5FNVB

A new complex structure of tubulin with an alpha-beta unsaturated lactone
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
427
structure length
419
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN ALPHA-1B CHAIN
publication title Pironetin Reacts Covalently with Cysteine-316 of Alpha-Tubulin to Destabilize Microtubule.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 172
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5fnvB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5fnvB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5fnvB01
1W5EA 3E22B 5C8YB 5KX5A 5JCOA 4O4HA 4O4JA 3WGNA 5LP6C 4X1KB 5IYZA 3N2GB 5FNVB 5LOVA 1RQ7A 2VXYA 3JAKB 4X1IA 3VOAA 5ITZA 1Z5WA 1W5FA 4I55A 1W581 4IIJA 4EI9A 4EI7A 5IJ0B 4YJ3A 5LP6A 4HNAB 4O4IB 4WBNA 3JALB 5JH7B 4TV8A 4ZHQB 5EYPB 3UT5B 5IJ9A 3HKBA 1W59A 1TVKB 1SA0B 1FFXA 3JAWA 5LYJA 3RYHA 4I4TB 5JCOC 3HKCB 4X20B 3RYIB 3JARA 5CA0B 1OFUA 1RLUA 5LA6B 4YJ2B 1TUBA 4B45A 4I50A 5EZYB 4X1YA 4F6RA 5BMVB 3VO8A 2VAPA 4B46A 3RYFA 5J2UB 2BTQA 4TUYA 5MN4A 4FFBB 4EB6A 4IIJB 2RHOA 5CA1A 5EIBC 2Q1XA 3HKDA 4O2BB 4YJ3B 5GONB 3WGJA 1W5BA 3M89A 4ZOLA 5EIBD 5CB4A 3CB2A 5IJ9B 4U3JA 5LXTB 4LNUB 4O2AB 5J2TA 4ZI7B 5KMGB 2XKBA 1FFXB 4E6EA 3JASA 1JFFB 4TV9B 3HKEB 3RYCB 4O4LB 1Z5VA 3N2KB 3JATB 3E22A 4U39A 5C8YA 4DXDA 3M8KA 2BTOA 2R751 4I50B 2R6R1 5KX5B 3N2GA 5FNVA 2RHJA 4O4HB 4O4JB 3JAKA 2VAWA 3ZBQA 5IYZB 5JQGA 5LOVB 3WGLA 4IHJA 4X1IB 5IJ0A 5ITZB 4HNAA 4I55B 5CA1B 1W5AA 5JH7A 2VAMA 4DRXA 4XCQA 4ZHQA 5EYPA 5LP6B 3VOBA 4ZOLB 4WBNB 5CB4B 4TV8B 1TVKA 3VPAA 4U3JB 3HKBB 3C8LA 5J2TB 5JVDA 3JASB 5LYJB 3JAWB 3RYHB 5M7EA 5LA6A 4YJ2A 3JARB 3VO9A 5EZYA 5MN6A 5BMVA 1TUBB 4X1YB 4F6RB 4KWEA 5J2UA 4X1KA 1RQ2A 3ZBPA 3WGMA 4FFBA 3RYFB 5JQGB 3RB8A 4IHJB 2XKAA 2BTQB 4TUYB 3WGKA 4O2BA 5GONA 4EB6B 2RHLA 3ZIDA 4O4IA 1FSZA 3JALA 4DRXB 3HKDB 3V3TA 4M8IA 3UT5A 3R4VA 5LXTA 4LNUA 4O2AA 4ZI7A 5KMGA 1SA0A 1JFFA 4TV9A 2GVIA 4I4TA 3HKCA 3HKEA 4X20A 4O4LA 5JVDB 3N2KA 3JATA 5CA0A 3RYIA 3RYCA 2RHHA 2Q1YA 5MN5A 4EI8A
chains in the Genus database with same CATH superfamily
4ARCA 1A7UA 3DZBA 5AQ1A 2H9YA 1UKBA 2VEOA 5KCMA 3HWWA 2NN3C 3IB6A 1FFGA 4WXPA 3PNKA 1PNLA 1PYDA 3L8ZA 1AUXA 1J8YF 4PZEA 4TL6A 3OT1A 1THZA 4N5MA 1I7QB 1IDOA 5C31A 3ESCA 4AIIA 1IDN1 1HP8A 1CUSA 5JNWA 3V42A 4L78A 2GJKA 3CCEF 3V55A 1SCAA 1ULAA 4MVWA 3WMWA 5JNTA 4JMLA 4J07A 2APJA 3PEEA 2YFKA 3BRWA 4G4GA 5FADA 5LDHA 4CUJA 1J2UA 3OHMA 4RIFA 3RVOA 3UXYA 2ZW9A 3DQZA 5CDFA 4KLRA 3JQ7B 5ERYA 4OIFA 4O8CA 3B77A 2AC4A 2Z3WA 4PAOA 2B6HA 3HDVA 3BSFA 3QKTA 1VRVA 3D3NA 3K9WA 3N0RA 3K0FA 2WWRA 1EFKA 3G7UA 1JQ3A 3U26A 4QTXA 3K4QA 3AL3A 1I51A 4DR3B 1Y7HA 1E9SA 1EK0A 3K5PA 4RYLA 4JV5B 4BAUA 1U8TA 4RTJA 1NZFA 1CY7A 5FTMA 4G5GA 1SKAA 3NTRA 2JF0A 2VHTA 1AXRA 2EQAA 8MHTA 4M83A 1QCYA 3HJWC 3A0HZ 3ER6A 4JSYA 1P2SA 2XGMA 2C3PA 3L7LA 1NVMB 2NT3A 3TQTA 1CR4A 4HGQA 5LQMA 1FMJA 1MC8A 1NS1A 1KWKA 1BCSB 3HH8A 2ZYSA 5KYNA 2GZAA 2GZSA 3UTDA 4ZRDA 1D09A 2Q2OA 1EGAA 4G0WA 3ESZA 2IGTA 4K0RA 2H1SA 3B3FA 2FZEA 3HWRA 4KBFA 2ERXA 2WSMA 5BSRA 2X42A 4CN8A 4MJLA 3NXKA 2CLFB 3WGVA 3K59A 2O7SA 4LQLA 3PCTA 4K6GA 3OPMA 2HF7A 2OWOA 3OLVA 5BSVA 5AW9A 2HSWA 4FLXA 2LNDA 3JW8A 2FA9A 5F98A 3NC0C 2AYXA 3IAM6 3FN4A 3TTYA 1NMQA 2VNHA 1KYVA 1KQOA 5TIIA 3K0CA 3KIZA 3ZCTA 1V26A 4RQAA 1OH6A 3BWMA 2BI4A 2A3RA 4BQEA 4Q7KA 3ABLC 5TT0A 1TYEB 2G8NA 1GP2A 2YNMA 4BUZA 4AJLA 2BELA 4KHPO 1VL8A 3ZGOA 1OJ7A 1F2UA 2EIMC 4NTWA 4BMZA 4C8GA 1VECA 3PUXA 4ISBA 1V11A 2I1QA 1W36B 3KZ1E 3DV0A 1EK1A 3KJEA 1WBBA 2HM7A 1R3JC 1Y4MA 5EE0A 3F7NA 5EG5A 3QUCA 5JXGA 4JXJA 2HJSA 4S1OA 5I51A 3TMAA 2ZBFA 1N2CE 3IQXA 4WNAA 5AKKA 1F8GA 1GZUA 4YPFA 1PV4A 4CV2A 1ADCA 4IRXA 4DMRA 4TTQA 4ZGGA 5KHJA 4N3AA 4I9WA 4D0GA 4BNLA 1H6CA 2EP5A 3G8DA 3L9WA 1Z47A 3RUDA 4GVPA 2HFJA 4NYKA 4NJMA 3LT1A 3DULA 2Q6KA 2FOLA 2R65A 3HJTA 5G0UA 3SX4A 5KQRA 2L2QA 1K5QA 2J5QA 3NMUC 2XMGA 5BSKA 4TLCA 5KTNA 4RD4A 5H3CA 1FFSA 2I3BA 3DP7A 5JBNA 5DK6A 2P5YA 4R0MA 3TZLA 2GTHA 4TM8A 3U17A 1O5OA 3SQNA 1XF1A 1BGXT 2ID9A 1ZIOA 4QDKA 3ZIDA 2NUAA 5IK2D 4BTVA 1ZVMA 3KAJA 4UDYX 4OI1A 1US6A 1N1MA 4H17A 4DM7A 1U2ZA 2QMUA 4OD0A 1Q5PA 4EPXA 1A8PA 2C2AA 4E4RA 3OIYA 1YU9A 4G09A 1N2BA 2CMDA 2BD0A 2L26A 2R70A 4PSVA 4MV6A 4ZO6A 4K9PA 1TOAA 1XEXA 3V4SA 1AR4A 5C81A 2VJMA 1W57A 4DLZA 1PX0A 3NHKA 3RC7A 5CUQA 4CIVA 2YXBA 1RMQA 3OW2U 3C4QA 2J5XA 4MUHA 1RM1B 3VVCA 5JNLA 1AROP 2CV0A 3LGXA 4U2CA 1KMMA 2FUKA 1I5OA 4ZHSA 4P2ZA 2VSNA 4XUCA 1SBNE 1XN4A 3O8QB 3SK0A 4JBYA 2ZYGA 4XSHA 4BKPA 4KH1A 3DLTA 4ZAZA 4F46A 1KU0A 2AJLI 2G63A 2FQQA 4X6UA 1E0SA 3FPBA 1NJ5A 2B61A 2PUEA 4C87A 2W11A 4FPXA 3PNYA 3GFTA 3SD7A 1YQ9A 5H82A 3GPIA 1QFSA 1FDUA 1V55B 1WW2A 4AMYA 1YI0A 2O2GA 4OQLA 2UXXA 3WMEA 1QTRA 1BCCH 3BL8A 1VARA 4AWBA 4BIZA 1WP7A 1NLFA 3K06A 3ZRWA 1PFVA 2IVFA 4CKCB 4IQ8A 4YP5A 3IFXA 4Q9LA 1SHJA 4F7WA 3N27A 3W5UA 3PGJA 5B36A 2DWOA 2X23A 1UBFA 3FNFA 2E4UA 4Z3DA 4JP1A 3CPQA 4XDKA 4G3XA 3HI6A 3QVKA 3WB9A 1PQPA 3ZYZA 5B1DA 1VQ7F 3O3CA 4CLOB 2MINB 1YSCA 1QDUA 2DTXA 4Z9AA 1JLLA 3GF4A 2A0WA 4LFBB 5SY4A 1S3GA 4C0SA 5E6SA 4UFOA 1MMMA 