4I50B

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
429
structure length
422
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 158
structure length 422
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i50B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i50B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i50B01
4I50A 4ZI7B 5LOVB 3JASA 2XKAA 5JH7B 5CB4A 5CA0B 4TUYA 3RYCA 5C8YB 5CA1A 5J2TA 2VAPA 4HNAA 2VAWA 3M8KA 4U3JA 5LYJB 4O2AB 2GVIA 3RYHB 4O2BA 3VPAA 3JAWA 5J2UB 4DRXB 3JALA 3N2GB 3RYIA 3HKBA 1FFXB 1SA0A 4ZOLA 4IIJA 4I4TB 4YJ2A 4TV9B 4X1IA 4KWEA 4FFBB 1W5FA 5EYPA 4EI8A 4EB6B 4TV8B 5LXTA 1JFFB 4F6RA 5JVDB 4O4IA 4WBNA 5LP6B 5KX5B 1W59A 4EI9A 4I55A 5GONA 3VOBA 3VO9A 3JATA 5IJ9A 4U39A 3RYFA 5EZYB 3HKEB 2XKBA 5KMGA 3HKDB 2VXYA 3N2KB 4ZI7A 2BTOA 4DXDA 5LOVA 5JH7A 2RHOA 1TVKB 5JQGB 5CA0A 4ZHQB 5C8YA 4O4HB 2Q1XA 5LYJA 4O2AA 2VAMA 4LNUB 3RYHA 4O4JB 3WGMA 4DRXA 5J2UA 3C8LA 3N2GA 5FNVB 5BMVB 1FFXA 5ITZB 1OFUA 2R751 5MN4A 5JCOA 3R4VA 4I4TA 4TV9A 3WGKA 4FFBA 5EIBD 4IHJB 3WGJA 4EB6A 4TV8A 5LA6B 3JARB 1JFFA 4O4LB 5JVDA 3HKCB 5LP6A 3ZBQA 1TUBB 5KX5A 3M89A 3E22B 2R6R1 5EIBC 1RQ2A 4X1YB 4E6EA 5IJ0B 3JAKB 3ZIDA 5EZYA 4YJ3B 3UT5B 2BTQB 3HKEA 4X1KB 4X20B 4B46A 5MN6A 3WGNA 1FSZA 3HKDA 3N2KA 5IYZB 1TVKA 4I50B 5JQGA 3JASB 4ZHQA 1W5EA 4O4HA 5CB4B 5LP6C 4TUYB 3RYCB 5MN5A 5CA1B 5J2TB 4LNUA 4HNAB 2RHJA 4B45A 4U3JB 1W581 3V3TA 4O4JA 2RHLA 4EI7A 5FNVA 5BMVA 5ITZA 4O2BB 3JAWB 1RQ7A 3JALB 3RYIB 3HKBB 4ZOLB 1SA0B 4IIJB 3WGLA 4IHJA 4M8IA 4YJ2B 4X1IB 5LA6A 5EYPB 2RHHA 3JARA 4O4LA 3HKCA 1Z5WA 5LXTB 1W5AA 1TUBA 4F6RB 3E22A 4O4IB 1RLUA 4WBNB 5JCOC 3ZBPA 4X1YA 1Z5VA 5IJ0A 3JAKA 3CB2A 4I55B 4XCQA 4YJ3A 3UT5A 2BTQA 5GONB 1W5BA 4X1KA 3JATB 4X20A 5IJ9B 3RYFB 2Q1YA 5IYZA 3VO8A 5KMGB 3RB8A 5M7EA 3VOAA
chains in the Genus database with same CATH superfamily
3X2SA 4PO3X 1R6UA 2AZDA 1YS4A 1AD2A 2QGNA 1U4SA 3G5MA 2WVJA 1QQTA 1N36O 4LK3A 1B8VA 4J03A 4H7EA 4BLVA 4IXMA 5FFFA 1F51E 3AVQA 3VR6H 1MQAA 3D7KA 3FVWA 1ZQ1A 3COZA 3L01A 1C3OB 4L5IA 2WMOB 2A9OA 3FGPA 2RHWA 1OBHA 3V4DA 2AI1A 1JPJA 3I3SR 2VHTA 2WUFA 4LRWA 3WRXC 3KJHA 5GTDA 1IOLA 5AWFC 1KYVA 4MYHA 2QM4A 3PS9A 1CRQA 4FYKA 5F1KA 3JZAA 4ND5A 4YMHA 3HJRA 1ZJWA 1BU8A 1V8DA 5EHQA 2GX6A 3AGQA 1L5NA 5F2EA 4R40A 3BGOS 4J43A 2YXLA 4YONB 1K4CC 3WLIA 5L3EA 5IC4A 1BH6A 3LUKA 5D85A 1RRPA 5TS3A 2W2KB 2BE3A 1KXJA 3ELYA 4MLCA 2VZ0A 1UJ2A 2ZQYA 5BSRA 4ZT6A 2CYCA 3RT7A 3I52A 1RHMA 3JR3A 1ADGA 3R3UA 3MWGA 3E7PA 3SLKA 2R79A 1AR4A 3M3PA 3Q3JB 1E2KA 5ARBA 3A9SA 3FHCB 2WQ6A 1OWLA 1XTVA 1IIRA 1MUUA 2F95B 4JLUA 4N6NA 1LZLA 1J0AA 1ESNA 2ZJZA 3QE0A 2BFFB 3LXRA 1R6AA 4WXPA 3SHVA 3AFIA 4G84A 4DSAA 4CGZA 1Y9DA 3LLVA 2WD9A 2WSYB 2GPSA 2YJTD 4YFVA 3RG8A 3BIWA 2CL7X 3WLQA 3BS4A 3A4YA 1RQPA 5DHPA 4B31A 4UUQA 3BJRA 1QU9A 2X8JA 2A0KA 1DBIA 1P18A 5L3GA 1QBKC 1KERA 2DBQA 1ZTEA 3CNHA 3IBGA 1ZU4A 3G85A 1XRMA 3TZLA 3V4SA 3GBPA 4K9LA 1C7ZA 1SWVA 1UBJS 1QHIA 4B6EA 5I7SA 4UW9A 5KX5B 2COEA 1SVOA 1L4NA 2CXRA 2RI0A 1QE5A 5TQ0A 4DR3B 1P7YA 4WNIA 1WVGA 1QXSA 4BMOB 1P6XA 1S7GA 4OHKA 4XI9A 3CTPA 3SLRA 2WE8A 3M5DA 4CF4A 2WYWA 4RD6A 3FAVB 3UCXA 4ARUA 3OZXA 4IQ4A 3OJCA 2AOVA 3MWEA 2UVPA 4X54A 1I6LA 1ZMXA 4DUGA 3TLGA 1HURA 4C06A 1X38A 1KO1A 3VYRB 2D1TA 4UM5A 3ZE2B 3NHWA 1K75A 2WNHA 5EKUA 1DRKA 3P0FA 2B82A 5C7LO 1PS8A 4HUJA 4K6HA 3T5PA 4KHZA 3B3QA 5JJIA 3KSUA 1SB9A 2PXAA 5IYZA 1HLDA 1WUHS 2HVKC 2CKDA 3G89A 2X15A 1F17A 2K1EA 2ZRCA 1WOMA 2QTNA 5GQSA 1YCDA 1T6BY 3LS2A 2JJ1A 4H0LB 1HA3A 4MI1A 4KQ9A 3L6UA 2XHBA 4DXDA 4LRQA 2RHRA 1EX6A 2UV8A 3T0IA 3TRDA 3DWGA 5L3QB 1O57A 4EGFA 3JWJA 5BRNA 4II2A 3CLUD 5EPEA 4TYWA 1H2LA 3OQ6A 3TLKA 4OHYA 3A4TA 1W5TA 3ZLVA 1YZBA 5G0WA 4KOAA 3B20A 3EGEA 3ETJA 5A62A 2NSDA 3BWVA 1RZRD 1X1TA 3F9IA 5AKGA 1GDDA 2GKSA 2EQ5A 2OZEA 2NU7B 1BD4A 3V4OA 5C80A 3M4JA 3D3WA 4DR7O 1UOQA 3FFBA 1IE3A 2Q4TA 1NG9A 3GOQA 2OZPA 5TS2A 4ISCA 5LNK1 4MGYR 2B8JA 2C9OA 4K6OA 1DIGA 2B94A 1P80A 5COBA 1XE3A 3FCYA 2P77A 2WMYA 1E79A 1T2NA 3LNMB 4PC6A 1YB5A 3GD5A 2OP0A 3CEPB 4G63A 4ZVRA 3KBOA 4FFBA 1II8B 5H2FZ 4MGZR 2GPBA 3EYAA 3WICA 3TG8A 1GP2A 4YCNA 2HQ1A 3KB1A 1FU8A 4DCTA 2WP8J 1Z0UA 2RHGB 2IPXA 3ZWQA 5KNCD 4BFSA 3HSKA 3LD9A 3TINA 5C7OO 3LQ2A 3WADA 5H81A 1SHKA 4O4JA 1JDBC 4BLSA 1S3SA 1YR3A 1RBQA 5LDHA 1EVIA 4FC7A 3HYNA 3UT0A 1WSAA 2DFKB 1BX3A 2FZ4A 4OGKA 5H70A 1INLA 2ZZMA 3W3AH 3N4ZA 1XZEA 3OZIA 3DEZA 5AICA 2KQXA 3H11B 3AEQB 4JFRA 1BE8A 4FQ8A 2P5YA 3FPKA 4MKFA 3HCNA 4HAWA 2EJVA 2CXPA 4R54A 5ICCA 1T0IA 1YZUA 3DMRA 3CMAF 2EIKB 1OZGA 4MQFA 5K5EA 4Z4EA 4LF7O 2ST1A 4QEDA 4KO2S 1VPTA 1YAHA 3RLIA 3UXHA 4LI3X 4MS1A 2Q9UA 1Z28A 1N0NA 1FJXA 2IJGX 5ENVA 4ERNA 2BCGY 4JI8O 3GRFA 1VP3A 3AOGA 1VGQA 1XXLA 1I5YA 4MZXA 5A4IS 5HFJA 4EGSA 3LXUX 4X00A 3OEHA 2CE7A 3SYQA 4M0CA 1CVRA 5D5HA 3U81A 4KHPB 3RSCA 3BCUA 1HTBA 2ZUTA 4BDTA 4I6JA 2ZAGA 4B3TO 2PQ2A 1ZR4A 4S2EA 2WIDA 3MJ4A 1XTQA 1QLJA 1D03A 4KPYA 4GDFA 3KX2A 4UHJA 3IMFA 3SBEA 3ZW9A 3LBIA 2DFNA 3BPSA 1IBCA 3RTAA 3VSAA 3U4MA 1YUBA 4DWJA 1VI5A 3UO2A 5L3FA 1QQCA 2YVQA 4JUBA 1SR8A 2WPDA 5CH5A 1I80A 4G5QA 