4I50B

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
429
structure length
422
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 158
structure length 422
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i50B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i50B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i50B01
3N2GB 5EYPA 5LYJA 1W5AA 4B46A 3RYFB 3JASB 1TUBB 4I4TB 3N2KB 4O4JB 1SA0B 4X20B 3HKEB 3C8LA 5LOVB 4EI7A 5EZYA 3WGMA 4IIJA 4I50B 5MN4A 5LOVA 4IHJA 1RLUA 3HKCA 3HKBA 5EIBD 3E22A 4HNAB 4DRXA 5J2UA 2RHOA 5MN5A 3R4VA 3WGLA 3HKBB 1Z5VA 3HKCB 4X1YA 5FNVB 3JAWA 1W5FA 4KWEA 4O2BA 5LP6C 5IJ0A 3JAWB 3VOBA 4X1KA 2BTOA 3CB2A 4X1YB 5EIBC 5BMVB 2Q1XA 4M8IA 4TV9B 1FFXB 4ZHQA 5KX5A 2GVIA 5IYZA 1JFFB 1W5EA 5C8YB 4LNUA 4I50A 4ZHQB 4WBNA 5CB4A 5KX5B 4O4HA 4TUYB 5ITZB 5JH7B 3ZIDA 3RYIB 4YJ2B 3ZBQA 5IJ0B 1Z5WA 1RQ7A 5LYJB 4I55A 4WBNB 1W5BA 3N2GA 5EYPB 4X1IB 3WGNA 2RHHA 3UT5A 1JFFA 2VAMA 2R751 5IYZB 3WGJA 4FFBB 5LXTA 3RYHA 3M89A 2VXYA 5JQGA 4X1KB 5BMVA 1TVKA 4U3JA 3JATB 5IJ9A 4O4HB 4TUYA 4FFBA 3RYCA 1SA0A 4LNUB 3UT5B 3VO9A 3JAKB 5JCOC 4TV8B 5GONA 4HNAA 4YJ3B 3RYIA 5ITZA 5JH7A 4ZI7A 3JALB 3V3TA 4IIJB 5EZYB 5CA1A 3JATA 3JALA 5IJ9B 3VOAA 5FNVA 5LP6B 1FSZA 3RYFA 1W581 1OFUA 5JVDA 2R6R1 4TV8A 5J2UB 1FFXA 2Q1YA 5JVDB 3JAKA 3ZBPA 4I55B 2RHJA 4B45A 3HKDA 2XKBA 3N2KA 4X20A 3M8KA 5LXTB 4YJ3A 4O4LA 5CA0B 5GONB 4O2AB 2RHLA 2VAPA 2BTQA 4O4IA 4IHJB 2BTQB 5JCOA 1W59A 4X1IA 3VO8A 5CA1B 4O4LB 5CA0A 5J2TA 4E6EA 4F6RB 5KMGA 3JARB 3HKEA 3JASA 4I4TA 3HKDB 4F6RA 3RYHB 2VAWA 4O2BB 5J2TB 4ZOLA 4XCQA 4EI8A 5LA6B 4EB6B 5C8YA 4O2AA 3RYCB 4ZOLB 3E22B 4TV9A 4DRXB 3WGKA 3VPAA 4YJ2A 1TVKB 4U3JB 5LP6A 5JQGB 3JARA 1RQ2A 4DXDA 5KMGB 5CB4B 5M7EA 4ZI7B 4U39A 1TUBA 4O4JA 4EI9A 4O4IB 4EB6A 3RB8A 2XKAA 5MN6A 5LA6A
chains in the Genus database with same CATH superfamily
3B82A 4H7DA 4MQEB 2XVZA 4IXMA 1XTSA 3DGEA 4E12A 4S3MA 5ALEA 1JKJA 4M87A 4JEMA 3FZEA 1QVGU 1CU1A 1MB9A 4MUIA 1N32O 2QVXX 4DV2B 1YVRA 4D5EA 1W46A 3HJUA 4C4RA 1XJWA 1PEAA 1VMGA 3E27A 3IQZA 4NR1A 3MUFA 3RREA 4HS4A 2L2QA 3DLAA 4L08A 4M38A 1IV1A 3UB3A 5ICGA 4P33A 1UJWB 1Z25A 1EFHA 1NA5A 3CH7A 2FPSA 3IE2A 4HGYA 3R7WB 1SH7A 4O2BA 2ZKOA 2ZTLA 2JK0A 1TK3A 1RHRA 4QM7A 3VYUC 5LQKA 3A3PA 3RUIA 5ETJA 1WXEA 1XL0A 1LF5A 1WD5A 2PMCA 5EP4A 4AKEA 3T3IA 4PW0A 5IAEA 3ABMC 1IBMO 1Z7BA 2YV5A 3P4YA 1VG1A 5LLSA 1PQ4A 5LN1A 2ZIXA 2X5KO 4FWIB 2QL9A 4HC4A 1NXXA 5TGZA 2CVFA 5LB4A 4TUYB 4GEKA 5CIQA 3EIEA 4N3BA 2R6CA 1V48A 2WG0A 1OVMA 3IOYA 2VYCA 5K03A 1CBUA 2HFEC 3RADC 4YIOA 2QTCA 3U37A 1NRXA 4ZWNA 3FB8C 1IY0A 3AJ9A 3R7DA 4DV3B 4ZGWA 1G4HA 1Q1BA 4IL5A 1TU3A 1AE1A 2OK8A 4FZ3A 4IJUA 1ODIA 4ZC1A 5C9ZA 5JI3E 1YXMA 2C0CA 4FGKA 4H31A 4LAFA 2UDPA 4B40A 2ZQ5A 1S3FA 3EC1A 3I8OA 1S5LZ 2I71A 3EXIB 1VQ4V 1VPDA 1ZJ6A 1EG7A 3K2QA 3AVQA 2DR2A 5HYVA 1AM4D 1XF9A 3LXMA 4N3CA 2WUWE 2LQTA 3AVOA 4REMA 4YP6A 1C9JA 3HBAA 1VPVA 4ZVTA 3WGIA 1RC0A 1U1DA 2FN9A 3R7LA 3ZDYB 1TK9A 3ZXIA 2ZYSA 3PA8A 3SF8A 1PD3A 4G8DA 1XRGA 2PX0A 2OTLF 4JOBA 4AMZA 4B31A 4YAKA 4Y6LA 3J7AR 2CNNA 2QA5A 2YDYA 4RYDA 3RYFA 3PZBA 1U96A 5H81A 1NOJA 2Q8QA 3TW8A 3NMUF 5KUMA 3LI2A 3TNLA 5JSKA 3B38A 3V8QA 1LI5A 1P77A 3TSCA 4GUDA 4EMUA 4UAVA 2QTBA 5F76A 4HYEA 1JYFA 2B9EA 3B78A 1FTQA 1QS0A 4LFAO 1FOEB 2Q3BA 4AN0A 1CEYA 4R6WA 4L2IA 5CA0B 1JR2A 1UPAA 1M3SA 4QTXA 1AP6A 3VH3A 1KAGA 1KL7A 4WDRA 2QWQB 3CCVV 2WYHA 4U5XA 2GO7A 5FUWA 3ZH2A 4B48A 