3RU3A 2ZRJA 4UJ3A 2IYVA 2QVGA 3M1XA 1SU4A 5HM8A 2OZVA 1E0KA 3EIFA 1E1KA 4DW1A 1NGSA 4EI7A 1LLQA 1ZITA 4B35A 1OAKA 3W1WA 1HK7A 3LWBA 2R96A 3H1HH 1X9GA 3HEMA 4PHHA 5IT9A 1Q86W 2BFEB 2WB2A 4W9NA 2VBIA 2JNWA 2RB5A 1VKHA 2Z1DA 4M6WB 2PZLA 2XUOA 2UZ0A 4BLTA 3KL2A 2AMFA 2GD0A 5AKYA 4UM9D 1AQIA 2D2XA 3G82C 3LPNA 1Q1QA 4YBZA 3FFQA 1S9HA 3R23A 1TK2A 4XDGA 1WU8A 3FYEB 2ZAYA 4MQEA 4G5FA 3D43A 3RFCA 1KZ6A 2XVZA 5KC8A 3SQLA 2Z98A 5JOQA 2QVBA 1JI0A 4DV2O 2GVIA 4OFXA 3JQRA 1BA3A 4G5OA 4S0ZA 3DC6A 1WQ3A 5TQJA 1QZ3A 2NR5A 4N3NA 2YN4A 1ZJZA 2X6CA 3CJRA 1U2DA 2QW0X 2EZ9A 3W9YA 3PFWO 3CS5A 5F1OA 1XQ6A 2NO7A 1Y6QA 2XMDA 1WA8A 3T4EA 3L0SA 4MYSA 3ROZA 3OW2F 5EJ5A 1QP0A 4WY2A 2AOTB 2PGXA 4H7JA 5K3EA 2ERCA 1HDGO 1EWQA 2ONKA 1K88A 4MW2A 5JCPA 4A27A 3PYXA 2BP7B 1E5DA 4E5KA 2GLUA 4JB3A 1R3UA 3K14A 3EUFA 4H3SA 4W5WA 3PZRA 3FROA 3D6MA 3IEXA 4WUTA 3M4JA 3IHKA 2V6FA 3I45A 2IOHA 4Q82A 1YZNA 2JKZA 1TZCA 3FBAA 2NNWB 1J56A 4ED9A 5EJ4A 4ES6A 3B6KA 1K27A 1JIVA 4AN0A 4IEFB 3VTKA 1G8HA 3U7RA 2M6KA 3KSAC 5GJWC 1V37A 1GOTA 3CR3C 3EORA 4MWDA 2HK6A 2G9IA 4IZIA 2X0FA 1JHAA 4EEKA 4D41A 1TL7C 3N2LA 5JW6A 4M49A 5EUQB 4JYZA 4I1RA 1J0DA 1EBOA 3TLMA 4TKUB 1GWNA 2GI4A 1V6AA 3ZCPA 2VHVA 4CKBB 3KVYA 4ECEA 1K9MW 1N2GA 4FLVA 5B2EA 1IPHA 3UWPA 4CS3A 2WK1A 4KEAA 3GLSA 4LMPA 4P2BA 4XB1A 2IS6A 1QZUA 3U44B 2BHSA 3NM4A 3SZUA 3TSAA 2O8NA 3VI6A 4HLQB 4P82A 1PK8A 3SPIA 4KQJA 2VDLB 1IZ3A 2XKAA 2ORIA 4L74A 1NC3A 3OUSA 4JI8O 1O6ZA 2AMTA 3OTGA 1UR5A 3NAQA 2FPIA 1KIAA 4MWCA 4RFSA 3L1HA 3UAXA 5LMZA 5A3JA 4B3MB 2X15A 1B74A 2W83A 2HUNA 2FG5A 2IELA 1HT1E 2KLHA 1FMCA 3GVXA 2OUKA 4PCAA 4D9GA 3Q6IA 3MF4A 2M1XA 4B7CA 2WF6A 3NTOA 3IDQA 3KV1A 2P27A 3FTCA 1LV7A 4JT4A 4DBLC 4EHAA 4N9WA 1DKLA 2GBGA 2YCBA 1E32A 1DOAA 1E8NA 2OOKA 2ZWAA 4JEUA 1W25A 3TETA 4H0FA 1HM5A 4ZAFA 4HYQA 4KBGA 1IQUA 4B3RB 2AYZA 3OPVA 3ZRVA 4CNQA 4EY6A 1LI7A 2XW6A 5JSYA 2JJQA 4WI1A 1SHLA 2DMRA 3ZS8C 3H3JA 4A8HA 2OP0A 4AG5A 3GIDA 4B6EA 1UODA 1PV1A 3MQFA 3T3DA 5DYWA 1XRMA 2OB1A 5KNDH 4CT0A 2OV8A 3VAAA 4RJIA 3LCJA 3LFHA 3CPWF 1G5PA 1LA2A 4JLNA 4JZGA 2XZTA 1KJIA 1XPUA 3TPCA 1X1TA 2PRYA 1BE0A 4JXKA 2Q27A 4CI9A 2QORA 1IV2A 2ZS7A 2PKWA 3C8HA 3H9VA 4BB0A 5BQ3A 1YAJA 5KTTA 2BBWA 3HCDA 3OCUA 4A8TA 4NI5A 5CT4A 1CQXA 4HWRA 1RS0A 4QAQA 3UK2A 4TV9B 4MRVA 4LSGA 3TZEA 1ZL8A 3ZDQA 2A1TS 3HM9A 1FYXA 3ONEA 2FUG6 2A5LA 1T3HA 1P5JA 5K0JA 1CV2A 3EZFA 4FZ0A 5HUQA 4FQ8A 1KAMA 2HRQA 1Q3TA 3IH5A 5E7QA 4C21A 2CNLA 3IAHA 2Z30A 2LBXA 2CJWB 1NKTA 1KDZA 2IYXA 3H05A 1Q43A 1M7HA 1SIBE 3LKZA 3UATA 4YRKA 4LZJA 5KWJA 2J30A 2Q49A 3LUAA 3KE1A 3G5UA 4LYAA 2PX2A 2WUVA 1SELA 4G0XA 1JFLA 3EXG1 1P1BA 3ZUGA 3CRCA 2HDOA 4OK5A 5A1TA 1JSLA 5JT1A 3ISVA 3ABKC 2W93A 5FBRB 4HYYA 1QGUB 1Z7BA 4TWRA 1EVZA 4BEJA 4D8VA 4N54A 3HNPA 2QV7A 4UZEA 3VPXA 4M36A 1VHAA 2BEUB 2OXIA 5BXYA 4XPIA 1OWPA 4KUEA 5GZ1A 1Z0IA 1Q6ZA 3A9UA 3V3KA 4DXDA 1Q11A 2V3WA 3MOIA 4DANA 3I8SA 1ZNXA 4MSUA 4AKTA 2HMYB 3HA2A 3I5UA 8OHMA 1WG8A 2XUMA 1K8ZB 2VXCA 3CR7A 1C3VA 1C0LA 2Q1UA 8AT1A 2JI8A 1E4OA 3FVWA 3ZPXA 1EE2A 1FE8A 2B9EA 2HR1A 4RS3A 1PR3A 3LWVC 1NQ5A 4MEJA 3DDWA 5ILGA 1YKFA 4DV1B 3RVRA 1DRJA 4LGYA 3MWEB 2RGEA 2BMDA 1XPRA 1DWPA 5BT8A 3HU1A 5CBKA 2W48A 1UJ5A 4KITB 4F2DA 1IN7A 4B7EA 5KOIA 3AC0A 4GKVA 2P2LA 3BWEA 1MIHA 4PG8A 4UB6Z 2GSDA 3OLXA 5DTEA 1FVFA 1Y6RA 5FWAA 3A6GA 2OC9A 1OC4A 1K6IA 1AN9A 2P79A 4UNQA 3AIMA 3BVOA 1CIVA 1NQ3A 3SXUB 2ZAIA 1QGAA 1M1KH 3SCZA 1NXPA 3TBFA 4QVGA 4IIHA 1ND5A 1WVGA 5B4UA 4JEMA 1G291 2P2GA 2P6NA 1FBTA 4LOLA 1IMJA 4G23A 2OSBA 3DWIA 3M3PA 5HZKA 1CRZA 3ERCA 4M0UA 3TO5A 2O4CA 3QUBA 3WG7B 1TA8A 3FTDA 3K2BA 5CVEA 2PTMA 3D4BA 1N5KA 2FEMA 3MGKA 3Q1LA 5ECDA 2HQBA 4Z7NB 3GUVA 4CKWA 5JCJD 2D54A 4M9XA 4RZ2A 5LPNA 3W1VA 2PGGA 4DADA 2FYUH 3BAFA 4LJ5A 1EJ2A 3RVZA 4QRDA 3EIHA 5KQPA 5JRZA 4DJEC 3IQHX 3IELA 1SC4A 3RPEA 5AVTA 3IV7A 1AOXA 1IXKA 2AI2A 4U7GA 2EP8A 4HATA 1LGYA 2VBCA 1GGNA 4G86A 2ZVDA 4YIPA 1G5HA 3W3AD 5HUJA 3BM5A 2QZPA 9LDTA 4TTAA 1E7RA 1GDTA 5A4KA 4LBZA 1MFPA 5WRFA 4Y1GA 4BO0A 4BVHA 4WCFB 5LP6B 2RI6A 3TFOA 4GBED 1I4TD 4DV3O 2ZNIA 1S7CA 5DI3B 1IH8A 4QGAA 1NXWA 2RAPA 2WKQA 3LC1O 3G6EF 1JR2A 3HK2A 3WMGA 3G2OA 1K66A 3E8BA 1YR9A 1T2DA 3JALA 4FSDA 4FEAA 2YXEA 1XTTA 3KZXA 1ZN2A 4UTNA 4MAMA 4DPKA 2ZUSA 2AHOA 3MJTA 5IYZA 5A9RA 2HFKA 4K6CA 1RW4A 1Z56C 4UHDA 3RUAA 4FFKA 2KE5A 4P30A 4OREX 3O3OB 2UZ1B 3H9QA 1ZZGA 2B3TA 4Y9DA 4U2GA 4AROA 3SP1A 3ECCA 1M57B 2I7TA 6REQA 3RC1A 2FCAA 1ADFA 2IPAB 1IVNA 1W6RA 1WXHA 1YCGA 1S76D 1OWOA 5JJLA 3I5DA 4MZXA 1LTKA 3KQPA 4FKBA 2II6A 1G7SA 2JFVA 1XJCA 2Z1FA 4DIMA 3GUYA 4DB2A 1AUPA 4JB0A 1DRWA 3ZBTA 4DB4A 4RH1A 4Q1DA 4I8DA 4KUGA 3RFVA 1Q84A 1LS1A 3C15C 5IYZF 5KC9A 2P90A 4LYGA 4WMLA 3QV2A 5KWSA 1LBIA 1BX0A 1L4KA 3IEMA 1KK2A 3U7JA 3I9OA 2HCJB 3OHSX 5I3CA 1JG1A 1QTQA 4JBXA 3NIGB 4Z0HO 5MDHA 5A3SA 3I23A 4DIKA 3GJ6A 5LL6Y 1CRLA 1U90A 1Z6GA 2DQ4A 3NIFB 5H9VA 2WA4A 4I4TB 4WXMA 1PIWA 3B2EE 1XRPA 2OT3B 3RIXA 3PX7A 2Y69B 1I0IA 1Y3DE 1BO6A 2Q3EA 3W5BA 1QIIA 1Y34E 1TD9A 4UBIA 4M1EA 1KYXA 3B8HA 2C4MA 3F6BX 4HR7A 1FJGO 4M8SA 2F8TA 5KQLA 4O4LB 3NHWA 2BW0A 2YS7A 4C3VA 3AP1A 5C7YA 1TT7A 3UMFA 2JAUA 