4I50B

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
429
structure length
422
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 158
structure length 422
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i50B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i50B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i50B01
3JAKA 5JVDA 4ZHQA 5LOVB 3N2KA 4TUYA 4O4HB 4YJ2B 4I4TA 4HNAB 5GONA 5LOVA 4TV8B 5IJ0B 1W5BA 4IHJB 4O4HA 5J2TA 3V3TA 3ZBQA 1JFFA 4TV8A 4O2AA 5MN4A 2Q1XA 4EI9A 3RYHA 5BMVA 4FFBB 4X1KB 5EYPB 4IIJB 2BTOA 2XKBA 3JATB 4LNUA 5C8YB 3RB8A 3WGKA 4X1KA 3JAWB 4F6RB 5EIBC 4I55A 1TUBB 4ZI7B 5CB4A 1OFUA 5C8YA 4KWEA 3HKDB 2RHHA 3VPAA 4O4IB 4F6RA 2VAMA 1TUBA 1RQ2A 3HKEB 3HKBB 4U39A 1FFXB 3VOAA 3E22A 2RHJA 3HKEA 4X1IB 1FFXA 4YJ3B 5EZYB 5JCOC 5KMGB 5LP6C 4EB6B 5LP6B 4TV9B 3VOBA 4X20B 3R4VA 5JCOA 4YJ3A 5EZYA 1Z5VA 5KMGA 4EB6A 5LP6A 4YJ2A 4TV9A 5M7EA 2VAPA 4HNAA 5FNVB 4EI8A 5IJ0A 4IHJA 5FNVA 4O4JB 1RLUA 5JQGB 3ZIDA 1W5FA 3JARB 4FFBA 5EYPA 4IIJA 4O4JA 3JATA 4DRXB 5LXTB 5JQGA 4B45A 3JAWA 2GVIA 4M8IA 4ZI7A 4ZOLB 5IJ9B 5LXTA 3HKDA 4O4LB 4O4IA 5JH7B 1TVKB 1W5AA 1W59A 3WGMA 5IYZB 4ZOLA 4XCQA 5IJ9A 3HKBA 4O4LA 1TVKA 3UT5B 3VO9A 5IYZA 1Z5WA 3WGJA 1SA0B 4X1IA 5J2UB 3HKCB 5MN5A 5CA1B 3UT5A 3RYFB 1SA0A 4X20A 3JALB 5LYJB 2R751 4X1YB 3RYFA 5KX5B 4O2BB 3JALA 2BTQB 3JASB 3N2GB 5LYJA 2VAWA 4U3JB 4X1YA 4E6EA 5KX5A 5MN6A 1RQ7A 3JASA 4TUYB 3N2KB 3M89A 4U3JA 4I4TB 2R6R1 3JARA 5GONB 4DRXA 3RYIB 5J2TB 3VO8A 3CB2A 1JFFB 5EIBD 4O2AB 4WBNB 5CA0B 4I50B 3RYIA 3RYHB 5JH7A 5BMVB 5LA6B 4LNUB 5ITZB 4WBNA 5CA0A 4I50A 3C8LA 5LA6A 4I55B 5CB4B 2VXYA 5ITZA 1W581 5J2UA 3RYCB 3HKCA 1FSZA 5CA1A 2Q1YA 2RHLA 3WGNA 3M8KA 4DXDA 3RYCA 2RHOA 2XKAA 3ZBPA 4B46A 3JAKB 5JVDB 3E22B 3WGLA 4O2BA 4EI7A 2BTQA 3N2GA 4ZHQB 1W5EA
chains in the Genus database with same CATH superfamily
3L7BA 2BMDA 4OKNA 1BE0A 3AG3B 1S2GA 1BN7A 1VC2A 2JJ1G 3HSSA 2RBEA 2JRLA 2IEBA 2Z57A 2IYTA 2WUDA 5MDHA 4YLYA 1CQIB 4RPKA 2I54A 2PKXA 2C5BA 1XDDA 2QLJA 2WIDA 1TUIA 1WP9A 2G77B 1C4KA 2G04A 3SPJA 5JYBA 4OMUA 3HGMA 1AMUA 3PFCA 4C0QC 3WQQA 5J23A 3KWFA 5A9RA 4KDFA 1SA0A 3HY4A 2FMIA 3VR4H 2EFYA 2VDOB 2XZOA 1WZ2A 3OWHA 4F85A 4MI9A 3FCAA 2UXNA 2G1KA 4XWYA 5TMBA 4TS9A 4B0PA 4NYIR 3NEPX 3O8QA 2RG7A 5FOQA 2HVJC 2CE4A 2CFRA 5G3YA 2YXDA 5EJ5A 3RSZA 2QTMA 2W6ID 1G3RA 3HAXD 3Q8KA 2G36A 3EEIA 2CHQA 3UUEA 1A9TA 3J81N 1WVGA 4IQ0A 1Z47A 2DG2A 3JQAD 3GDHA 5LWQA 1GNSA 5REQB 5EIBC 1U9YA 1A2OA 2HLHA 1ZW1A 5CR9A 4X8MA 5CB0A 2COEA 4WVFA 3AI1A 3ZI7A 2I6SA 1NU8A 3PITA 4LSWA 3N07A 5FLKA 1N8SA 1QYIA 5DM4A 4A0HA 3H87A 3IQHX 3DDSA 3OLQA 3WLAA 1ORWA 4B8ZA 1XB2A 5AXBA 4F3TA 2ZI9A 3ND9A 4GSYA 1KSFX 5HQTA 3HU3A 5B7PA 3S8EA 4HDQB 3UO2A 5HP8A 1L1FA 3U48A 3DKRA 4MTFA 2HIHA 1KO1A 3M6UA 4FYPA 3AUSA 2VF5X 3VX4A 1SNYA 4PSDA 2ZIEA 4BZZA 5EIXA 4FFDA 1M83A 4NWIA 5B4VA 1AS2A 2VYQA 2A4KA 2PLRA 3V4SA 1E61A 4LWSA 4AM8A 3MUEA 5JARA 1JP7A 2JNWA 4J80A 4S0ZA 1DV1A 5ERGB 4YDHB 1W73A 4B32A 1QBGA 5IZCC 2A2ZA 3GG9A 1RS0A 2WTMA 1EVIA 4L0DA 3GJ0A 1Z0IA 5D5HA 4JR1A 3FZYA 3G2MA 3V5NA 3FIJA 1ESDA 1WULS 2KHZA 2VJPA 1NMZA 4M8SA 3PZBA 4DIUA 2FYTA 2XE6A 4LBWA 1BWRA 2A86A 4GO1A 2OHJA 5IW8A 2JJ8A 1VXOA 4TZTA 3H5VA 4OQQA 4XPZA 1GL7A 5BW4A 2FMLA 5LWHA 3PPYA 3ESJA 3ESRA 2ZS8A 2CDNA 3ECAA 2YZMA 1U3DA 4KV7A 3BIWA 1OAOA 3LC1O 1SQVH 1JQBA 3DEJA 3KPVA 1HQKA 1LA2A 1TO2E 1EN5A 2NO4A 4Q15A 1Q2UA 3LLMA 4LJ9A 2QWPB 3ENWA 4LGVA 2EF1A 3ITEA 4DWWA 1SPXA 3A58B 1SQBH 3NCTA 2QSJA 4UHDA 3BEHA 4ND8B 1W36C 2BP7A 4WCVA 3SLRA 4UOZA 3EFOA 4D4JA 1SRRA 3TIVA 1K5HA 3VVCA 2KS6A 5DNUA 5C3MA 1GGKA 1E4EB 3G80A 4I1SA 2P4HX 1U1DA 4YLGA 3TH5A 1OLSB 2O5EA 6LDHA 2OFWA 1PWEA 1LSSA 4RZSA 3STZC 4FSDA 4TQDA 4EJ6A 4BNJA 5I8PA 1QQAA 4BNXA 3MWGA 1S9DA 4GVPA 5FPYA 1BVRA 1VE1A 1AB5A 2RGNC 1Z3IX 2ZAIA 3QF4A 1S9HA 5COQA 3COYA 1EQ2A 1TMYA 4LAFA 2JJ2G 2UZAA 2PZFA 3TQOA 4ZN6A 1SHZA 1ZUIA 3IMCA 2GXSA 5BR8B 1AKVA 5H1YA 1Y8QB 2HCFA 3KEMA 3RC2A 4XDGA 3BAZA 5B57C 3A9VA 4XUEA 1KKLA 1RBYA 4EUKA 4D9GA 2ZANA 2FW7A 3MN1A 1CLIA 2FV8A 1CUVA 1YASA 3FIUA 4UCXA 1DEXA 3PQ4A 3ZHXA 4MHSA 1QP4A 1A27A 4A1FA 1QH1A 4QGFA 1ZR4A 4BBZA 1MJ5A 1ZD8A 3ABMB 3VDRA 1FP4A 4ZI5A 4Z4FA 1UFKA 1R8SA 2BELA 3RVOA 1F48A 3LGXA 4INJA 3GJSA 4CKEB 4QASA 1IOWA 4BGUA 1XA4A 1ZQ1A 2G40A 2P5UA 4IUDS 4DDKA 4PN3A 4JC0A 2R1UA 1JHMA 4AMVA 1KNKA 1ZA2A 4NENA 1ZP6A 4KO8A 5JSQA 4P54A 3OOHA 1NHGA 4RQOA 4MTLA 4X6YA 4DV6B 2EP5A 3JSLA 3A0BZ 3WP0A 3P2YA 2IEAA 5CMUA 1O0BA 3FFBA 3CYPB 4LH6A 3E0QA 3Q9LA 3RVJA 2WILA 4NONA 2IJHA 1REQB 1WMBA 2ADMA 3NB0A 5A2GA 2PZEA 2YQZA 3C8DA 3U3MA 1XYVA 3OY2A 1R8YA 1QDLB 3A25A 3IEUA 4DNQA 1EYZA 4QTTB 4TROA 1C3OB 3KYJB 5K2OA 1U4OA 2X4DA 3WYFA 4B45A 4L16A 2V0CA 2YV5A 4IAOA 3IHLA 4CLDA 4BNIA 1PDWA 2GJSA 4C0LA 1EFRG 1MTZA 2HEPA 2DUNA 2F1OA 2MJLA 3ZCXA 3LYBA 4GKJO 1X92A 1XHXA 2QYTA 1SO8A 4UZSA 1FVOA 4BNHA 4IYRA 1BEZA 3LDCA 1IWOA 1N78A 4HFNA 2WPDG 2CJFA 3G6WA 1YL7A 3VBEA 4B3SO 5C7OO 2VPZA 3RRZA 4LISA 4G26A 2GRUA 4F5YA 2DUUA 4YJGA 3ZY4A 3QFSA 3NXKA 5K3EA 1J56A 3ROQA 2D4HA 1R9NA 1NDQA 2O3TA 5DXJA 4J0DA 4UHCA 4HCJA 3CE6A 