4B8WA 4BO8A 4R54A 2XYRA 4DGSA 1T1JA 3LIPA 2JCXA 2PX3A 2FR0A 4PX3A 4WGGA 4AXXA 4Q18A 5M29A 2ZJ3A 3I62A 1UBLS 3UG7A 2O0JA 2IYEA 4HUTA 2IJGX 4KE8A 4RHFA 4RWEA 2BMWA 2O6LA 5SYAA 3ZV7A 4YLYA 4CTJA 3G85A 1ZR4A 5C8YA 4YC7A 4LJYA 3WSTA 4WFHA 1IDN1 4XEHA 1HDIA 1A8HA 2CYBA 1RRGA 3DULA 2BCCH 2EIJC 2HR1A 2NR5A 2YC4C 5JSZA 4B8ZA 3JTEA 2VPWA 2H0RA 2BW0A 3AHJA 3GZJA 4FT2A 2JEZA 2KS6A 1EVKA 4YUZA 2QM0A 1IOZA 1BQEA 3KZCA 4MWZA 3SSMA 2VJAA 4QGSA 4TOIA 2IUTA 1B8OA 3ZO8A 4FLFA 1VIAA 4KI7A 4CF7A 1HDOA 3WNZA 3ZGXA 5CJPA 3TL6A 3TZQA 4GOLD 5HRCA 3KVVA 3D00A 1UODA 1PKXA 1LPNA 1XTJA 2RGDA 4J03A 1JV2B 3SP1A 3DFIA 3TTVA 4D4LA 2XGJA 1G6UA 3WJPA 3JQCA 2AW3A 4G9GA 3TR6A 1T36A 3GLUA 3BGWA 1S8FA 2PD3A 3QI2A 3E20B 2WSLA 1QRDA 2O4UX 1V4BA 4ODIA 4C4YA 3AU9A 5C4IA 1H3EA 4RCZA 3PKJA 2O5RA 1KJIA 4OMFG 4Y1RB 5AVOA 4YMIA 3SEZA 2GFIA 3ZHYA 2CNKA 4DMKA 3ABKC 4IMIB 5BORA 1VP3A 3F90A 2C9OA 1JHPA 4EF6A 2B34A 5AVMA 1JMYA 3NANA 1XE3A 4MJ3A 4PYRA 2HA3A 3GLSA 5AHXA 3L07A 4PSVA 3RRFA 3G0CA 2JGDB 3GA0A 5G1NA 3MS7A 1U7ZA 2I6RA 4DR2B 2XJ4A 4OPMA 4W5HA 2JNBA 2V59A 3OMLA 4LEIA 3VBEA 4CM8A 3P7MA 2CV0A 4RXUA 4DLNA 4FINA 1Y9DA 1AKQA 2G0NA 1WMFA 2ZXFA 3RYIB 1XQYA 3TRIA 3F7NA 3H9BA 4WESB 2JFYA 5KAIZ 4BZQA 3V00A 1UT6A 3FUWA 2PZJA 4BRSA 4ARVA 1EP9A 4MS1B 3IC5A 5AT1A 1Y7PA 3WYFA 3GNQA 5BT8A 5IVPA 4A23A 1S3JA 1PZGA 4LMRA 3NNNA 2H3EA 5AOCA 3P5SA 4G1FA 2K87A 4JXJA 4PZAA 1HMPA 1P8AA 4Z7QB 5CVCA 1M1XB 3PSHA 1VLHA 1Z08A 4R41A 1H47A 1N0HA 1K7EB 3LCUA 2DOSA 2GN4A 4D4HA 2NUPB 1Q86H 4IIJF 4GPAA 1KJ9A 1T43A 3D6TB 1BOOA 2MR5A 5AK6A 1HSZA 4G5HA 1Y8AA 3H6HA 4NMLA 5I9TA 1R0WA 3WU2Z 2VP4A 4FTWA 4F6LA 3HK2A 1QXSA 5LM3A 1TO1E 3EK2A 1JN1A 1FDUA 4CMIB 4MSUA 4B3TB 3WYGA 3BGIA 2HHJA 4MYUA 3WYCA 1FFXA 1K3FA 4TS4A 5ILOA 2DBVO 3O03A 1CYEA 2O7VA 1VL2A 1Q81W 3G5AA 2RSLA 3OT1A 3BRSA 3TRJA 1OD6A 2NX2A 4E09A 5AKIA 2P2GA 5KYGA 4NZMA 2BRUA 1E2EA 1ZGAA 3CPSA 3AH8A 2VA9A 4FMDB 3LVBA 2JIZD 4PF1A 3KKKA 3NEPX 3HY4A 1MNAA 3N70A 2O2SA 1JN0A 4PBRA 4GECA 1K4CC 1Z6AA 5T4FA 3HEMA 3HR4A 1NW4A 2C03A 1KDYA 3W6NA 2IL1A 1G8GA 3WLLA 4EQ6A 3OAAG 3SGIA 4BTLA 1GZ6A 2HU2A 1GUFA 1UOQA 5HUQA 1CUZA 4QAJA 4J16A 3CMAV 2HLDA 3TDKA 2PUVA 4BGEA 1E9AA 3IJRA 1DSSG 3RTGA 2JAUA 3ORHA 5TPZA 4R31A 4HNVA 2ZTHA 1QR8A 1MDBA 3G23A 1KERA 4NB5A 7MHTA 2ATVA 2BOCC 2YUAA 1DAEA 4X65B 4UBIA 3UMJA 3GO4A 5TVGA 4CFYA 2XRMA 3WMXA 2C8LA 4JJKA 1T3GA 4WY8A 4A15A 4NX2A 1FU8A 1U8FO 2NZ8A 1P7CA 3SEFA 1AGPA 3NIWA 4QLBA 3OTFA 1VQPF 3R5HA 4R1QA 2BM1A 2YYAA 3I61A 4X91A 2ZVPX 3WK5A 1DUSA 1TKBA 4CBCA 1CWUA 1DP4A 4RMHA 3UMMA 3WQSB 1JR9A 2DX7A 2Y69B 4YY3B 1IPAA 3H9JA 4M22A 2HVJC 4DUGD 2OGZA 1OWNA 3NNDA 3URMA 2MSKA 4EPYA 3II6X 1IJBA 2DKFA 1J2JA 5ALRA 3A31A 5H9CA 5FBWB 3KXPA 5TNXA 3UGJA 1WABA 2CK3A 4TVSA 3JWIA 3CF2A 1U2GC 4N7MA 4MI1A 2A06H 4ONEA 3WMFA 1KMNA 2FE4A 4IKPA 1L8AA 2NZUG 3TLAA 4IGAA 4ZEOA 3A3YA 3JZIA 5EBWC 1AKEA 3E5NA 3ZCVA 1GXSA 4C87A 5HOEA 1N4DA 2CFRA 3LO5A 1E1KA 2DFKB 3QELA 3H17A 1C0IA 4EVRA 2WFAA 1GTL1 1IIRA 4B83A 2GYYA 3WKBA 3VKHA 1UDBA 5AW5A 5K6AC 2AK3A 3F4KA 2D3OW 3FWHA 2HRQA 5DHQA 2BT4A 1VL8A 4P22A 2Q4BA 1Z5ZA 2N46A 4E13A 3W2GA 4ZVSA 5A04A 4HGQA 2B33A 3B36A 2HLPA 1QP4A 1YS4A 4DLZA 2W4QA 2VOJA 4UUAA 4B4WA 1BG6A 4S0XA 4UNRA 3HUUA 4WXPA 1DTWB 4UQLA 2IDJA 3H2JA 3D3WA 3TI9A 2A33A 1G6OA 2GASA 2HTFA 2ODTX 2ZG6A 3F0TA 4RGBA 1SZTA 3SXUB 1UJ4A 3KRTA 4BYMA 3KQHA 3IEVA 3WZLA 1KRHA 1EZ4A 1BH2A 2AIRA 2GA8A 2O50A 1YHNA 1ZMRA 3EGDA 1ES9A 3RA5A 