4OHUA 4M1OA 3UA3A 4ZPJA 3K6KA 3D01A 1LLUA 3EFHA 3I83A 5L3QA 1TUBB 1P73A 3NUGA 4JYAB 2DWPA 4IXDA 1W48A 3T5MA 1YU6A 4K88A 2MSCB 1SBTA 3R5HA 3Q3HA 3S0JA 5DP1A 1Y3CE 4D97A 5GV7A 3MINB 3RGGA 3A6HA 3SIXA 3UM7A 2PMBA 4GWKA 1T8SA 1F7VA 4HD8A 1GGJA 2C78A 5BQPA 4DY6A 4CG3A 4CZZA 3TL6A 5K0ZA 3H9BA 3BMOA 2Q7DA 4GD3Q 3R3YA 1RPOA 3PC8A 7REQA 4YRZA 2VDWA 2IYQA 5ICSA 2MSDB 2OK7A 1VQOV 3H0CA 3GJQA 2HQ1A 2OV6A 4DDMA 1FX1A 4TPKA 4B32A 2L69A 2PBLA 3ELUA 2QDKA 3LVBA 4BNIA 1H2ZA 1ZLXA 2B8NA 2QD2A 5FL7D 2R6FA 2Y0BA 4JLSA 3L9DA 1N5OX 2XGSA 3K9AA 1OIWA 1ULSA 4XWTA 5TS2A 4QOEA 3IDAA 3IE2A 4DLKA 2PANA 1AQJA 2P65A 4JL6A 2H1FA 1YE8A 3TBKA 4BLWA 2EIKB 3HCWA 3U60B 3MTQA 4GEKA 2P77A 3L4SO 1Q3KA 2ES4A 1GCAA 4D6PA 2WP0A 4UBLA 1Q82W 1YOBA 1Z4MA 3I9V1 4AO7A 1EGQA 1M1XB 1RQ7A 1F4VA 3S2GA 1D9ZA 4AP9A 1U02A 3LDAA 3L2OB 4G4YA 4PJ0Z 2ZDHA 3LYHA 4H7EA 1AHHA 1IQRA 3P3NA 2CFIA 2YTZA 1ZS9A 2J32A 3UNXA 1WUJS 2OLJA 5JVDF 4NCAA 1WAZA 3MFYA 1KAHA 1B04A 5E1OA 1N1DA 3ONFA 4NBNA 3STTA 4O6VA 1OYYA 3UZUA 3OJWA 4PGHA 3JWPA 1ZGZA 2JZNA 1CE8B 1PRYA 5AI0A 4LF9O 3SYCA 3NKFA 2WZDA 3KYCB 4IHJA 2VOEA 3DVLA 1IFXA 2Q3CA 3PNBA 1OF1A 2CXXA 4PGFA 3EXIA 4HAOA 2Q21A 2HRZA 4TMVA 1E2KA 3UCFA 1RAAA 4P9PA 2Z9DA 2ZF8A 1X1DA 2Z2IA 1XK6A 4BQNA 1NULA 1J4AA 3A6KA 3FF1A 1R73A 1JZQA 4ZKEA 5EZSA 3UAOA 3GPBA 4LQDA 5AI5A 1WP4A 1LEHA 1TO1E 4CCSA 4D4LA 4L4UA 3D3QA 4ZZ2A 5IEBA 3BORA 1JJFA 5HOQA 4I99A 1ZI8A 1H93A 2VSXA 2IPNA 2M2IA 3A7DA 1PSDA 2OGTA 1HKUA 3WHKA 3W04A 2Q9UA 4NPHA 3AG7A 5HK8A 5JXIA 1N0WA 3DBLB 3LCCA 1VSQA 2Z8ZA 3TW4A 1GPJA 1Y0BA 5AXBA 1PCXA 1GRRA 1IIBA 4CCYA 1O89A 3DTYA 3DG9A 4LZLA 3MB8A 1KIMA 1DBWA 2NZ2A 2X0RA 4H35A 5FL7G 3W2IA 2P91A 4HDSA 4IJ6A 3QG1A 1VP3A 1YBHA 3G68A 4RUKA 4RELA 1K8AH 2G9NA 3QI7A 5LNK1 4BCBA 2ZYDA 3LBHA 2BYTA 3MT8A 2NVOA 4RGVA 4DQXA 2Q6LA 4CEJA 2ZIFA 5THKA 3V2HA 3RVQA 2ISQA 1SEPA 4OOEA 4IL5A 2Y1OA 3WC4A 4Q00A 3F98A 2DYSB 4FOPA 1NXXA 3L7MA 3A1FA 5LQAA 1GNSA 2FPPB 4H13B 1EWYA 1CNFA 4BMDA 3UJAA 1CYEA 2GEKA 3L0CA 1XZLA 2KGWA 3CINA 1A5TA 3L3BA 1YR1A 3NOVA 4GYCB 1ISFA 5DDIP 5ICCA 4K2HA 2AKAB 4N3GA 1YQNA 5F7ZA 1UKZA 3KT3A 5DWDA 5CB8A 3ZJ4A 3L71H 1NBMA 1MB0A 2R1ZA 4K3VA 3LPLA 4ACAA 4LDRA 3IXMA 1Z35A 4AKEA 1AI4A 821PA 5FBZA 4L3OA 1OHHA 3DOIA 4MCIA 1XDUA 3FZEA 4GKJO 2Q5ZA 1T9CA 5BSHA 3LCVB 2QVXX 1VYVA 5AI4A 2EL9A 3LOUA 4P93A 1NMYA 3FX7A 4J29A 2PUGA 1YS4A 4CT4B 5TEWA 3FPFA 4P54A 3C9UA 3ABZA 1PZFA 2JGNA 4GR9A 2PUVA 4GH5A 1F2VA 2ALJA 1DRKA 2IYUA 1BGYH 2ZJOA 3LT4A 3B8EA 1U3VA 5B2ZA 2I91A 2IGBA 2O5VA 1J9GA 1D4ZA 2Q9LA 1JB1A 1QHSA 2YRXA 4MTOA 5JS8A 4PBTA 3J7AU 4LFCB 3K9SA 2ZAGA 3JASB 4X65B 3GX1A 1KO5A 4PLVA 4EO9A 2CGEA 3F1LA 2JHGA 4FMCB 3A3OA 1XZAA 1DLIA 2EJBA 3CF4A 1CB0A 2XHBA 1UFVA 2X4LA 3FD6A 1EJ6A 3W3ZB 3PJSK 5H0IA 3GA5A 4R68A 4NVPA 3R7SA 1Z5WA 2TMGA 4AJ9A 2EW1A 3KJKA 1U0HC 3G5MA 1VCIA 3HN6A 5I7EA 4GRIA 5IVIA 1XMOO 2DP4E 5FORA 2ZR0A 5JMOA 5HDBB 3IV9A 3WB1A 3S3TA 1CTQA 5L7TA 4J2HA 1Y9JA 1N5RA 4S1NA 4RY8A 1BWRA 4Y30A 4GX5A 4CKEB 3OU7A 1TLFA 3UWMA 3OJXA 1VMEA 4XTRA 5B55A 1AH2A 1DQRA 4GPEA 3OFKA 3CN7A 3FH0A 1XWWA 1U8XX 3THRA 3R4CA 3GH1A 3WP0A 4QYWA 4QEKA 2A7XA 2D5LA 1TU3A 1ZVJA 1SXJB 2GZRA 3RAJA 4RK6A 1BYIA 3OQJA 5I9TA 2P9HA 3SVLA 4R71A 2QQFA 5THQA 3B8NA 4PCVA 3ROXA 3BCCH 1QU3A 4ND8B 3GBPA 4YMWA 4XGRA 4IF4A 3T9BA 4WFGA 4S1TA 4IYHA 5DN9A 2F43G 3VNQA 1NV8A 1ZI9A 2GZLA 2FSSA 1RWQA 3SYLA 3X2QC 2WM2A 1Z15A 3O4IA 2WINI 4UQLA 4LZWA 4DLXA 3LMEA 1N1GA 2Q9CA 1SOAA 4Q7QA 4CFSA 5AXCA 1DUSA 3VGPA 3D2CA 5BR4A 1SETA 2R5WA 2E5LB 4Z6KA 3SKYA 1X0XA 5KAFZ 1JHYA 3WG9A 3EFEA 2RHJA 1SZPA 1KPGA 1YDFA 1E9DA 2WAAA 2HU5A 2BKEA 2NV0A 3HCAA 3GJ5A 1NJIW 1GJRA 3GCXA 3DMRA 1HURA 3HFRA 4X6LA 4UNPA 1QBGA 3HA5A 3VUFA 4OLHA 5EPUA 5DF1A 4JTDB 3D5QA 3UOGA 2YWEA 3DZCA 4J2TA 3VPBA 1H6DA 1WKBA 5JATA 7ABPA 4N7MA 3AL0C 2DT8A 3CLUC 4QOJA 3VNBA 2YY6A 4RQTA 2GYYA 2BEWA 2RB9A 3B70A 3EEFA 2XAHA 1NDQA 1R0YA 5IT5A 4YYZA 4ERHA 2ZU6A 3SJ7A 1GXSB 3NWEA 3MJ4A 3IESA 1YQDA 2IUEA 3K70C 4G5QA 5EI5A 5AHWA 2Q0OC 1H65A 2H52A 2BGKA 3QUWA 3W3AH 4PFQA 4EATA 1ACJA 2P8SA 2OD9A 3HBNA 4NBVA 4REOA 4N41A 2E4XA 2ZYTX 3PF8A 1ZY2A 3SR4A 3IO3A 2JK1A 3OLYA 3PLAC 2A4KA 2F1IA 2CJFA 3ZMVA 5FPYA 1LJUA 5A5VA 5AVWA 1Z0AA 3OEED 5CVDA 2D5BA 5IRCD 2ZZMA 2OXFA 3LH5A 4I6EA 1Q8RA 2YDXA 2Y1XA 2XEXA 2G70A 4YYEA 1NTRA 1MW9X 4X64B 3N6VA 5FF9A 4DA8A 1UDWA 2FSFA 2RH5A 3X2FA 4JLDA 3ZXXA 1JFVA 2NUTB 3SZOA 4DEVA 1W88B 1TDJA 3EBPA 3ILHA 4HNTA 4NAHA 4CFZA 4RKQA 3G1UA 2IYSA 1IHUA 2UUPA 3A37A 4P4SA 1YB4A 3WSTA 4JFAA 4OK6A 1KU9A 2O2YA 2OO5A 3CCVV 1P1FA 3WXBA 3LHIA 1NVDA 2C83A 4M9QA 3FFAA 3O6VA 2PX8A 4IVQA 3BABA 4YMTA 5FUVA 2N75A 1WSAA 3CJQA 3UJDA 2O48X 1BZKA 1JFTA 2AOWA 2PCLA 2YRFA 3RS5A 3BDIA 3UJ6A 1M8GA 3C3MA 4Q4DA 4ZICA 1GNTA 1IBSA 1F23A 1QHYA 2FR1A 2V1UA 4ARSA 4V1CI 2IZOA 4HQOA 1YDEA 1EM8B 1FYDA 1BMFD 1DRVA 4FYKA 3DT9A 4R2WA 2J8ZA 3L01A 3DOEA 3AM5A 1P81A 2EULA 5JDIA 3CB2A 5PGMA 2ZCEA 1W29A 1NX6A 5KAPA 1ARZA 1QZTA 1SN7A 1VTKA 5F1YA 3SLGA 2ZDGA 3EYAA 2NMUA 2A0UA 2WLIB 4H3VA 5F12A 3EVFA 2EV9A 3KHTA 3QF7A 1DHTA 5F7OA 4BVGA 3NEJA 5L4NA 4NG5A 3ZDDA 4Q3DA 2DU8A 3DEAA 3MUFA 3R4VA 4GM4A 1VQ5V 