1VQLV 4O5OA 5KTNA 2NPFA 4AI6A 4D4KA 1THTA 1AMOA 4NBWA 4EB8A 2IVFA 1XU4A 2A1UB 3KQOA 1VSUA 2PWPA 1N6RA 1JR9A 5HY1A 2A9KA 3A7EA 2JJMA 1SRYA 4PSKA 1EVYA 4JVOA 3KLBA 5IARA 3PSAA 2QTRA 3CSUA 2V7PA 2WFZA 1S3FA 5FBWB 3SS8A 1SB9A 3KELA 2R9IA 2QIOA 3ZBTA 1U2DA 1SXJC 5FUXA 4LF9B 4NOMA 4ANFA 1VARA 3FUXA 4TTJA 2XQJA 3W6UA 3K5LA 3SP1A 4WA7A 2M6LA 2KB1A 1YZKA 1J2JA 1VL0A 4U3JA 5HOEA 1W42A 1UJCA 4JKYA 2HS3A 2E9SA 3S28A 2ZRPA 1N75A 4PYJA 1ZJ4A 2GF9A 2OXIA 2CY0A 3CWQA 4NCIA 4YP5A 1IY2A 2F8SA 2E18A 2QENA 4ZAGA 4XEHA 3DZIA 5B6JA 5KVQA 4DXAA 3HFJA 2X0JA 5FI0B 2X7XA 3DTNA 2IP2A 2YJTD 3ZOKA 3C9UA 1E3WA 3AF2A 2TYSB 1SZCA 4K0KB 4MWSA 1VL5A 1ADFA 2C57A 3I37X 4HNVA 3K0AB 3EQ8A 1P9NA 5JE8A 3S5JA 4D3YA 3LU1A 2NW6A 3ZWXA 1S3IA 2H7CA 1ZK1A 1XXHB 1IQRA 1WDWB 1SXJB 4GPD1 3I4LA 3H1KH 1UBTS 3KB1A 4NKRA 4FZ5A 3PTAA 2WT9A 3F5SA 3K9NA 5KAMA 1WA8A 3PHIA 5D1NA 2ZTUA 4O1IA 3FTNA 1LNSA 1H0HA 2XMZA 1ZAYA 2OESA 4BECA 4NWOB 1WUIS 3MD0A 3M5PA 3QLUC 4PFJA 2XDQB 5CA1A 2WAOA 4B87A 2R96A 3E7XA 1ZJJA 3PUXA 4X44A 2NT3A 3O9VA 2VQFO 1DTWB 5C1OA 1DMSA 4N01A 1M1KW 4MRNA 2EJWA 4RKQA 1DNPA 4GRIA 1VHTA 3KQMA 4KRGA 4E09A 1HNZO 3HZZA 3HDTA 3ZRWA 5EWLA 2UYGA 3HFGA 3S03A 1QLHA 3KT8A 3KHTA 1GFWA 3MNFA 1TMOA 1AUPA 1XAHA 2JEYA 3WLNA 1KMMA 5CB8A 1RM0A 4EW3A 1NHWA 1G8SA 5JVDF 1CUHA 5J47A 3TRKA 4FYKA 4K8OA 4RY0A 7YASA 3OW2F 3D3KA 3MSCA 1XAJA 1DKOA 3A4IA 2ZWOA 1ECGA 3U7QA 4U7OA 4P83A 2PZJA 3RV3A 1NDHA 1GGNA 1HORA 2FEOA 1Q44A 3ZU2A 2BO1A 3T1HO 2PIAA 3J80N 1B6GA 3B9RA 1OH6A 3CT6A 5B58T 2HU7A 4A23A 4KUHA 5K1PA 3WGTA 3D8RA 4LOJA 3OMNB 1WP4A 1WV0A 2ZKIA 3O9ZA 4QXPA 4J2TA 4YMTA 4PNPA 2GDSA 4LOKA 3F96A 2R70A 4GZ3A 2AOXA 1NI4B 3I04A 3K03A 4YACA 1W87A 2V96A 5HBRA 3RNLA 3K1AB 1NXPA 2V98A 3U7EB 2COUA 1Z5ZA 1ZK3A 2X8JA 3W8DA 1NURA 5B1HA 4N0MA 5AVUA 2PM8A 1VG0B 3CZCA 1E3DA 3UYKA 4MW2A 3FHTA 1Z7YA 1U9JA 3PXCX 1GYPA 2XUOA 4MQFA 1JKJB 3JALB 2BCEA 2C3YA 4NG4A 2WF5A 3T5TA 5DK4A 2FK8A 3CTPA 1V2GA 2XOKD 3G7SA 1RXUA 4WFHA 3IUEA 4FNAA 2A0WA 4JLVA 5C1IA 4PDVA 2OT3B 2G82A 2CLLB 5I9NA 3G88A 4X85A 3UV3A 1X2BA 1IOLA 2VDWB 4B3TO 1NU1H 5LLDA 3LGAA 1ZDMA 3AJ8A 4UD6A 2G70A 1S72V 4GVXA 3R8XA 3L40A 5ALDA 3B09A 2QTVA 4TLAA 4F2WA 3BPZA 2V4ZA 2V6MA 3LG2A 1D4AA 1QZZA 3QV1A 1PL0A 1ZBDA 3I6IA 4GBJA 5D87A 1H4TA 3HVRA 3TAUA 2AG0A 4BATA 1ZFNA 1RMYA 4Q7LA 4HOYA 4L15A 2XBUA 3SQLA 4R8SA 1AF7A 3E8GA 3U37A 1H8HA 2ZR0A 1KI7A 3GLFB 5J58A 2BMJA 5LYJA 2VAWA 1NF2A 3DKIA 5F64A 1FDTA 3BZWA 3JQPA 3HR8A 2JAOA 5ENZA 4HN2A 4BWGA 4X63A 4CI0B 5JY6A 1TGOA 3JWHA 4B3HA 4QWMA 3V46A 4ISCA 4EFNA 4QDTA 4Z2YA 4BNTA 1VEWA 5FCDA 2FP4B 4LFBB 5FTJA 1H48A 3MPUA 3OFNA 2QE7A 4TSKA 1YK1A 2FKAA 5DGDA 4K6GA 4PS1A 2HYDA 5FR1A 2BKUA 4MVJI 3KUKA 1TF7A 1XQWA 4RQAA 2ZE8A 3USZA 2HHLA 5CT9A 5CA0F 1KI9A 3IE1A 2BHNA 1BVHA 1U11A 3LTEA 3AGKA 4XCQA 3NGLA 5TMDA 4L5CA 5EN4A 1V8DA 3VJKA 2ITDC 1M1UA 1R6VA 4K9LA 3UMMA 4PS0A 4F97A 1HDGO 1N7HA 1GFSA 2PD3A 2QSZA 2XIQA 1C30B 2W37A 3DBIA 4XLTA 5LQNA 1U8TA 3SYQA 5EE0A 3KLNA 1J99A 1R5OA 1Y4MA 2QP4A 3WHIA 3W5UA 4I0XB 1L4BA 2XUHA 3BL6A 2YQ4A 3ZWNA 3V34A 1QR9A 3EC1A 1Y76B 2IW3A 1CVLA 3SJCA 4KOAA 2J9ZB 2XQFA 4MVJF 5KAPA 4BLTA 1H9CA 1DJNA 2XNDD 2V9YA 5A9SB 4K9DA 3MYYA 5BW6B 3VHXB 2ZU0C 1TCVA 5LLSA 4DOMA 4A8JC 2H4WA 5CBPA 4C43A 5F1KA 4DLAA 2DYSB 1JVBA 3U7HB 4FD2A 3D3QA 3AUUA 2AMLA 2OCCB 3O94A 4D6PA 4NMWA 2JS3A 2J3QA 3IUMA 3ZKWA 4D9NA 3GZJA 1HWYA 1KAEA 2QY6A 4JGSA 4HAMA 1TDJA 1COZA 3GHYA 3EOZA 3MBKA 1Z73A 3U7GA 2ZJ8A 1QR2A 1TTPB 2VJBA 3GU3A 1I0IA 1Y5NA 4J3FA 2P65A 4IUBS 4CR6A 2Y77A 2F1IA 3MGGA 4EHNA 3NDJA 1BYIA 3CLSC 1J7HA 5GJCA 3F6MA 4R50A 1V43A 3SJBC 2ZIMA 1HRKA 4NAUA 2R79A 2GF0A 1S7CA 4AECA 3WHKA 4A8JB 1YGPA 1RWQA 3TQQA 2NVOA 3PYLA 4K6MA 1YKSA 4PZDA 4YCSA 3C41J 3TVTA 2BUAA 3BCCH 2R84A 4GDMA 2V8BA 2UYNB 1RSOA 4A6PA 1JH9A 3LECA 4OK5A 1VCHA 3CZQA 1J07A 4XQGA 3GBPA 2Q0SA 1LX6A 1N6PA 2WC1A 1QRTA 4Z8YA 5I47A 1BEUB 2Z3ZA 1E1QA 2Z09A 3BOSA 3P9XA 4JI6B 4S05A 2H85A 4LWPA 4NPAA 2AXPA 1VMAA 3HXQA 2Q7OE 1BH2A 2PR7A 4FDTA 3JQFA 4LDQA 3ACCA 1MEJA 1POXA 3WIBA 3KWLA 5AESA 3K0BA 1ISMA 5HGJA 2HJ9A 1LNZA 4ILKA 5L3SA 5B3AA 5AJXA 5TS2A 4Y6LA 2C88A 2BKEA 3K92A 3QUAA 4OGKA 5HM8A 4KUGA 3L49A 1N25A 4KYVA 1MD9A 2UVPA 1QX3A 5CCDA 1G1AA 1SQFA 4JNCA 1KKCA 1EAMA 2VCYA 3O6VA 2OHIA 3H05A 2XHZA 3QFCA 2JIMA 3DM5A 1TVKB 2O0LA 3GLRA 3ZDRA 3GAMA 3N53A 2CV2A 3W2EA 3JYQA 3K1ZA 4LRTB 3BHIA 2XD4A 4FFMA 1RXCA 4UXIA 1GX1A 3TS1A 4Q19A 2ACVA 3K7EA 3D8CA 4H0CA 4PQYA 2WM9B 4ZDKA 1GO0A 5DXFA 4FM2A 2BMVA 5D84A 4OF4A 3CRW1 1VHQA 5EE9A 1YI8A 1F06A 1CEYA 2N48A 3HRIA 4HEJA 5AKLA 5LCXA 4KXWA 5CYFA 1F7YA 2V3CC 3GJ4A 3C3CA 4IF6A 3BA1A 3MWEA 1Z2PX 4JLPA 3MT8A 2MDTA 1PJCA 3IO3A 4U8GA 3DJFA 2RHHA 2QD5A 1F4VA 4MI6A 1ML4A 4JAUA 4QHSA 1EX6A 3KYBA 4YJHA 3DP7A 5CLIA 1K7XB 4DQXA 1U1CA 2QPTA 1FMLA 1JXAA 2ZE6A 4FKBA 2ZUFA 4K6FA 1BCRA 2QKAA 1L5NA 4KYTA 3BB3A 1JLMA 1Z07A 1PYGA 3SFVA 4ERHA 2QRLA 1O96A 3KCNA 4M38A 1VE9A 7AT1A 5DNDA 4DJDC 3KXDA 3H8JA 5K8UA 2ZPAA 3K31A 3QF7A 3SIXA 2H08A 3EH1A 3T3GA 1KNJA 2R5WA 2QK4A 2HU8A 3WJ2A 2LV8A 2AMVA 4LDAA 1R0CA 1GGVA 4C06A 1L7PA 3TDKA 1WPQA 3IAAA 