2PM8A 3NTXA 2JFVA 1W25A 4E2FA 5BR7A 5IEJA 1N9KA 5GONA 1RE0A 1X8LA 3VTAA 1CZHA 1T9GS 1KYXA 4ZPJA 3DKKA 4Y2JA 3BB4A 4AKTA 3UPTA 1XZMA 2NO4A 1KPHA 2HHHB 2BY4A 4QWWA 1U7DA 3E7DA 1ID8A 2XWJI 3OM9A 1GCAA 1RAHA 3E8GA 3R5JA 4QDZA 4BBPA 2B2XA 3R75A 2F4VB 1H8ED 3PE3A 4ZMRA 3G2HA 1OCRC 4NV1A 1MP0A 4QPCA 4EY7A 4ZN6A 1U4SA 1SBIA 1EP3B 3QVXA 1X74A 4EABA 4ZGBA 5JNUA 5L3SA 2OLEA 5DV9A 1UPTA 4CT5A 5A1TA 4OX9O 2ZXWC 2Z1TA 1PKEA 3D64A 3EGWA 3QIAA 3QPAA 4FFSA 4X20A 1ZWZA 5HFJA 4B6FA 4C7BA 1YZHA 1XR3A 4EX6A 4FLZA 1AQYA 2CW5A 3X43A 3PRHA 3RC7A 1KOGA 1QLWA 2P3QA 1UOEA 3U40A 3EG9B 5BSFA 3OEEG 1CDEA 4DBLC 2JVKA 3ORRA 3F4LA 1N0NA 2BEVB 4FLXA 3SYMA 1ADBA 2M9MA 3I2GA 5K6AA 2QTTA 4INPA 4LTMA 4XCXA 3Q5EA 4CM8B 2XMDA 2NTEA 1E9FA 3HMKA 4TTJA 4HCJA 4R1UA 5C4GB 1IX9A 1JI3A 4GP9A 3SC2B 1V55B 3K12A 1OCZB 1JHAA 2YV1A 3BQMB 3IAS6 3PC4A 1TNDA 3Q1LA 4BVAA 4QT4A 3U16A 1F7UA 4YUVA 5KDDA 4K5QA 2CGNA 4RK4A 3SS9X 5IT5A 3U39A 1NVKA 2I6FA 4H0CA 5CFOA 4N5NA 1JJ2U 1BVUA 1MRNA 1NE7A 1SXJB 1WQ4A 2RHBA 2YMPA 3LP6A 3NAMA 1IVSA 2F95B 4HB0A 2HMTA 3THYB 4AJOA 1VI5A 5A71A 5GM1A 4HWKA 4Y6GB 3PF8A 3MTGA 4BIIA 5EJ8A 1LI4A 1NSTA 3A0RA 4HATA 1OLXA 1NVDA 3ZZUA 1E3JA 2OD2A 2JBAA 2PI4A 1SQ6A 3OCVA 5FXMA 2A9OA 4GLFA 3CWCA 3WICA 5AKZA 4DSNA 1AV6A 3CCUV 1T3LA 4XDLA 3G8DA 2UU9O 2OB2A 2WKRA 4LQ4A 5EB1B 2QVBA 3DBLB 2N05A 1W73A 4PSKA 1SD1A 2KJQA 4RBNA 1Q1AA 1KJ8A 3DVRX 3CVOA 3VX4A 4CCYB 2DP4E 4XSVA 3G2LA 4GX5A 2XX3A 4NF2A 2EX4A 3OP4A 4BLOA 1IRIA 3T7RA 2TMKA 2EGUA 3A3OA 3B12A 3FPSA 3PYMA 1WCIA 3CWQA 3DT9A 3VQVA 4KFMA 1NM5C 3CUSA 1KA9H 3B52X 3K0EA 1TYDE 3NVDA 1VB3A 4XW2A 2KBEA 3D7LA 3I0ZA 2C5HA 1EX7A 1E1QA 2C5FA 3FGZA 1S3SA 4LOLA 4UNIA 3I9JA 3IEUA 1J07A 4Y9SA 3KLNA 2YWRA 3G7NA 4EMTA 2ECKA 5K0EA 4DVGA 4HN9A 4WOCA 4GM4A 3DFUA 3ZWYA 1HBJA 4QJFB 5B1EA 3HVJA 2L42A 4PN3A 4WZBE 1J2RA 3V7NA 1KI4A 1L7VC 2FETA 1S4MA 1EQAA 1TGVA 2H57A 3OF5A 4CEHA 3VR3A 3R41A 1MX9A 4CR8A 3DVAB 4HB4A 5CVEA 2O59A 4LWZA 3NP7A 4JXZA 2IU0A 1RRPA 3F5DA 1L5HB 3I37X 3ISVA 4FYYA 1W6UA 4N03A 1N6KA 1IBMB 1PWXA 4XA8A 1NULA 3W8DA 3I55V 1GUBA 3K9SA 2LNDA 3C5EA 4CBVA 1GO3F 1JNYA 2YXZA 1A96A 1TAQA 1NU6A 1GITA 2IYQA 2OG1A 2JS7A 2ZRQA 4KQXA 1TLLA 4RPHA 2CKMA 4BMPB 4BWAA 3SM3A 1S0VA 5FNVA 5JWPA 3FZGA 4M8NE 3KD3A 3HJAA 3O3MB 1U2EA 1T6BY 3ND7A 3ORSA 4BNNA 4L15A 2GPSA 1Y76B 1NMXA 1UZMA 2V6FA 3EFOA 4W82A 3TSOA 4OSPA 3EVKA 1N0WA 3DUFA 3IV9A 3L0ZA 3L49A 2WF9A 2WJIA 3OCXA 2NQ2C 4JP2A 1SCUB 3KL4A 2QRNA 2UZ1B 2YQZA 3LT2A 1Q7RA 3N2KA 2W83A 1TQ6A 2JLSA 2AQHA 1DIGA 2Y1KA 3NM6B 5CAEB 3VR6A 2IW1A 3PPYA 3RUHA 5GANK 5LD2C 1HZZC 3RK1A 4HVLA 2ZM6O 1OBCA 1K75A 4Z4EA 5H9WA 3T3DA 1NKDA 3BSSA 2Q99A 3L7MA 1IFXA 1PTJA 4NFHA 5EESA 3U4IA 4E4RA 2AHYA 4XCQA 3UICA 4ZYZA 1ZNZA 5E9JA 4R1TA 4K3AA 4QPJA 4O5AA 3A04A 2WQ6A 2QDKA 3QVKA 4AX4A 3IP1A 4DR2O 2ZS9A 4TSKA 3SU8A 3ZZ0A 1R64A 3G2KA 3L7IA 1BWSA 3OTGA 5F64A 3VNQA 3ZGYA 2NTNA 4FCVA 4XVQA 5C7IO 4KRFA 3UJDA 3LT0A 4ZC8A 1DXOA 2PH1A 2OYCA 3OZXA 4DANA 4F4HA 1PWZA 4MR9B 4ATNA 4EELA 5T41A 5CDYA 1IOVA 3V2HA 1CP9A 3OIFA 2NZYA 3ENZA 4MS2A 2FY8A 3CX8A 2QD5A 3B60A 3RTCA 4HFRA 1E77A 3TD2A 3QNUA 3IAXA 5KHKA 1PVOA 4S35A 3E7WA 1N34O 1NV8A 4U9IS 1FKAO 2AJDA 1F3OA 1AQJA 5A6VA 3NR2A 2Y0DA 5TV2A 3DYIA 1QNMA 1U80A 2V0NA 4FFWA 4J7AA 4PYLA 2GBCA 4GMXA 1ZUWA 3DMRA 4ZT7A 3ESDA 3MS2A 4GPTA 4LPKA 2BHLA 2XZOA 4OREX 5C53B 1ONSA 4AYTA 2AXEA 3CC4F 2ZODA 1IVYA 2XB4A 2CZGA 1M34B 2YV4A 3FVRA 4LZJA 1TGOA 4MVYA 5IM5A 