3NTUA 4WX2B 3TRKA 4L5JA 4P5EA 4KU4A 3KXPA 3AI7A 5I7VA 5BSWA 2OD7A 3ZXYA 4RVOA 5L6MB 3FRHA 1S6YA 4KE7A 1OROA 4OQZA 4K1XA 3H5NA 4F60A 3CLSC 3OEEG 1TAEA 1EGHA 3T7SA 4IEEA 4BBPA 5ADUS 2W71A 2WJHA 3IAFA 2P8JA 2PYLA 4IQFA 3Q5EA 1F20A 4Q9HA 4UDOA 3HY4A 2GHRA 3OH8A 4DMFA 3O90A 2IWRA 3M8AA 1DO8A 2Q5EA 4ANFA 2FSIA 4ZFNA 4N8SA 3LE8A 1XL6A 5CA0F 1ZQ1A 4FYXA 4BMCA 2HXGA 4DKJA 4MQ4A 1A9TA 2R8YA 2ORED 5FNVA 2R2AA 1F0YA 2QN6A 3DUFA 3KFVA 5CEFA 1PE0A 4C4PA 1EFRA 2QJ1A 4C0XA 5KYTA 3R6TA 2GXUA 1HX7A 5BNZA 4LSZA 2W2LA 1SQSA 3PHBE 2RHDA 4DNFA 3ADPA 2PXCA 2VRBA 3KYBA 1EX1A 1QVAA 2C5FA 4DYVA 4OXYA 3U0ZA 4WGFA 4JITA 3JVEA 5MFPA 2FN7A 3LY7A 2FSPA 3RJMA 1QU9A 4TMTA 3KE8A 1LC3A 4H7FA 4AMBA 2FQYA 1H3NA 4HNHA 5H9CA 3L7QA 2FNAA 2GKOA 3ZCCA 3ELCA 3MS4A 4ZU3A 3ETQA 3D4IA 1I2DA 4CHGA 3AUYA 4IXTA 3RF7A 2Q29A 1NMSA 4X8OA 3S1AA 2HQSC 3AY0A 3E5HA 2GTIA 3IUMA 2XUQA 1VMAA 3F3KA 1UI9A 4QPJA 2ZYAA 5FNVF 3RARA 2RAUA 4U6QA 4X24A 4Z0NA 1DEKA 4RZSA 4A3SA 4FKZA 2GO1A 1BMFG 4EM6A 3LM8A 2V7XA 2QT1A 5IVPA 2EIXA 1BA2A 3HO8A 3I9FA 4OQDA 3A9VA 3FHOA 5LA6A 3A1VA 1UM9B 1PM9A 4Z2WA 1X3SA 3TLGB 3DO6A 1ZUNA 5T4EA 3VC3A 1DBPA 4UCSA 3E9DA 3IUSA 1Y1LA 1E2BA 2VJCA 1X7XA 1SQGA 3DBHA 1MX3A 2LGQA 4W5JA 1SUCA 4HG2A 2YDYA 2JLXA 3QELA 4L0QA 4N0QA 5IS2A 3SDBA 3A28A 1IC6A 1X7GA 1JIJA 3SPGA 1NW7A 1A8QA 2OCHA 3E9QA 4TMXA 1QBZA 4I1PA 1BH2A 4HNVA 4OBXA 1SUSA 3B6MA 2AWNA 3A2LA 4H27A 3UW3A 3GUHA 1S2DA 2WMYA 4BX8A 4RF3A 1ZL0A 5LA6F 5CDGA 4PNPA 4KHPB 3FOCA 4HGNA 2C5BA 5ADWA 1ZD4A 2LCIA 5T67A 1QQCA 1BVUA 4PBSA 2P4UA 2QJFA 3F2VA 4GZMA 2R1UA 2ZJ2A 4F6RB 4MVJD 2JAQA 3Q10A 2H8EA 3TFWA 2WKRA 4TTRA 2W6IA 3QPWA 1GL6A 4RS4A 2YH2A 3NALA 1FUYB 4M1MA 4CYMA 3BJZA 4YRLA 1I7PA 2QAGB 2ZJ5A 4QLAA 1M33A 3LHFA 3L7OA 4OGQB 1KTVA 4GCZA 2B1JA 1WUHS 1SR8A 1NRIA 1IHXA 3WWZA 2B6NA 3BBPA 2QTVA 4E21A 2H7CA 5ANRB 5JY1A 4W4LA 3FUVA 2XVAA 4EJSA 1VPVA 4DLVA 4PYLA 1KMQA 4K26A 1LZKA 2BHRA 2WHYA 1UH5A 2WIAA 5K3AA 5DV9A 1RA4A 1UBTS 4BMXA 3LTEA 2VRZA 3AEIA 1JI3A 4IVNA 4P32A 1E3WB 3PQEA 4LX8A 1CUAA 2F3PA 3STZC 1CUCA 4X61A 2CBZA 3I6IA 2ZUBA 5L3VA 4P31A 1DARA 3D81A 5DHSA 4RSMA 3JQFA 1E7YA 2BSQA 1UKCA 3SYAA 4QXOA 4EKDA 2F3UA 2CKDA 2GILA 3PPIA 1NU1H 1R4AA 1SA0A 2ETNA 4I7EA 3EZYA 3N2ZB 5K0TA 2F48A 2AVDA 1A4IA 1Z3IX 1J0CA 4URWR 2XWQA 4EMTA 4CLRB 1RHJA 4C43A 3FSGA 2EFGA 5CH5A 2JIZA 1IOLA 5K3DA 2ZJ1A 4MLDA 3RO7A 1IZ9A 4DN6A 2EHJA 2GMWA 3F0GA 4DLPA 4EELA 4N39A 3W8FA 2FFQA 1Z4KA 3PJGA 1YFLA 1JSXA 1C9EA 4XGNA 2JS5A 4HT3B 4IJVA 1LB1B 5D3ZA 3P4YA 1K3EA 2GPNA 3RK1A 1C0IA 4QZVA 2BKXA 3T61A 2HVJC 3GLHA 2X3UA 5KYWA 1FNBA 3ESDA 1FJXA 3NHSA 3RYHB 1NHWA 4R01A 2XCQA 3TOVA 4ZO9A 3D36C 4IO0A 5TPZD 2XAFA 4RIIA 1ETUA 3GWZA 3K3PA 3PCRB 1JDVA 2CVOA 4XM2A 1UFOA 4HTAA 4P3PA 2OHFA 1Z7EA 3EVCA 1JEQB 3IDFA 3N2NA 3JQEA 1VQ1A 5D3MA 4EFBA 4ENSA 4H1HA 4MVJG 3ZWCA 3DOOA 1NNI1 2ZITA 4OHMA 2QYTA 3H2BA 1W41A 1JEAA 4Y2YA 1C7RA 1M6YA 5AVRA 1KI7A 4Y2QA 2X5OA 4HP8A 2PSHA 1H5UA 1U5AA 4TTSA 4TMWA 4WKPA 3BTUA 3R5XA 2YY5A 5AVOA 5LQKA 1L5QA 3IDOA 3CWBH 5DASA 2OE2A 2JLZA 3T3IA 3VNUA 2DFNA 5K3SA 2FGKA 5IPFA 4B4WA 4IIBA 3QLTA 3H8JA 3K1AA 3OLWA 5BQXA 1J2RA 1CG6A 3H04A 3FD8A 2W42A 4KIJA 1GPMA 4MYDA 3KG2A 2H1RA 3O4JA 1E3EA 1OCZB 3P96A 2RB4A 5EJGA 1S01A 3MWLA 4IQ4A 1UP4A 3DZKA 3HKDB 2GK3A 4J6EA 3IEPA 2WLHA 1Z6YA 1WCIA 3KEFA 2UXNA 3UB2A 1TCBA 3Q7EA 5BN3B 1SBHA 1NVVR 4RVNA 5HY0A 3E9NA 2HSDA 1P19A 2OFWA 3ZXUB 1TX4B 1QV6A 4B5LA 5DPMA 3IPRA 1FPMA 3P9XA 5BWLA 4N5LA 3KX2A 4YRDA 4NHEA 3G9TA 3L6RA 4BDTA 2LDXA 3BK7A 1DO2A 2QQ5A 4BQIA 1HR0O 3C70A 3HKEB 3AHJA 4NWIA 2AK3A 2DPLA 3RVKA 1LH0A 3IUBA 4LJ9A 4P4TA 3AWIA 1BN6A 3X2SA 3KFLA 4YRNA 3CX4A 5HW0A 2RGDA 3VU9B 3EXEA 4A8PA 3NOOA 4PZPA 2A1TR 3H5TA 1S5HC 3DT8A 1O7JA 3P0HA 3K1TA 5FPQA 3DLHA 4US2R 3V1LA 4UQOA 5ENZA 1OT3A 4DV2B 3MT7A 3FKJA 3VMFA 1FNKA 3KQYA 3IMPA 3HPLC 2V55B 2B2XA 3WPXA 4O4JA 3TJRA 3L02A 1D9XA 5CYGA 3MSCA 3SM9A 3BHMA 2XNDA 2X8AA 1A8IA 1EWKA 1MNAA 5HZHA 1B43A 1BTOA 4JL8A 1QVVA 3VI4B 1M1YB 4GXQA 4H4DA 3Q3IA 5K51A 2CD9A 3GWGA 4D2IA 5LLSA 1ZH2A 2XGJA 1WULS 2N04A 4FKMA 1V54C 3OE7A 5F73A 3QLEA 1BCRB 2WNHA 2MSKA 5EBMC 2Y9PB 4L87A 2PZ8A 4YECA 2R4TA 3FB8C 4GPIB 4P22A 5AVUA 1WXGA 1Z37A 4AJOA 4IFTA 1M5IA 3FXAA 1QO0D 2GEVA 4O4JF 3R75A 4C6TB 1V1JA 4C4SA 1MJFA 3FMPB 2O50A 4Y9SA 2AW9A 1QRUA 1WCXA 1A88A 3CPWU 3K79A 4WLOA 2XLCA 1ZUQA 3K0AB 1H2FA 2PN1A 1GPLA 2G72A 3EGIA 5GVSA 3CEPB 5EWJA 3PQ3A 2QX4A 3BWXA 2R6AA 3IR6A 4UCTA 1GNRA 2QPLA 1BCSA 2QBYB 5B7PA 4E5PA 5DH9A 1BXGB 1OOEA 1XBLA 4RUEA 1IJKA 4I6GA 1R6TA 4ALNA 2P6OA 3IT3A 1ZA1A 2Q1WA 3E15A 3X43A 2Q28A 5P8WA 3IL2A 4ZEWA 1OVGA 1XXHE 3SYNA 3NH9A 3DDUA 4KAAA 5CHYA 1QRSA 3D3JA 1G5TA 4MVRA 1YB5A 5AW6A 1BIFA 2VRCD 3IEIA 1DAFA 4DNOA 1HNWO 4IY1A 1MAWA 1WMEA 1KYIA 4JI8B 4JI5O 3TB4A 1KEEB 2ZIWB 4MNTA 1SHZA 2O2IA 3QX7A 1C3XA 1JMYA 4MIEA 6YASA 1PQYA 4DMLA 1RHKA 3NPMA 1GEGA 4Y6QA 1J1IA 3DAFA 1BL8A 4DDUA 4G0VA 5IARA 1U2RA 3BQ9A 1RP3B 3N39C 3N86A 5EMNA 4EQ6B 4YJGB 4WBNA 1XQXA 4FQ5A 3F3SA 3QY0A 5LB4A 3JWEA 2BO1A 3SZGA 1T4BA 3M6LA 4LE1A 3WYDA 2VYND 2VZ8A 5AXDA 5EIBD 4PHCA 1AI5A 4BZWA 5LXTB 5EIAA 2PRSA 4N76A 2JS7A 2CW5A 4E2ZA 