4F4IA 5LB4A 3MJHA 4C6TB 4B81A 4J29A 3V48A 3GZTB 1QX4A 2LO1A 3BERA 4ITRC 1W4ZA 2VQEO 5KNCA 3WDKA 3QU5A 3FMFA 1FRNA 3FHOA 1QH9A 5FUYA 3D36C 2OR3A 3VYTC 1G8MA 3O4JA 2QEXV 3NFRA 3UWDA 1RFGE 1TRKA 4RQFA 2B98A 1IOVA 1M90W 2W93A 3OPMA 5FIUA 1YRQA 2OBLA 4ED9A 4CF5A 1ESMA 4MV8A 3ZHVA 5JBIA 4TMWA 1TA0A 3AQIA 4ZEWA 1NR1A 1B1AA 2FR1A 4IV8A 2KYRA 2VN8A 3OBYA 1AB3A 3I0NA 3KPYA 4M53A 3S2ZA 5G3ZA 2NGRA 3UHPA 3QVMA 3LYAA 2BISA 3PWZA 3C2QA 2J5QA 4Z99A 5A0VA 4B46A 4OREX 4B7EA 5CFNA 3LT1A 1OLXA 2H8KA 1CNEA 1J90A 3BREA 4CLXA 3BG5A 3EDYA 5EIOA 1U3WA 4AX8A 4DXHA 3ELCA 1AOXA 5BSEA 1XMQO 4L08A 4XQ0A 4B6QA 1P9RA 1E6WA 3UBMA 4AB1A 2VDUE 1IL0A 3D4IA 4UM9D 5FV7A 1GNVA 5EZQA 3RLFA 3VYTB 2AWNA 4YEDA 1YZYA 3PJFA 2IYEA 1VQ5V 4S04A 4RTPA 4RQBA 1LPBB 1Y8RB 2QUAA 4DJ5X 2C5AA 4OX9B 2J3LA 4HD8A 3AHFA 2MCFA 5JADA 4H2DA 3WNCA 4DR3B 3H9BA 4NYJR 4BTEA 4CQNA 3CTMA 2QY9A 4AN1A 4KPEC 1VE7A 4WMLA 3IILA 1WY7A 5A62A 1UIRA 1NJ2A 4S3MA 4QPPA 3I4CA 4I5GA 1WDTA 1XWIA 4P0TA 4PX2A 2WSLA 5A4AA 1KQGA 3PV0A 1ZK4A 3OEED 3LUFA 3FX7A 1T15A 5BVGB 4BMXA 1P60A 4J7UA 4M9SA 3DVAA 5AM0A 2B94A 1JMKC 3OJOA 2FC3A 3ZDQA 1GRRA 1MMMA 3QW2A 3HL0A 3ZRXA 2IUEA 2IS6A 1PWYE 3RF7A 1P1RA 1UMBB 3FUCA 3MIZA 4M0EA 3TO5A 3EDRA 3O0TA 3N59A 2CD9A 2P62A 1A8HA 5EE1A 2Z2IA 1R6TA 3QA3E 1CUCA 3I9NA 1Z75A 2PGNA 5L7YA 2HMTA 2NO1A 1KC8H 4KFRA 2BHSA 1UXKA 1P7VA 2GWHA 3CWCA 3SM3A 5LD2B 1SXGA 5KYYB 4LFAB 4QO8A 5K0SA 2IZOA 2ZP1A 3P0JA 3OFVA 4CC6A 4OLBA 1WB9A 1P2SA 3EIOA 2DQYA 1QB7A 5GONF 5THKA 1WXXA 3ZCQA 1B0PA 3PUJA 1OHHA 1E3SA 1Z0DA 2Z6AA 1WDKA 4A0GA 2ATXA 2Q68A 3D54D 4J2HA 2EIJC 1Q1QA 5EQDA 4CCSA 1BE6A 3TLEA 2YZKA 5BWBA 3AUFA 1H2LA 3LTNC 5I9SA 1HLFA 5C37A 1XTZA 2EX0A 2W6QA 2XSZA 5HRCA 4HFMA 4WESA 4PC6A 2IX3A 1NXTA 5DYNA 4YQFA 4DRZA 2ZLBA 1GADO 1Q7YH 5BYJA 3BDIA 3EEYA 2I67A 2P6OA 1SZXA 3C3XA 4RMNA 2IA5A 3WLTA 2IS2A 1DC3A 2PY5A 3QVKA 1X1BA 2FW6A 3OKAA 2M2IA 3NGMA 4ZT2A 5D5PA 3ZXXA 3DOOA 3P0ZA 2I91A 2JW5A 2HU2A 1EFKA 3PUHA 1US8A 2WWTA 4UE2A 5GZ3A 4DIDA 1CUXA 1W2HA 3TJTA 3HCWA 3T99A 3BS4A 4NUTA 2QTNA 2Y2VA 3NW9A 1OZAA 2FW9A 3EF1A 3ER8A 3MWKA 2E85A 1XI2A 2UUAB 3C5EA 5BN5A 2YW9A 5DH9A 1QHTA 4OI2A 2XD9A 4FYJA 2CFOA 1QWOA 3NT5A 2EIJB 1OH8A 1J5XA 1T3TA 2AEMA 2OORA 4FC6A 5C4GB 3UWPA 3L1VA 3VI6A 4ZO8A 3NIFB 2DWUA 2E55A 1UAAA 4W82A 2HK9A 2ZJ3A 3PVCA 3SJZA 2Q1XA 3L9WA 4YRZA 3QTLA 1YJWV 4X8LA 2YVUA 3L02A 5C8YA 5ALOA 4Q3DA 4BQEA 1XLTC 2F8MA 5KREA 1A04A 5J5CA 2ZS7A 4DK0A 1FFXA 3A6DA 1N0IA 2C3UA 1AKEA 3FJYA 5KHKA 4Q16A 3DOHA 3GPLA 1RXSA 3AY0A 4LDZA 1RPTA 1TL7C 3AXTA 2P6NA 4NXNB 1U8EA 4DWJA 4BNWA 3I2FA 5HJEA 3FAZA 4FFVA 1PK7A 5T4HA 5ALMA 4E5MA 2C77A 4EMUA 2RJ3A 1ODLA 3E4DA 1COMA 2YC2C 1WBDA 3MUOA 3P30A 5ESDA 2XADA 1NBMA 3G6KA 1WNFA 1UEIA 3H6HA 4LZJA 4TUYB 1Q1BA 1TF2A 1O4WA 4Y0NA 3HA5A 3NKVA 4WIAA 4QT4A 4RESA 1FVXA 2XGMA 3WSWA 2XTJA 3FVRA 4ER6A 5JNLA 4OHYA 5AUNB 1PHPA 4YT5A 2O8NA 4F6EA 3CJRA 4O4HB 2O23A 2JFYA 3C3YA 4LA4A 1ZW6A 4Y2YA 5IU6A 4RFSA 2HP3A 2BGUA 2WTNA 1G3MA 2Q6OA 4OFZA 5B2FA 3ZOZA 1H2RS 3GVCA 1ATIA 4LZLA 1P1JA 2FPGB 3ZW8A 1NBME 1SXIA 2A0UA 3ZU6A 3EVFA 1YHYA 4Y1EA 1PR6A 1QHYA 4KAFA 5E7JA 4RD3A 2Q8QA 2D0DA 4DTCA 4Z7OB 3EZ9A 3T5GA 1CEZA 1C9DB 2FZLA 4MRVA 4RL6A 1R6NA 1OXSC 4NECA 4FPPA 1FLAA 1TCUA 1J0AA 3U49A 4M9CA 5E6UB 2GM4A 3UJ7A 2ATKC 4O2BB 3D4OA 3VR2A 4R7TA 3T94A 5TDHA 2OTJV 2MYPA 3ZHBA 3KOMA 3PL5A 2BJVA 3LWOC 4QBIA 3PI6A 1R4ZA 1AA6A 3JTEA 1FA9A 2J4FA 3R7SA 2CKDA 2F6RA 4HQLA 5T67A 4MQ4A 4JSTA 4YYEA 2IW1A 2G88A 1EVQA 2RMKA 2C1EA 1RWBA 4CN9A 5TB5A 3W79A 1YIDA 2AOVA 3IIIA 3E86A 3UMGA 1EQUA 2HK8A 2IP1A 4TV8A 4W9MC 5DNAA 4KI7A 4PZCA 1VQPV 1RAEA 5L40A 2PLAA 4IDPA 5JJBA 2AK3A 4EQ6A 1M10A 1YTUA 1FMFA 5BV8A 2ZB3A 2GZAA 3K30A 1QE0A 3FSEA 3TGWA 4ZXFA 4HH4A 5DTIA 2KSDA 1TYCA 1I3MA 4RELA 2OO7A 3PC2A 2BFBB 5EXDA 1SDSA 3VQVA 2IHJA 4UM5A 4XARA 2Z2KA 4OX9Y 3K9CA 1JLLB 3CNQS 3AEQB 3OMAB 2PVSA 2AQHA 5IT0A 4I4TB 2DTXA 1O6FA 4MPRA 3DC7A 5K8VA 2ONCA 4FLMA 5IVDA 2OFFA 4DBZA 5KOJB 2F00A 3DLPX 1BS1A 2GUZA 1U4SA 5A6VA 3EG5A 3ECCA 1OIXA 2RCVA 5AIAA 3WYGA 3QTYA 4V0RA 3V7WA 4ODIA 3LUGA 3E89A 3BSWA 4XQ9A 2C9CA 3ZOPA 4C8GA 4DNOA 3PQEA 5JZ9A 3R5XA 1ZLYA 4PLVA 1DP4A 4BNMA 1CXZB 4YUVA 3VNSA 1EHIA 2RC5A 4KUMA 4KWEA 1A9XB 3V42A 4HGOA 4IL5A 5J3JA 3ASYA 3U4IA 2P2SA 3CZ4A 4GOND 2CW4A 4ZOBA 1EVZA 4MWCA 1SU7A 1VJTA 3OT7A 1T0IA 4UCVA 1VQKV 2PL1A 2RC6A 4FINA 4BS9A 4E1VA 4C5BA 5BOSB 1E6EA 3IMEA 1GPH1 4OSPA 4HTFA 4NMLA 3NIBA 5L4SA 1IY1A 3BMNB 2CC2A 4UEKA 1PI3A 1U0LA 4MV6A 2BOVA 2HO5A 3GAZA 4KQHA 1LK5A 4OL9A 3ON5A 5F1PA 1H1LA 4C8EA 3MF4A 3TBKA 3F6YA 1FFAA 3JZAA 3TW8B 1DIGA 1TOAA 4OYYA 1BKYA 1QGAA 4PAGA 1IBMB 3KZNA 3PEYA 4HI0E 2H1IA 3K5OA 1JA8A 1SESA 2PNJA 4PYIA 5L3QB 3A4MA 1BVYF 4EEQA 4R1OA 1NWHA 2P9EA 4OH7A 4HDNB 2JA1A 2E6KA 2QXYA 3QMPA 2A35A 4U39A 3C74A 3L0ZA 4R83A 1JZTA 5FADA 4MVZA 5CNMA 2G5TA 2UUPA 2N46A 3G0DA 4KU4A 2Q3DA 2WINI 4DLBA 2Z2YA 5EOVA 4GFDA 2WF7A 1Z22A 3DC2A 4Y1GA 2F8TA 3O9MA 1QS0A 4B6FA 3ZS8A 1YS7A 4G4JA 4KVFA 5KQSA 3LUHA 4ND4A 1F20A 1X2EA 4TYYA 4S12A 2QMZA 3NRJA 3UCEA 4BMPB 3STTA 3F7NA 4G0QA 3DAGA 3D8NA 3I8SA 1RW4A 1D04A 3HRKA 