4P3YA 4B3CA 1U0SY 1UMBA 1Z4NA 2H4WA 4OV6B 4RX1A 5DT2A 3HAXD 1OYOA 1MOQA 4MS4B 2ERCA 2QL6A 3K5PA 4GZ3A 5EPEA 4E2XA 5GY7A 4BIUA 3AOEC 1PGNA 1Z7WA 1Y74B 1XOUA 1L7OA 3ZU2A 3HCEA 4JLAA 4QOGA 4TKMA 3SJAA 3ZK7A 2WDPA 1TYZA 4FP9A 5DGXA 1A4RA 1P4AA 1VCMA 2XUDA 4PHTA 4RDCA 4GWLA 4RTRA 2LGWA 3F0DA 4YYZA 4PTYA 3BRWD 4HO1X 1Q20A 2RI6A 4G5OA 1R8YA 3R5TA 4OKNA 1WCYA 4OGLA 4BJHB 4MVRA 3R5FA 2HU8A 2D3TA 3R3UA 5FO0A 1HWYA 1I0LA 4O02B 4KV7A 1Q6IA 4ZEMA 5ALFA 5CTAA 1V16A 2I9PA 2IV7A 1YR7A 5TISZ 2XITA 3OY2A 1AHHA 1BZYA 5HF6A 4EEZA 1RW4A 2BR5A 4UD2A 1ISMA 3BGVA 3FTCA 2EZ4A 5LKAA 2UZ4A 3PXEA 4HX5A 5IHPA 4RJKA 2UYGA 4Z4CA 3MTDA 2VH1A 2KE5A 3L1JA 1GA6A 1M33A 3DBIA 5E6RB 4DEVA 3OCUA 1JI0A 5GJVC 4L95C 2GJ4A 4BRWA 4CTMA 1P2FA 2P9BA 2YWBA 4ICGA 3EXHC 1TCUA 3MOSA 3N7AA 4GFDA 1GPH1 1C9MA 1UMCB 2YJNA 2ZK7A 2H29A 3AX6A 2HK6A 3KEQA 5KHJA 5CVVA 4KSYA 5DE3A 4QBIA 1ZJZA 4DLVA 2JLVA 1XNRB 1NF3A 5JJNB 3C1AA 2HRRA 3REQA 3ILSA 3O92A 4PAQA 3CCSV 3S55A 2ODWA 4KDCA 5JLJA 1BCRB 4X00A 1U6IA 1MR3F 3V4RA 3AONB 4FZ1A 4I7ZB 2PL3A 3OJOA 1S8AA 2CCKA 3JAMN 2AOUB 1XQXA 2VTBB 1YB2A 2G71A 1VXOA 2V8BA 5ALUA 2WBLC 1GN9A 1GNQA 1JQLB 1ESMA 2X8LA 1POWA 3OTIA 1OTXA 2WYOA 4AY6A 2RHLA 5JAQA 2YXLA 1NYLA 1M74A 1O95D 3H2ZA 1ZWKA 1TF5A 1XJQA 3CEJA 1QH9A 4WECA 5EBLC 1JTVA 3VO8A 2NO6A 2C5GA 3KKPA 4RANA 5LQSA 1WTAA 2BR3A 4CH5A 4CCWA 1GNPA 1NRWA 3IP3A 2Q7OE 3QXGA 1CZKA 2NP6A 3DOOA 5FPTA 4LV6A 5FPRA 2QV7A 4XIJA 5HK9A 4YP9A 3UMSA 1TM2A 2C4WA 2QYSA 4GNRA 5DZSA 3R7BA 2HA7A 2PGJA 3E3AA 3MCWA 3BMNB 2NSLA 2PPLA 2W71A 1BL8A 3N4ZA 2NO7A 1SKMA 1JSZA 4AJLA 2V1DA 3CNNA 4UTPA 2VP9A 5BWLA 1L8XA 4I1UA 4S12A 4UCTA 4MVXA 3DZHA 2V7BA 1F4MA 2UYNB 4U7WA 3HLTA 3ZR4B 3V7YA 2ADQB 2P06A 4V0KA 1P1RA 4ZHYB 1YJ8A 3H8SA 3OJEA 3UVEA 4B4OA 1TUEA 4YP1A 4LYHA 1PYDA 2P0YA 1G8HA 1R5BA 1X39A 1PT7A 4B4KA 2Q0OC 4EJSA 5BVGA 1RXUA 3V1UA 2VWGA 1GARA 5ALIA 2NO9A 1O89A 2AOTA 1QH1B 3JQQA 2XNDG 2CE7A 4X6UA 5B1IA 3CP1A 3PWSA 3VISA 3U62A 3OT5A 4PI2A 3NRJA 4YAOA 3W7BA 3RWMB 4KNWA 3BTOA 3QFRA 1UAGA 2I2XB 3VPGA 1WN7A 5I7OA 1M6VB 3GGSA 3I3FA 2XWSA 5FNVB 4M6WB 5AK3A 3ROZA 1FXSA 1AR4A 1FLDA 2HN9A 2X40A 1YOBA 3CW2A 5IM4A 4QBKA 1G20A 4TXNA 3QVUA 4ARBA 4EVIA 4JXXA 1LLFA 1HI9A 5IPFA 2B7BA 3G7SA 1JZSA 1ECGA 4JFRA 4LY9A 4XH9B 3R9KA 2CDAA 1GKLA 5ILQA 3E48A 3CN7A 3MYYA 3DL4A 3EBOA 4M99A 2CDNA 3UMVA 1W2GA 3CPWF 1SBTA 3KO8A 2P8SA 1JFRA 4MVJP 4RL6A 1SRRA 5K0TA 5BWCA 3DEHA 4JLSA 5PGMA 3KLPX 1IB6A 4KWTA 1D9ZA 4CG1A 2ONYA 1TZCA 1JHQA 3PEYA 2UYNA 3RANA 1HRKA 3VR5D 1CRZA 4J49A 3CUUA 1RXEA 1FNCA 1YZUA 3EFEA 1BGVA 4CM7A 4D3SA 3Q8MA 3C43A 1DLIA 3AKCA 3IMCA 3A1FA 1YQGA 2VJDA 1E4OA 3NAGA 3UXYA 1A9TA 1SA0A 2GD1O 1NZJA 1G41A 2JFHA 4JYAB 2VH5R 1L8QA 4S1VA 3OFNG 2HXGA 4RIFA 4CW7A 1E2FA 2JFNA 3GRYA 1JPJA 3OSZA 4UTZA 3MK31 3TTYA 4M1TA 2CJWB 2P2ZA 1VHAA 2TMGA 5A2QN 2CVQA 2FFBA 3NNSA 1GAWA 1EVJA 2FPWA 2NUBA 1MRZA 3EPPA 4I2VA 4KO2S 1CJTC 1JHZA 1BYUA 2NQTA 4JD5A 4LHEA 1NUHA 2BFCA 2QQGA 4QE7A 2C99A 2G1UA 3WL7A 4JYYA 2JDID 4XQEA 1U63A 1FSZA 1RDFA 1ZD9A 1GVHA 1OX4A 4Y0NA 2QUHA 1P19A 2AC4A 2GZLA 2WTMA 4V38A 2I4RA 4BP1A 5IAAA 1D7OA 2V7TA 2GTIA 1VA4A 1CE8B 2YEVA 2PHNA 1BKYA 3BWEA 4OYHA 3W8FA 3WYBA 3IR7A 1EK2A 4UZEA 1W0KA 1XHFA 1AKVA 1R9NA 5EXSA 3F6PA 2RHJA 1S2DA 4MB6A 1KJJA 2P41A 4R1MA 1F4LA 1RP7A 1BFKA 3TD6A 1HE4A 4R7GA 3BN3A 2HJDA 3FUCA 4GQIA 5FWYA 3FF1A 1B16A 5IBCA 1HTTA 1CLEA 3F6MA 4X71A 1KY4A 4B80A 4F5YA 1RBQA 2OTMA 5FBHA 1NVTA 1DX6A 