3S2EA 3LPAA 1VXRA 3ZU5A 4CMBA 5JMPA 1ZJ6A 3CC7V 1H4TA 4MI3A 2J6IA 2IEIA 4NJEB 4NKGB 3PG5A 3GK3A 2IA5A 4IVRA 4EG8A 5E95A 2QN7A 4G81A 4AXXA 5K8TA 4MUJA 2JASA 1NOJA 4EZBA 4WBNF 3T5PA 1TQ6A 1JEOA 4YI5A 3DE5X 3KLPX 2LR0A 4Z1MG 4MRRA 4KO8A 3U19A 4RAQA 5TRTA 2GF2A 4J4TA 4LC0A 3RKUA 4OM7A 3P9SA 1SURA 3CMEV 1CS0B 4WXHA 4ZVPA 5GAPK 5ED0A 2BEJA 4I46A 3PFKA 2XUAA 2ZXUA 4I5FA 1EK5A 4ZCTA 2ENUA 1KQGA 2MMCA 1R1DA 3PXDA 4XM1A 2Y1WA 2QN3A 5K09A 4ZJPA 4GLFA 5C8DA 4R40A 5JISA 4MRMA 1W0KA 3OKAA 3ORRA 2CGNA 5GM1A 3T3MB 3IEVA 4EUFA 3INTA 3VVMA 4EG0A 5ALUA 5KTSA 5IDVA 1SEVA 3DTVD 2CBXA 5EC2C 4LRSB 2YIBA 2JW5A 1OXVA 2WOJA 1DC8A 4TLBA 2J09A 3CISA 5DHPA 2GZ3A 1FJ2A 4P4GA 4MGHA 1QG2A 1SHTX 2YJNA 2O2XA 1JGTA 1ZQ9A 5F5NA 4ZKDA 2CAZC 3N05A 3WZMA 3FCUB 3WA7A 3ZLJA 4D98A 4HKTA 4ONEA 1YRWA 4MINA 2QTTA 4DW8A 5T4HA 2C4NA 4CIYA 2PGOA 5JI2E 3EH1A 1L5VA 4YIOA 2OZKA 1B06A 1ABFA 2OG1A 3ZHXA 2VSYA 3H84A 2VRWA 4URHA 3L7AA 3JPYA 2B4YA 3FLBA 1RIFA 3A6ZA 4WK0B 3ES9A 1GLVA 2QTZA 4BGUA 3O91A 2WHXA 1UADA 1K5GA 5ALZA 4GOLD 3G71V 3TX2A 5IAOA 1GA1A 3CJHA 1ZO8A 4RKFA 1PJRA 1V48A 2VJBA 3BHJA 2Z1EA 4KYTA 1MH9A 5AKGA 1NVGA 2J5RA 1I2ZA 4CBVA 6LDHA 1P4RA 4RC9A 2WF5A 1AKTA 1N3IA 4E4EA 3HL4A 5U4XA 1YRBA 3A6EA 1LZLA 3DP9A 5JS1A 1M8PA 2HV9A 4PC3A 3ETDA 1X4TA 3K5HA 3S2SA 3SIUA 3CY6A 5DW3A 5HIJA 1P8JA 1BWQA 3Q3GE 3I0NA 3HZZA 3H0KA 4GZ6A 1M34B 3DFIA 1EN4A 1T0UA 4J7CA 5CNMA 3GCZA 4RGQA 1XTJA 5H16A 1GRVA 3AY7A 1T36A 4D0SA 4E1AA 3RYTC 1O0CA 4WZZA 2V3VA 5LWHA 3AR9A 1DTWB 4GMFA 3FRIA 4IV8A 3N7UA 2HIGA 3A4IA 4W1SA 1OGIA 2CCKA 2ZG6A 1XK7A 2GPSA 4EUEA 1YL5A 4EKEA 1ZJJA 3CW8X 1QONA 2A35A 1WPGA 2MINA 5H3LA 1FRQA 3LIIA 2JIQA 1Y8RB 1J00A 2X77A 4UU1A 4EG5A 2CTWA 2BI7A 2J9FA 1CR0A 3WYNA 3P9PA 4Q1BA 1L5NA 4MVJH 1CP2A 3TE6A 2LBTA 4EKWA 2FJPA 1ZW6A 2EFDB 4EH1A 5LN1A 1ANKA 1C4OA 2GFIA 3WLNA 5DX1A 2QMYA 4A91A 2J5KA 1WXQA 3SZMA 2BFEA 4HI0E 4GNRA 1WHTA 2BE7A 4W6ZA 3D3WB 4AJPA 1ST2A 4CWAA 3JYCA 1II9A 4IWXA 3O2JA 1U43A 3K9HA 5E7IA 4KUHA 3W2EA 4RWZA 4F9TA 2Q41A 3RJZA 3OX2A 2QP3A 3T1TA 2J0QA 3PGLA 4EL0A 5HKKD 1PSWA 1QDEA 2HWWA 2QRQA 4JWKA 5TJ9A 4ABMA 1P17A 3CNHA 3VR2D 4DV3B 2O14A 3I9NA 1GTJ1 4B43A 3BEHA 1R74A 4S0XA 5G1PA 3EFOB 1COZA 4CM6A 1KHHA 3CX5F 5IUJC 4N4AA 4H7KA 3NZEA 5I48A 1NRJB 4YMHA 1S0VA 3SJAC 2H06A 3C6MA 2DQZA 2XMRA 1SXIA 3MM4A 4DHWA 2BDUA 3C7TA 1U0EA 2HP3A 1T1EA 3A05A 3OTOB 4GP6A 3VPFA 1U2QA 3HPQA 1JQKA 3KBOA 1JVNA 1M8KA 3N1UA 3N5KA 2I4TA 3EODA 5LFAA 1R0SA 1IB0A 3AV3A 3EUWA 4ZZ1A 3QO8A 3QNMA 2BP7A 5D6OA 3ADOA 2A9RA 3JCMM 3ZIAG 4NOMA 3KJNA 3LDCA 3GARA 1Q7YH 3N7AA 4OMFG 4X3MA 4R1TA 2PYIA 1JG6A 1WD5A 1QG6A 3CCUV 1JFFB 4FXOA 4MHTA 4QXPA 1NVAA 1G8KA 4Z3OA 3D6AA 1SVSA 2PKCA 2X0DA 3TAUA 1T9DA 1O0SA 3L4KA 4RFVA 2FF5A 1NI8A 3HBMA 4PYIA 3CPEA 5GPBA 1GN4A 4KR9A 4ZOQI 3KCNA 2QWOB 2PO7A 4PYRA 2G5PA 5I6DA 1Z6PA 4K9SA 4Y6RA 2O07A 2P0AA 1KZYC 4DM3A 4EAAA 4TZ0A 4FGKA 4CS2A 1UOQA 3EXHB 4FDVA 4N0PA 1Z6XA 3KQOA 2JHCA 1G7CA 3CTMA 1TVCA 2JBAB 3RFUA 3ZY3A 3FCYA 1EUCA 5FV4A 1J09A 1HDEA 4ZP1A 5D86A 1HTTA 4M1QA 1AMUA 1JMVA 2EZUA 5K45A 4OJTA 4XVUA 1XV2A 2XKKA 3BC1A 3CXCU 1COWA 4CIDA 1UPAA 3H8WA 3ZR4B 1IVSA 2VCHA 2VPZA 2B37A 4FOLA 3FGOA 3B5IA 2WU1A 2NADA 2ZBPA 3H13A 1N0IA 3WLAA 3GJSA 3X1YA 4R84A 2C99A 1F7UA 5AVQA 3R6WA 1NW5A 3U44A 3CW9A 3CF0A 3OMLA 2X4IA 3G2IA 3K5MA 2GSMB 2H4WA 3C7KA 4AF6A 5EJFA 1ULHA 1KQNA 1YZQA 1Q7GA 1E3QA 3V1NA 5JZOA 1FU8A 2PRKA 4FE4A 2ORVA 4B85A 4BU1A 2OY0A 2FR0A 2E5WA 3K72B 4AUMA 3Q8HA 4M0CA 3DCYA 3ZWDA 1FLNA 3AVYA 3P2OA 3DFZA 3VC7A 4WBSA 4B2PA 2N0SA 2QTCA 4EW2A 4Q37A 4D3YA 5AO9A 2F4NA 4F21A 1Z6QA 5FUMA 3CRZA 2GAJA 4YMGA 3AUSA 3MOSA 2EWWA 3BA6A 2QJTA 5HDQA 4X97A 5H5JA 4H08A 1AURA 3NW9A 3DE2X 3ACDA 2CK3G 3HMQA 4Q48A 1Q1NA 5I7UA 3L5OA 1LW7A 4LXGA 3EZ6A 2WLSA 5G02A 4HXGA 5GIOC 5GONB 3R41A 3K1ZA 2DB3A 3BKWA 2B8JA 1OV4A 3B1KA 2H4YA 2AQ8A 3T1VA 4BGIA 4B7AA 4YASA 3SIPA 3MDOA 4G1FA 5EKTA 2VZ0A 2XUFA 4AC9A 1GT6A 4L0DA 1DXHA 3QGMA 4JDPA 1AGYA 2PZFA 3I09A 3KQVA 4MS4B 3AM3A 4WLEA 3VPSA 1BQ3A 3VI3B 4JNKA 1H7MA 4CTJA 2I6QA 3QIVA 3EIUA 3QHPA 2CKMA 4FFLA 1WLSA 3KVRA 1WZEA 1P0MA 4F93B 3VKWA 2XYRA 3JSAA 5HFLA 3A1CA 9LDBA 4JELA 4Q47A 4AFNA 4EA8A 3ICXA 2WRZA 5AK4A 1LPAB 3W79A 2CXTA 1G4UR 1L3CA 4AUKA 2CFSA 1IUKA 2W2QA 4LF9B 1MJGM 3ZCUA 2IXGA 4KI0A 5ARDA 1JZTA 2X0NA 5IJ0A 4GPBA 3A2MA 3TRFA 4MP8A 4KIGA 1FP4B 3CNOA 3UWSA 3FPCA 1T0JB 4L3WA 3AY6A 3RGWS 2PT6A 1G0NA 1QFJA 4ASUA 1TAGA 1Q0PA 3CXCF 3ABIA 1K1EA 4PSCA 4JVOA 4LJ6A 3MBOA 3HJGA 3SFTA 2Y3IA 5LUBA 2XB2A 1U2PA 1IUOA 4U6SA 1V35A 2B8EA 1ZUD1 1YGYA 5FOUA 1V41E 4CMIB 4ENUA 3ZEAA 3MVEA 3IX7A 2JLVA 4RD6A 4U7JA 4REMA 2ZI4A 1VIAA 2DLNA 1LUAA 3BIXA 2GJ8A 3EG5A 1M2JA 1R0ZA 1QKIA 3TJMA 2I1VB 3D6FA 4QTTB 1WB7A 1IEWA 2BWJA 4QT4A 1AKQA 3OM9A 4Z7QB 1D2GA 3A1DA 4OTZA 1TKCA 4U63A 4OPAA 3K5OA 2YHIA 4G01B 1XHLA 4LKOA 1H0KA 2YV2A 3H2IA 3IC5A 2P9CA 4JI7O 2IYZA 3SM3A 3SC3A 1B16A 4AAYA 1SVMA 1UXHA 3OCJA 1QYCA 1Q12A 3EVZA 3P2EA 3OHPA 1PFUA 3M49A 3IAS1 4IHJF 4N6GA 5KQSA 4IGKA 3OC6A 1IXMA 4TS1A 3B3AA 1MC1A 3LV8A 4JP8A 4BO2A 4D4HA 1I6WA 2GZ1A 5IXSA 1XTIA 2HI0A 5BMVB 2V6MA 3LNCA 3L8HA 2GLXA 5GOTA 1C4KA 2AZMA 