1EFRA 3S8YA 3TIGA 1K1EA 1G20A 3JQGA 2FY8A 3U2QA 4DV1O 3PD1A 4EG8A 4PGHA 5KNBD 4DLSA 5KPDA 5GGYA 4MEBA 1I7DA 2WPDA 2WV9A 3M5WA 1OLOA 5DHTA 1QF6A 2GNOA 3T3PB 2A5LA 1O6CA 2ZIWB 4CHGA 2ZR2A 4U0JA 3CW9A 3IV9A 3IYLW 1LQUA 4NL4H 1TUBB 4KQCA 1Z36A 3B70A 3UK7A 6ADHA 4LXTA 4EVQA 1ZN8A 2JH3A 1AQLA 4ZANA 1B8UA 1LVUA 4RPIA 4S1OA 5EPUA 1I1OA 1XVLA 2RB9A 1G20E 5IN5A 5AW9A 4OLHA 1ZINA 2JLRA 5FO1A 3BXOA 5D2CA 4UBMA 1P0PA 5SICE 4QLBA 2O8DB 1RP3B 2LW1A 3F3KA 5TXGA 4X97A 1A8PA 4CH3A 2ZRKA 1YJAA 3RSHA 5JS8A 2Q6LA 4JC4A 1JWAB 2VGMA 1ZCZA 4QEKA 3Q2IA 5B6IA 2JD1A 1HYHA 4ASUD 1GM5A 3AF0A 3ODGA 4YV1A 2BLNA 2P3SA 4EG4A 1E99A 4XASA 5EHQA 4F46A 4P3NA 2PJDA 5TPWA 1O97C 4PQEA 2PS3A 2IZ7A 4OJKA 2YNMD 1JKIA 4KSBA 2YWXA 2W2QA 1AQNA 4AS2A 1BN6A 4BNFA 4WX2B 4AKGA 4KWCA 1KYQA 4I1YA 2ZJ0A 2EW2A 3HPRA 2AG5A 3B2NA 4GWGA 2LXNA 2IEYA 7ADHA 3OCUA 2FXIA 2F4NA 3C24A 5FXMA 5HKKD 2W6ZA 1OV6A 2GLTA 3HNOA 4LZWA 3WBBA 3OC6A 4ZT6A 4JI0B 1Q1ZA 3D8BA 3OPNA 2MYNA 4F4FA 4KSCA 2GYUA 3G8YA 1N1DA 4EJSC 1CY4A 3O8LA 5AG2A 1E0AA 3ZWKA 3KHKA 3ID6C 3ASOB 5AW8A 4QYIA 3M84A 2DFPA 2CXHA 3FZEA 1IBKO 4Q9HA 4MTCA 2QMQA 1TMKA 3NZEA 5LQJA 1TW3A 2RHWA 3IHWA 5KHAA 3JCZA 4M89A 4JQSA 2CFIA 1S3SA 3ANTA 1TZMA 3MD9A 5IT9N 4JI5B 1MA0A 1WBJB 4LY3A 2H9YA 2GM9A 4EYOA 4BO5A 4NBNA 4W9RA 4UW9A 2DKNA 3LHDA 3SYOA 1E9BA 1T0PA 3IMKA 2O07A 3GIWA 4FDMA 1JAZA 4HDSA 5FJ4C 1J1IA 8ATCA 4MUMA 2VRWA 1GDTA 2JHPA 3R5KA 3LP6A 1XD2B 1J2EA 3U10A 3FMIA 3R0VA 4I81A 4GM1A 1NE2A 4XM2A 1JEQB 4P4TA 1FXKB 2IY7A 3S4YA 3KCXA 2FZ5A 4WFBV 4RJJA 3CPEA 1Z4KA 4AY4A 5BPFA 4HDKB 3G6EV 2RHRA 2YYEA 4L2IA 1RAHA 2O8BB 3CS3A 1VPLA 1A4XA 1W0KG 3ICQB 2OBYA 2YYYA 2OBXA 1WXQA 3GQBB 1NUPA 4BQRA 5SZJA 4C7BA 1AF4A 3RC7A 3LWPC 1FNJA 5BN4A 1F5NA 5AOBA 4J7JA 4KDEA 2ODBA 1XZCA 3FWPA 3UN1A 1Z4NA 5KI6A 1XBTA 3GXOA 3COZA 3JD3A 1WUYA 2QM8A 1II0A 1OFVA 3WB2A 3MTBA 1L4EA 5EGNA 3OETA 2R66A 1PF5A 4YT4A 1PJLA 4CMIB 4DYVA 3NS7A 4J0QA 4QU8A 1NF3A 1RYBA 1E5QA 4GP6A 5TARA 3T52A 2VH1A 1ULHA 2XT9A 2DWCA 4ARZB 3ABQB 1U2TA 2ZRQA 3MQ4A 2Q7HA 1SQXH 4FFRA 1E98A 1HKUA 3G0OA 1GPBA 3T5BA 5CLLA 1L4UA 3OJWA 1UWKA 4XDKA 2ZJ4A 5DWVA 3F3SA 2NNWB 5HA5A 2R8BA 2ICAA 3WWEA 2IIPA 1E2DA 2VPIA 3ORSA 2WAXA 2VF7A 3LKBA 3UGQA 5EZYF 3CV3A 3WDSA 5EZ5A 1RWWA 4KN5A 3MBOA 3ELWA 4LXIA 4QNNA 4WLFA 3K0FB 4JYPA 3Q8HA 2BEJA 2XMSA 1OAAA 4Q02A 3R3VA 4DR4O 4ESVA 4Y6PA 2O1WA 1I33A 1N9GB 1ZVKA 3RW9A 3KYIB 5DTRA 2CDYA 2J9GA 2LZ0A 1ECPA 1E69A 2F9ZC 4EI8A 4DDMA 3QYJA 1P5HA 3CMAF 2QKCA 1IONA 4QOHA 1D2AA 2XECA 3IPRA 2D00A 4FILA 1QQTA 1DHTA 1WB5A 4BNGA 1KXZA 1XNJA 4TMZA 4MGEA 5BSWA 4M1TA 5EUQB 5FUBA 2ONZA 2INGX 1RZRD 3O47A 1PR5A 1J97A 1Q0UA 1XQ8A 1EB8A 3R74A 1M34B 1A7KA 4GBMA 4FFLA 3VZRA 4LI3X 3KG2A 1OPXA 3L71H 5CFMA 3M0EA 5DW3A 1BE8A 2AXEA 3Q9SA 4DW1A 1XZMA 4YREA 1ZM3A 1NJ5A 2GA9A 3G71V 1VMEA 4S2EA 5EWJA 5EP3A 2PBRA 4PONA 2NU6A 3OQ1A 3PEUA 5D01A 3KKEA 2FGKA 2HWYA 3JQ9C 3ORYA 2OCLA 2QTHA 3W9YA 1NLZA 4E08A 3IVAA 2NUPA 2F93B 1WMEA 2NUAA 4QPJC 3W6ZA 2ODNA 4UNPA 1QHIA 4O3FA 2CXSA 3O26A 3E2MA 1G66A 2RGAA 5LXTB 3PWKA 2FWRA 4KVGA 2FJPA 2K5UA 2JIZG 3NO4A 3TLJA 3I5XA 5K0GA 1EB9A 2P2DA 1N33O 1AQ6A 5FF9A 3SGLA 1PKXA 3MC1A 1DAOA 2YEVA 1JEEA 3R5HA 1H2HA 1W36B 3GJ3A 2VTBA 1Z6AA 2H1VA 5T57A 3PPWA 2ZT5A 4Y6RA 3C3PA 4FSXA 3L4BA 1B43A 3H9GA 1F60A 1RWPA 4DY4A 2RFLA 3WQRA 2C00A 3KVOA 2RHTA 2BFCB 4GVLA 1D0VA 3PXEA 2HF2A 5C7YA 5I9TA 5ETJA 3DO6A 4B5LA 3Q8LA 3HKDB 2GF2A 1P5JA 3RAEC 4HB4A 2IQ5A 1R37A 5KMGB 3EFHA 4JWTA 2JGUA 5KSOA 2OAQ1 5GOZA 4DE5A 3A2NA 1E92A 4NBUA 1OLUB 3VTKA 3OIDA 5AUQA 13PKA 2H1CA 1G4AE 2JJYA 3DHNA 3AEZA 4AKEA 2EARA 2XW6A 3LS2A 3UJHA 5AW7A 1N8KA 2P4QA 5EB1B 1NI3A 1V8ZA 3FWKA 1G21B 4CW7A 2W2LD 1UKBA 2LE0A 4RPLA 3JD0A 1YB5A 3SIRA 4F56A 1U28A 4QYMA 3R0ZA 2AR7A 5IASA 1SIWA 3PXAA 3WV5A 4EPYA 2W6JG 5HUQA 2OQIA 4EYKA 2FEWB 2IOQA 3AK4A 1PNQA 3STLC 3FH0A 4RE5A 2Q6IA 3HL4A 1ROPA 4LJYA 1W47A 5EBLC 2C99A 3K71B 4HXFB 4E5KA 1KMCA 4BIUA 1JDSA 2WK1A 3B1JA 5DNVA 2GSWA 2QLLA 3AESB 3C70A 4N9QA 2UUBB 1I24A 2RBGA 3RG8A 1ACJA 3GA7A 2RD2A 1CJCA 1FFHA 2B9EA 3W1WA 3F5WC 2IIQA 4YBZA 1E4OA 3KQTA 1KOLA 3B52X 3UUGA 3ESCA 4FYMA 2P4KA 3N8KA 1DAKA 2PR2A 2R7AA 4R31A 1CS4C 1MXHA 2AZMA 4R3WA 3LUJA 5FJJA 5BWLA 1L5RA 3CRNA 2E89A 4UU0A 2DYRC 4QPZA 1AK2A 2XMQA 5ELXA 2E75B 4CUJA 4NDNE 1OU0A 4O02B 4DM4A 5JH7A 1VHJA 5KPJA 4YA6A 1LSOA 3CG6A 5HXUA 2A59A 5CVUA 2V7TA 3U61B 3N2KA 2BR4A 3W6PA 5DBHX 1MAAA 3U0BA 1JCHA 5HG0A 2X8AA 4FVTA 5A9GA 3FAKA 4M54A 2AYYA 3JQAB 5LQUA 2XF8A 2CD7A 3UTCA 4RVHA 3ZHYA 1DOAA 4BLVA 4Y0VA 3MJFA 3L01A 2E1PA 2MR5A 3LHIA 3A0RB 1V7ZA 1E1NA 3I9LA 2P4EA 3Q5EA 4J10A 1XNRO 3L0YA 1HE8B 1JT9A 4LSMA 1YA8A 2XQIA 2WICA 3PGJA 2RGBA 1HEYA 3JVEA 5LR6A 3AIMA 2DCMA 2E82A 4AXBA 1IJFA 3FB1A 2Q21A 2Z6UA 1HE4A 5CGQB 2DYRB 1CWUA 4NZYA 2CXUA 5BYBA 5H59A 2FVYA 4EJ2A 3AF4A 4M0CA 1IHXA 3CXRA 2VZ9A 2YZ2A 2SCUA 4PWYA 5GJVC 4IUCS 3U11A 4IZIA 3HK2A 1D2EA 3NALA 1TEZA 3RR2A 4X8OA 3GRRA 4K9KA 2HVYD 4R1UA 4BFLA 2WJHA 3L4EA 5JC1A 4X7PA 3H17A 1RI4A 2CBXA 2HWWA 2N3ZA 2B1RA 4FFBB 1PTJA 3S2UA 4IOLA 2WLLB 4I55A 4DSAA 2O5CA 4MJXA 4C4SA 2P90A 4DABA 