2EW2A 1IZ7A 1DRWA 5J4VA 1JR3A 1I8TA 2FLKA 3R6DA 1PGPA 1T9HA 3GT7A 5DCUA 4I50B 3IR9A 4ZHQA 2EJTA 2HJ9A 5BYKA 4EI2A 5K0LA 3GFRA 4KQEA 3I09A 5HNKA 2Z30A 5EA2A 3QWIA 3PNVA 3EY4A 4CNBA 1S0VA 1GL6A 2RHDA 3KYDA 3D6FA 1RJ9B 3CC7V 3CSDA 2HJSA 4BNIA 3D2LA 2OFPA 4N1AA 2O19A 5E3HA 1NR7A 4ENSA 1U94A 2VJAA 4ER5A 5KYNA 1ZD9A 4ZDIA 4L7VA 2RGDA 4CF6A 5FWYA 1EFRD 3G2OA 4ZQHA 3C87A 4MQ4A 3UJNA 1IOWA 1HR0O 1AJEA 3DBHB 2EOAA 3SC6A 2GHQA 2JCVA 3Q0TA 1R8XA 2X6CA 2NUTB 3NFYA 1CHNA 2R66A 5KKAA 2QF7A 5CYGA 4RVUA 1MVOA 3NG1A 1QB8A 5BQ5A 1R7RA 3D7NA 5FTNA 2FEMA 3FOZA 4QHTA 4RSHA 3PUKA 5A6SA 1YB4A 5LGNA 1JQ5A 1G17A 3BZWA 1IN1A 2P9TA 4AQDA 1CR4A 1SU7A 3F71A 2EVWX 2OHXA 2DPYA 1VLZA 2VTKA 3M4YA 3HCDA 5FEUA 4UAUA 4N21A 3LUFA 3WYNA 3UIEA 3G6WA 3ADDA 2WFLA 1XJ5A 4HAVA 5LZ2A 1I1NA 6NULA 4GG1A 2QNRA 4E13A 2D3WA 2GYUA 3O8RA 4HS9A 2O1WA 2AIZP 1DQSA 2GGSA 4GC5A 3GLIE 4MVYA 4PPYA 2V0NA 2BEUA 3BMOA 1NFFA 3A4VA 4LP8A 3GEPA 3CCMV 2O20A 1BA3A 3ZCSA 3I1JA 1KVRA 1PLLA 5CH8A 3GEHA 3QEOA 2AG6A 1UK6A 4F60A 4BR6A 1X13A 4XYMA 2AFVA 3D59A 2GN4A 2HSEA 4OBBA 1OHHD 4O5OA 2QSAA 4AQYO 5G41A 2XTMA 5H16A 2GK7A 4GU5A 1TKRA 1YJ9F 3DXZA 5FA6A 4EPRA 2FRVA 4K8RB 1TEXA 3E8HA 4J4TA 4M54A 2NO0A 2XCQA 1TIPA 4GXRA 4B8YA 4P7FA 3E3MA 5I8WA 1M1XB 2XUAA 3EW9A 4RULA 4ZANA 3CZ4A 1YK1A 3ZX4A 1QH9A 2QWXA 1DQPA 1LB1B 5SZIA 1NV8A 2HA3A 1XOIA 5FULA 1FXUA 4FIZA 3O2SB 2KBEA 5EYPA 5L3SA 4EK9A 1X92A 2H1CA 3M6IA 3WFIA 4B43A 4FILA 1RRCA 1WF6A 3PWTA 1BXZA 1U3VA 3AUKA 4PZZA 3DBRA 3GJ4A 3PC4A 4I46A 4CMCA 1FP1D 4R3WA 1AV7A 3OO0A 3PYXA 2HEGA 4MCJA 2EIMB 3V4LA 1OFUA 3IP6A 1SQ0A 5AW9A 3OM1A 4JB3A 4TLBA 2IZOA 4LVUA 4U2DA 4YRRA 5A2QM 1VCNA 4FSDA 5B1YA 4Z8XA 3SJBA 4B81A 1CUUA 4F91B 4AWXA 2G1AA 4PG5A 1M90H 4G65A 5DM60 4KIJA 1IDSA 3I04A 1WKCA 2BZSA 1O58A 4C3OB 2HS4A 2FMIA 3N4YA 1R3DA 3OC6A 4U7PB 1SCBA 2PGDA 5JCZA 3L0IB 3X1XA 4ZO7A 2XT9A 1FUYB 3L8DA 4PYQA 5B6IA 1QHTA 3PR2B 4WZBB 1RWVA 1HDOA 1ZIOA 2A14A 3WLLA 3ZXUB 2WI8A 3VBEA 3OICA 3LFHA 2P30A 2ZOSA 2IJIA 2C04A 3IESA 3D8BA 3AEYA 1EGMB 5IVKA 2B8EA 4DA0A 3TIXB 1JLSA 4XQCA 4KO8A 1VYUA 1XMXA 5KVAA 3V8VA 1KJ9A 1DG1G 3LYUA 2D7JA 2R5NA 2L2QA 2XGOA 4ZCRA 3OKCA 4N8SA 4H18A 2YASA 2CFTA 1YRAA 4Y98A 1AGNA 5IC5A 1XDUA 1OJLA 1ZIPA 2I2AA 4KRXA 4C4OA 2OHJA 4Y1GA 4JY7A 5LQUA 4J1SA 2IEYA 1QG4A 4DJAA 4JASB 1M0SA 3AUXA 3DBIA 3C39A 4INOA 3NNDA 2GJSA 1XPUA 1PBNA 1E2LA 3STVA 1MABA 1DEHA 4PLWA 3UXEA 1LSSA 1V96A 5IWCA 1ANKA 1KQSF 2CMKA 1A2OA 2WSSG 1PZGA 1W40A 5CYPA 3WGZA 2ECPA 1RZ3A 4ARIA 4Z0NA 5DEDA 4E2ZA 3LV8A 4I5GA 1UJBA 1Q3EA 1E3TA 1XTUA 2NU8A 2YNMD 3U5ZB 4JI3O 3NOVA 1J9ZA 3LGXA 1ZOIA 1KMCA 3V4FA 4GCZA 2OO7A 1UP6A 2JF0A 3OPYA 3FDIA 3CC4V 4NU0A 4JV5B 3R44A 2ATVA 2PKWA 3NC4A 1WN7A 5DM6V 1XEFA 1GUAA 1NYRA 3D8CA 2PO7A 2NV2B 2RSLA 3UT5B 2WT9A 3BJEA 5KVVA 3LBFA 2ZUSA 3D36C 1RWNA 5LP6C 3TTXA 2ACKA 2WKQA 3LWOC 4RLFA 3LC1O 1LPOA 4RA6A 2R7LA 4CMAA 4JJ8A 1POWA 3RAJA 4RVFA 5ERGB 3LFOA 1WQ4A 4D56A 4P22A 1L5KA 2HJVA 1NDHA 4PTLA 1WV1A 3CZ9A 4UJ5A 1PU2A 4MW0A 4JGIA 2FG6C 5E6UB 3IQHX 4BZXA 3L0BA 2FDRA 4NARA 1RHJA 4MV5A 2ZTUA 2ZBPA 4M1YA 1NWCA 4OAQA 4RTMA 1C1YA 1HQYE 4M1MA 3DGEC 4IINA 4RO2A 2AOUA 1ULSA 2UYGA 4C6TB 4LA4A 3OSZA 4A23A 4BGDA 1OF1A 3SHOA 4S3MA 1V9PA 4WASA 2GFHA 4YMIA 4CM9D 2P4EA 5DHTA 4K87A 2HXSA 4P3YA 2Q7XA 1NURA 5BQFA 4IQFA 4KBGA 2A9VA 1T8TA 2JJ8A 3SQDA 2ZSBA 4Y67A 3HGTA 4UHCA 1M1KH 1GT6A 4X3LA 3ITKA 2VP3A 1EI9A 3QMMA 1O95A 5EMJA 4ND8A 5JE8A 2Y66A 1JU3A 3PUHA 4CKCA 3BMCA 1DCTA 4PRYA 2VKQA 3OIWA 3F5FA 2KW5A 4DKXA 5KNDD 2ONJA 3GPDG 3EVZA 2N48A 1HOXA 2V54A 4DA4A 1T3ZA 2NU6A 3P30A 1JR6A 2AK2A 4G0PA 1VE7A 1XEXA 1OCRB 1CERA 3AX6A 2FFHA 2IELA 1O0BA 1ZM7A 3CH5A 4R9VA 2VCHA 1GQ2A 2CMFA 2D6FA 1J8MF 3MMNA 1A76A 1SNYA 3H9JA 1AH2A 3D5QA 3L8CA 1G2OA 3TCKA 3CF6R 3VYSC 4W6ZA 2K9PA 3ASNB 1TEVA 1I3NA 3F7OA 1K7SN 1BMFD 1GUDA 2Q0AA 2YYZA 5DBEX 3IIMA 3HYSA 2PR7A 3CVWA 3FETA 4QE7A 2QZJA 4PG6A 2AJBA 4DPMA 4RIGA 2X1HA 3E82A 1VE1A 1FAFA 4EW2A 5H3HA 4OHWA 4RLQA 4DIDA 1LTQA 5CLHA 2X13A 3EUEA 1OI3A 1PT6A 1CXZA 4P4LA 4HT3B 4NTYA 2IOQA 2ZUFA 2DFTA 4YMSA 5FD8A 3IPYA 4IDDA 4FYPA 5GOTA 5GADl 2R70A 3DMYA 4DMGA 1Z16A 5KDDA 5H5JA 3CYFA 1TK2A 1V2GA 2PKCA 2HHHB 2Q68A 2HT1A 1UM9A 3N8NA 1OCZB 3K8YA 4RV9A 3NRCA 3MSCA 4NBLA 4GYKA 3AGPA 3QWFA 4UPEA 1Z0IA 4RFVA 4UUPA 3MM4A 4CDGA 2OC4A 1LPPA 3SVLA 2Q5FA 4MKXA 3TLYA 2QWRB 4ETWA 2XWBF 5ILOA 3LJKA 3CXCU 3HU5A 2HCFA 3OE7A 4C0AC 1GV0A 4PHZA 2VOEA 3QKSB 4BWGA 2ILVA 4JBLA 4KXLA 5GW7A 5F1OA 3WNCA 3SDLA 4DA7A 1E9RA 4BO8A 2Y1DA 4CLXA 2VK2A 4UASA 3ABTA 4CIVA 3OW2U 3TWOA 3QF4B 4K05A 3LP6A 4INPA 2VATA 1BSMA 4EEQA 4NFYA 1TD9A 1ZOLA 2L6LA 2D00A 2DECA 4F9GA 1FSSA 1JQDA 2Z2JA 4K46A 4WOKA 4L4UA 3K5IA 4LH6A 3K2IA 4NZOA 2IL1A 4NYIQ 4X93A 2GAJA 1ORWA 4DYDA 5F21A 4BLWA 3TQCA 4MP6A 2BYTA 1V5IA 1FIUA 2IJJA 3B6IA 4FNOA 1UBKS 4BNNA 1S4QA 3L04A 3KCNA 2DJ5A 1BXGB 1K6XA 3NHPA 1LF5A 1KJIA 1LLDA 2PJDA 1NMXA 1GCOA 4AKGA 2HJGA 2QM0A 4J11A 1A69A 3OJFA 5ER9A 3K0CC 1M2OB 4A36A 4HUQB 2J3KA 3FMPB 1XQXA 1FXKB 5FR2A 1IVSA 3TW6A 1KRHA 1X1QA 3U9TA 1MMFB 3JVUA 3S55A 1EU1A 3S3TA 5EK0A 1FTQA 2F4VO 2Z2XA 