5GVSA 4UU0A 2WM9B 1HQKA 4V02A 5AM1A 4D0NA 2XCTB 4HZ3A 4MQUA 3UJ7A 4KU4A 1ZMTA 2Q45A 4PYNA 4D8UA 4RA6A 4EFLA 4DJDC 3CZ9A 1HFKA 1SWVA 1FSFA 2JA1A 3PQ4A 4CU2A 4YRZA 5HGXA 1F9EA 1ZW6A 4RL4A 1GKIA 3LDFA 1J7KA 5H5NA 2WVAA 1M7BA 3OX4A 4J7JA 5HIJA 4A8HA 4I0WB 3L7OA 2NU8B 3GVCA 4GBMA 2H2AA 4IY1A 4KW7A 4M1EA 1FSSA 4OK5A 1U3UA 3R5XA 1OQAA 4F46A 4NOLA 4YRQA 1YT5A 3LL7A 2YW9A 4JB3A 3A8TA 3T7IA 1SQVH 2ZIZA 2UYOA 4MPTA 2BF7A 3WA6A 4A73A 7MDHA 4MCJA 3L9DA 2QTPA 1EA7A 4OKIA 4C0BA 1A8SA 3KXDA 4O5OA 4B47A 1Z83A 2OECA 4JJ6A 3I4CA 3OUTA 4PGAA 4EPVA 5CFQA 4TQAA 4DMRA 2I6XA 4HUJA 1CY0A 5EMMA 5CUQA 1B8PA 3W1EA 4YBRA 1CUGA 5A6SA 2F90A 2VCEA 5DLQC 4DQKA 3V7EA 2XA9A 5AM4A 1I94B 2V7UA 2VWQA 1JEDA 2VZEA 3BPSA 3CNHA 4KACA 4YAWA 4DIBA 2AKEA 3BEOA 3ETHA 4QOSA 2O5CA 1N3IA 3CCRF 1E7WA 5BUQA 3TOSA 1DIRA 1REQB 2QNBA 3UXHA 1NVEA 4AULA 1TJ5A 3EVGA 4B3JA 1E79G 5DECA 4CH4A 1QIMA 2ARKA 2VF5X 3IDAA 4MB0A 1CRWG 5JR3A 1B93A 2AW5A 1P7YA 3IIMA 1V6AA 3L77A 3N87A 5CDTA 2BGMA 4DB2A 1YJCA 4MW6A 4YV2A 4OPHA 3J7TA 3IHTA 4M3NA 1N36B 2PSDA 2WF7A 1QK3A 2BGLA 4K86A 4NJOA 3ZCUA 1N8SA 1MPTA 3BF8A 2EP5A 1TB4A 2B4AA 2XB6A 2HMYB 4PRLA 1GGEA 2ZJ1A 4XR9A 1U3GA 3UBTA 4PIPA 5DGTA 4DG5A 3QEAZ 2WU1A 2XASA 3KOWA 2ZR8A 2QTAA 5FJIA 1V2HE 2GRUA 5IZCA 5C8ZA 1KI8A 4XX0A 1SPBS 3AESB 1DIOB 2IHVA 1CJUC 3GFPA 1RYFA 2MSEB 1I51A 1X1DA 3KG2A 3SYAA 4L4ZA 2UXCB 1PL8A 2R65A 2D54A 2C97A 3SD7A 1RM5A 5MFZA 4TV8B 1F2TB 1GFIA 4FW9A 4MW2A 4B3FX 1FFCA 4BZZA 4EGCB 4CHGA 1JE1A 2VSNA 3AG1C 3Q11A 3TRDA 2UYQA 2V45A 3DLTA 1NXPA 3WNVA 4GVPA 2DQYA 2PQ6A 4GOXA 4IX9A 1IXKA 3WYDA 2AK2A 2HMWA 2JAWA 3BRCA 2W42A 4AY5A 4X88A 2X0NA 1WW3A 2YJZA 3LY5A 2EJ7A 2J3JA 2CFIA 2WV9A 1G19A 2FW6A 3H7AA 2ZINA 1BQZA 2E48A 3Q9SA 4R2WA 2UXCO 1IDSA 1YEWA 4Z0NA 4V3CA 3TXQA 4C0WA 4EDHA 3MGBA 2C95A 1ZK1A 4WW0A 1VE9A 2F17A 2NIPA 3KJKA 3AYXB 3DSRA 4MWTA 5FBKA 3CT4A 5B57C 1QVVA 3VHXB 5HQ3A 4FKBA 1PLLA 1PZNA 4G8JA 4KBFA 2E4ZA 4L4UA 4RC9A 5K3BA 2REOA 3ITEA 3JWEA 5A5VA 4W5RA 3ZDDA 2DCMA 3BG5A 2X9LA 1MCZA 2PVPA 2MSLA 1G5QA 2QJWA 2HP0A 2QLJA 2XGMA 2JK5C 1RWBA 2YMLA 2Z2JA 3GBSA 3L6UA 4HRYA 2QN3A 1OWLA 3KSMA 1Q74A 3DT8A 1CJBA 3GAAA 2Q4RA 3N86A 4O29A 3E5HA 3U1BA 1LSUA 2XXJA 1A5ZA 2B4TO 1D4FA 3FOBA 2WJVA 1GQSA 4NTYA 1L5QA 1VCHA 2MYNA 3AB7A 3SJUA 3ZTYA 4A0RA 3VO2A 1ZX3A 1MOPA 1QHXA 2DBZA 1BGXT 4LJ9A 1GGMA 4WKGA 1Z63A 1VH8A 1PFGA 1SAYA 1E8DA 1R4MA 5FPPA 3E0XA 4R6XA 1O2DA 5E9WA 4MRMB 1OF1A 1FBTA 1DWOA 1L7DA 3ANXA 3H04A 3N0RA 4O59O 4Q4HB 3QLEA 4RS4A 3OKCA 3URKA 4E1AA 3L8FA 4FNMA 2LWIA 5CGZA 4EHLA 5J47A 3ZRWB 3AFIA 3FZQA 1J22A 4Q9JA 3GLHE 1R74A 5FFMA 4UTVA 3ZV4A 1ZBQA 3R6GA 1NDQA 3AF5A 4HAOA 4MI9A 2OLJA 3ABSB 5E79Z 1N7IA 3C9TA 1QV6A 1UPFA 2LR0A 2P2SA 3IX7A 3NHSA 3OE7D 5DMHA 3RN4A 2D5AA 2H31A 2DWUA 3PEFA 3R76A 5H4HA 4IKEA 4D80A 5EJGA 5IJXA 5IKPA 1ZONA 3IE1A 3ASYA 3NTUA 1A50B 3IVXA 2H94A 1NXSA 1KMQA 3IJ5A 4C3UA 4X6LA 3ZWQA 1ECBA 2G70A 1EK0A 2KI5A 4U4AA 3UK7A 2EJUA 3JD2A 3EBLA 1Z5VA 3OWXA 4G0UA 3HM9A 1ICIA 1NONA 3PVZA 4LWSB 5FAXA 4TSFA 5TMEA 3G8AA 4EJFA 1EFTA 2RGNA 4PHCA 4Q4LA 1II8A 1Y8RA 1RD4A 5TEVA 3OF3A 3UC5A 3GRKA 4G25A 1ILEA 2GAFA 3L8DA 2OO7A 1E60A 1S89A 4LDJA 4KQWA 4RABA 2HKIA 3OSUA 4M98A 3M9LA 1UM9B 2NU7B 4U0JA 1V71A 2ZE5A 5I4KA 3EZ7A 5I8ZA 5IVHA 5C8YF 1JF8A 3WB2A 4FLTA 2EKLA 2CZCA 2EWWA 3L7NA 3L7JA 2RJZA 4L74A 4P7KA 5C32A 1SBNE 2G9VA 1TECE 4GC9A 2FKNA 4PTZA 1LF0A 3ZLUA 4FONA 1K4MA 3AERA 4QHTA 2GESA 5YASA 3LM8A 4GXNA 