3H4VA 1L7NA 4G6ZA 3IDQA 2VAPA 4NYKA 2L17A 1O8CA 4PRLA 5FNVA 1EP3B 1E1RA 4AJKA 3O4HA 1PFWA 1UADA 4CF3A 1E3TA 3RN4A 2R11A 5ILOA 4WTOA 4PE5B 3IPXA 4LZZA 1TADA 3QGMA 2XYRA 3FD9A 1U3PA 1VQNF 3VVLA 1DT3A 2C5GA 4O33A 4BO8A 2W2VA 1ABFA 4AUKA 2R1TB 4TMKA 3T3DA 3B1KA 4H0NA 1FLDA 2FWNA 4U0KA 3I32A 3GAAA 4TM7A 3O8OA 1KZYC 1C3XA 1E20A 3PDIA 1T6NA 3FRHA 4QDKA 1Y7TA 4JZ2A 2Z1MA 2OFXA 3T7KA 2XA1A 4A8PA 4D7SA 4MPPA 1E79D 2XB2A 4UCSA 3W34A 4JBNA 2XGOA 3IEXA 3LWZA 4P9OA 2C1ZA 2IH2A 1YCFA 3BMOA 2J6IA 3DAOA 1ZY2A 3KTAA 1XRNA 3G82C 1KI6B 4NEQA 3V4ZA 2PFSA 3H42B 2HMWA 2RGRA 3WSVA 2E7ZA 2W2KB 2ZIOA 5J43A 4ZAZA 5IYBO 2BFNA 4P2BA 2WIGA 5J4LA 1HR0O 3DL7A 3UKJA 1E2MA 2G9VA 2B36A 3MRTA 1XPJA 5IVPA 4UU8A 5DIFA 4JKIA 1E66A 3QE0A 2DFDA 3Q7IA 3RIMA 3P9YA 2Z8YM 2Q2WA 2J9FA 1EK5A 2HNKA 5DGHA 5JYCA 4LF7O 2GQ0A 3EG9B 5A2QM 3D9QX 2QQGA 4HN9A 2E4VA 4OHKA 2VK2A 4EHJA 3MOGA 1YS9A 4FUTA 3OFKA 2IQIA 4B47A 3VC1A 2YIBA 2RHOA 4YJ2F 2AL7A 4L27A 5DDIP 4GX1A 5B1SA 2NT4A 2ZQ5A 4GPTA 3T0IA 2CNKA 4G37A 3PIIA 3V7EA 1UPFA 1IEWA 4NX2A 1L5KA 4Q4HB 1P7PA 2FPPA 4OQFA 3IQXA 4LE0A 5CCBA 2B33A 2Q0OC 5EK0A 4KBFA 4NZMA 5HX7A 4PPGA 1KDPA 1MEEA 1KAOA 5IAOA 3AI3A 3H8WA 4MVRA 3EQ7A 3Q72A 4NEHB 2FUKA 1V0JA 1GNQA 3RVSA 4MS4A 2PKEA 3DZCA 1Q6IA 3H7IA 1JQ3A 5LOVF 3D6TB 3ITNA 2GAFA 2FZ4A 1TM4E 3TTSA 2FPLA 4ND1A 4ZJPA 1VE6A 2Q1YA 4LQLA 3UG6A 2L35A 4GLLA 4ALMA 5K4AA 3RVZA 1KI1A 2VP3A 4EIWA 5JSZB 4YHHB 1YI2F 1VQ7V 2DPLA 4BNNA 4NZPA 3NBYC 4DLNA 4DT1B 1BC5A 1T4MA 3RVBA 4W5QA 3G23A 3OZGA 4PPYA 2VZEA 5TQ2B 1J5EB 3LY7A 4DY6A 2R6DA 2GBOA 3O91A 3CC8A 2PUFA 2O0HA 3DJYA 4FE4A 4YJKA 2J4DA 2ZBEA 1OYYA 4MUIA 3VBCA 5E4FA 1PV0A 2UYJA 5EIWA 1U81A 3BTSA 1C0IA 2J8ZA 2XB9A 3ND5A 4K9OA 4K7JA 2NYUA 1Z0JA 3EZFA 1BROA 1V7PC 1YJ9F 1E2LA 2QZ4A 2G76A 1I32A 1XOUA 1QRSA 4UQPA 3G89A 3BJMA 1FSZA 1NFRA 2WNIA 2P68A 1B16A 4E5PA 1L1QA 1JR4A 4O25A 1LTKA 1ZGAA 3DAYA 3S5UA 1IAVA 4HXEB 3M4NA 1UC5B 4NFYA 3KEFA 1YVEI 1XL6A 1W6UA 1U6JA 4MKGA 3OIWA 5EJ4A 1RYFA 4YFYA 1ACMA 4COKA 1QZXA 1SZPA 3ZNNA 2ZI5A 2JJQA 1GDHA 3PZRA 3OP1A 2ZI4A 3W7BA 2YX1A 5A03A 1LPNA 2HMUA 4KP7A 3QBEA 1Z39A 1QIMA 3RRMA 1MC5A 1HFKA 1QYRA 1RLIA 3DMDA 1EWYA 3OQPA 4RVUA 2OZBA 3TRHA 5E9AA 1R9GA 1E77A 3MCAA 4EVIA 1E7KA 3U16A 4YGXB 3ZUGA 5AHOA 2ARHA 1CG6A 2K9PA 4X0EA 3MCZA 1TU0A 4XFKA 5LBIA 3WL3A 2VLBA 1RHRA 5JV5A 4MCAA 1NVVR 5JTTA 4JOQA 1VLMA 3K6JA 4KE8A 2XUJA 1FU4A 3A05A 1ZOSA 3UT6A 1V7CA 1MX9A 3ZMVA 4XD2A 1NJIH 2R85A 1BDBA 4W5RA 3OQVA 2NUTB 1YEWA 3PFGA 3DT6A 2J4CA 4Y7CA 4G09A 4GWKA 4NH4A 3KL2A 1U0EA 3IEWA 2HUPA 5BXZA 1ZL0A 3R0XA 4U7WA 4DMUB 4FGSA 4X1OA 3S99A 1Z25A 1FRFS 4TRNA 5JS2A 4NESA 2YJZA 4DR6B 2H9AA 3AM1A 1Z5VA 3GFQA 1T6XA 1I5OA 3Q1LA 3KSUA 4RU1A 3AI2A 4RNCA 3E03A 1KB9F 4HH1A 4PBSA 2W7TA 3ILHA 1V4NA 1P2DA 2QYOA 3CPQA 1CY6A 3IT2A 5F7JA 4EECA 4U6SA 4MP3A 3NUZA 1D6SA 3RIGA 3DFMA 2XWJI 1V9PA 4H18A 4RFLA 3UHOA 1Q1NA 1VIMA 2FN3A 4J7AA 3PCXA 3M9WA 1RJDA 4BV8A 5IUNC 4D8TA 4JBXA 2Q3JA 4RTLA 3ORFA 1BDMA 1OV4A 2BMFA 3EIEA 4X1KB 3FTCA 4K8XA 5L9AA 1GKFA 5FBHA 1BDJA 2W70A 3EFEA 4MTGA 3F90A 3NH6A 1KQSF 1X70A 1Z4LA 3P0FA 5BP7A 2XYQA 4LRSB 1PQYA 3EGDB 3QOYA 5TV2A 5H83A 4QEDA 3NP9A 2GI4A 5C53B 3SZLA 3LQ2A 4WDQA 3FD6A 3DZJA 3N70A 4C22A 1YZLA 2CUGA 3ND8A 5JALA 4FHCA 4WZBB 4EENA 2NSDA 3SMQA 3FOFC 3KZKA 4L5YA 4Q03A 3EZLA 1BWPA 4A73A 2VIIA 4PFQA 4NDAA 4BCDA 3G68A 3TI9A 1IN4A 4W5JA 1G9TA 4JXKA 5BN3B 4XJVA 2PGXA 2WMOB 4TSFD 5LZ5A 3KALA 2PMPA 4AF6A 1SWWA 2OHGA 1MV8A 3GFSA 3VJRA 4CEIA 1XQ6A 5JSUA 4AUMA 1VJ1A 4XWAA 5BSRA 2YVKA 3C6XA 4O4IF 5FPOA 1ZI8A 2WWGA 4AD8A 2GTIA 5KUMA 5E1MA 1GNPA 2MSEB 1NW5A 1G59A 2H06A 1K08A 5LU9A 4KN9S 1GQRA 2X0NA 3S1AB 4AMGA 3G0BA 3ZIAA 2PYZA 1TM2A 4RVSA 4AYTA 1CERA 2JFZA 2AF3C 1QQBA 5ALQA 1D6JA 3L84A 4QBHA 1RLGA 3OJFA 3N2EA 3NDBB 4U5XA 2YXBA 1CZUA 4QLAA 2WLKA 3SPCA 3DTYA 2Y1EA 2I6GA 1WHTA 1MNAA 1G1MA 2G0TA 4R8LA 1ADCA 3VM6A 3ICVA 2XEXA 5DKFA 3VA7A 2DJ5A 3EHEA 1ZCJA 2BRUA 4LR3A 2VPPA 1UC4B 2YRFA 1PQUA 3TQIA 3OESA 1KQNA 4N5NA 3MLBA 5I51A 4D8XA 2EJTA 4Q1VA 4DMCA 3QOWA 2O8CA 5JBQA 3NHLA 1JZSA 1B2RA 1Q7BA 5C7LO 4O59O 2YW2A 3BSYA 4QQFA 1PJSA 2C98A 5C4IA 2BGIA 4COOA 2VNJA 5EPOA 1UODA 4P5EA 4W8HA 1W5FA 2VZ0A 4KIJA 1MSWD 3GBVA 1AJQA 4O4LB 4RW0A 4AICA 3RODA 2XR1A 3G2NA 5HFNA 1OJ7A 2E5FA 3KQQA 1LS1A 1P77A 1E1CA 3SQMA 3FDFA 3WOHA 3QU2A 3VTZA 5CUQA 4LXHA 4TQAA 4C4AA 3MOSA 4F4HA 3U80A 3E1GA 4BHTA 1RCFA 2Y0CA 2PPVA 1KFKB 4I5FA 4MR9B 1N9KA 2CLCX 4L5JA 1Z5NA 1U0GA 3B1VA 4OU5A 3WA6A 3IP8A 4MQBA 4HFRA 2EEPA 3L1UA 1CVIA 1ECBA 1PGJA 4BMVA 3PPVA 5J4HA 2OCKA 3R7DA 4RHFA 3SJAC 1RQGA 3UH0A 2AJ8A 4WW0A 4C89A 1N3BA 3ADKA 5TPZD 1W94A 1BNCA 3LFUA 5DWDA 3A1CA 1GTL1 2D3OW 3C14C 3FDZA 3NHWA 1MFPA 3CF4G 4QTUB 1JJFA 4R1TA 1KI3A 1ZX1A 1FS5A 1KVQA 4N23A 2LCFA 1QDUA 1VP9A 2W4QA 3Q7SA 4D4HA 3OLZA 4K9RA 3PHLA 4YQYA 3KPWA 3A8TA 4I9UA 2VYNA 3D3JA 5DBIA 1XZBA 3ED1A 2CSXA 2O5RA 2CJYA 1F0KA 5LUBA 3UPTA 1W3EX 3GP3A 3CC4F 3EULA 2FG6C 1W49A 5H68A 4RX1A 3A0HZ 4JMPA 5CM2Z 1OREA 3GO4A 2AN5A 4FGKA 5B1YA 1QCCA 4G67A 4LF8B 5L3CA 2PI4A 4NICA 3WGKA 1UKAA 5J5VA 4QQRA 4ZI7B 1GIAA 4ZU1X 3OUUA 2X1LA 