1SXJA 4URVR 5BMVF 4CTMA 3I6IA 3MHPA 2WAXA 3ZHCA 3RSQA 3OFJA 5A7FA 1V41E 1CZLA 3ZHZA 4X1YB 2WAOA 3BHMA 4LQCA 2L35A 4CG2A 2IYZA 3KV3O 4FNMA 2J31A 2G7MC 3LK7A 3RVJA 1N32O 2GZ2A 1KDVA 3DT9A 4ZCMA 2XUJA 4XGQA 4O1MA 2MYTA 4J7AA 1C81A 2BFDB 2O7SA 1HYGA 1FYJA 3EGWA 3B7GA 2N75A 1GZ5A 1KOJA 3W7XA 3EDQA 4GYWA 2VYVA 2E48A 4ZIRA 2YZMA 3RLFA 4UFOA 4PC2A 4QYSA 1S2LA 5LGTA 1KWKA 2RMKA 2CXUA 2WOJA 3V1KA 1NVGA 3JQ7B 5JARA 4O2LA 3BC1A 4F85A 1XRPA 1ENVA 3KQMA 1SBIA 2PNFA 2JIZD 2CH7A 2JHAA 4TXLA 5BRAA 2AGVA 1B43A 3UTCA 2XZTA 1QFZA 1KEEB 4OMCA 1B23P 2HP0A 3NRJA 2OBBA 4ND2A 4TZ6A 2HHCA 3MUNA 4H37A 2CDAA 3P7MA 1L8DA 3KSDO 1EDOA 1NZDA 3U7IA 1UJMA 3I55V 4C2BA 4TL6A 2BFCB 3OAAG 2LO1A 1YI8A 4U2FA 4K9NA 1VYHA 1AHIA 3RSLA 5I9LA 2FA9A 3KYCB 2D5IA 2O7VA 3GWKC 4IUDS 3TRIA 3ACCA 4DW1A 3T61A 1YE8A 2AOTA 2WG1A 2OB2A 4CMHA 1U8UA 3IVCA 4LFCO 1VQ5F 4P83A 3S29A 4PLHA 4HYTA 1NZ6A 1NVUQ 2XQGA 4ARCA 1F0KA 4J1TC 2IYVA 1DCKA 4K6FA 4GMFA 4GI2A 4IY1A 3DULA 1TM4E 3DLTA 4ZVKA 3VUEA 2WZCA 2C5GA 2QPTA 2H8KA 5BSWA 4DV4O 3W7TA 3BRWD 4KR3A 2XYRA 2YV2A 1MNQA 4B85A 2B1RA 4HTFB 2MSDB 1EHYA 2PSHA 5BQPA 4YBZA 4KCGA 2VAVA 3E22B 3VNRA 1QOPB 2ZRBA 2EZ8A 3WHKA 5HBRA 3DH0A 2WB4A 3ZE9A 3U56A 3RJMA 4GPD1 4EX7A 1XLWA 1COMA 2X40A 4UNNA 3BMNA 2BGRA 2XUOA 4G0NA 5HGXA 3EXFB 3L73H 1H2RS 4OHBA 4FFDA 3CLKA 1O94C 3T54A 3HKCA 1WXEA 1PJ2A 1ZNQO 2Y4TA 1NOIA 3OD5A 5U4QA 1SUPA 4IO1A 3E8GA 3MT9A 4E5KA 2IK8A 1Q0RA 4P7JA 2NVOA 4BMXA 4C8GA 4IDBA 1J00A 4FYVA 1BHQ1 4YRNA 4JFAA 3W3ZB 1NA5A 1YHQV 4HEQA 3KU1A 4F72A 1RPZA 3VJRA 2G77B 2ASEA 3WLOA 3EJWA 3MJSA 2Q50A 2HU8A 2OFXA 1M7HA 5JMWA 5KAFZ 3GB7C 2CHTA 1HE3A 5FI0B 4XBFA 1FQOA 2O8FA 3UK6A 1D6NA 3LL7A 4PSVA 4X1KB 4MRMA 4B35A 2JVJA 3RASA 2RK6A 4D7TA 1I08A 3K0AB 1K8RA 1RXUA 2P40A 1R5JA 3KKKA 1V8OA 3GIDA 5NULA 3L4KA 3J7AC 3NFRA 2QL5A 2RI6A 4HH3C 3EGDA 2VSOA 1TLFA 3LWNA 4RS4A 2BJVA 2JGAA 3IOEA 2VUHB 3OZEA 2PSSA 3N87A 3K9WA 4HEA1 3LVRE 3ZWDA 4KDEA 1Z06A 3QPVA 4NG5A 4TVSA 3WP1B 3DCJA 2QD1A 5GZ3A 5DNWA 4F1WA 3IURA 3OTWA 1N5LA 1EK5A 1R9GA 3VQTA 5DT2A 5EKSA 2EJ7A 4F04A 2QXUA 3QOYA 2M7WA 3SPCA 5C5CA 4C8EA 2FDXA 4TQGA 3FTNA 3L7CA 5GAJA 1WLSA 4O3FA 2ZCEA 1V5FA 4OHCA 4QTXA 1VEWA 5A0VA 3IMEA 3BYZA 3CD6F 2ID8A 4GPBA 2Z2YA 4OLBA 3IJEB 4YV7A 5JNLA 3C6KA 1P75A 1RQLA 1T3SA 5C81A 4I2NA 1KZGB 3ZV5A 4JPRA 3FA2A 4BB6A 3IMPA 4QYWA 2EINC 4X61A 1NVVQ 4A6DA 3ENKA 2QS9A 1NQVA 4RJ2A 4RZUA 3K32A 5LIPA 1LK0A 4KWCA 4R8KA 3AB8A 5FKJA 5A2QN 2HF7A 4Q4DA 3TIGA 1TO6A 1CSEE 1CQXA 3NIDB 1ECGA 3DC7A 4H4DA 4OA8A 3GUVA 2HW8A 2NU9A 1YRHA 4L8YA 1EINA 1KZYC 4C0QC 1LR1A 1GYRA 1QZUA 4G1VA 3K9BA 5F7ZA 5JI2E 4UQOA 3EMKA 1R0KA 2VJOA 4AZVA 4US2R 2QEXF 3UO3A 3PLAE 3H8VA 1ESZA 4B4VA 4QPKA 2P62A 1CFZA 4GSYA 3T5DA 2UYHA 5TR9A 4PVCA 4LJ7A 3F5SA 5ALOA 4I5IA 3RFCA 3KLOA 4Z9YA 2ADFA 2UKDA 1G55A 1PNKA 2FSVA 3LWPC 4DJJA 2P9BA 3DEIA 1U1DA 4NFLA 1EQ2A 2X0NA 1X7ZB 5GM2A 1DDOA 1ZH6A 4D8YA 1ZSVA 1NYQA 1C7RA 1F12A 1TDJA 4LDNA 4L2IB 3P45A 1GPBA 2VDMB 1IJFA 1HYBA 3KEMA 3C6YA 3TG2A 2EZTA 1F4VA 1B26A 5T41A 4JOBA 4FYJA 1QRTA 4B9AA 4DPLA 2PL3A 3QU9A 1UZUA 1HKUA 4LX0A 1AKNA 5ALHA 4GP6A 5IYDO 2ZTHA 1QQ7A 2Q5OA 4E0BA 1F4PA 3FLEA 2ZVDA 1YR6A 4TQ9A 3VNAA 5JCOA 2YJNA 3HJGA 5FB3A 2HSGA 4LCJA 4PNHA 1EWTA 4IDEA 1SQ5A 4WUVA 3MIIA 1ZZEA 5JJJB 4K8XA 4UE2A 4WFAV 3A36A 2X6AA 1G3RA 4F0JA 3DD1A 4YI3A 3B1FA 2JFHA 3D3NA 1TZKA 2E4XA 3DP9A 4FLZA 3F8SA 1BHJA 3MLEA 2EZOA 3LFTA 5HQTA 5IM4A 1QGDA 3ZN0A 1TKCA 3RHZA 3WRVA 4CS3A 4QVIA 1SHTX 4Q3AA 3DPIA 1U8ZA 1XSEA 5HFMA 2FFAA 2QX8A 5DW0A 5ED4A 1M83A 4AUNA 1XNQO 4H0NA 3UHJA 4J2OA 4EYKA 2PXXA 1HEYA 1R2QA 3D31A 3FUVA 4E14A 1KNKA 4HDCA 1T9BA 1OX4A 1XFDA 1NVPD 1MIOB 1NLMA 2DR3A 1S77D 2WJYA 3EPRA 5AK3A 4WX2B 4QU0A 4EDHA 4EG8A 2V6IA 2H9AA 1TW3A 1YMVA 1NJ8A 1DZIA 3C3AA 4MYRA 1C5KA 1CLUA 1QIJA 5MN6A 3SJCC 2ZKIA 1W88B 5DN6A 2Z3YA 3RTEA 4D99A 1PF7E 3L0YA 2RQ6A 5KYYB 2NVBA 2YHSA 4A6EA 4CKBA 1XQYA 4IIJB 4X8LA 4W5TA 3D00A 1UKVY 2BKUA 4G01B 4KUGA 3VTIC 4MVQA 1MEOA 3BHPA 1SCIA 2H8GA 4HDAA 4CI9A 4Q1AA 4A2CA 2Y71A 1SC6A 2UYPA 3IALA 4JR2A 2OD7A 2B2NA 1L1EA 3T1QA 2A5LA 4M0FA 4BNLA 4QOHA 4J9YB 5B2ZA 1N5JA 1FBNA 3LIPA 3ESDA 3E5NA 4A8JC 2NT3A 5CPBA 1H1DA 5DYIA 5CPFA 5JPIA 4BTLA 4JQSA 3H18A 1A8UA 1QCEA 3EAFA 4BB9A 2P9QA 2XUZA 3OQNA 3NTQA 3LCUA 4EG0A 3IUMA 5HTOA 3RHFA 3GQVA 4P2GA 4CM3A 1QIKA 2FDCA 1VJ0A 1XL0A 2I6DA 3LY5A 3I92A 1O08A 1M1NB 5KTNA 1NQOA 3NYRA 1G9TA 4DLWA 3I61A 1X0VA 4H27A 5HCNA 2AI3A 4DDUA 2I22A 1UPAA 2W93A 2BO1A 4UVBA 1DLIA 2FR0A 1L4GA 1AA9A 1ORQC 2O07A 3WQRA 1N2GA 1WUYA 3BL6A 4ZJUA 4C22A 4I9FA 2QPOA 3G4SF 2JLUA 5E4YA 2FHSA 3VTAA 4CTOA 4AUMA 2XQVA 5JS2A 4IKEA 4LIPD 1U02A 4TKZA 4CF3A 2WYOA 5A7HA 4I7ZB 5LYYA 4I81A 4OHPA 1RD4A 4X88A 3L05A 4J10A 5D86A 2ASVA 1EWQA 1GVNB 1E7WA 3S3WA 3BOSA 3DZKA 4BVEA 3U7HB 4X84A 3RUDA 1QG2A 1TTQB 4RHFA 1NT2A 5DLPA 4HDSA 4UNPA 3ZK7A 1E3SA 1FFXA 2DLCX 4JT2A 3TRHA 2JAOA 5MHTA 5BW8A 1TZBA 4FPXA 5LL6P 3VC1A 3SGIA 3ODGA 4TUYF 4PWTA 3EC2A 2PX5A 3L0CA 3Q7PA 3R6LA 4EUNA 4D8WA 4S1NA 2WTBA 2PEZA 1SCQA 2NXNA 4WLFA 5BR1A 5IDJA 1PFUA 1Z08A 1TZCA 1JI3A 2OHGA 3K79A 3WHPA 2HMWA 1VI6A 