5FPHA 5KU7A 1GG2A 1VQKV 1XQ9A 3QVMA 4MH0R 4QXQA 4CU5A 3IR9A 4DV5O 4KL1A 2ZE6A 4X1KB 3OFKA 4OFBA 1EDEA 2E18A 3MTEA 3ZBHA 1W4CA 1SWWA 2MJLA 3RBXA 4F06A 1S5PA 1TADA 3OIGA 1RKVA 4QHSA 4DV7B 1TAHA 3ES9A 1HL7A 1KDRA 1QHHA 3H2GA 1XL1A 4EG4A 2B92A 3CH6A 5A9SA 2WUVA 2Y6UA 4QPKA 1QWOA 3E8MA 3IFSA 2W0SA 2BZSA 4V24A 5F73A 1Q17A 2P79A 2SHKA 5IT9N 1AZWA 1T6YA 1OTHA 2BCEA 3CSDA 3JWPA 1RYDA 1WRBA 5DBIA 5T57A 4WCDA 5DKFA 1GPWB 2NVOA 4Z0TA 1J95A 1TVMA 4Q9HA 5AXBA 1M2HA 1YJ9V 2VJQA 3NT4A 4FQ7A 4AJKA 3HTXA 1TUEB 4MZDA 1U9IC 1WA5A 5AI4A 2EBFX 1YI8A 2VYNA 2FP4A 3SR0A 2UV8A 4B3MO 4QT0A 2HZBA 4BZPA 1Y6JA 1MN6A 3DO8A 3N6VA 2OHWA 3IT0A 4J75A 3WMGA 2FFAA 2R70A 3ZHUA 1VK3A 3A7DA 4PVCA 3TMKA 1E2PA 1P9WA 2QTLA 3FCUB 4JLDA 3QXHA 2XF2A 4PDVA 1BE8A 2GPAA 4YQFA 2IX3A 1MTOA 2IJIA 3HJGA 3OOJA 3K5LA 1BIFA 2V6BA 3G0GA 2ZJAA 2JB9A 4JI3O 3QK7A 5JAIA 1NBEA 1YVEI 5CCDA 5CP8A 5AO9A 2KG7A 3EGOA 5ANRB 3SJBC 1JJAA 4HUQA 3WX0A 1AJEA 4HQNA 4M53A 1E5XA 1W85A 4M60A 5EBMC 3HDHA 4OK3A 1ENOA 3DLIA 1IMJA 2C3UA 3I1JA 1Z4IA 3M9WA 4RSMA 1WU7A 2TSYB 2ISQA 3D8UA 4GDMA 3U4HA 4D8VA 4JR1A 4ID9A 3I6BA 3Q9NA 4DSTA 2X9GA 4ZI7B 2YWGA 1UEXC 4UARA 3GCZA 3KZ1E 4YCLA 5ALKA 1MLDA 3ASNC 3GQVA 1XBLA 1H6DA 1CUDA 3KHSA 2ADMA 3UXMA 4BASA 2H51A 4XIGS 4C4ZA 1N5RA 4J43A 1MVLA 1ULUA 3SZ3A 1PLJA 1UADA 3SIPA 3GJ0A 3G0HA 3RHTA 1E2DA 4W7SA 1RHQA 1X70A 5SYMA 4JBIA 1EDDA 5KBYA 4BE9A 2QRQA 1D2RA 2Z57A 2PGAA 2NXNA 3E23A 4RUFA 5KYVA 4ZKDA 1P5RA 1PYOA 1L4BA 1HY3A 5FA8A 3DJYA 2A0UA 3OVMA 4CT4B 2XTZA 3N74A 5GV8A 1PUIA 3VR2A 2D2XA 1JG3A 3A11A 3DC6A 1GPKA 2ZIMA 3SBEA 3S81A 4X1KA 1XTVA 4JHLA 1R9GA 4JI8O 4BFVA 4PV1B 3MAGA 4KMOA 1QAMA 3PL5A 3SIRA 2WAAA 2B1JA 4FZVA 4WVFA 4ESHA 4EKYA 3CVWA 3FROA 1ULZA 4ZYVA 2O7QA 1C1YA 3L04A 3UB4A 4WDQA 4LG1A 2UVDA 3C16C 4LCEA 3V8PA 5GIPE 2E6KA 1ZGBA 1G8AA 2OV2A 4JC5A 1VQKF 3I56F 2BCJQ 4MKZA 4P4GA 3V1NA 4MPDA 2A1TS 2C7GA 1TTHA 3ZNOA 3NHZA 4YRAA 1H2WA 3P0HA 4QJIA 3M84A 1ZOPA 1FDTA 2GXQA 2CHSA 1LX6A 2FDXA 2HBQA 2ZNJA 3OMNB 2GEFA 2Q29A 3FY4A 3I2FA 3K2IA 3QUTA 4J0IA 2QWXA 4JEIA 4CKCA 4KCGA 2YC2C 3SX4A 5HRAA 2L6LA 2XQVA 1KOFA 1OVGA 1QYVA 3LDHA 1PK9A 3VPSA 3D8SA 1L5MA 2H7XA 2GHTA 2Y93A 1EXDA 1PNKA 1X7OA 1IEXA 3NPMA 1HC7A 3FDXA 1QUEA 1I3LA 3X0DA 1ZI9A 4MYTA 3MWEA 3QO8A 1IY1A 2OXTA 4AMVA 4B6RA 2JI7A 3FNEA 4DLXA 4RK6A 4BO9A 4QYMA 3UOWA 3GG9A 1P4HA 1PFKA 1W29A 1WSWA 2GTHA 2I76A 2OMKA 3PV0A 3ACDA 5TPWB 3LH5A 4F4FA 3P32A 1XRJA 1RXCA 1G6HA 4M0UA 1ISHA 3JQ6A 3MQFA 5F23A 4RH3A 4KSBA 4A7PA 1H42A 2Z4TA 1V45E 3L8YA 4NWOB 2Q6IA 1QAOA 4NABA 3TPZA 2UZAA 3KQLA 3O84A 1DTWA 5GW7A 5BNTA 2ZM6B 5EC1C 1Y80A 2YI8A 2PXHA 2YV2A 1YB6A 3VNBA 5EGNA 5JLAA 1JLLA 2DTXA 3KKZA 1T8RA 4R5HA 1GPDG 5AJXA 4C4XA 4HTFA 2QP9X 1A77A 2OVFA 2VRNA 2WWHA 3ZN0A 2FUNB 4UEOA 4YLGA 5K3FB 4EB8A 1GRVA 1LC0A 1WCV1 5GPBA 2YXYA 2RC6A 5LZ2A 1RQPA 1RQRA 2ID8A 2P9YA 3KUUA 3ONEA 3DFFA 5AXCA 1ENYA 4Z51A 4EP1A 1H6AA 4EQZA 2GN1A 1JSXA 1LB1B 1D4AA 2FWAA 3C3JA 5EJIA 3BXXA 1K27A 4ZA2A 3F1KA 4K46A 4BT5A 2XYPA 1Y6FA 5G4VC 3JARB 1UJCA 5LUAA 1LNZA 4XGKA 1P29A 2WICA 2X5JO 4LI3X 2OPHA 5AJHA 5MDHA 1YL6A 2AR0A 1RLOA 2Y68A 2D0DA 4TRMA 4RESA 4XJSA 3HVIA 5D00A 4EB3A 4G1UC 4WJKB 4MTGA 3A6KA 4CCSA 5AUPB 4ZYWA 2H4YA 2QEXF 3D54D 5A9TA 2HREA 3STUA 3WWZA 4ZIBA 3U09A 3O73A 5K0FA 3ZRXA 4DM4A 4ZTUB 2VHZA 2ZRMA 3OIWA 2J4DA 3KDPA 2XEXA 4XGRA 5FBZA 3RHSA 2H92A 1GGFA 2DWPA 1W0KG 1G8MA 1TEXA 2JGJA 2VJMB 2ZWAA 4H17A 3VBCA 4YRCA 2VIIA 2AFVA 