2JFUA 2CLOB 1DFHA 5B1HA 1UF9A 4R2IA 3OQ6A 2LBPA 2I1LA 2YV3A 3GLIB 4RUFA 2NAPA 1Z8NA 3T7TA 2D7DA 1U7WA 4HEQA 2VAMA 1TRKA 2EQ5A 1OXXK 4L9AA 1GITA 1X8XA 4PTLA 2HCFA 2O2ZA 3W5IA 3SE7A 3R8CA 2X86A 2A33A 2WE8A 1T8WA 4PQFA 2IHBA 4DLLA 5GGYA 1N8TA 4P6VF 4HH4A 4M0FA 1FTGA 2Z2KA 1QP7A 4DMGA 3AKEA 3ZOKA 4BEWA 1ZAUA 2O3RA 4K6OA 4QOHA 3SQXA 4L22A 3P27A 4M86A 4R8RA 4A0HA 3ETHA 1J39A 4NE2A 3HKCB 2XE7A 1V3QE 2FLWA 2R66A 2G06A 3JVUA 4ZHYB 1DBQA 4J16C 3VU1A 4K46A 2XWBF 5JWHA 3D9QX 4U00A 1JR3A 3A1SA 2QI9C 3HA7A 3IC9A 5CFMA 3N2KB 2FKAA 2E82A 3OJLA 3NTQA 3WV4A 3LT5A 3ORQA 1ORDA 4B8ZA 2FLVA 1C9KA 2WD7B 2AUMA 3BSWA 2DFLA 3M4XA 1T25A 2PZBA 5E0OA 3RWMB 4LSMA 4MZDA 1NH2B 2J48A 5JPCA 4Z1VA 4JLKA 3L7JA 1P44A 3P97A 5AFSA 4CODB 1UBHS 4DLNA 3K0SA 3L1IA 5HF9A 1NUTA 2UZ1A 3A7EA 2D5CA 1WABA 3ZEIA 4L6AA 3UY4A 2IP1A 4YCLA 2XRFA 5FPSA 3PKZA 3B3GA 2IYEA 3U6KA 4EY5A 1L0LH 5KVCA 4ZKIA 3OOYA 4Y1RA 1N75A 4HF7A 4K03A 1YZBA 5J4VA 3NAZA 1L7DA 1RSZA 1GA4A 4YRBA 1UFIA 2Q5FA 3M9LA 4BC0A 1X7PA 3ECAA 1JSRA 1CF9A 1O96B 3WFZA 4D82A 3CLKA 4HZUA 1N5DA 2AK2A 3SBOA 3QTYA 4K8RB 2ICAA 2G25A 1JQLB 2ZT6A 5MF6A 2F7SA 1OY1A 3ZDBA 2GH1A 2Y2UA 5LD2C 3SJQC 3IEQA 4D9JA 2RKBA 4OOFA 3AH8A 3KLNA 3GCWA 3LY9A 3QKUA 4IW3B 3JD3A 3USCS 1BAPA 2VTEA 1MN6A 2H1HA 3VYUC 4P7BA 5J2UA 3AU8A 3QWAA 2XHEA 2GETA 4P4UA 3QBVA 3U4AA 1ESEA 3OOSA 2R9AA 3K1YA 3FPJA 4HLUC 1IL0A 1YACA 5LBIA 4I4TA 3EUEA 3OZAA 4KDRA 5F4ZA 5H68A 5HJEA 5TGDA 1LR1A 3F2IA 5EC1C 4G0ZA 3FHJA 3T9AA 1YZLA 1HFJA 2QR5A 4F11A 5AW2A 4G0PA 3QVVA 4Y9UA 5EVCA 3IP7A 3P4EA 3UKOA 4OGFA 1OUMA 1TW3A 4ID9A 1M5TA 3AK4A 2AR7A 3CCFA 4KL1A 2EIMB 1S2OA 4BVJA 4Y2XA 1E1CB 4XVRA 4GIBA 4YUAA 1EDBA 5DTQA 3LY5A 1M6VA 1Y6FA 4II7A 3DAPA 5DM0A 2B4QA 3THWB 3RW9A 1I6MA 2FDXA 2X6RA 1I4LD 5J2UF 3U0OA 1NW3A 1QJ4A 2ODQA 3UWKA 3W9BA 3X0DA 2OWDA 1RRCA 1KKUA 2QM7A 2OKCA 3F5TA 1U28C 4I08A 3TKYA 2W6NA 5DK4A 2EIJB 2ZSEA 4HH1A 3CIOA 5CDFE 4AG6A 3VISA 4IGIA 4WJZA 4IDDA 2GKGA 3EIOA 4MPJA 1YTFB 2VPQA 5BYBA 5AK5A 2QJRA 4MKXA 3C0KA 2JKVA 5LGTA 4TKZA 2I3DA 5FXMA 3H8SA 4IQ0A 3U13A 3H7IA 2WJ6A 4TT8A 4MRSA 4EX7A 1TO6A 3SXPA 1RM5A 1B8VA 1L6RA 2HGZA 1QHIA 4RVUA 2D4AA 1S2IA 3LCRA 2HLDA 3UTCA 1FB5A 4RLQA 2ACKA 5G0TA 3OA0A 3MGBA 2PLRA 4G84A 5JD4A 1BSVA 3MHPA 1PL7A 1I14A 1FXUA 1WHSA 3KJIA 3DJYA 1WCWA 4Y2HA 1Y1SA 4PS1A 3T94A 1KOFA 1ODFA 4DLTA 4LCKA 1IM5A 1ZK0A 1XZPA 5JJIA 2QRKA 4XAQA 1KEPA 4OATA 4NBSA 5BW6B 2UUCO 5AYVA 3E2IA 5BXZA 1ZINA 1OBVA 3VYVA 4UFNA 3F5FA 1VCNA 4UNNA 3G02A 2Q3MA 3OEWA 3M34A 1AHIA 3VO1A 2OWEA 3F67A 3WNQA 2DC1A 4DY4A 1M1ZA 1M1UA 3OT4A 2IM9A 2JRCA 1EGMB 2R97A 3KTAB 2Q0HA 4QRIA 4Y1EA 5FOXA 4BNFA 3VR5A 5KHHA 5CFRA 5T6MA 4OXRA 3CC7F 3JATB 1M2VB 1SY7A 3TDKA 1BX3A 3AIIA 5DEIA 1XEAA 5AIAA 1IG0A 1Q0HA 3TNDA 1GVNB 3LBFA 2QW8A 3R8FA 1ICEA 3KLBA 4YP6A 2NZYA 3VH3A 3QG5A 3FGNA 3AHIA 2R6GA 4I8XA 4AO6A 1ZSVA 3HBAA 2G9QA 3G13A 1Z2PX 3CMEF 1YF3A 1DXYA 1G0OA 1XR3A 3C8UA 3HHEA 4A8JA 1XI2A 2JFXA 3CSDA 1YXMA 4C07A 5AM2A 3RROA 4DG9A 16PKA 1O6CA 1E0JA 1FXKB 1LRKA 2CNBA 3OPNA 4Z0PA 2AMLA 3L93A 4YMUA 2H59A 2Q7HA 4QBGB 4S1PA 4Z8XA 3M89A 1SCJA 5KHLB 5HY2A 2FN9A 2IVZA 2W8BA 2AEEA 3L7DA 4A5OA 2CH7B 1W75A 1NVVQ 4KZKA 2AV6A 1SKUA 3UJPA 1KBZA 5JH7A 3FVQA 3QUTA 1Y8CA 1OAAA 4B7ZA 1YCDA 2VWQA 4RLSA 1H8ED 4MITA 4Z54A 1R16A 4A2QA 3WGUA 4PN7A 5JROA 1GH6A 1E3LA 3DAYA 1VLHA 4YAEA 3HO6A 4WDQA 2IY8A 3ZBUA 2WJPA 3QQ5A 5KMGA 1H48A 1U0RA 5LBQA 1X9IA 1CQZA 3NWBA 4IO1A 3IAXA 1R8SA 3O1HB 5FPPA 2JFGA 2QD1A 3PJFA 1R8QA 3HNRA 1AGPA 2PH1A 4CMGA 2J87A 2NPIA 3R24A 4LPSA 4BQSA 4YONB 3RYFA 1P49A 2WAYA 4HAUA 3VTIC 3UYKA 4F4CA 1KJNA 5JH7F 2PQ0A 2YIAA 4X6YA 1DAGA 3UK7A 3WAKA 3FE2A 1NVUQ 1M2OA 4LHVA 4FM2A 2F3SA 3BUSA 4L6CA 1D04A 3ERNA 1DMRA 1C9YA 1XTRA 1SNYA 3B12A 1SKVA 1YQGA 2JIOA 3DE6X 2GZDA 4EF5A 3HTXA 3LHSA 1GG5A 4TWJA 3AHEA 2G1KA 3OQHA 3QQPA 5L4LA 2XCUA 1PNTA 4GM0A 2DFVA 4W9MC 2QMHA 1DKOA 5KJ1A 2C8JA 2VN8A 4CV1A 4EHNA 1H2KA 2ABWA 3BEOA 1VQ8V 5KYUB 1J8FA 1I33A 2XQVA 3DMTC 1SCKA 3V8MA 3DV9A 4JUFA 4KGZA 5BY2A 1WSWA 2AEMA 3NBQA 2QG9A 2WHPB 1MXFA 3H99A 1QE3A 2FMHA 1L2TA 3M1YA 5YASA 1GKFA 1TB4A 3R7WB 3TUJC 4AMGA 1YC5A 1KQ3A 4MDHA 1OR8A 1XE3A 3UJHA 2CZWA 1GRNA 4BIOA 4BNVA 4D7SA 4TWBA 3NAMA 2OXRA 4ZI7B 3JASA 1Z4IA 2V54A 1TECE 3AZQA 3PA6A 3HJCA 2AOUA 1W85A 3M2TA 3KOOA 4ZV9A 4JI2O 4QGHA 2N9UA 2DF8A 2F4VO 1Q7BA 4V1CA 3FFWA 2TSYB 3MCAA 3VYTB 1VQMV 1H6BA 3RVNA 5A9TA 1GU7A 1LS6A 3PDHA 3MT0A 1NG1A 4DLBA 3BXPA 4H2DA 1SXQA 4WD3A 1H8EG 4FIZA 3ZNPA 4BBJA 2DUNA 2XODA 4XIIA 2FUCA 3H9JA 4Q7LA 1I7FA 4CKEA 1NI4A 4R2JA 3IMFA 5KHAA 1L0NH 1TQHA 5HSGA 2LXNA 3JAWA 4E3WA 1HRDA 5AG2A 4CM9D 2ZJ7A 3CRNA 2X19A 2E75B 2NTNA 1E2PA 3KPYA 3T7AA 3DMHA 1Z18A 3REQA 3TQFA 4FB4A 5HCIA 4PLWA 1SXJA 1Y37A 1NVPD 4K28A 2QI2A 5DYIA 2ZJ8A 4ND6A 2DR0A 1XVVA 4ND8A 3E48A 3JRNA 2RJOA 1IWOA 2X0LA 4FZ5A 4DIEA 2RBGA 3E35A 3QNUA 1E4EB 3LWQC 3B7PA 1Q0QA 2CXRA 1WP8A 1RFLA 5J40A 2A58A 1KORA 4NATA 4RJLA 4X7MA 2XJ9A 1P6QA 1O57A 4G4SP 4ZDJA 1QLEC 3LUJA 4DCCA 3NTVA 1VA4A 4C4OA 4WNCA 1VQ9V 1RHRA 3NBYC 5DTIA 3ZE0B 4YX9A 4EX6A 1R3LC 5IKXA 2FFJA 4ARIA 4RDCA 4C0JA 4R2MA 3TG8A 1TXGA 2JGAA 1M6NA 2A3NA 