA 5H5NA 2FZEA 1UJCA 5T6MA 1XZPA 3FKSG 1D8TA 4LMPA 1POXA 5FUBA 2Q0QA 4BGEA 1JIJA 4QLAA 1ZUIA 5AI5A 4NLLA 2QGFA 4ACBA 2V1UA 3ASNB 1JD1A 3BB4A 4QTXA 5KQSA 3OTOO 2MSDB 1SVWA 1CQIB 2CSXA 3ZGLA 2F1MA 1DBWA 2W6PA 4FFOA 4J9YB 4IXNA 2JK0A 2C8KA 2BC9A 2VDVE 3EA4A 4P80A 2G63A 4BP3A 4ARSA 4DV5B 2XUZA 3DXYA 1ZNQO 1ESMA 4LSZA 3V00A 5THXA 3OMLA 1IUOA 2ODTX 3BHNA 3VZCA 5JPDA 3D8HA 4RETA 5IULC 2JGFA 3FUCA 5CA3A 1NQAO 1U0HC 3C85A 4AY2A 3MCAB 1SC6A 3D3QA 4EEXA 4KREA 1BD3A 2D3OW 1RAAA 3FDZB 3GCXA 3REGA 3T9DA 3FFAA 3U1VA 4AY5A 1YZLA 4EGSA 4G1VA 2BGGA 3UO8B 1V1MB 4QDUA 2I2DA 2N3ZA 2I2FA 2O8NA 1O94D 3L0SA 2VSNA 5T64A 1BDHA 3IBCA 5CA0A 1C3LA 2AFHA 1RA4A 1RC1A 2HV9A 4MW6A 2IEDA 2P9JA 4UAVA 3JATB 4HDKA 3WICA 2ZRBA 4DADA 2DYKA 4MVXA 3GUZA 3C8LA 3PUVA 4E4EA 3E20B 1M76A 2AV6A 1I51A 3QLJA 4XH9B 1KH3A 1E4VA 6PFKA 3SIWA 2PX4A 1AKUA 1CNFA 1L4YA 3GB9A 2G0TA 2IDZA 4NS4A 1HKHA 1RE0A 5JWHA 3JWIA 3R3JA 2BEUB 4FFNA 1REQB 2ORWA 3KVVA 2UZIR 3RJ9A 4BNFA 4NBNA 2OCIA 4N0EA 2RGBA 4EGCB 2X86A 2O8VA 2HHJA 4JJGA 2EP7A 2KLBA 3MJCA 3GLHA 3E5RA 4DNOA 3VGJA 2QE7A 2GV9A 1B8NA 2V0CA 4L72A 1HZZC 4DA7A 2AKYA 3N2YA