2QT1A 4PAWA 2CF6A 2R84A 3HDTA 4AD8A 2XKAA 3DDUA 4J7KA 4WVLA 2LD4A 3UJ3X 4RM2A 2VRCD 2VDWA 4R8SA 2Z2XA 3RUEA 3PQ5A 2O0LA 1EZJA 3RK4A 3C8LA 1SQQH 3NMUC 2H1SA 1Q95A 1Q15A 3HDQA 4XRRA 1VG8A 1VKNA 3VI6A 2QEQA 3FB6C 121PA 2IEGA 3OE4A 1DS6A 2VN8A 3M3HA 3T1NA 1T4GA 1MA3A 2GZAA 1XQVA 4YHHB 1L0BA 3MWJA 2NUTB 4L85A 3HKBB 1RYEA 3TXSA 1AGYA 1GRRA 3OTOO 1K8ZB 2P5TB 2R6DA 2VHVA 2XQJA 4BLPA 8LDHA 3RC9A 1FJ2A 3UKJA 4BW9A 3SKVA 4YS6A 2WHYA 5LP6C 3JAMA 3HLKA 3BXOA 3LC7O 3K6JA 3LJKA 3CE6A 4G4IA 3AW9A 2PGNA 3QFHA 5DGIA 2IOHA 4PFJA 4B4UA 3CVYA 3OZIA 1YRYE 5I7HA 1J0BA 1G1MA 4DMLA 3WDKA 1SBCA 4L9WA 3K0CC 4MJ7A 4CKWB 3PGA1 1Y1SA 4P80A 1FXKA 2OYQA 3UOGA 1ZXBA 5DX0A 1HM5A 3MRSA 2V65A 1R0KA 3ESZA 1M5UA 4GM1A 4NR0A 3NASA 2JVDA 4Q7JB 4Y7DA 4UXHA 1VE1A 1M2WA 5IHXA 1YQDA 2FN3A 2GD0A 2C83A 1L9XA 2PZAA 1CEXA 1JPXA 4XE5A 3CD6F 3DM5A 5CA0F 5EXXA 1I3MA 2KG7B 4LHZA 3GRCA 2YN0A 5DOVA 3TXAA 3I5XA 1MB0A 3CLTD 5AKJA 3WYAA 3UAOA 6GPBA 1XZDA 1GM8A 5KWEA 5JPDA 4BLUA 1ESNA 1SKQA 3OJCA 2C92A 2YWHA 3VXKA 4OSOA 4PG7A 2JAPA 5IN4A 2ZITA 1D3AA 4Q3OA 5EQTA 4FSHA 4QTUB 4YPVA 3UHJA 1DG9A 1A4IA 3I6IA 1P3DA 3LWBA 5J43A 4JI8B 3DMYA 2NZXA 3F3SA 4RWUA 3FD6A 1CLIA 1K7SN 2PZMA 3ZE8A 2PJRA 3FYUA 4B7XA 1YQXA 2O07A 1KTIA 4GR4A 1CR1A 1T15A 1VJ5A 1R8QA 1I30A 1YRHA 2H54A 2JJMA 4W6ZA 1KECA 4FFNA 3V5NA 3OCJA 5HQTA 1OJHA 1YL5A 2EC5A 4JUDX 2ET6A 1KJYA 2VDVE 2B4KA 1WDLA 3M2TA 1Y6ZA 3GC6A 4ECEA 1XJ0A 5KQPA 4FZ0A 1HQYE 3R3ZA 4C0HA 1Q22A 5HIAA 5I7RA 1NX9A 3NIGB 4NZYA 1ZDMA 2J3EA 3V80A 4NOKA 4B3RO 1Z4MA 3I58A 3SVLA 2DHEA 2GEJA 3L79A 1NE2A 1UCFA 2FA9A 2J6BA 4P7FA 3L7AA 3TUJC 1H1LA 1QHFA 2CF5A 1NRJB 1NSFA 3E3MA 4GI1A 4QDUA 3DDNA 3MHHC 4JI1O 1P6QA 3KKLA 4LYDA 5ERXA 2GZDA 2ONKA 1F8UA 2FSVA 2QR3A 4M76B 2ODAA 4IIGA 4YROA 3AF1A 5EA2A 2IYZA 4EH1A 1FFSA 2H2IA 5K0JA 1OV9A 3Q8XB 4I0XA 4DR6B 4IUCS 3W5UA 1ORQC 1ZH6A 2FZVA 2VQEB 1LSSA 3FJ1A 2CVLA 2B2NA 2IPMA 4OUDA 2QRPA 2PWYA 3H99A 4JDPA 4KVAA 3USCS 4C0QC 1H2AS 2IW3A 2OM6A 5AM0A 4GGMX 4KPYA 2PLWA 3DMGA 4D3YA 3GWGA 1SVOA 2Q6TA 4NNPA 3H42B 1DELA 5FCDA 1O8BA 2HFKA 1WUKS 2B25A 3AR7A 1A7AA 3WBBA 1GUYA 1UKEA 1JX9A 1CNFA 1N78A 1HR0B 3EAFA 5CW1A 5E0KB 5KPJA 3KKEA 4MUNA 1EUQA 3I0NA 4G2NA 1BMDA 4B4DA 4LDNA 2HCFA 4I4TB 1D5WA 4ID3A 1NJGA 3BEDA 3BE6A 4G5GA 3L8CA 2YZ2A 1Q3EA 2ZBFA 1I5XA 4P4SA 3LLUA 4WXHA 4KRYA 1MOFA 4MUMA 3ZTWA 9ATCA 1N36O 3IE0A 1D5AA 1T2CA 3PHCA 3WXBA 1GEEA 5FWNA 1J6UA 2WYIA 4NXNO 3A2NA 4QO8A 1PI3A 3ESYA 1E3LA 2R9AA 2H1VA 3LX8A 1RAEA 4F8JA 1VQ5V 3GA5A 2PWAA 2XIQA 3RIMA 4BCDA 5CYPA 1JTFA 1T9HA 4TXHA 2EF0A 3CMEV 3VOUA 4NCBA 3OGCC 1H2NA 2YZGA 1DOAA 3CKMA 3AL0C 3GJSA 3BKWA 5HIIA 1KIMA 4DIFA 3VNSA 1JCHA 2ZTSA 1CETA 5FTKA 1NP7A 1UBTS 3TLEA 4ZXPA 4BKUA 2CUGA 3F67A 1U1EA 4QBHA 2I4TA 3RU2A 5JY6A 1ZIXA 1RLMA 4XWOA 1M7GA 3NV9A 4Z7NB 1RJ9A 2HT1A 3MMSA 1PO7A 1LUVA 4CWAA 5ADUS 4I99A 5EL0A 3BFJA 3RI3A 2F4NA 2CT8A 4LVUA 1KR5A 3NRCA 3B7WA 1IDOA 4Q9IA 2NZ2A 2VAXA 3MLAA 4KRGA 5AJYA 3FFAA 3WJ7A 1R0YA 2G9UA 5LMNB 1F20A 3UANA 1GG9A 1X1RA 3C5VA 5M5BA 1OUMA 3DDSA 1RC8A 3O93A 1IYZA 3TNJA 3ANTA 1CULC 1HQCA 2BZGA 2XZLA 4WFAV 3ABIA 2JI4A 1JVNA 2OV3A 3C3BA 2LE0A 2REQB 2PMPA 3NZEA 4GXRA 4B73A 3BXHA 1YH3A 4D81A 2EIMB 3E7XA 3C3PA 1RZ3A 2GD2A 3IAM6 4IOJA 4WPGA 3RTBA 2CMFA 2GKSA 4OJTA 2FOXA 4TYNA 1YA6A 1X7XA 3AFHA 2CNBA 4G0WA 5EB0A 3EXFB 3PUXA 1KETA 3KFXA 4E4YA 1BQ3A 1MABB 2I80A 4IVRA 1ZGGA 2QAGC 3KJFA 4CLOB 2OEPA 3ZCQA 1U3DA 1FRQA 2QNIA 4HDKA 4DYLA 1C4XA 