4F5WA 1XZKA 5EIFA 1PYGA 3KZOA 3CCUF 1NUSA 1P9NA 5HKOA 4UHJA 2GOYA 4OB7A 2Q5CA 2HT1A 1NJSA 3OVMA 4U7NA 4Q93A 2RGGA 2VHCA 4LDJA 5AKXA 3BFXA 4D46A 3GG9A 1FFXB 1GPKA 1TYBE 4KAFA 1R0BA 3H2GA 5TVKA 1FFAA 3KKLA 1WXEA 4ZK7A 3FI0A 2XGOA 2H92A 2XT0A 3E3OA 4ZK2A 1WV0A 3GXBA 4QFDA 2YINC 1B8UA 4XIYA 4IIXA 4PYNA 5DE3A 4OLFA 1SQQH 5GANK 1RXYA 4DSAA 1ODKA 1UBMS 2HW8A 2R62A 2VHXA 4JGGA 3Q40A 3OSUA 4CI0B 3ZOPA 3H4MA 4Q9DA 1FQOA 1PJSA 3AEYA 2XAUA 4MR8B 1M1KW 1OFUA 1II8B 3IE0A 2ZDQA 1KI6A 3AFHA 4YAJA 1IZ7A 3BREA 4JOCA 3QLVA 3HLTA 1FRVA 4O3MA 5AVZA 1Z5VA 3Q4GA 4BO6A 4I50B 1C3OB 1P3Y1 1C9MA 3RLFA 5DIFA 3UK0A 3HFJA 3ZTTA 2OOSA 2JARA 4TTVA 5AMXA 3I2KA 1FMTA 3HY3A 3QIAA 1B76A 3V8RA 2AN9A 1NPYA 2J6BA 2YNMD 1K3FA 5CM9C 2R1TB 1D0SA 1HF3A 3MTAA 4FLWA 5HPYB 3C3EA 3FOWA 1DS6A 4NU5A 1P2FA 1TQ2A 5AXAA 3UCSC 5C1PA 2BCCH 2YEVB 1USWA 1W5EA 2WJ4A 3C9TA 2HAEA 3IOYA 3LLCA 3IIEA 3GUUA 4UBOA 2Q0SA 3VNRA 4AF8A 4X44A 1JJ2U 3OPYB 3QE4A 5CMUA 4YJ2B 1PR1A 3E2MA 1QR8A 2YVAA 3G49A 3NUQA 3FUCA 4A0SA 1GO0A 1TEVA 2H1IA 3J80A 1XKXA 1FCJA 3CMAV 2EBOA 3Q15C 2WG2A 3VKUA 4N5DA 1L5LA 1SQXH 4I36A 4CT5A 4CN9A 2X1MA 3CLVA 1AHPA 3L0PA 2ZDIC 3HUUA 2MOKA 3QMPA 5EWRA 4IDAA 1HLDA 1R50A 3RAGA 5F51A 1E6MA 1SVOA 4BQOA 2I55A 4DA6A 4DMKA 1DKNA 2DJ5A 4NCHA 4QA9A 5IX8A 2VPPA 2ZWVA 3QYJA 3KT8A 1VQOF 4FR0A 2ZAMA 3MJVA 4KQMA 3KYIB 3AOGA 3K58A 4EO7A 1OTXA 5IULC 2I6FA 2ZCJA 1ZWZA 1EM8A 2J7PA 4EI2A 4PYMA 5T7BA 1VRWA 3GGGA 1DGSA 1HBJA 1EM6A 3OMXA 1DCKA 4LYDA 4XVHA 1DIHA 1MO5A 5JECA 5CLLA 4EMUA 3P0RA 3BGWA 4F56A 4OSOA 5FD8A 2O8EB 2W2KB 4KLAA 3VHLB 4B3FX 4DIDA 1GPAA 3IE1A 3W5SA 3K30A 3AG1B 3A4NA 4AS2A 2ZRGA 1HR0B 2A88A 2B3DA 2EG9A 1VB3A 3U7HB 1OIXA 6AT1A 1XEFA 2QVYX 4IDQA 4OA8A 3F0EA 2Y4UA 2VDRB 4R1LA 4YACA 3WGLA 5SZHB 2DHEA 4MJ7A 2JIPA 5KYYA 2VF2A 3I52A 3QNEA 3EFFK 5FAKA 1D4OA 4WF9V 4ZGBA 4MVUA 3CHXA 2HF8A 1L4MA 1BS2A 2YIMA 4R7CA 3PV0A 1OLUB 3ON1A 1ESMA 4BXOB 4PRLA 1VF7A 4GC9A 4ZAXA 2JAOA 1E69A 3WBKA 4YLYA 2FSVC 4ZV4A 2Z2XA 2YV5A 3NVKI 5BSUA 4MP6A 2VGMA 4P7FA 1U6IA 1SK9A 3F46A 1THGA 4EVSA 4KPEC 4QBTA 2PMKA 1KGSA 1XFAA 2XOKA 5A7HA 3GYQA 2GKSA 5AK6A 1RWPA 1EQ2A 3BE8A 1M73E 3GD5A 4PLFA 3NXSA 2VQEO 3BJRA 2QIOA 2HK9A 5JARA 3U11A 3O8BA 4RV9A 2HMVA 4A9AA 5ITZB 3O8CA 3M0EA 4E2YA 2DWDC 1SXGA 4OM8A 1U7TA 4TV8B 5CLJA 2X5KO 5DNCA 2NUBA 2R7AA 2Q3FA 5DXFA 2IEBA 2ZUCA 3ZLVA 1BE8A 5IXJA 5ESXA 1WXFA 3L1VA 2GHQA 2O8FB 4R5MA 4UPDA 4JLJA 5B3SC 3ORFA 1QB8A 1JJ2F 3L79A 4OB6A 1WKCA 5DMXA 3QU2A 2HO4A 1RMTA 3I62A 4G1EB 4ZIRB 1RWVA 2C59A 4B3TO 2QR2A 1I5EA 1X7DA 1SH7A 4H1UA 3GVHA 2V7WA 2VQFO 1GNVA 2Q2QA 3UT6A 5EUCA 1W0JA 2PWBA 1V5WA 3MAGA 2EVWX 1ZXBA 4CF3A 3JY6A 3PC6A 1Z16A 3JQ7A 3A1EA 3WWCA 1TD1A 1KOJA 3AOEA 3B1XA 4OXXA 4RMNA 3WISA 3DTNA 3EPHA 2V7UA 2G1JA 3BXFA 4RV5A 4Z1MD 3Q9LA 1G6KA 3Q3VA 2NXNA 4I9NA 3PIIA 2ADOA 3PX2A 1YASA 5DBEX 3G2QA 1RRMA 2MR6A 2YYYA 4O59O 3TGUH 4XASA 2A5JA 4GR5A 2Z08A 3O5AA 1HE5A 2PPLA 4LWPA 3IUQA 4IGGA 4W4TA 2BKAA 4DUYO 2R2GA 1VGQA 2KWIA 5E3JA 3VCZA 4K81B 5HQJA 4BAZA 5ESWA 1EUDB 4MDEA 3F7OA 5LQDA 3QEOA 4WKGA 2GBPA 4YDRA 2WUFA 1P6UA 3U9SA 2GTAA 1UZAA 1OU0A 1EX6A 2I33A 5BSTA 1R5NA 3R9IA 3T4XA 1YS9A 1Z6TA 2HNBA 4LN1A 5KDOA 4ZQFA 4ERNA 2WSSD 4AYWA 2C9CA 1RQLA 1YR8A 2G5GX 3OF5A 4BNUA 2ZSBA 2IT1A 4Q05A 1NOIA 4HX5A 4Q3LA 4UATA 3RVYA 3ZVKA 4URUR 5TX7A 2HX0A 2CNNA 1IOWA 5HRAA 4DLYA 5EP3A 3SF8B 2JGDB 2PMDA 4JQSA 1N57A 1YKSA 2Y76A 4EFEA 2ST1A 3PFCA 5CX4A 5AKLA 3KZMA 1PNQA 2ETVA 1Y7LA 1NV9A 1KKCA 3WHPA 3SGIA 4QYIB 2IBZH 3WLQA 2DJIA 3KKMA 3GW8A 1UDBA 1PV0A 4XWAA 2W6QA 2PJRA 1QGZA 4LGCA 2EWMA 4NV1A 1PTKA 2WPNA 4CR6A 4CIWA 3EUAA 1AMOA 1BRMA 2YXYA 3ASOB 3W7BA 3B09A 3DZDA 3VAZA 2XUIA 4CH4A 1QOPB 3H1TA 2OLKA 3H65A 3SR0A 3Q7PA 4CETA 1E3WA 1DL5A 3K96A 3HB1A 4N5HX 3CWCA 2UXDO 3ZE8A 3TLJA 5ICEA 3AVXA 3V8QA 2Y1CA 2B5UA 5TQ2B 3G79A 5K1XA 1Y42X 1FS0G 2I6SA 2CFCA 5DLDA 4DR2O 4BNDB 2XY4A 4N18A 2WBLC 3GDOA 4UVIA 1LRLA 3CH4B 3FPLA 1V43A 1ISMA 2INGX 1KVRA 4FINA 5ALDA 3G88A 4MAFA 4KWEA 1K8AW 3JU3A 3JRWA 5KSWB 3U4DA 4BMYA 2HPZA 1YA4A 2ANCA 2DW4A 1EQAA 1TEXA 5KJ6A 3K2QA 3LRTA 3DBVO 4LXXA 3WFVA 4NOKA 5CFQA 1ZUWA 3UG6A 4BX9A 3L8MA 5KOHB 1UBSB 1DWOA 1OZ0A 4BJ3A 3BG5A 1QHXA 2YXLA 1I1NA 1PR4A 1GILA 5CGQB 2JPDA 1GL3A 5DNWA 3FB5C 3FB4A 3Q5DA 1E7SA 1KNKA 4DHEA 1JVMA 5L8VA 3HCEA 4PRZA 3GRRA 2AFIB 5EXDA 2PHNA 3T7DA 1QR2A 3Q7RA 2J3EA 3FMGA 3N2EA 2XUJA 1OPXA 3CC8A 4JH0A 4X0EA 3T38A 3IKFA 5B3AA 3F7VC 2IC5A 1GZ0A 2WSSG 1TIBA 2FMFA 3A10A 1F2TB 3O9OA 3RRZA 1JJVA 1X80B 1JEQA 2D62A 1WZIA 4FHFA 4L4YA 3KTFA 3H6HA 2VDKB 2W37A 1GM5A 1W55A 4H16A 2IZ1A 4ENVA 4KRYA 2FWAA 4R7GA 2GD1O 4LZNA 1WX1A 1W49A 4ZTZB 4IT5A 5M5BA 3RSQA 4HDNB 4UOQA 1O87A 1P2GA 1UFYA 3JSXA 3QLUC 2VIIA 3RRMA 3O8QA 3GR6A 3S0WA 4HDKB 4X93A 4AZSA 2G4CA 1YIJV 4XJTA 3TKAA 2ZSHA 1Q16A 2PGNA 3APOA 1B93A 4MVMA 5NLLA 2CNDA 1UKEA 5J5CA 1L8DA 4MUEA 2XYVA 4E32A 1CY4A 3R5TA 5HJ2A 2VJDA 3WK9A 1OASA 4EIWA 1GSOA 3TZCA 3AJDA 4E70A 4GDMA 4HQLA 1PU2A 4NYJR 1O97D 1UAGA 1JV2B 1JHOA 1P4GA 3QOYA 3TR0A 4JC5A 3AYZB 4CC5A 3A3KA 3RV4A 1EHYA 2ZLBA 4F1JA 1N0NA 3DYIA 2WTMA 3LVRE 5H6RA 3ZIAD 1UMDB 4X1YB 3UFXB 4MW6A 1PJTA 