3O8OB 1HZJA 2PLWA 4JVNA 3Q8HA 1X14A 1EDEA 5KO2A 1B00A 1OSNA 2LD4A 3WGUA 1E3IA 3JASA 4YRAA 1SKBA 3GD7A 3PEUA 2VJQA 3LDAA 1YI2V 4HAXA 4DLNA 5TQJA 5ALFA 5L45A 1E1MA 1NE7A 1R8YA 1VQKV 4X7RA 2IRWA 2O3TA 2OFOA 2DN9A 1WUKS 3DD5A 1R0YA 3TN7A 2PX0A 5DGCA 3TEFA 5THQA 3NHFA 4EA6A 4V38A 1U3PA 4OX9Y 4MVJM 1WP9A 4DV3O 5C0OE 1JLLA 3L49A 5JMTA 5CEFA 3N3BC 1YQNA 3C3MA 7YASA 1PTKA 3S5JA 1Q44A 1MB4A 3P3PA 4TS4A 3HKBB 4L0CA 1SUBA 5B66Z 4LKRA 3C8UA 4DV6B 4C2UA 2QJTA 3CEHA 1U8XX 1SWWA 3PGVA 2XDYA 3E15A 3DFZA 2DULA 4Y2YA 4UHDA 4NBSA 2IJKA 2WUDA 4O4IF 4U8GA 3PGXA 1JKIA 3U3XA 5E7IA 4XRGA 1I0ZA 2B69A 4CMIB 2YV1A 3DV0A 3F78A 1BO6A 4M7OA 4TXMA 2XOEA 3CH6A 4GQBA 3SYMA 1D0SA 5EWLB 2VJYA 4NCNA 4E5PA 2UZ1B 2AZ0A 3OETA 5LJLA 1J1UA 2NVWA 4DCGA 3AJAA 1RAEA 3EQ6A 4U9HS 2YOFA 5H80A 3DZDA 4Q9DA 5K4AA 2AC2A 5D51S 2XKJE 4BNJA 2Q3JA 1QO0A 3HKDA 3UJCA 2XUKA 3TUIC 3QHQA 3GZNA 3TFOA 1RCUA 5DFAA 2ZIFA 2MSNA 1HNZB 2G40A 4OGLA 2QSYA 1YC2A 2NZUG 3I2IA 5AHOA 2IE0A 2Z9DA 1OTHA 4NU8X 1P77A 5DZSA 4CH4A 3LPLA 4WXRA 3SHTA 2ADPA 1IZYA 2YHIB 3EPPA 4E7PA 3PC8A 5IVIA 1U7OA 1LEHA 1J95A 4CJXA 1EN4A 2VC2B 4JTCB 1J20A 2PX3A 4WKBA 1G3IA 4RBNA 3D4PA 4V0RA 3K06A 3G7UA 3E9RA 3U44A 4OA5A 5AM4A 4Q01A 5BN5B 3A6EA 5E7QA 4YP5A 1Q3TA 4GFDA 3ZOKA 4PGAA 5CBGA 3I8SA 5FOVA 5E1OA 5IKOA 3INYA 3WLMA 2CWJA 3DZIA 4DF3A 2H6LA 4MGKR 1Q21A 1WV0A 1QGAA 1F0YA 1Q7YH 2P5TB 1QAQA 4IYIA 2VDWB 3KHSA 4AY6A 1PM9A 3U4DA 4D97A 4QUIA 2RONA 1AN0A 2B98A 4GNKA 1RCTE 3AI7A 4Q3OA 1WLYA 3LSYA 2BHSA 3AVXA 4XB2A 4AZ3A 4OHVA 3OOEA 3I8OA 1QUFA 1NVPB 3WG7C 3EZ9A 1CY8A 1P5HA 1H1LA 3E53A 3EVCA 4BU1A 2RC6A 3HTXA 2OWOA 2NZ8A 2JGLA 2K2WA 1PUIA 2H3OA 3I0MA 1N2ZA 1NI4B 1MPXA 1J2EA 2Y67A 2P7IA 3WDSA 1ZC4A 2C3OA 2Y0BA 4PY2A 2PQMA 3ED5A 4BUCA 1X25A 1JPVA 5ES4B 1HE8B 5GONA 4L6AA 1HNNA 1OA0A 3BYQA 3MCAA 3D54D 4LY3A 5DSTA 4UBOA 2QXYA 1HDCA 2JI4A 1AN9A 1SCJA 1SC9A 4Y6LA 5AW2A 2DQSA 4BCDA 2HA2A 2NZVG 3AVWA 4A8TA 2BOCC 2GHYA 2GZDA 4AYXA 1EG2A 3ND7A 1W87A 2JDID 1GRCA 3HVRA 3LO8A 3B77A 2H4FA 3WGLA 2Y0PA 4E15A 1QAHA 1BXRA 4U9IS 2ZXWB 1UBFA 3L7BA 1WMEA 3KXIA 2VG8A 4ZQIA 1HX7A 2QDKA 4HX5A 3V7EA 3OGIB 1XK6A 2FWNA 5HS6A 4CEHA 3AEZA 1JH8A 4A8PA 3ECCA 1Z4NA 1MF7A 3TQSA 3D64A 5HOEA 1L7AA 3CX5F 5DM2A 5HFLA 2X7HA 3UQZA 1PTJA 4ASUA 3VR5D 3AR3A 2Q5HA 3FI9A 1I7FA 3E35A 3V46A 1CBUA 4NV0A 3TZEA 1IPFA 1S8FA 4EENA 3VKVA 2A5GA 1KKLA 3UJHA 3GN1A 4BU0A 1ZL2A 3L2OB 2AZXA 1Q82H 3UUFA 2HNBA 3I01M 4H6WA 4YRLA 2FX5A 3RF6A 5JHHB 2JFZA 3CISA 4XB1A 1J5EO 2C0CA 2G36A 1AJQA 2VRBA 4RKYA 1WPQA 4FUQA 1GUBA 2K87A 4C4XA 1LRJA 3AXTA 2XWPA 2PD6A 4ALLA 2ERXA 1S3IA 3O7WA 3PDCA 3N5KA 4IGAA 3B36A 1DAFA 3ZO8A 4ESHA 2ALJA 2ZI6A 5K09A 5JUWA 1WNSA 4XPZA 5JDIA 1W8IA 2BMAA 4BXOA 5DV9A 1UFIA 2WPNA 4B47A 1UWCA 2V45A 4X64O 2O6LA 4U39A 2RK4A 4FLTA 5DGXA 2IZ0A 3H0KA 2RN9A 2Q0QA 3PT9A 4M88A 1W4RA 3C90A 3DL4A 3ZXXA 1J25A 1UFVA 2Z1UA 4D9JA 2MDTA 3WWOA 2AGAA 1H66A 3W4IA 4GLXA 4KK3A 4ZVLA 2Q1TA 4UNQA 3U48A 2HLNA 3DB2A 1A4XA 3DLIA 3VOTA 4NR0A 3CMEF 1JTVA 1OJ7A 3OE4A 4PR3A 2YVKA 1MDBA 3EBLA 4JWTA 1WB4A 1K08A 1ADJA 2JW5A 1HORA 3UMVA 1UC4B 1Z13A 4JVSB 2W2QA 4LHWA 5G0UA 3T80A 1QHNA 2MJLA 3ZNPA 3ZBTA 2VJLA 2QJFA 3TR5A 1JA8A 4BQEA 2BH9A 2BFNA 5KJEA 1XVTA 2C5EA 3RVRA 4GP7A 2GM4A 4EYSA 1HG1A 3AJEA 1RTTA 1TYAE 4BL5A 3THXB 3AYZB 2VYNA 3NTOA 2BEJA 3KQNA 3BCSA 2X9LA 1QRUA 2DQ3A 4GOND 4NTXA 2F1HA 3L8YA 1IN4A 4IFBA 1CLEA 3LVQE 5JASA 3B2EE 5H68A 1OD6A 1X7WA 3VRHA 1X1RA 2C82A 1AE1A 3K2QA 4L95C 3K0DA 3QE3A 4LJRA 2ILMA 1HT2E 1IXMA 1VYVA 2ZQMA 4FFWA 4U7OA 2HX0A 4KQ6A 4MJXA 3DT6A 2CN1A 5EESA 3ZGVA 4FK5C 2D1FA 1IXRC 1AUQA 4QUGA 1QK5A 2IV7A 4RJIA 2BGTA 1L0LH 3G59A 1RYEA 1TZJA 1M2JA 1W0JD 5F5NA 2BDTA 4N7RA 1TYEB 2CXHA 3OJLA 2NNUA 5KMGB 2ORIA 1PGOA 3ZGLA 4WNAB 1XL6A 3A9VA 4WVFA 1XL4A 5CDFE 3SX0A 1FLVA 2JJ2D 5IYBO 2WALA 2ZODA 1MEJA 3Q4HA 4QFDA 4MS4A 1BYIA 3TUZC 3C8MA 2PGOA 1F2TA 4M0PA 4E1BA 4BTVA 4EI9A 3WZMA 5LL6Y 4ROSA 4RX1A 1DIOB 1QKKA 5HKOA 4J2HA 3OHSX 3Q6MA 4XGNA 4CW7A 3WJ1A 1FQWA 2OENG 3G6EV 5L7TA 5FI1B 1C7EA 4DMFA 1BWSA 3REQB 4JNCA 2JEOA 1CUWA 3G0HA 1IN5A 1AXEA 3VJKA 5JADA 8ABPA 5ITWA 3B6EA 3NKVA 3RWBA 1L5SA 1MO4A 2PCLA 3PNKA 4F3KA 1QC5B 1C1HA 3UAGA 1YFJA 4GOKA 2KI5A 3CBQA 4CCSA 1O6GA 2VZ9A 4Y2PA 2ZIAA 3E05A 1VIAA 1FLDA 4KGXA 4Z7QB 4X6YA 3GRUA 4LECA 2Y1GA 4QGGA 1MZVA 1DARA 2EJRA 2X9VA 1N2XA 1SG0A 2YIDA 3SJQC 3WSWA 1S5PA 4Q3NA 1GCAA 3OLQA 3UWSA 1W3EX 5IUNC 2NNLD 3LZCA 1Y3FE 3VMFB 3CVOA 4WCVA 1ESCA 3FI0A 3FPFA 4ZHWA 3LUJA 2CUNA 1P8JA 4BWAA 2CD7A 4EPTA 2CLOB 2C8VA 2ZYRA 4UE3S 5LQSA 3H1JH 3RJ5A 4A27A 4N0DA 2GTIA 4LWPA 2JVKA 1D5NA 3MZ0A 1T9AA 2C3YA 4PQGA 1CIVA 3ABMC 1TW2A 3SE7A 4XIYA 4LY6A 1R88A 3GNTA 1BDHA 1CEYA 1GO0A 1BIFA 3CV3A 2QRHA 2KMLA 4CV3A 4QBFA 4L28A 1R74A 3M1AA 2J9FB 4F4LA 4NONA 5B30A 2IP2A 1RR6A 2WSLA 3ZY5A 4KVFA 1JJBA 2IH3C 2JRIA 5EB1B 2DUNA 3HP7A 1VKNA 3PB3A 4WXEA 3UV7A 1OAAA 4RHUA 3GN2A 4ZQBA 4ZRNA 1KC8H 3M6UA 4LRXA 3E61A 4YRPA 4BGEA 1F48A 1LRLA 1LUAA 1E2PA 2AHYA 1U0FA 3G0CA 3IC9A 5IZCC 4B6SA 5JY1A 1NYTA 3F7VC 4OF4A 1XXHA 4P35A 2FSSA 4MUFA 4X65O 1BCSB 5AW6A 3U6BA 2ZUWA 1U9CA 5FBQB 