2A9OA 2OK8A 3P97A 3SZUA 3UM9A 1NDUA 3ZDBA 4FYYA 4LY6A 4X7MA 1MC8A 5B4TA 1FYWA 1JJOA 2X2EA 3TMAA 1IBLB 1UFIA 2JKZA 1AXEA 4IS2A 3AEKA 1LXCA 4ZCIA 5E1OA 4EJFA 2XRMA 2VRCD 4PZZA 3NETA 3WYCA 4FE3A 3CEPB 2OG2A 2C2AA 4JJKA 1OILA 1RPJA 3HC7A 4YTEA 2FSIA 4CM1A 5KSYA 4QVIA 1WJGA 3ZW9A 1T3LA 1AILA 3INYA 1WNTA 5EA2A 3TVDA 1S2MA 3IJPA 3T3HA 1NJ1A 3G2QA 3UJ6A 2JLXA 4D9FA 4M99A 1NRIA 5K03A 4OO3A 3AU9A 4TRMA 2WVJA 5IM5A 3KJKA 5A6SA 4BIMA 1NYTA 5HFAA 4O8ZA 4CXMA 4IIEA 3OZSA 3ZXYA 1YFKA 4Y2RA 4ZAVA 1EM1A 4WPGA 1B23P 4BB9A 3NHZA 1RKVA 1G6HA 1FX1A 3SQNA 1NVGA 4HR7A 5HS6A 2JVJA 1R0LA 2MW2B 3HEMA 1W44A 2VUUA 4H1HA 2A3QA 2EHDA 1YOVA 3MQ2A 3JYCA 5DN6A 1Q7GA 3PE4A 3GCGA 3GI1A 1HTWA 1S02A 4E15A 3UFXB 3E3MA 5BXYA 3WBKA 2WSIA 5JAQA 1OCOC 3M1IA 2DZDA 4DV3B 1FQOA 4AG3A 5DHQA 2R8PA 2AX3A 3OUSA 3B5IA 3OX3A 2XWQA 1DBPA 4QM7A 1GGFA 3OT4A 2VDNB 1XN4A 2XE4A 3PHHA 2K6GA 3ZVRA 1BAPA 2MU1A 1C9NA 4OJYA 4JP8A 2GPWA 3O82A 1S3GA 1ZJ6A 4RZHA 3P96A 4AZVA 2ZI3A 3THXB 4BIIA 1A72A 4OB8A 4YX9A 5EHNA 1FSPA 1Z0ZA 4FYHA 2JJ1A 2EQBA 5I8WA 10MHA 2UDPA 4Y67A 4YMSA 2E4YA 4MJ7A 3OZIA 2NU7A 3TZCA 1RYHA 5K8CA 3CVXA 4EA6A 4LDNA 4FMDF 1NRWA 1IBRA 3AHDA 4DLRA 4IMJB 5I9IA 4O4JB 1MLDA 1RYMA 5JQGA 2WT4A 1G60A 3F7MA 3H0EA 4KHPO 4RF4A 5J2UF 1OCOB 5ALEA 1OU4A 5F4BA 1PVOA 3DDHA 2YYZA 1XTKA 3AG1C 3V2UA 4EMBA 3JYNA 1DQSA 3JASB 5GIOE 3RSFA 1O58A 3QXHA 3W9SA 3QKSB 1UZUA 3ASVA 1N6OA 2Q9BA 4IW3B 4B4KA 3PEVA 1YS2X 3I9OA 1A98A 2BMWA 1P5RA 4UQLA 3UOAB 2OPBA 3C3AA 4RBNA 4KP4A 3T38A 5I4IA 1NI8A 3TPFA 1BHBA 4YJ3F 2GDZA 1G4UR 3H9VA 4CL3A 4PTZA 3GJ5A 4EHDA 1ZVJA 1YONA 2FB9A 4YJDA 1W0KA 3FF4A 2BKVA 1H1DA 2C2XA 4RIFA 1V3VA 1R27A 4LXGA 4KXYA 3R3UA 4RGBA 3E9CA 2BFMA 3ZZ1A 4G8BA 1KEEA 1BA3A 5ALPA 4FYXA 2IUTA 3BQNB 3SFZA 4EOGA 5KYWB 4H77A 4ZVUA 3T5AA 2DSTA 2HOQA 2AF4C 1J0CA 3HYSA 1RJGA 1I4DD 3GUUA 1C7RA 3HB4X 5IF3A 1ZLXA 1IG0A 2PBZA 1KBZA 2P0AA 3U7JA 2CYCA 4U2GA 4L4YA 3ED5A 2IZ0A 2VBGA 2C8KA 4AN4A 4DWOA 5KSWB 1PZHA 2W42A 2ZCEA 2QV7A 2BEVB 4OPMA 1W2GA 1XJ5A 4Q47A 2O2ZA 3E9MA 3RFVA 4G63A 3EYWA 2KB0A 4EATA 3U3XA 3B3GA 3C8MA 2YCBA 1GZVA 4BKUA 4CM9D 2AOUB 4I3HA 4V2UA 4C7XA 4L57A 2J3KA 3IDAA 3T1NA 5FBQB 3ANLA 1M6WA 3PE6A 1XZHA 2H6EA 3RI3A 1I2DA 1R74A 4YK7A 4AO7A 1GQFA 2B7LA 3BFRA 3A6HA 3MB5A 4NCJA 1UJNA 5DGXA 1J39A 4ZOEA 4LF5B 2WWRA 1OFUX 4DG5A 1KO5A 5EKTA 1UDBA 4DEYA 5CX1A 4YC7A 3V2GA 3SF0A 3E5RA 1CUGA 2RIPA 4WCFA 5LB2A 2M98A 6PFKA 1SAYA 1MXFA 3E53A 2P0EA 2VOEA 1R4AA 2HMVA 1C3LA 1J6UA 1ONIA 3MS7A 3A14A 3D6JA 2P67A 4ZIBA 1RNLA 5JS1A 2YJ4A 4N3CA 4JN6B 1UDWA 1AH2A 4KPUB 3VR5D 5F7OA 2QYHA 1WB7A 2PN1A 2WJ3A 1E7RA 4YIPA 2XNKA 3DAPA 1Z5GA 3IEQA 4Y98A 2C95A 2NXNA 3OPYI 3DTVA 2GPTA 1DLJA 3NC4A 1K7YA 4XUCA 5BSFA 2HT6A 1NUHA 4UVDA 4D4MA 3FVQA 2CF5A 3RNOA 1OYVA 3QX3A 3RBXA 5ADVA 3OQ6A 2F3PA 2C1XA 5CB4A 3TUIC 4PLCA 1VLLA 4JSYA 3ZVLA 2WY2D 5FFNA 2YFKA 1KMIZ 1EUYA 1CQJA 4TLMB 2AG6A 4AWXA 3QFTA 4RCVA 2G4LA 3H2ZA 3HHEA 4UM9B 5GVRA 2ZM6B 3CT4A 4DLUA 4AF8A 4ZPJA 4X95A 4ETIA 3OKFA 1V71A 2ORYA 3GDWA 3NOQA 1NW9B 1XK7A 3NHRA 2JIDA 3TTYA 2JJ2A 4XJTA 3ZVMA 2PKYX 4DYHA 3O93A 4W1QA 4LGCA 5J2TF 1CFZA 1IFXA 3LP5A 3EMDA 3AF5A 4LHSA 4Z0HO 2AGVA 2WUEA 2DB3A 4WK0B 5GP1A 1BS3A 4HK4A 1Y34E 4OJQA 2RGWA 2HHAA 1OI2A 2WA3A 2XKAA 4GKKB 1FXWF 1OW3B 3ENQA 3I9MA 3FUVA 1XL0A 3I2GA 4X88A 3CY6A 2VWKA 3HJHA 3P19A 4OU4A 4MJ3A 3APOA 3V1NA 1DQYA 5KDLA 1PZXA 5DSXA 2A5FA 3QBTA 4DEXA 2O2JA 2C7VA 4NTZA 4ZZ1A 4FNMA 4CKZA 2POCA 2ANBA 4B6PA 3AY7A 3L8DA 2R62A 4M1YA 1V8BA 4BMYA 3M4SA 2GZSA 2LQTA 4MITA 3WRXC 1HOXA 3IIMA 4DR5O 2WSSG 1SVNA 4U2FA 5JU6A 3STWA 1XEXA 4UV8A 2Y1GA 4BY9D 1WUHS 3BK7A 4N0QA 1URPA 4FB4A 4Y2XA 1G3IA 1GUDA 2IHVA 3NM5A 2YHBA 1GLVA 2WD7A 2Q5EA 1U63A 4TKMA 3F7YC 3ROXA 1GUAA 3UAYA 1MVOA 1T0JB 3T3MB 3V1YA 2YKGA 3TIFA 3QTBA 1YR7A 1ZM2A 1YITF 3ZWBA 3M9XA 3V3TA 1EK2A 4JBGA 3HM2A 4ZT3A 2QJWA 4IDFA 1YJNF 1FNDA 1SKVA 4R9UC 4B71A 2ZS9A 8LDHA 4PFSA 4C20A 4F3CA 2QRUA 2IOFK 4FBMA 3BORA 4KH0A 4V0LA 8GPBA 2QG6A 4EJ0A 1MOPA 3OE7D 3TAHA 4L9RA 1M8PA 1UJ5A 5EP4A 4Q12A 1EI9A 2R8EA 1RJEA 4PEVA 4F3KA 2BCGY 3I56F 3AX6A 3OSUA 4CMEA 1T4CB 2BCCH 2VTVA 2CL5A 2UYOA 1YQGA 2JI8A 4FT4A 4ND3A 1U90A 3L93A 3WL6A 3LRTA 3PC7A 2ZBPA 3JQCA 2YR0A 3VH2A 3KVRA 3VXKA 3GMIA 4P86A 4X7BA 2QLBA 4B74A 5JJKA 1D2RA 1Q3HA 1NT2B 3DEAA 5A4DA 1NULA 3WG9A 2GFQA 3M49A 3SQXA 4C2AA 2WJIA 1PUJA 3PCRB 2WFLA 2I3AA 2BKLA 3ADDA 2X8BA 3MJTA 2FHPA 3F6PA 3C5CA 3U3OA 1Q6YA 5KU1A 3HKBB 1KIAA 3COSA 4DJEC 3DLIA 1X0XA 3KSZO 2P40A 4IIUA 2I2BA 1Z7WA 4GLBA 4CNQA 3KUXA 2B3TA 2WWFA 3O4FA 1NATA 1QZTA 3Q4HB 1D03A 3ZZMA 1GG9A 1HNWB 4EY7A 4ND6A 4C7KA 4KEAA 5FOVA 1N6HA 3JCMM 4JLWA 1YHNA 3EEBA 1NVFA 1I4OA 2P9GA 4RDIA 1EIWA 2Z5LA 4NCXA 1AC5A 1Z6PA 2J30A 2G9QA 3AUJB 1RR6A 2H2HA 3U6KA 3EXFA 1O8BA 1HETA 2X5KO 3GFGA 2ZKLA 4FOLA 2GUGA 4BO3A 4DM7A 3K57A 3QVWA 3RYHA 5BMVA 1P7BA 4FGLA 1GJRA 3Q3EA 2MMCA 4LBYA 4FWBA 4UTNA 3IRVA 2P6MA 3L75H 2GLZA 3A6EA 1LU9A 5FO0A 2QRZA 4KHZA 1UKVY 1SKQA 3ZV7A 2P9CA 3HM9A 4UUQA 5FORA 1G6OA 1XZFA 5KQLA 1GUYA 4G0MA 1MHTA 1H2MA 1GQYA 1P62B 2RAFA 1HL3A 4G24A 4ALLA 1XMXA 2JGDA 5EIHA 1HOTA 