4I3FA 5BN3A 1V6CA 2MK3A 3JWJA 4XYLA 2ZBDA 3O2QB 4NSNA 2BFFB 4FCTA 1FS5A 3VR4A 3UAWA 1LK7A 4J0JA 5ENDA 4CKCA 2FMIA 13PKA 4U1RA 4EF4A 1HG1A 1TTHA 4JAVC 5CIQA 3WKBA 3JAKB 2AR0A 4RTLA 4I9UA 1ONSA 4IRUB 4LKRA 3B7GA 2Q5IA 1E8MA 1ODCA 3RSLA 3FX2A 1KEUA 2E3CA 3NHZA 3S2YA 2PU5A 1WZCA 3TOSA 4CLOA 2UYQA 3H2JA 2DQSA 3ZWXA 2NSLA 1QC5B 3BIJA 5K8LA 5CTJA 4QULA 4DG5A 4MR9B 4FFWA 1QYVA 4HMOA 2CVZA 3LSUA 1P4HA 2FW0A 3OESA 4UNIA 3I0MA 1WB4A 1DJQA 1O54A 4A2PA 3EN0A 3VJMA 4WASA 5ALEA 2GPWA 3E53A 3DOFA 3S29A 2GBLC 3DXYA 1Y4UA 5HMMA 4PZUA 2O54A 2ZIXB 4BV3A 4D3FA 3BWDD 1M1YA 2YFYA 1CRQA 4M6WA 4R2HA 1U9ZA 2O4UX 3K2XA 1DT9A 2NQTA 5DBGA 4BWYA 1K7YA 2CLKB 2IF0A 4G67A 4WKOA 4E2XA 3CCVF 1Q0RA 1GAEO 4HC4A 4N49A 3GL9A 3G2JA 1BS1A 2GUGA 2DPXA 2VK4A 5EFZA 2YVQA 3TL3A 1DIAA 4KWHA 5IUKC 4W5OA 1PUIA 4QGPA 5IZCA 5BSFA 2Q5LA 1MLDA 3H5RA 3GEDA 3EY4A 4L02A 4WFKA 4V0SA 3THYB 2V7QD 4URFA 3A1WA 1CDZA 3MYRA 3UMSA 1PVOA 3QYPA 1TZKA 1HEUA 1PI3A 1ORHA 1GR0A 2W9XA 3NEAA 4LJYA 3CLRC 2CK3D 1R6KA 4J3JA 4TS4A 1TCCA 3AEZA 2AOTA 3RUIA 3WRYA 4EP1A 1BE1A 3MN1A 3SLRA 5CIWA 1TAUA 1YRAA 3KZCA 3HCNA 2VYVA 5BN5B 2A6PA 3RSFA 2W6JA 4KVZA 1OSNA 1XOUA 5K1ZA 4R8MA 2YR0A 1C7IA 4FK8A 4WFFA 3I2IA 2EILC 4U02A 3S06A 2QEXV 4IKPA 3DMGA 5A0FA 3UEOA 3PJDA 2HMAA 1Z83A 1SQ6A 4XYGA 2WLNA 2XRYA 4IIUA 2Q4EA 4I1OA 3ZI0A 3FFBA 4JB8A 1VQ5F 3IEWA 4M9CA 5CA3A 4TYYA 3C4VA 1Y8ZA 4QL3A 3T1NA 4IJKA 2OIGA 1R88A 1DLBA 2C5SA 3BRSA 3WFJA 3Q2KA 1D6MA 3IQDB 3RUPA 5IY5C 1EFPB 4M1SA 4NE9A 5ALFA 1VQ8F 2JH3A 4TKUA 2CB0A 3EHBB 4NENB 5CYFA 4BIIA 2X0KA 3AIKA 2BKVA 4CKBA 1NBME 2RC5A 4EQ6A 1TGVA 3OZUA 1ZBDA 3GJ7A 4Z9BA 1AJNA 1CZHA 3R1IA 3PQFA 3UMBA 3CUVA 1EG7A 3REOA 2JFBA 5D8DA 2CWWA 1FJGB 1OU4A 3EX7C 1IY1A 1JIIA 4ZGWA 4DJ5X 1LBSA 1E2UA 3MS7A 4LZAA 1M7GA 2YJGA 2A0XA 3IUYA 2LCFA 2F9FA 5KHGA 2XAAA 2IV3A 4HYEA 5KOYA 2XT9A 4XEHA 5DT9A 1V9PA 1VKOA 4QHYA 4O2AB 2EHDA 1UEXC 1CXZB 3U3ZA 4KZPA 3IKEA 4TYMA 3V4LA 3KEGA 4FM9A 1JU9A 2RG7A 3IRUA 4FLZA 4KFRA 1X74A 4C4YA 2GAOA 3W2HA 2V7QG 1GNLA 2RCVA 1EB8A 1N8SA 3O75A 1WVIA 4H0CA 1XCBA 5H02A 5IBCA 1VF6C 1O58A 1D6SA 1ODSA 1XAHA 4UW9A 4YLGA 5DULA 4NPCA 3TZQA 1PHPA 1DC7A 1QQTA 4FT4A 2HSZA 1TVKB 1Y67A 4ZJZA 1XA4A 4F2WA 1DJPA 2YV1A 5KYKA 4EYQA 2H1LA 5ED4A 1L4FA 1DEHA 1KS9A 1Y63A 3MMZA 3ND9A 3AGQA 3COSA 4L2IB 1TC1A 1J97A 2WJWA 1U0GA 1A9YA 4JX9A 4GQIA 1R0WA 3DF9A 4HDQB 4RZUA 1M2NA 1OCCC 5A5FA 3EZ2A 4HAMA 3QM1A 1FPQA 2ZRMA 3LYLA 1K8QA 2PLWA 2LJ2A 3ZE7A 4AP6A 3UUWA 4MTFA 1MVLA 1QHNA 1ESCA 3I53A 2FPSA 4CE6A 2IIQA 1VQ9F 1JSZA 1W7AA 4KB5A 3NC1C 3D54D 2Z8YM 1NTKH 4TV9A 4KPUB 4ER3A 3L1UA 4MCJA 3NNSA 1MEJA 3B36A 3ROEA 2IK8A 4M1YA 1ZR2A 1V9LA 5FI1B 2IXFA 2DY1A 1ZD3A 2P35A 5PNTA 3B20A 3ZW7A 5GZ3A 2CJWA 1JS1X 4E11A 3RREA 5EPOA 1YNSA 2EJVA 3RC2A 3M5CA 2B20A 3NANA 4XQEA 3JD2A 4UHHA 4XVQA 4FNMA 3L84A 3TWOA 3RADC 2RARA 1WJGA 1YE5A 2YN2A 1PR6A 4FZ1A 2HL6A 4UOEA 5JNRA 1MA1A 3ZTWA 4LX0A 1NJFA 4C4AA 1C0EA 3WL7A 1IBLO 4BTEA 2HU8A 3ETGA 4YQYA 4QOGA 1QGUA 2PGIA 4TV9F 4JI7B 3EISA 1U2GC 1U3TA 1ZG3A 4MRAA 4BB6A 3EXG2 2P6PA 3PXGA 2H0RA 4JVSB 1KY2A 1RI3A 2BEUA 3RTCA 2VDJA 1GGKA 2OHJA 3E0XA 3ZWBA 5FT9A 2F8SA 2OFXA 1N2IA 3ZJ5A 4IYRA 3HFSA 4M8LA 5F3RA 1KYOF 4O5OA 4NZOA 4D4GA 5M29A 4ERXA 2IYPA 1HMPA 2EG5A 4WLFA 1CYDA 4QM6A 3JQ9A 1JA1A 1GX1A 1D5AA 5ISMA 3UC5A 4MVCA 4F5DA 4LXQA 1KPHA 2AIRA 2GPYA 2QZ4A 4NDAA 2GESA 3UK1A 3R0VA 1L7XA 3IBGA 2IYNA 1L1RA 2FFBA 5JZBA 3DFFA 1C3LA 3MWEA 4JN6B 4A10A 5IANA 4ARZB 1NKDA 4XBFA 4L7VA 2ZR2A 4P7KA 4MV1A 3EGEA 4G07A 2ZB7A 3DW3X 2Y05A 5KA5A 1XQWA 3E8MA 1Z29A 4MO2A 3SXUA 3WV5A 4UNSA 4H0LB 1LFDB 3ZK8A 4KPYA 3LBAA 4H9GA 1RLTA 4Q5IA 4KR2A 4NBTA 1N5MA 2PEZA 1JKIA 2FR8A 1U7UA 2OESA 3CSSA 3LX6A 1X7OA 5I8WA 4PV7A 3CMAF 2Q5QA 3TSCA 1A27A 4E2FA 4EW1A 1WMSA 2GSWA 3TGPA 1FYEA 3A6JA 2GAFA 5C80A 2B94A 1CUWA 3FMIA 1ZESA 3ZVRA 3ZWVA 4LRTB 1AS2A 4YREA 2I67A 3UYLA 5KUTA 4EEXA 3S28A 3NR7A 3OQBA 2AW5A 3M70A 3GB7C 4P83A 1K7FB 4G2KA 2ZKLA 4S2UA 3F6MA 1BRTA 5BSEA 3D31A 4V0LA 1AKMA 1QLJA 1NW4A 5K0SA 1VI5A 4CMKA 2FB5A 2VDVE 3NEPX 1FDOA 4EEZA 5HY1A 3RS9A 2ZETA 2CYCA 2HZ7A 4GKJB 1NVEA 1L4GA 1U2TA 2YZKA 4KI7A 4RTKA 2CE7A 1L0BA 2PVCA 5DGXA 5E6RB 5KNBA 4C2BA 2CZGA 4JIMA 2GQ0A 3SC6A 5KJFA 3X1KA 3I28A 3IBYA 4KWTA 3OX1A 3CPJB 5GTIZ 2QTPA 4KXVA 4LUCA 2FEOA 4KN9S 3F90A 5E38A 4OHFA 2Y1LA 3CBGA 2P0YA 4WCFA 2O2DA 1KECA 2IW5A 5LP6A 3FCOA 1W8IA 3OEHA 3A04A 2EGGA 1ZU4A 1Z12A 2Z04A 5E79Z 1HI9A 4UE6A 4HQ6A 4FIPC 2DERA 3VNAA 5DI3A 2JS3A 1W1WA 5LUAA 1RYMA 1EIZA 3DE1X 3MGGA 2ZYVX 2Z56A 4XR9A 1KWGA 4RESA 2BVNA 5B7GA 3JWGA 5A3RA 4RULA 4E22A 3GFOA 4PONA 2BSKB 5FTLA 1DAPA 2JIMA 4YJHB 1HZZA 2FQWA 3L4BA 1AKYA 2IZ6A 3EXHA 2YXZA 2B7CA 5FPTA 2CNWA 2H2IA 1SXPA 2YUTA 5CB4B 3SC2B 2JBAA 2PV0A 1F7YA 2BMJA 2KB0A 3FDFA 1R8JA 3EGXB 5EQFA 3KV3O 2HFEC 5ALRA 4O25A 1C1XB 5LP6F 2Z3YA 2HYIC 4I81A 5LHGA 4YUZA 1XMOB 1SB9A 2IYAA 5ESDA 4QGFA 5TMEA 4QVKA 3UMJA 1SQPH 4Q24A 3N3BC 1M8FA 5DM70 1MRNA 3V7WA 4FGJA 2LKDA 3ZTYA 4GRDA 1QLHA 1N6NA 2P7IA 1D03A 5C3UA 3KAPA 5HTKA 1FAFA 4J0DA 3EDMA 5CPBA 1Q95A 5LGUA 4PD4F 4CRWB 1WPRA 3NIDB 1O6BA 2XKBA 2HV8A 3BOSA 3FJYA 3AKYA 4Z99A 4D9FA 5K6A