3R5SA 4RMHA 4YAGA 3MBKA 2XNSA 2VQDA 1Q1NA 3OEEA 2ZE8A 2UZAA 5KNCH 1V8BA 4K3AA 2XMCA 1RSZA 2JL1A 2PVPA 3SSMA 1Z3IX 1S3GA 3ORFA 2QU8A 3FRHA 2Y1EA 4CQMD 1DRVA 1PJQA 2B37A 1UEJA 3TDMA 1OQAA 3HZRA 1FB5A 3M5CA 4XUCA 4JQOA 3CG6A 4PHHA 4E5NA 2VWKA 4QBKA 3ZIAG 4ZO6A 3GFVA 3BSSA 4BAGA 4LJ5A 2X1LA 2A0WA 2R1TA 1N5KA 1FDTA 3HWUA 2FSGA 3ZIUA 4GPIB 5IARA 5KKCA 3U7GA 3VISA 3T7IA 2JZCA 1T91A 2OCGA 3WO1A 5TGTA 3EG9A 1MPTA 4RL4A 1QF9A 4N7MA 3E8XA 1V1JA 2P4HX 1OBOA 4N0QA 4CETA 1SULA 2YWEA 4GR9A 4MVJG 4AMBA 4A1OA 3UENA 4N5HX 2FZCA 2F43G 1DXHA 4XWTA 4MHSA 1SXQA 4BAYA 1L4KA 5JWOA 4CM4A 5DP1A 2V7UA 3ZHTA 4YTEA 4YIOA 2ZB8A 2CXXA 4L76A 4K9RA 3H5IA 3IMGA 4XJVA 5HJ5A 1CQIB 2VNIA 4N4AA 1N6KA 4EJ0A 4ZJZA 1YUMA 3I30X 4BMDA 4JHLA 4KXWA 2EKBA 3KKLA 2WIAA 1OLOA 3HUTA 4DTCA 4QUHA 3D5EA 3I1FA 1YWGO 1KEPA 1L4HA 2IX9A 3KKOA 4BNMA 5AD1A 3B1JA 1M0TA 4HBZA 3E9DA 4JP5A 2BTEA 4RVOA 4LWSB 1UDAA 3M99B 4F11A 2R6CA 1TMYA 5CIWA 3Q9NA 3UCEA 5AW4A 5JPCA 2QZ4A 2XKKA 1VL0A 3ENNA 3CF0A 4CT4B 1XMSA 2VPTA 1AQIA 5M3BA 3DMGA 3LKZA 3D6NB 3AERA 2AJTA 1S8AA 4G4IA 4KUHA 5AT1A 2PL5A 4ZK6A 3MPUA 1RKVA 1FFEA 5IJAA 3D3EA 1J7KA 4NTWA 2JGEA 2XA2A 4PRKA 3TVDA 3VPDA 4HATA 2G0NA 4LC0A 2ODMA 3UICA 4FMCF 4B46A 1D1PA 2ACVA 3HGMA 1P2FA 3C6MA 2GMWA 1T5EA 2R8EA 4QPJA 1OE0A 2HCBA 3PCRB 3FYSA 5FL7D 4MLPA 4MS3B 1KP2A 1UK7A 2ZJ0A 2J5BA 1ZRNA 3RFTA 2BW0A 4BNFA 1SC4A 4I7EA 5IEBA 1XLUA 3Q8MA 1IBLO 1E4YA 4DR2O 3BWCA 2HTEA 3AI2A 3KZNA 2ZIWB 3I5AA 1PL4A 4AKTA 4DR1O 1G8GA 1NONA 2NUBA 4MRSA 1NPYA 4TV9B 1JDVA 2ZI4A 5FEMA 2VF7A 1HWYA 1U0NA 2C9YA 1Y33E 3FVVA 3OUTA 5LP6B 2HRQA 1A5AB 1OWNA 4YVFA 3O6VA 4PR0A 5ERYA 1KZHA 1S1CA 4I19A 3VR4D 4KYIB 3FYCA 4PSCA 3IQEA 3EVAA 2RDMA 3PDIB 3KYJB 3FSGD 1V2HE 1AVTA 2PD3A 1JG2A 1G8YA 4IQGA 1L4LA 4FWBA 3BXEA 3V8PA 4DV2O 1SBHA 3P97A 4KNVA 3EIXA 2BUAA 2B8TA 2PQ6A 3SIRA 4WACA 1VQNV 1EGVB 3OCXA 4GZ5A 1C4KA 3KOWA 4MVJE 2PN1A 3B6MA 1ZSYA 3QRWA 5AW8A 1QDLB 1H0KA 3KHNA 5CB4F 4QRHA 1HT0A 3DFFA 3DHWC 8GPBA 3BFRA 3N0TA 4AG5A 3ANSA 2VZ8A 1FL9A 2OMEA 2TYSB 3R23A 4U7WA 4X7BA 4AMYA 2ZM5A 2PIDA 4G88A 1LV8A 4TMFA 4A82A 1U9YA 4I1IA 2QT9A 2XF2A 5EVJA 2YUTA 3O21A 3KE8A 3PQ5A 5BWOA 4RWEA 4MUYA 3AP3A 5DX8A 1GD1O 5EO3A 4Q03A 3TNJA 1VGVA 1F7UA 3MWDA 4EHJA 1Z63A 1LDBA 5F76A 4UDYX 2HBRA 5I9NA 1K9MW 2YVUA 1WA5A 1SIOA 1PYGA 2CBZA 4Y2SA 1Z0ZA 3X3HA 4BMSA 4HGZA 4F1JA 4NI5A 1AI5A 2QN6A 3F9RA 1D1SA 2YN4A 4HYQA 3BMXA 5HUJA 2QB5A 2E82A 1O94D 3HY4A 1JQ3A 4AZWA 1IBRA 4JP2A 1PFYA 3L82B 3AG1C 4F6RB 1GJRA 2GZSA 4WVLA 3LIIA 1LWOA 1RWOA 5ELMA 1YVDA 5A4JA 3JAMM 2QG6A 1JAHA 3I39X 2ZYAA 3VYSB 4UJ3A 1NXSA 3PPYA 2YXBA 1I3OA 4BEJA 1EFUA 4E70A 3N2ZB 2CSLA 2IPOA 1Q77A 5F64A 1TCVA 2YS8A 3GFTA 3R3HA 1MEEA 4LF5O 2GETA 4G4WA 3C1UA 4ZQFA 5KSPA 5J47A 3EF3A 3HYTA 4PRZA 5CEEA 3OKAA 1JHVA 1YULA 5EMHA 2CK3D 1R4NA 2IYTA 1X1DA 1F1JA 4HRXA 1JPXA 1EKXA 2EX4A 4DT1A 3C6BA 3K57A 4L5BA 1L5HA 1NQ5A 4Z1VA 2V6FA 1UAYA 4DLRA 4EHAA 6ADHA 3L6OO 1T2EA 4H7JA 2PH7A 5L95A 2VXBA 2I78A 3T9FA 4MV0A 5DIFA 3U2QA 3GFQA 2DSTA 4RQFA 3CXRA 2WM3A 4O2AF 4YCJA 3W6PA 2EFCB 4MGEA 2WHQA 1R73A 5CNKA 4RDXA 2DZDA 1M76A 2JVIA 2DT5A 1G8SA 4K9QA 1GSIA 4GBED 5SV2A 3ASOB 2J3IA 1G21A 3KELA 4DIEA 1YEWA 4TSKA 3PKJA 4J7JA 4NE2A 3EVKA 4J80A 1YB7A 3MCTA 3W5AA 4P3XA 5J5VA 4ZHYB 1GSOA 5JCJA 2NTJA 3N2KB 3ESJA 1HFKA 3OF3A 4CLOB 3A7DA 1EUCA 5LHGA 1N2CB 3I9NA 5FLEX 4CT5A 4G0VA 5DK4A 1K88A 1QP0A 2AMTA 4I9WA 3FDZB 2NVUB 4DNQA 4BZZA 4NBVA 4X8OA 4ENQA 2OXFA 2CHQA 1TAGA 3EHDA 3BDIA 4I8IA 3LMEA 3P9KA 3R0ZA 2EWMA 3RBZA 1B0UA 3RFXA 4D45A 4IKOA 1QP4A 4U6QA 2EKQA 2HK8A 2ZKLA 4IIBA 3DLHA 4Y9UA 2UZ3A 3E9ZA 4LFBO 1DQRA 2IYFA 3UYKA 3OEWA 1T6YA 3OH8A 4IH4A 5AP9A 4ISBA 3CIFA 1HT3A 1KFCB 3COPA 1YI0A 5ALVA 5ICGA 3NM4A 3ABIA 5EGNA 3K72B 3R0PA 4B2PA 1LF0A 1QGUA 3GLFA 4I5SA 3GUZA 4FLYA 1VPDA 1PPJH 1QO9A 1X1EA 2J3QA 2W6ZA 4EHNA 2V0GA 2JJYA 1EWRA 5LYJA 4DUYB 2MQEA 3LRTA 3FDFA 1ETHA 2TSYB 1Z5PA 4DV1B 4CMEC 4BRWA 1VQLF 2PBZA 4NNJA 2ORYA 3T5CA 5KSOA 2QRMA 2Y9MB 6REQB 2HMUA 1DHRA 1NBWB 1RFYA 3SC3A 2YWCA 4CG1A 2R60A 2CHVA 3GLGB 4RANA 4QDUA 4WCFC 2IHJA 1M6VB 1D4FA 2OLKA 1TO1E 4O0LA 1V6SA 4W99A 4AZ0A 2J5RA 4R41A 2QPLA 3S3XA 3UWOA 1Y7PA 2RI1A 1RLIA 3ODPA 1J70A 2HRZA 2J6BA 4YLGA 3B3GA 1ZH4A 4S05A 2QM8A 5FJJA 2AW3A 2J0UB 2W48A 5DNYB 1YVWA 4BNGA 5DSZA 1UT8A 4AYTA 3H9VA 1YZGA 2CLLB 1VIVA 3NR2A 4K0RA 2BKAA 2YTZA 4XWOA 1YD7A 2GZ3A 2GUZB 1T3HA 3BA1A 2VJBA 3LAWA 1SCDA 4JDPA 3FMFA 5LBUA 3WGMA 4FFNA 5GPBA 1QH8A 3R09A 1OREA 1IOVA 4GL4A 2IUTA 1JLHA 4KJZA 3FCAA 1LQ2A 4DCOA 2P3SA 3IVAA 3FYIB 3NK7A 4C08A 5JSHA 2W6JA 4MW9A 5D8DA 3ZDBA 4HQFA 4KB5A 2PA3A 1LD3A 3TZQA 1FZQA 4AKIA 2EYQA 1RJDA 1KI8A 2G7ZA 2XAHA 3OZRA 4UV8A 3NDJA 4I9NA 4J75A 1KC3A 4CQLB 5ECWA 1WXIA 1QCZA 1FDIA 1J2UA 1Z56C 2ES4A 2BRUA 2ZJ6A 3L79A 1YZYA 2VK8A 3O7MA 1B0ZA 4IIDA 5KNDH 1VMGA 4BQPA 1JVNA 2C3UA 1GH6A 3G8YA 4AY2A 5LBQA 2QV0A 4NXMO 1I24A 3VR1A 1ZK0A 2AFRA 1UJ4A 1D04A 3K1TA 4JVOA 3RQSA 2I1VB 2GVZC 3ZDYB 1IHYA 1UIRA 3I5UA 2QY9A 3PLRA 1N2EA 2PUSA 3U4QA 4YCBA 1VIMA 3HCRA 4C87A 4P92A 1BWPA 2D2FA 4M7RA 1OXTA 3N39C 4EMTA 3A4IA 4F7WA 4J9VA 1ZJ4A 