1YDMA 3FLEA 4B4VA 2D5CA 4Q1DA 1GGJA 5EAZA 3DM9B 4TXHA 4HSGA 3ZI0A 2DHRA 4EJMA 4DCUA 3ELUA 1ZCFA 3IVGA 4L4ZA 5L8VA 2FUNB 2QLFA 2KLBA 1MH9A 2YY7A 1K7SN 2MINB 4UPVA 4GGMX 3ROEA 5HQJA 4TTIA 4MI3A 4YJFB 2JA2A 1JSZA 1Y98A 3HP7A 4GT1A 4Q4AB 1YZVA 4XDHA 1I80A 2FVXA 1K89A 4YP7A 3OWOA 4O0LA 1OMOA 1PEKE 1D1SA 2P1DA 3I1YA 4W5NA 3CPJB 5T6BA 3R7AA 4FE7A 2CZGA 5CT4A 4FWIB 2HQSA 1RWNA 4E14A 4RSMA 4EJSB 5EC1C 2QE6A 4DYLA 5H3CA 2AA3A 4N21A 1E2BA 4DLYA 3TI7A 3S7ZA 1CU1A 4DNXA 4JBWA 1ZR2A 3BRCA 4TKLA 2X3FA 1Q86H 4NS4A 5D3KA 2PUSA 1AN9A 1WLEA 3CCVV 2N75A 1L5HA 3CN9A 4RTJA 1XA0A 4GGOA 4QTYA 3LDAA 2CN1A 2CLOB 5LA6A 3LZ6A 2AFVA 1UI9A 1C14A 2YYAA 4RETA 5DLYA 2ZYHA 1NN5A 1TAQA 2H4FA 2C58A 1O94D 4J9UE 3NHFA 2JCSA 5CT5A 5CYPA 1UAYA 1F14A 5KDOA 1FBTA 1G18A 4ND2A 1YR2A 2WQZA 1PX0A 4MUHA 1W29A 4P34A 1F1BA 2X14A 2GK7A 3USES 5JAPA 3KZIZ 5JQWA 5HKAA 4AO8A 3OM3B 4OHPA 5KX5F 2ZRHA 4JB8A 3T12A 2BH2A 1JU3A 2V58A 3E2EA 3BSSA 3M8AA 3GJQA 4ZOAA 5FBLB 3E83A 2AZ2A 3AETA 4ARVA 4I8IA 3KD3A 1CQIA 3WWPA 4F2PA 4GOLD 4G1EB 2B4YA 4LTNA 5IT5A 1Z62A 2ZR8A 1XPUA 2V7GA 1XCJA 4GYJA 3TZHA 5IHPA 3RYIB 2DW4A 1PP9H 1PLLA 2W2NA 3GVHA 4EG5A 1M67A 1ZZGA 3U7RA 4ZARA 2P5YA 2FW8A 1IXMA 3QHAA 3Q8MA 3RE3A 3TBHA 4K8RB 2O2IA 1CK2A 2WT8A 1SC6A 4IOKA 1WPXA 4UU7A 1HO3A 1JX6A 1JYEA 3JAWB 1KYIA 4L4XA 3I9KA 4UBLA 4U3FH 1DWPA 5EO3A 5FL7D 2VKQA 3ZDCA 3E7DA 3KAKA 1E6LA 5HPYB 2C83A 4R5MA 3PBKA 1WSBA 3RO7A 1T0AA 5D85A 5EI5A 1U43A 1Y5LA 5GZ1A 3E5HA 4F38A 4WFEA 3ICOA 3TNJA 4WGFA 1VF6A 4HVCA 5REQA 3LZCA 3LC2O 4JBYA 3ZGZA 1EVEA 2BE9A 4FW8A 1H0KA 4J1SA 5F9FA 3EPPA 4QOJA 1N8RW 1MVLA 3VIUA 3CZ9A 2OO3A 4L0QA 4DV2B 4MPDA 2C7GA 5HXAA 1Y48E 1KZHA 5EJ8A 3C6QA 3OBBA 3FAVA 5SY9A 2YVAA 4FGUA 4RH1A 4LFCO 3ROGA 1Y66A 3OZWA 3U19A 2VPYA 1ZJYA 4XSVA 5AOAA 4BRWA 3FTEA 4P3OA 3B2EA 5AW3A 4A9AA 3O84A 2XNJA 3PCTA 1GP2A 2X41A 3R5SA 2C2ZA 3DNFA 1U40A 3OQIB 4QSHA 3F74A 3PJGA 1OX4A 2B2CA 1VQ8F 3CXCU 2YNMC 4G97A 4K9PA 1EZJA 2ID9A 2EFCB 4HAUA 5JMTA 3IFXA 3OGIB 4E3ZA 2ZYTX 3VGJA 4CYMA 2FFJA 1HDXA 4DIKA 4NARA 3LUBA 2YJNA 1P18A 4I50F 4RJ2A 4ZFNA 3E6AA 8MHTA 5FLEX 1W35A 5J9PC 4Z4CA 6CHYA 2GO1A 3RYFB 5ISMA 5BSVA 1TM7E 3B2EE 2PUEA 1WD5A 3MJRA 4ICGA 5E4YA 4YMLA 2QTSA 3PNMA 3ZWQA 3GT4A 3SG0A 3PQFA 4PZEA 3PICA 4URYR 1O3YA 5CBFA 1N92A 3CCLV 3NAGA 1CQPA 1KSGA 4JU8A 4ZU3A 4JBIA 4RF5A 3ELYA 3VHQA 3LGSA 1XF9A 5B6PA 5JXGA 2OHFA 2CJWB 5IULC 3DXZA 3RW0A 2X7HA 3F6SA 4RVCA 4L3OA 3D5QA 2OXFA 1OWLA 4WY2A 1NQWA 4A26A 4HAIA 1G8GA 3FGOA 5CH8A 5JDCC 3TUJC 4QAJA 4CDNA 1QIHA 4ND8A 4CEHB 3SEAA 1HT1E 1N4CA 4H37A 4RLFA 5JBNA 2PWZA 1SUIA 3GWGA 4PG4A 1U3LA 4PGAA 4MVXA 3UMBA 4CDRA 2V6GA 4I9WA 3PX3A 4IVQA 4LWZA 4DR7B 1AKUA 1QAMA 3E7FA 2H1WA 3RBAA 2I65A 4IKOA 2JFFA 1J23A 1D0SA 1ZIOA 4Z2WA 3GVMA 2BUBA 5KS2A 2O54A 2A9PA 3PXXA 4HNHA 3L6BA 5LN1A 3D7SA 1NUTA 4FTWA 4QWWA 4UU1A 1DG3A 2OCIA 5JNTA 2EYUA 1XZLA 3N0WA 1Y8QA 1IUKA 5MN4A 1YI0A 1H0SA 5CDTA 1SQ6A 4X3OA 4RQEA 2GJ4A 4KQGA 1BZYA 4HNSA 1FFYA 3BWXA 3G2HA 3GC6A 4B40A 3M1AA 3W8NA 3DZKA 2ACKA 4IYIA 3ETHA 1BD3A 2ZIGA 3S2EA 5EY5B 1QKIA 2CWWA 4HAXA 1VRVA 3WWOA 5KAFZ 3HJNA 2C4MA 2JLYA 4RPGA 4W5HA 2P2GA 3BMCB 5AQ1A 2R1VA 4MLPA 1CDDA 1EFUA 3OX2A 4G1UC 1M1XB 1XRJA 2QJRA 1Z6TA 1NN3A 1J1ZA 1GPLA 3WWCA 3GA5A 3KXIA 5HILA 4FM0A 4CKEA 3PJEA 4GZ5A 3APQA 3TK1A 3S2SA 1CS0B 2QGZA 3FGNA 4HZ3A 3WYEA 3SBXA 3HYLA 4PTYA 5FA5A 2OZLB 5L4LA 3RQSA 1SBIA 1PJ4A 4JQYA 1MZFA 1IUPA 3PQ2A 3NMUC 1XZAA 5KTTA 2OO5C 1KDTA 4ZHQA 1ZK2A 2BBWA 2EBWA 4LV5B 3RSOA 1NVDA 1J8FA 3TD2A 4HLNA 1AMNA 5B2ZA 5CIWA 5LMUB 1JDZA 2SNIE 1HXHA 3F6CA 2AQ8A 1SHTX 1W19A 3E1SA 4MOWA 3DT9A 3WTCA 1U98A 5CHYA 4ZEVA 1E3QA 5TJ9A 4DBVO 2WLSA 2VDMB 3ZCSA 2PMBA 3SR0A 2IVZA 2QT9A 2PUBA 2XE8A 1PL8A 2UUCB 4JCCA 2HXGA 3H1PA 4CC5A 3AK1A 1XHEA 4K03A 3V7QA 3O2JA 2DR2A 2CYBA 3TLCA 2HSGA 2VDVE 1HSOA 2CCGA 4OBEA 2I1LA 1DJQA 1C3OA 3DVSX 2VI5A 1QG4A 5F2KA 1DARA 1RIFA 2J85A 3S2IA 3V1UA 4H4CA 5ED4A 4I4IA 2KE5A 4BGIA 2BE7A 4AP6A 2VQFB 5ER9A 1B6TA 4CIAA 1G5RA 2C3MA 1BQ4A 1PFYA 2ZI7A 3A9WA 2R25B 1F4NA 4RS4A 4J6EA 1GTMA 5FHQA 3AK3A 5AYVA 1J00A 3FTQA 3E9NA 1M54A 4G1CA 1OXKB 4C4WC 4ON9A 2OL4A 5TR9A 2GCEA 2VR1A 4UARA 4MI1A 3LUCA 1YMQA 1A76A 4K6HA 3JQ8B 2WE8A 2W2MA 3DF7A 4UBJA 3ZVKA 5CN0A 2IPMA 1U2GA 2D8AA 1M7BA 2XDYA 1RP1A 3X2EA 4G01B 3CS5A 1SCQA 2R60A 3PSHA 2V55B 1ZH6A 2GK3A 3T1HB 4R6WA 2B83A 3TLGA 3C48A 4BEJA 2JGKA 3OZCA 3CONA 2XBLA 4G2NA 4BFTA 1SJ9A 3GELA 4KL8S 3VDQA 3O2SB 4FLEA 3L18A 3C6BA 3CUVA 3FVTA 4TTTS 3HKEB 3K0CA 3G9UA 2YDXA 1P72A 5IEBA 1L1EA 2Z1FA 4C30A 4ZODA 2O0KA 4CU5A 5H6RA 1RT9A 3CRQA 5CLGA 4FU0A 1K3FA 2HQ1A 4QJBA 1P1HA 3OZ7A 2W8ZA 3A1DA 5HFJA 4RMJA 5HEKA 2O7SA 1XELA 4WN9B 4FZRA 2P35A 1XWFA 2Y69C 1PM9A 1V4VA 3QU4A 4G5HA 3IQGX 1DDGA 5HOQA 3RU2A 3UJ8A 5BQ3A 1WDLA 1QAOA 5FR2A 1TI7A 4FIZA 2LDXA 2AFRA 3ETJA 1GZ3A 2UXCB 2CVQA 2P77A 2PGIA 3IUSA 1U7ZA 1XTVA 4B73A 2EL9A 1Y74B 1OVGA 1X7XB 1P91A 1T24A 3TNYA 1ZVVA 4ZJYA 5B30A 2IBZH 3AEUB 2V9PA 2XDQA 2VXBA 1LDYA 1RKBA 5GAJA 3TL3A 3I01M 3CCMV 1EGMB 5T6MA 1D2HA 2I1QA 1I5YA 5YASA 2QRGA 5CPBA 2JDID 4NK5A 2QGFA 2F4VO 3PXBA 4LZPA 1TQ6A 4BNKA 2NR5A 4EHAA 4RDCA 3OF5A 1EMDA 4CT0A 2BFDB 4GOKA 5CG2A 4WN3A 1SOVA 2OECA 3IVMA 3TZBA 2X6QA 2FE1A 8OHMA 2XZTA 4WLNA 2DYYA 2WA4A 4IH4A 1X87A 5J1SB 5AK3A 4U7NA 4NZOA 4PC2A 4QLOA 1NQTA 3IJEB 2A5JA 5CG1A 4Z3DA 3B6IA 4LPSA 5FEUA 2VFAA 3URMA 4IINA 1VBFA 1GSIA 2AH5A 3SNHA 3NVKI 1N2IA 1YRBA 2IDJA 2VO1A 1MC4A 4PZYA 4KBYA 1F8XA 1WNSA 1AN0A 4BYMA 3DPIA 2QTFA 1T0UA 1UXGA 1SK8A 5IS2A 4A82A 4XM0A 4JI4B 2IHTA 1Q7CA 4D0LB 3NC0C 1B6RA 1TUEB 4YP9A 1MX3A 2HRCA 2MSNA 3H01A 2V9ZA 4TKUB 3PKZA 1UJMA 4P9NA 2WUVA 3STHA 1BFKA 1DGQA 4PW0A 4ZWNA 4BO9A 1P0IA 3O75A 3QEJA 1KDYA 2VQ6A 2ERCA 1V6SA 1P0QA 4LNUB 4S1TA 3TTWA 4LXYA 3EJ6A 1TCBA 4M3NA 5B3JA 5IMBA 3H5RA 1WQ3A 1TEHA 1YULA 2PO5A 3QPUA 1MOFA 1ZOIA 5HCUA 3K9WA 2C20A 4PGMA 1L5ZA 1SK9A 4RDHA 5KHGA 4H7PA 2WV7A 2PT6A 4GCZA 1DDOA 8AT1A 5FTWA 2JEXA 4JBHA 3H5AA 2VDWA 4XWWA 2JAQA 2DQZA 4WEQA 3JY6A 3R6LA 2BGKA 2J59A 5G1OA 2ZSUA 4CV0A 4F93B 2Z2ZA 3HBMA 1LBIA 2B7CA 1W5AA 4GX2A 1DELA 2FLVA 3P4YA 1LBTA 1XGKA 1DVRA 4WXRA 3WHPA 1QVGF 1JIQA 3HFRA 1FL9A 4TVKA 3D2AA 3L06A 4KG7A 2WP0A 1BMTA 2QRVB 1JJ2F 3OEHG 1EJ0A 2XVAA 2OGWA 4URZR 2HWUA 1RYNA 3OX1A 3S3XA 3L0PA 4CUZA 4CIWA 2HDNB 3PJDA 1W55A 2F3SA 4JVLA 1H93A 1XROA 4WFFA 3QBVA 2Y4NA 3OAAG 1L8LA 1ZI6A 3OF2A 1PS0A 4B3MB 3N7UA 5IP5A 3FOEC 2C92A 1VYHA 2WALA 4C4PA 4DUZB 2Q3LA 4K88A 4ZCLA 1DRWA 5H02A 4KV9A 1BMFG 1SC1A 1CUWA 2DERA 2FP4A 2NZUG 2PYJA 3GGCA 3SKXA 3GRPA 1ZGCA 1IQUA 3EHDA 5DYGA 4KQMA 2QDOA 1ZL2A 3H9QA 5ALUA 3PFWO 5E8JA 3FMGA 1D6NA 3KZMA 1JR3A 2JLSA 2ZUSA 3D3IA 4B6JA 3BM5A 3EPKA 1N2CB 1P2TA 4XVRA 3F6RA 2C5EA 2VTDA 2DT5A 4AMUA 1E5TA 4NMHA 3D2BA 1C1XA 4E2FA 2J0UB 4KJZA 3DCNA 2VXCA 5CM8B 5D6NA 1WR8A 2C4TA 3DMYA 3B8EA 5HF9A 3F5DA 2ILVA 1C30A 4Q9JA 3EWAA 5HCIA 1XKQA 1FQWA 4HHEA 4ASUG 4F4UA 5L7WA 1JR3E 4I0XA 1WPRA 1EE9A 1FTWA 2Z56A 1T1IA 2NP6A 2BZGA 2CCJA 3IUBA 1ZWLA 1VQOV 1RAAA 1J0DA 3MT9A 1U6KA 3BA9A 3HJFA 4LQ4A 1KP9A 2YMQA 1U4NA 1G7RA 4QECA 5A9SA 1W88A 1IHPA 4RHAA 2OD2A 3CD6V 3RVPA 5DTEA 1K3TA 1CB7A 2GD1O 4UHEA 2UXDO 4I2VA 4KAXA 1G8KA 2B5VA 2WF9A 1C0KA 3H83A 1G63A 3R9KA 3SZ3A 3NEAA 4F04A 3FHJA 4TT3D 4GM4A 1JU9A 2B2XA 3Q3JB 2JCXA 4UEQA 4KPFC 4O3MA 1NOIA 5AM1A 1VHAA 1KKMA 4BAGA 3A1TA 3OW2U 2OGSA 1KO8A 1TYAE 4DA6A 2CCKA 3VSDA 4MYHA 2ZSBA 1D9ZA 2XAFA 2QG9A 4GOMD 2Q5LA 5FP0A 4RZ3A 5FH9A 3SHTA 4RUFA 2OT5A 1KRHA 1UP4A 3ME5A 5PGMA 3RBZA 4R1PA 1PNMA 2WRZA 2Z98A 3FRIA 5AWFC 3LVQE 2TMYA 1N32O 1WP7A 3RSSA 2G63A 2C54A 5ALVA 4LC1A 4Z9BA 1WKCA 1IG3A 1QORA 3M4XA 5DE3A 1KC1A 1BCCH 1VF5B 4F1WA 1NV9A 1XKTA 5DGIA 3PX7A 2AX4A 4WFJA 1NKDA 3R9IA 1ZA1A 4CF7A 5LM3A 2UYNA 2WLIB 1ACLA 4CCAA 2ZJFA 3MMPA 4DEVA 1Y1PA 4TV9F 4BLPA 1THZA 1RMTA 5A4MS 3AC0A 3QQ5A 1QZUA 4HN4B 3ZNPA 2W6IG 1S0VA 1D1PA 3NJRA 3QLJA 5CAEB 2IPOA 3RT3C 3AV0B 4NHEA 3L07A 3RH0A 3M6XA 3NOXA 4IIDA 4PGFA 4QOEA 4URHA 5U4XA 1BWSA 3LNTA 4G1MB 2CK3D 4ZGGA 2CNWD 1Q21A 3A6PC 2FPWA 4PWZA 1T5EA 3AJRA 3QG1A 5KVCA 4WKNA 3G3EA 3M99B 4ZQBA 5C8ZA 1GL3A 5HTOA 3ZWAA 1OVMA 1Q83A 3AY3A 2J87A 4UHBA 1VQ4V 2OZPA 2B1QA 3A9CA 3IOCA 3EMKA 1X1AA 1YF3A 1O9HA 1X8LA 4RTMA 2WSSA 1K7FB 3D4LA 3CYQA 2AHRA 2IUSA 1HEIA 1WU7A 3W2TA 1AHHA 3BCRA 4AP9A 1KEVA 2ES4A 3NDIA 4X90A 3NCHA 1ZD3A 1HYGA 1L4NA 1M2VB 3ANSA 4QRDA 4P92A 1NX9A 2PL3A 4XGQA 5EUBA 1ZEMA 1Z8FA 1F6BA 3TR5A 5K0TA 2X6RA 1SC3A 3V4FA 3R3WA 3AG4C 4FFOA 3AUAA 3KKZA 4RM2A 5KIAA 3DMTA 3HNRA 4HYOA 2K2QB 4E03A 4FM1A 4JJAA 2AC7A 2VRBA 4BX9A 2QN7A 2ZCUA 4HWTA 4W63A 4G9GA 1Y1KE 3ZBUA 2OTLV 2R751 3SYMA 4DLVA 5AI9A 4OQYA 4FFNA 3MGBA 1CQXA 2XCQA 2Y9PB 5IDVA 5JNWA 1GZ5A 4TMFA 1SZJG 1KJJA 4AG6A 5I4KA 3H18A 3BH6A 4V1CA 1QVZA 4XX0B 1QQ5A 3G5LA 3SYTA 1Y7HA 1NTKH 4V3BA 2PX4A 4F72A 3JAMN 4MGHA 4DV7O 1MIOB 1P1BA 5IE9A 1MDBA 1VIVA 2ZUTA 2O6HA 4H13B 1L4KA 4EO9A 2ZIFA 3D2CA 1YBVA 2JHCA 3BRWD 4HGNA 4OQPA 1VG9B 2PL9A 1E0JA 1AE1A 4B7XA 4C6TA 4B6GA 3A11A 5F5NA 2PFKA 4H1UA 2PV0A 1B0ZA 1SIOA 1ISSA 1XVAA 5B12A 2QHXA 2XHBA 2HFJA 4CRWB 1VRWA 4D25A 1KP2A 2ADOA 1GU1A 3NK7A 5GINE 1B8OA 2OBBA 1FFWA 1CB0A 3G1TA 2PZSA 4MW4A 3BE4A 3KQVA 4Y2UA 1Y1QA 1Z7GA 1U9IC 221PA 1YCDA 4QGPA 3RS2A 1M8GA 2I2AA 3I8OA 3DEYX 3QPCA 1EH5A 3R09A 1H66A 2CVZA 4R69A 1JU4A 3WQBA 5HJ5A 1ULBA 4P5DA 1CZOA 1WSWA 3JQRA 1KMHB 2C3PA 1VZ2A 1PT6A 5AM5A 1BGVA 3HN6A 4BQPA 4J7CA 4JJGA 1SZQA 4ZOLF 4U7GA 2I03A 1X13A 3KE1A 3HY3A 2DTDA 3LKZA 5LP6A 3A7DA 4X66O 1A69A 4I5SA 2CLSA 3R5JA 1NW4A 4NE2A 4M86A 1K73H 4BXOA 2BF7A 2ZUCA 4DV5B 3AR4A 4IIHA 3CX8A 4ZMSA 3EMBA 1XRQA 5HM6A 1G38A 5CXSA 4FEGA 3CUUA 3KVYA 3VPCA 3H4IA 3DCIA 3OM1A 1TO6A 1WZEA 2A6PA 1Y8RA 4U5QA 1OF1A 2YS6A 1P3JA 1IH8A 1XHLA 3FNRA 3AU8A 5I7UA 3HO8A 3HWWA 4M0DA 5HHTA 3I5UA 4G1VA 1YZBA 1FRZA 2WZQA 2NMUA 1MTOA 3EGCA 3ILXA 3I53A 3UB4A 3CUWA 4HAWA 4S2UA 3S06A 4QUIA 1F0PA 1DC7A 5IYZF 1S6YA 2BCJQ 1QK3A 1DLBA 3L6DA 4KN8A 4HLDA 4HFJA 4YRBA 2C2KA 5AVVA 4RYLA 3O3MB 1W76A 4HAOA 3ITKA 2GM3A 4PIMA 4HUJA 4C3VA 1BRTA 4RV9A 1UMBA 3BD6A 3C3WA 1DG1G 5LL6Y 1NNUA 1Q11A 1X0VA 2ZG6A 4QKQA 2JKYA 5CT8A 3PAFA 3M5DA 4MUFA 3NXSA 3GARA 2QKSA 4H7KA 1BE1A 2WHPB 1MGOA 4TL6A 2I66A 2YY6A 3K96A 3DV9A 2PMEA 1BW9A 5AKEA 2PGJA 4DA8A 2EF0A</