4HO1X 1GM5A 1XYYA 4XVRA 3UT6A 5BWBA 1JEQA 2R4UA 3OM8A 2I3AA 4KMSA 3W78A 5I7RA 1Y3CE 2ETNA 3ZN2A 3H84A 3EHEA 1C1XB 3PCTA 2CUGA 2OHWA 4YPFA 1UK8A 3HPQA 3AOEA 3IPRA 4HFNA 4EL5A 2PT5A 1IWBB 1KNXA 3U61B 1AG9A 4QE9A 3ANTA 3LGAA 5HA5A 2A2ZA 2CTPA 2JCGA 3K9AA 1P9RA 4MOWA 3J81k 2B2CA 4JYAO 3FPCA 3AIKA 5DTQA 1X2EA 3QX8A 1IZ8A 5MFPA 1DUSA 3EHBB 3VVBA 2BP7A 5L7YA 3IOCA 3BMQB 3QVNA 1K89A 1UBOS 3N2EA 2HYDA 4PS0A 1JFFA 1QAOA 1VI2A 4BV9A 4PDRA 3HI6A 4YJFA 2PYLA 1YFZA 2ISSD 2V4ZA 4W5RA 4PM4A 1H65A 3GJQA 1Q8RA 3SYOA 1ZWZA 2Q8QA 4F5ZA 2V4UA 1ZD2P 4EJSA 2E76B 1PJZA 1DP4A 4ALKA 1XPOA 2QHXA 2GKGA 2J0EA 2VTVA 4PICA 1AJNA 2ZIEA 1V11B 1ZNXA 4Q34A 2G9QA 1M2VB 1GU1A 5BV1A 4RK0A 3V42A 1XPRA 4ID9A 3ESAA 3Q2KA 3RA5A 3C3PA 2ZVQX 3DEHA 1Q43A 2OILA 3KWLA 5LXTA 4RAQA 2ANCA 1LDNA 4YMVA 4LYGA 1IATA 2FN3A 4U7TB 3E81A 5B7NA 1UDCA 2IS1A 2VS1A 5JXHA 4MIOA 2Z08A 1RJGA 3GNLA 3VQWA 2J3LA 4KRGA 1N9GB 1Q1ZA 3A05A 3IOMA 5MF6A 3OSUA 5ESDA 2KGWA 1G2PA 2P6MA 2JB9A 3HEAA 4EB6A 1I94O 4MQBA 4HBNA 3NBYC 3NTLA 2XMBA 4OUDB 4YRZA 2FUCA 1MRZA 1TPYA 4IMIB 1C8VB 4P0QB 5I9MA 2Q49A 5DX1A 1LKZA 1QU7A 4L5AA 4GSKA 1MJNA 2Q2VA 4AX8A 1J21A 1SKYB 2XWSA 1YRYE 4R8VA 5DOZA 2FMLA 1XD2B 1X94A 3T4UA 4HSGA 4N3GA 5DHQA 2XDQB 2I6GA 4YJGB 3TQRA 3HDGA 1E3EA 1SS3A 1JZTA 1O4WA 3LPAA 3EXHC 1BQEA 4E30A 1BFDA 1R0WA 4DA6A 1GMGA 1PD1A 3PQDA 3VUFA 5JSZB 3IMCA 2FUKA 4YAIA 1IB6A 3RS3A 3TE7A 3H5VA 2ZZNA 3VU9A 3OESA 2ZD9A 2OECA 1BW9B 4LNUB 3OO1A 3QYAA 1ODEA 3LH5A 3SZGA 1OH7A 5C52B 3KHKA 1ZCFA 4IO0A 1YV9A 4H6XA 4PEVA 1Q1QA 2GAOA 2XVYA 1MTZA 3K0FB 4TOIA 3MAAC 5KUKA 9GPBA 5LMUO 4RIFA 5CDTA 4DKJA 4HN4B 2WW8A 5CFRA 3DS8A 4OMDA 2JLCA 3UMGA 3WLHA 1US8B 1F51A 2WU4A 4LY0A 2BOBC 1Z0FA 3B9PA 3EIQA 3TVTA 2A86A 3IIJA 2P6NA 2UZ4A 1GKIA 2EGHA 2H5EA 1HE2A 3DKIA 2WKSA 3SDSA 1ZUHA 1IM8A 4A0FA 2HA0A 3TLXA 4HB4A 3TL2A 5MFZA 4GM0A 2CSUA 3T7SA 4ZVSA 2OSVA 8AT1A 3H2SA 1XNHA 4J4HA 1JR9A 3WIBA 3L75H 3P2OA 3EGOA 4LDAA 3VR2D 3KJIA 2BGLA 3E2EA 5JZ9A 3GFGA 2GCOB 1UDWA 4CCYB 3NHMA 2P9ZA 1U0RA 1JHQA 1L5OA 3QOFA 4ZT2A 3CCUV 2IH5A 1MO6A 1F23A 3U0ZA 5J2UA 1T29A 4TLMB 2Q21A 5IAJA 1JNYA 2I4IA 3PFBA 5E9QA 3ZBQA 3R9IA 1KYOF 4CFSA 3ELDA 3F73A 2I6FA 1ZK2A 2Z8YM 1W0KG 3S4YA 2GTAA 5LUAA 2WJZB 1P74A 2PZLA 1S01A 5CHYA 1M2FA 1DC4A 2RHLA 1TJ5A 4G0YA 1E6KA 5HE8A 1PV0A 4JLKA 4BO5A 2OQIA 1GNPA 5EAIA 1MHTA 5JALA 1KJWA 2FZGA 2REOA 2Y05A 3D6VA 3VI6A 2NOAA 2P4VA 4Y1EA 4QPZA 3ZU2A 3W4KA 4EJ2A 2PRKA 3CPQA 4QGBA 4WV3A 2JHCA 3RVBA 3R8FA 2BGWA 3N7TA 2KG4A 2FEXA 3I2YX 2YEVA 4ALNA 1PSWA 4BLPA 3DGFC 4UU8A 4H60A 3LW7A 4DREA 3OURA 4PNZA 2VZLA 5JQGB 3WE7A 2VH5R 3HMQA 3AWIA 3MOGA 1QP7A 2IYSA 3T1HO 1Z18A 4E1AA 2R25B 1J22A 4DMCA 2OCIA 1A9TA 4RQTA 1UMDB 1PD0A 1UXGA 3QUCA 4TKVA 3HY6A 5I9SA 1OA1A 3INTA 2UYNB 1ZESA 2RB5A 5KPDA 1OC4A 1S1MA 2FG5A 5DNVA 3W7UA 1GADO 3WPXA 4OL0A 3DE7X 2YRWA 4ICIA 4CR6A 2OHHA 3EA5A 1T8SA 4YX9A 2YFYA 4CTNA 4R6XA 2XHEA 4JI2O 2N9UA 3NTUA 2B20A 5H4GA 3O9ZA 1WP4A 4YJ2A 1ML4A 4RQEA 1EJ6A 3ZK8A 2YXHA 4B83A 1KU9A 4YHBA 2AV6A 5EJ5A 2P68A 3IBTA 4W63A 5BWCA 1UOEA 2R6ZA 4PG8A 4B4DA 2JFWA 2QD3A 1ST3A 2VJKA 4QFBA 1PYDA 2H92A 4QJFB 1Z8FA 2BJHA 2X77A 3AU8A 3GP5A 1RLOA 5C18A 1ZD3A 2Q27A 1CEEA 3IQGX 1OYVA 1TIKA 2FETA 3BJMA 2NSLA 3QXJA 3P0JA 1QORA 1H23A 2HNKA 4AC9A 3ORYA 2DHRA 5ICMA 2H8CA 2HPZA 1U63A 3SIUA 5LSAA 3V4VB 2IYWA 2WFAA 3OMNB 4PDLA 1XALA 1NJ2A 1MFPA 4RESA 2ZRJA 3BIJA 3RV3A 1XN1A 1OAKA 1Q81H 3CCEV 3HG7A 4JELA 3VAYA 5H9VA 3RYCA 4I4TF 1URPA 2IIBA 4JUDX 1UKCA 4PE5B 2QE7G 4R2WA 1UZLA 3KE1A 5HUQA 1CQZA 1DT3A 2PT6A 4BEVA 4GRDA 2I87A 4JLPA 1J1IA 4K5QA 3ZEDA 1HQCA 4YT4A 3BAAA 3RJTA 4BYGA 3JAMN 1F38A 4LV8B 4NY1A 5DGIA 4B0OA 4EO4A 3PFHA 4G07A 3M89A 2NZJA 1H6CA 4Z0PA 2LCQA 1QHYA 4YRTA 1TF7A 5HWSA 2XT6A 4DFDA 1MOZA 1TK9A 4LJYA 2Y27A 5D2CA 3IAS1 3ZOZA 4IWNA 1Q84A 4NSNA 1SO8A 4EZEA 2E2WA 1F3OA 3TD3A 2LUOA 1LLFA 3QWAA 1XLTC 4JUAA 2C5LA 1DOZA 4PN3A 2MSEB 2GLUA 3D3JA 3BDVA 3M6AA 5JHGB 4QBHA 5SY6A 3GLUA 2JGJA 4D6XA 3PR3A 2TMYA 3CGWA 4EKNB 4ZK2A 1VG0B 1YJXA 3EFHA 2AQ8A 2Y1KA 4MV3A 4IUYA 3CPWF 2E18A 3KSBC 4FCTA 2ZRAA 5TPZA 2VQEB 3W2HA 2H1HA 3IS3A 1PFVA 1XRLA 3KTAB 1HNWO 1R6DA 2ZB4A 2O3SA 4KL1A 1D1TA 2J07A 3IPXA 2YVAA 4CLHA 1CP9A 3UOGA 1Y9EA 1YTFD 2IZ1A 4BIZA 4J42A 2J1LA 1WVMA 3FNQA 2C42A 5G0VA 1NKVA 5HF8A 2H65A 2ZPTX 4JXJA 4BVLA 4WOJA 5AVXA 4UPVA 2X2FA 1CS0A 3AP1A 4A2QA 1XIVA 4RDCA 1QHGA 5L6LB 2CBGA 2YWDA 3V6LA 4M0EA 5KOJB 1D2RA 3H9BA 3G5TA 1VLMA 4YB8A 1ZOSA 1H5UA 3OCYA 1EM1A 2F1OA 5AXAA 5DI3A 4X24A 2J9GA 4BEWA 2WNIA 1EJBA 1C9EA 5FP0A 2G6TA 3D8TA 4DNFA 3AIOA 2H94A 5ADWA 4OOFA 1M34E 1Q6ZA 1ZN2A 4AXBA 5D7NA 4GXNA 4M8LA 3NUGA 2DYKA 3Q98A 3U7FB 5LA6F 3C3YA 2ZB3A 1WMFA 4ZU1X 4DCJA 1T36A 3T41A 2Q4RA 4IDHA 3WTBA 2Z04A 3ZD9A 2X1VA 4F6CA 3B6ZA 4XLTA 5B4TA 1RJWA 1IV4A 4A0QA 3LOQA 3RU7A 2NM0A 4IXNA 1F3LA 2OQRA 3SMVA 1PNTA 1PNMA 3R5TA 1DO0A 5HIKA 4Y1RA 1QK4A 3K0BA 1TYBE 4Q66C 5KWEA 4JI5O 4JJ7A 3WI7A 3ZTWA 4GLOA 3AO0B 3ZE7A 4L9SA 3SC2B 1UQTA 2OBLA 3EXAA 4U7GA 1D8AA 1T4GA 1MC5A 3ZC3A 3HVKA 3CMMA 1R4MA 4UEJA 4RK1A 4OQDA 4EG5A 5L3VA 4Z8YA 1RM4A 1FUIA 1HL3A 4DRXB 3T38A 1D4ZA 5L8VA 1E89A 5CEJA 5IHXA 4U2GA 1FBTA 5F73A 4TRMA 2ZYDA 2LR0A 3RUIA 1NDQA 2AFHB 2QTFA 5KWIA 1JHYA 2G4VA 4YAUA 3C8DA 1VQOF 5DMXA 2C8KA 4BLRA 1TF5A 3O93A 3Q4GA 1D2MA 5FI5A 4LCUC 5DYNA 1FUUA 2ODPA 4HWSA 2QVYX 4S04A 4JI7B 2BONA 3PL5A 1Q5PA 4IVRA 3C98A 2VJCA 5C4GB 2VQ3A 4XUDA 2CDCA 1DAHA 4OJTA 1NVEA 4EYGA 4U2BA 2FUG6 1G19A 1CJVC 1ZOOA 1WHTB 1OXSC 3ZE1B 1JHDA 3NQ41 4TRJA 2M6LA 2QUKA 4R5MA 4J0HA 2GZ1A 1D5CA 4FNGA 4D25A 2P3LA 4CFYA 5ICFA 4FLFA 4QUDA 3MRVA 4P3KA 3MOSA 4PTYA 1D2GA 5IF3A 1YJWV 1U9JA 1HDZA 1WBBA 4D3FA 1OY1A 1FTSA 3ICWA 3HCWA 1O2DA 2H2HA 1KXZA 1QHEA 2FQYA 4G5GA 2J4FA 3KL4A 3EUAA 3HY3A 1KHTA 4BJ5A 3HJHA 4BDSA 3A6HA 3RUAA 3WG7B 4UDOA 4MA5A 5KLVH 2OVFA 3QVSA 1WZEA 4A0GA 1E1KA 1UK9A 1XZBA 3HH8A 2M6SA 5HMMA 4UUMA 2UYJA 4FVMA 5BR8B 1KK2A 2X8WA 1MSWD 1HNXB 3B85A 3AHEA 2CVPA 1R6BX 5L3BA 1E6WA 4CH6A 1Y6ZA 4DN6A 5HY4A 2ZITA 2QZSA 2YYAA 2WG0A 1M7GA 3Q9UA 2HUNA 2PBRA 3W5SA 1BAPA 3PZBA 4Y2HA 3SYNA 1NM5A 4DM4A 2BF7A 5ELXA 1L5YA 3QE9Y 3HB9A 1J0EA 4XYGA 1P72A 5K8TA 3KC2A 2F17A 3DTUB 3PQ3A 2F1RA 2PSEA 3MEQA 2ZB7A 2CGOA 4M6WA 2XOKA 2JA2A 2ZYTX 5K1XA 1E3QA 4Q4HA 5B7QA 1T1EA 3QFTA 2HK6A 2F3SA 3N8DA 1I4DD 2VDUE 2GBPA 3W8NA 2QJRA 4BNDB 3EVNA 1WU7A 3CS3A 4LSZA 2GILA 4BCCA 4EPXA 2PGNA 2WT8A 2BN4A 4OLFA 4C78A 5EZ5A 3Q5EA 2WU0A 1HK7A 1TFRA 1COWD 1V4NA 1L7EA 2PGIA 5H6QA 1DK1A 2EATA 1ZIDA 4LYDA 4E3ZA 5KTRA 1BT8A 4DLAA 2NO6A 3W7WA 3ZG6A 1CB7A 4EY7A 2CTWA 5CX1A 1M93A 1VF6C 1Q86H 3UAOA 4GI7A 1BQ0A 3G0IA 3HBNA 4KJXA 5B1DA 2XNHA 3K35A 4LY9A 1LVHA 3MINA 5I5EA 4CR8A 4KBYA 2Q5CA 4TMYA 5AKHA 4LDPA 4YUWA 1OH8A 3A9CA 2I03A 1T1JA 2Q0HA 4GZ6A 1X1BA 5HBGA 2IIVA 1D7AA 3ETLA 3DOFA 2F1KA 3KKZA 3PENA 3P4EA 4IPTA 2GARA 4L07A 2CLHB 4GOJA 2F8TA 4F8EA 2HBQA 1JFSA 3AEKB 3WMRA 1VQ7F 4ODIA 4P5DA 2PZKA 4ZOAA 4F21A 3O91A 3UMFA 4JAVC 3JQBA 4NBKA 3W5HA 3V3TA 3EOZA 3VKHA 3IL2A 4BBJA 1UPFA 5GANK 2QTGA 2FJUA 3NVKI 3FE2A 4K8OA 1U1GA 2GFIA 5BN4B 4NB5A 4D7SA 4LDRA 4BN0A 1JDBB 2SKCA 2XZLA 2WAAA 1THTA 2RHBA 3EGVA 4DEXA 4IJMA 3HU3A 4MUAA 3ES9A 2GXSA 1CN7A 4LJ6A 4EQ6B 1YTFB 2VXOA 3X2EA 2OY0A 4YUVA 4HNSA 2PGJA 4KP7A 4Y1FA 2DT8A 3C7AA 2ZDIC 2D5CA 3SF8A 2B6HA 4LBWA 2GCNA 3LHDA 2FP3A 2PGAA 1ZM2A 4X41A 4QDXA 4BQFA 1ZRSA 3JARB 3HK2A 1XUQA 3G0GA 3OF5A 1YBHA 4DR3O 4E6EA 4BO2A 4DYLA 3KCYA 2FOLA 3KWJA 4B6JA 4KGVA 1NLFA 1RE1A 2CXTA 2DPHA 3OCJA 3TO5A 5JYDA 4WLOA 4R7TA 2UZHA 4DC0A 3BSWA 3A8TA 2ZRGA 3HB4X 3ABOB 1EFPB 1CJKC 3KPJA 3PWSA 2LRHA 3U4AA 3TXAA 1TUGA 2RGAA 4IZ6A 1PW7A 5ALRA 3JQEA 3ZZUA 2J3HA 1FW6A 3A3YA 1WCIB 1E58A 4JGBA 4K3VA 1X77A 4XDJA 2Z5VA 1KD1H 1KI2A 1NBAA 2L18A 3C1OA 5C7YA 4Q21A 2VRCA 1QFXA 4ZI5A 1HSOA 4AF7A 3CINA 3OBWA 3KLBA 4PSAA 4O63O 1OVMA 1NOKA 1P9NA 1SC1A 2GV9A 3BK2A 3UMMA 5IZ4A 4A2PA 1JKJA 2P5UA 3CCLF 1PW5A 1GU0A 4C05A 4CT0A 4H1WA 1J33A 3BZBA 3Q11A 4CS2A 4TZTA 2IXAA 4M0KA 3PC7A 3BWYA 1ZDMA 2XE7A 3CSSA 2ZJBA 4R2IA 4MV7A 1ONSA 4RHTA 2PTMA 3DEYX 3INGA 5CXSA 1A9YA 5CJ2A 1EXMA 1YL6A 3ZE6A 3RAGA 1GPMA 3ZWKA 1ADFA 4QTZA 1KVSA 3JQAA 5AI8A 1ENOA 3P10A 4EYQA 1WLEA 1OROA 3F3YA 2AIFA 1YK0A 2E89A 5CHEA 1GK9A 3L43A 2F4NA 4UQLA 1I6WA 3OQIB 2HMVA 2OGSA 4ZEWA 2X23A 2BGUA 4C1NA 3DOIA 5JI3E 1B1AA 3VHLB 3O8LA 1U5CA 1MA3A 4YDHB 1ST2A 4IFEA 2AR9A 1GV1A 3IGFA 4HH4A 3BABA 2VN8A 3OLWA 3ROKA 3ZLTA 3NYQA 1Q74A 2X6TA 2JFBA 4B3FX 1D0VA 2VH1A 4RE5A 2EHDA 1NHWA 2GYWA 3ZI0A 4RD0A 1MV8A 2X0JA 3C3CA 2IQ5A 4UMDA 1Q16A 3HJNA 2PI5A 4RA9B 1WZNA 4ZGGA 1EWKA 3HR7A 1BOOA 1CUSA 3M49A 4A5UB 1JVSA 1V8ZA 2VHUA 2YJ3A 3CLTC 2LE0A 4PCLA 2XLCA 5T57A 4I36A 1B74A 1O1YA 2OCHA 1HLFA 4IHQA 1XTRA 1X7DA 2GRAA 1YDFA 2G06A 1JF8A 2Y6VA 3UMBA 4O1IA 2XB9A 2XEXA 4E6PA 2F2TA 3L1KA 5H3LA 4DS3A 4U02A 1Q7GA 1VQPV 4GEKA 1E3JA 2XCOA 3BTSA 2YYEA 1ODIA 4F8JA 2VL7A 4BKPA 3SICE 4YJ3A 1MDFA 1W5BA 3KZOA 1XF9A 1U5AA 1HZZA 1QK3A 1KI1A 1Q5OA 1AUOA 2W6PA 2PYIA 1G7RA 2A6PA 1LVUA 4KYTA 4U8HA 1DXYA 3EFOA 1N34B 3VR5H 4HK4A 1JJ2U 2AC4A 3PRJA 3JV7A 1K5SA 3K7EA 4GKAA 2DKFA 1NDUA 1GM9A 3KPUA 3SPHA 5FBWB 4RC9A 1D2DA 3AP2A 2ZJ7A 3QG5A 5IF9A 2DPMA 3ER8A 4ATNA 3MS7A 5D1NA 5F1PA 3H8JA 2QQEA 5EUBA 4C0KA 1F5NA 2PKEA 1KJ8A 3DVSX 2ZJOA 3Q40A 1VA4A 2DW4A 2OA0A 3LNTA 4HHEA 1P6QA 3LHKA 4DB4A 3OFND 2QTMA 3M6MD 3HVIA 1AF4A 3AMVA 4HPXB 3M9WA 4LNAA 2HDNB 1GGJA 2QLNA 1HEIA 2Q5QA 3QFFA 5CBKA 4KTVE 1Z82A 4FWTA 1O9BA 1I33A 3CPHA 1MB2A 4WLUA 3ZHSA 2AKEA 1DVRA 1JXOA 3THWB 2EP5A 2Q2OA 1R3LC 3OJEA 4II3A 3ZEIA 3Q7IA 2SCUA 1CR0A 5C2JB 4AP6A 3AVVA 3TRKA 1XOUA 3P19A 4KHPO 3IULA 3IEQA 3ZH2A 1EFVA 4NDNE 1UBTS 4UZEA 3IE1A 1YOVA 2I2XB 1MOQA 4ZV7A 3A3KA 1NXWA 3P9SA 2H52A 4GXTA 3CW9A 2ZQ5A 5ALIA 2JIMA 5HX7A 4RTRA 5B3JC 1CUJA 4NJEA 5EC1C 2REQB 1JSXA 3BQNB 1R0SA 4IV8A 4WFEA 1ID1A 3L8MA 5K0BA 1QDEA 2WABA 1LPSA 5JNSA 2RC5A 4IOJA 5DRTA 3WNVA 1BQZA 3G2NA 3V8NA 1E4VA 1JU9A 4MVRA 4PBTA 2OV4A 4LK2A 3ZHYA 2VAPA 3L5OA 4KKVA 4TQUS 1L5MA 1DUVG 1CTQA 3V34A 5JVDF 3T5GA 2EDCA 1RRFA 3AFNA 1K5QA 4LJ9A 2A1TR 4PFSA 3NM6B 5K0EA 2VNSA 3P4UA 1OILA 4LX8A 2WLJA 3FYDA 3NVDA 4YS6A 4DA8A 1U2SA 1G18A 3ZX5A 4C89A 1YIJF 3PHJA 4H1HA 4F4DA 3S44A 1Z5GA 3R6WA 2IIQA 4ZYXA 3TCUA 2FVXA 3AR7A 3AVPA 4YQEA 3SBXA 4RPGA 1T4CA 1JEOA 3PXCX 3K94A 4FOPA 4GZMA 3R9XA 4I0XA 4YXWA 5EXDA 4C4AA 3QM1A 4FYYA 1BWRA 4MEJA 3NBFA 1ZRHA 3AM1A 3FYUC 1I7SB 2H0RA 4D6YA 2H4WA 1VZ3A 3RH0A 5K03A 5E6SB 4OGGA 1SOVA 4P9OA 4BVBA 3CW2A 3O85A 5C1BA 1GZ7A 1AC5A 2FZEA 1VQ1A 4H3HB 1RQXA 3ZU5A 3U3MA 4KKXB 1E2HA 2KHZA 4DBZA 1U2EA 1A82A 3ZWOA 2CCKA 5KA5A 1JCHA 5J3JA 1KBOA 4RELA 1PG5A 1C7FA 1QQBA 2IYLD 5K7SA 3T94A 4WAUA 1SPBS 2FPRA 1BKDR 1XEQA 1IIBA 2KBFA 3NDIA 1PUJA 1T5SA 3E7XA 4RKFA 3S2YA 5HIAA 3MYRA 4IYRA 4E5DA 4PSDA 1V9SA 4PLFA 1XV5A 2A57A 2BFBA 4O4HA 3EF0A 5CB6A 3N70A 1SG6A 3HXLA 1XMPA 3EMVA 1UJWB 1IQ0A 5BXZA 5FFMA 5DXJA 1M6WA 4CTJA 5DNEA 4G6ZA 4GM1A 1Y3IA 4ML3A 4YROA 3RKSA 3VDRA 1Z3CA 5HF5A 3EEQA 2QP9X 1CDDA 4OYYA 2VJMB 5KUTA 3P0HA 3PJRA 5KJ1A 2LPMA 3ZEAA 1XNRB 3SYTA 2VDJA 3C3BA 2XAFA 2E55A 4HB0A 2NIPA 3DOCA 2EFYA 1SK9A 1KH2A 3H05A 2BMJA 4QVGA 2D74A 2RG7A 3DM5A 3Q87B 2ZUUA 4XWYA 4XDKA 1NJIW 5HK9A 4YT8A 1S72V 1MX3A 1L8OA 2QLFA 2IV2X 3R7AA 3VZDA 3QMPA 2DFPA 3A4NA 3ZIDA 1E1RA 4ZYUA 1Z5OA 1B6TA 1HI9A 4DXAA 1N4DA 1ELOA 2W8BA 1ZWKA 2HO4A 5ED0A 7ADHA 4GYCB 1KDYA 4NZ9A 1VJ1A 4FM0A 2CNLA 3LNCA 2GM3A 4EARA 4WFBV 3QVKA 2G8LA 3AI3A 5FBZA 5LBIA 1TJ4A 3HDQA 1XWIA 3HJBA 5BXQC 5FTLA 4H7KA 4FGLA 2I34A 1VDMA 2LIVA 3KR1A 1X7OA 3HB3B 4PW0A 1O87A 3SXUA 1LQTA 1NH2D 2HPHA 2HS0A 4CKEB 1RMQA 3RRZA 4QYMA 1QWSA 4ZI7A 4XOIA 3GRRA 1SXIA 2F1IA 4P33A 5IH3A 1T2VA 4D4KA 2NZYA 1LK7A 1VE9A 3P2YA 2NLOA 1EGAA 1NUTA 2FW0A 2UYCA 1K3FA 2C2BA 1GNSA 3BX1A 3F47A 1VHLA 4FR5A 3NORA 5CFQA 4B6FA 3PI7A 1A9ZA 5KWSA 1TA4A 3AHDA 1EN6A 1ZMOA 5E4TA 3RGWS 1R6TA 4K9PA 3FNFA 5H5NA 2IDKA 3CVXA 1GPH1 4N5DA 3GJRA 3WKDA 3OMLA 4KL8S 5AYVA 3ICXA 2LCIA 1V7ZA 1NT4A 2DQYA 1BC5A 1YE3A 3K73O 1JEDA 2PWYA 6GPBA 1KR5A 2IYUA 5CUQA 1QD9A 2HLDG 4YCCA 4WZBE 4GUDA 3RVKA 1TJNA 3FVQA 1IHDA 3G8AA 1QFSA 3G67A 1EFRG 5T6MA 3NEYA 2JLRA 4OFXA 4XSHA 2HX1A 4DM3A 3NKFA 3QUTA 3P9PA 2X41A 2W7TA 1Q6IA 5KVCA 1G6HA 1B8OA 1JWBB 1H8ED 2Q8NA 4S1OA 5BMVB 1XHFA 3OM9A 3D6HA 2PMPA 1VL6A 3F7TA 1NOJA 2V8BA 2AD5A 4I9GA 1EFAA 4K35A 2ODNA 3MT7A 3GLHA 5CRIA 4KI0A 4B3MB 2HC9A 4X20B 3IILA 4YRSA 3NBXX 4NEGA 3EMDA 2JLSA 1EXWA 1K98A 3H97A 1RRKA 3DO8A 4US0R 3OP1A 4K81B 3PNBA 1ISPA 5ALQA 1AV6A 1YHYA 4JV5O 3DNMA 1S7CA 3CSUA 4V2IA 3HUFA 1KK1A 2NUAB 2MMGA 4B5LA 1OI7A 4TWZA 3G0BA 2Z01A 4MR8B 1Z37A 3FMGA 4PC7A 1OOEA 3PCXA 4ZQCB 3QHDA 4CQMB 2QYSA 4X7MA 4RLSA 5BURA 5JAQA 2IUSA 1OBFO 1GTVA 2CLDX 2NP6A 3CZCA 4X6XA 4H17A 3GHYA 1U2TA 4QYIA 1FD9A 2DWDC 5YASA 1K06A 1P1BA 1Q0PA 3IAHA 4M1WA 4B74A 2F59A 3KUKA 1VRVA 2N04A 2ZXEA 2WLIA 2ZI3A 1UXIA 4J0FA 3FGNA 3DOEA 2AZ4A 2HSJA 3IYLW 4C4RA 4TQDA 1W9HA 3C9RA 2Y6UA 1IMJA 3DC2A 5CFLA 2WM9B 3O1JC 4R1SA 3VPSA 2G4CA 2PAAA 2P3OA 3GT3A 5LVAA 2PZEA 2XXAB 1U0HC 1IXZA 3S2GA 1VOTA 2BEWB 3GF4A 1KDPA 4HNAB 2QVCA 3FCUB 2PMDA 5BVGB 3SIVA 3GJ3A 1Y8ZA 1YNOA 2FPIB 1LDMA 2X7XA 4DYHA 3KS9A 3I62A 2A7QA 3QQ5A 4JI4B 1ZL8B 4Z9XA 3L3BA 1W94A 5IG2A 4MJLA 3S0HA 4XQGA 3ZE0B 3RFUA 1CP3A 1S2MA 1A8PA 5HQ3A 3X1YA 5DTIA 3DDNA 3GV0A 2CFSA 3FYTA 1CE8A 2VT2A 3SYAA 2VPYA 5LMZA 3ANYB 4RL6A 1ZIXA 4MUMA 5KWJA 5GJWC 1VXOA 3FBAA 4HAOA 3VR4H 3OIFA 1W6UA 3RIGA 3EEIA 2QMYA 3KB2A 5EWJA 1I2CA 4S12A 3GGSA 1SESA 3SKYA 4XPIA 4D0RA 4ZT3A 1NIJA 3UTDA 3PXXA 2XNDD 1WY5A 4GBJA 2R1UA 2QTVA 5FYQA 3HA2A 4W8OA 3JQ9A 1Q14A 3NT2A 1R6XA 2PUHA 4CV0A 2OCLA 2V7WA 3PTZA 5A6VA 2NX2A 3V55A 5TQVA 1O9GA 3E0QA 2QRGA 2KX7A 1R0LA 1Y1QA 2BD0A 3WMWA 1Z9BA 2CFRA 1X15A 4WJKB 3TOXA 2NYUA 2HSWA 1AY0A 5A5GA 2FGJA 4C7VA 3VQYA 4RFLA 4URXR 2P9HA 1D09A 1WZCA 3NUQA 3GJ7A 4E09A 4LHYA 3O4FA 1Z8DA 1NP3A 3ROTA 4EW1A 3K3WA 4DV5O 4MMYB 5H0IA 1HL7A 4XDGA 5LJIA 3G23A 3KLPX 4K6CA 1XROA 5I48A 1GQRA 3JQFA 1LPAB 3B48A 4EYEA 1PGNA 4FBMA 5HYVA 1G6UA 4R1NA 1P61B 1LJUA 3IDSA 1YU6A 2IYOA 1HO3A 4JQCA 3B3AA 1C9KA 1KDRA 5TEVA 2CGNA 4PGHA 4BT6A 3L1UA 4L74A 4RMGA 3QVOA 5BR7A 1BGXT 1A4RA 5DNAA 5SY9A 1A2KC 3UKMA 2RAFA 4BGVA 1G7SA 2PMWB 3EZXA 3BFXA 2XRYA 2ZRQA 2HHHO 2KPOA 4WBNF 4TMKA 1L7BA 4C30A 1AA6A 2JFNA 2XX3A 4FFSA 1CUDA 1VIBA 2J0QA 1OJHA 1Z39A 3RYFB 1EGQA 4URWR 3WG9A 2FZVA 4BP8A 3QIVA 2ZT9B 2LBWA 4A3SA 2LVBA 2R5WA 5D3QA 3HP4A 1KPGA 4Q1BA 5G3ZA 4FR0A 3FCEA 1CR1A 3M1IA 1XCPA 4YR7A 4AS1A 4B7KA 2H7VA 2PLAA 3SU8A 4A16A 1NXQA 5BP7A 4S35A 1BN6A 1NBMA 4BW9A 2QLLA 3R7SA 3F2IA 1ENZA 4N5LA 3WLPA 3B9QA 3DL7A 1VG8A 3AZPA 4WFGA 4X3PA 1P8AA 3HNOA 3X43A 4V0QA 5AHXA 1N2HA 3WLJA 2C2KA 2JGFA 3ND5A 1KQ3A 3MSXA 1N1DA 5K0GA 2O8BB 3LW8A 2Y48A 2CL0X 2QW8A 1FX0A 3QKRB 3DM9B 5C8XA 1R66A 1RYBA 2QAJA 3IT3A 3ZNOA 2Q1SA 3GRKA 3CLRC 5AOBA 2O8DA 1NXTA 5JRJA 2ZSAA 1X7GA 5ALUA 2OGWA 4XM1A 5B58T 1PFQA 2C99A 4O2BA 1E96A 5EB0A 1L8XA 5KYTA 4GSLA 3FSJX 4GMGA 2FQQA 3COVA 1E9CA 1NL3A 3LBNA 4FFLA 3U0VA 2ZT8A 2FP4B 3A2MA 3O90A 3KOUA 1H4SA 2YIBA 4H1UA 2Q7EA 5FLXM 3VNQA 4CG0A 5FPKA 2A58A 4TYQA 4HSEA 1KSHA 1RWWA 2CL5A 2WYHA 5IBQA 2YBEA 2ITCC 4FZRA 1SC5B 2PCJA 4F3NA 2ARHA 2OXRA 5JMPA 4RAOA 1JTEA 2WWIA 1ECCA 1XDCA 1LQUA 3PFGA 2F66C 2IV3A 2NPOA 9LDTA 2AFIA 2J3JA 4DOMA 3EARA 2ZJ4A 1G0NA 4KLRA 3ZNQA 1Y74B 4YJDA 4OFZA 2VDVE 3PX7A 4NYJQ 4WN3A 1K7XB 2XVZA 2HK7A 2F3PA