1HEYA 4YJGB 3QU5A 2H1RA 4AZ0B 5JATA 2AZMA 1I1QB 1BQ0A 1N0IA 1NJ5A 2FWJA 5JMWA 3R3XA 3VPBA 2PS1A 2GX6A 3TTTA 4X60A 3FMGA 2Y1LA 4BKMA 2P4KA 4BW5A 4IHJF 1Y6QA 4TGLA 1L7XA 2PD4A 4CMAA 4D41A 2QLTA 4JI7B 3A7EA 3NKFA 1IUPA 1Z17A 2HF8A 1GR0A 2W5UA 4HLDA 1J0AA 2COEA 4P7JA 3T5BA 4S2UA 1Y9EA 5HKBA 1XG5A 2YHAA 4AILC 4O2BF 4W63A 2YASA 4OXXA 4FILA 3D6NB 5H70A 1UPCA 4HGOA 1TIPA 4LDQA 1YF2A 1X92A 4HAXA 3WJ2A 5HNKA 5KSPA 2GTPA 3OHPA 4F0JA 4II3A 2A5GA 2V7XA 2E4VA 4J41A 1W8IA 2ZT6A 3KOOA 4G89A 3ABOB 1E1DA 5HKKA 1E2JA 4BLRA 5LLTA 2FPGB 1G63A 3ZXXA 2GHYA 1HLDA 2FUKA 2QX7A 4FFRA 4OI4A 4WCEV 4RPKA 3FJOA 3QVWA 2WU4A 4D8TA 5HKOA 3K6SB 5HIKA 1L4EA 2JLQA 3UB2A 1Q0RA 1YU9A 2XODA 2G80A 2HJSA 2JA2A 3WLJA 4EW1A 3S2ZA 2WU3A 5JAZA 1EGAA 2PKCA 4FD2A 1OIXA 2BGNA 1T9CA 5EGSA 4AKGA 1DGSA 4O4IB 3UJNA 1DKQA 2GUZB 2YHSA 5BT9A 2VPTA 4UCWA 4WXMA 3VR5H 1M1KH 3E9QA 1SUEA 3PE4A 2AE1A 1REQA 3RT7A 5TJ9A 1S7GA 4W8OA 3MN1A 5CYOA 1ECPA 1JJ2F 4NE2A 4NWIA 1QOQB 3RV3A 4G27B 2FZWA 2V7VA 3W2FA 4N6NA 3L05A 1CY7A 1NN0A 2FVYA 2WMNB 5BN4A 4AU1A 3I1YA 2IXBA 3QUWA 2OGUA 3CLRC 4FDAA 3ZOKA 3HB1A 2XCIA 3QEOA 5BNWA 4FIZA 2J3HA 1PW7A 1U98A 2P9FA 5JV5A 1QPZA 1VLJA 4ZI5A 3JPYA 3KZXA 3TM4A 1PF7E 4BDSA 1XDGA 5JASA 2BHRA 3BFPA 1U8YA 2ZIWB 4QATA 1VSUA 2CLLB 4UOZA 4MUYA 2AR7A 3GJQA 1ZHFA 1J8MF 1KMMA 3B2NA 4KR6A 2UUCB 1X1BA 3N05A 4BLWA 5HWSA 1YGPA 3EH2A 2D1RA 5DEDA 4JV5O 4Q34A 2VHTA 1TOAA 1DC4A 4QD3A 4RF4A 3UKOA 3IAM1 4DILA 2B69A 2ZRDA 1WUJS 1DEAA 3U3OA 2MSDB 3NHLA 1AZTA 1M76A 3LCMA 2CC2A 5K8LA 1B0PA 4R8VA 2EIMC 1Y8CA 3GB7C 2IXTA 2OXFA 2PH5A 5EJ5A 3U44A 4KUMA 3UA3A 1YB7A 4YJKA 3OZRA 3E81A 3PR2B 1XRQA 4Z9FA 1JDUA 4H6XA 1ZITA 2MMGA 1ZVJA 3AI3A 2O8DB 1X1CA 1P1HA 4KN5A 3CMAF 2ZI5A 1YCHA 3TLBA 2JS5A 5DNUA 1Q14A 5IY5C 3C8DA 1TZMA 5EZYB 1GZVA 3GZNA 1XVUA 2P9TA 3LHIA 4KQHA 4NZNA 1UWLA 2Q5CA 1A32A 2FR8C 2DSTA 3QEMB 4CXMA 1M1UA 1EE2A 4YI3A 2WF8A 3H2KA 3HSKA 4ZXFA 1A9PA 5E6UA 5GVRA 2A5JA 2B3TA 1TMOA 4WV3A 1C1XB 1N9GB 2QM3A 2YYEA 5G4KA 3VPCA 2IP2A 3ELDA 1PNOA 2YZNA 5ICFA 4I55B 4ZT4A 4DR7O 3Q7PA 1HYEA 1N0VC 2E4XA 3HV2A 3A27A 1Y4MA 1JDZA 2C0QA 3ESXA 3EULA 3FH0A 4CIVA 5BNIA 5K0NA 1XKLA 5CBPA 2IY9A 4O4LA 4IVPA 4GAEA 4ZKIA 4PVDA 2VGNA 3IUEA 3BIFA 4J0CA 2EKBA 1E99A 1W52X 2I22A 3MXOA 2Q7HA 1G16A 1TIBA 3OZEA 5ESWA 5FOQA 2DQ3A 3HKEA 1OASA 2A9PA 1CHNA 1V5IA 4AZSA 3OZWA 4RD0A 2Q3LA 5SZKB 3N58A 2C7VA 2ETVA 2C04A 4B5KA 2CNWD 3HJHA 3TRKA 2WSYB 3E35A 3STZC 3PXCX 1J20A 4YMSA 4DADA 1SHZA 3WGKA 2FZGA 1YU6A 3E1KA 1XDUA 2I87A 4QEZA 5EKUA 1QS0B 1XPUA 1RC1A 4Q9DA 2IV2X 1C9KA 3M1XA 1DFGA 2R9VA 4YJFA 3S1LA 5EC2C 4EPTA 1S96A 5FTLA 1H22A 2Q3DA 4QE3A 5AVKA 3TW0A 1V7QA 4OXSA 1QFXA 2B6HA 3IALA 5AI6A 7YASA 3HZZA 3OBWA 1YIJF 2J30A 1W5AA 1C7FA 2ZJZA 1XZCA 3WNCA 3U3KA 4Q7EA 4ZTZB 3CKLA 1AH2A 3UO8B 2W8BC 4JN6B 2QS9A 2WF5A 2X19A 1WWKA 3LC1O 3OJLA 4QXRA 3VR4A 4AFNA 2CLOB 1HT0A 3I9LA 3PQFA 3B6MA 1UXOA 3RSLA 1MFPA 3S2IA 4C1NA 3LY7A 5DNCA 3WRXA 4DNOA 2Q2WA 3DCNA 3KQTA 2VFAA 1SB8A 1B15A 5J2UA 1D1PA 1MKYA 3COSA 3DE5X 4FJ2A 5AIAA 3TRFA 1ID1A 4DDHA 2YICA 1EEXB 2WT4A 4NS4A 1XGKA 2XE4A 1OZGA 3SHTA 5LP1A 3O7WA 5HCUA 4ES6A 1U5CA 5JD3A 1K3TA 3QBJA 3PHJA 1KZYC 2AC7A 1TF2A 1DX4A 2MINB 4WK4B 4S1OA 4YRBA 1EK1A 3HFRA 1RPAA 5BR1A 4NCAA 1WZNA 4ECAA 1SZPA 5F3RA 4OLHA 2WTEA 3WB9A 1Q8RA 1WVGA 4EVSA 2LZ0A 4OX9Y 1ROPA 3MJRA 5KQSA 3M0EA 2WZQA 2WHPB 1NHWA 4E7OA 2W2LA 4US2R 3VKGA 1CY8A 1JDTA 1YZKA 2B99A 3EGXA 3UO3A 3QVTA 4LQDA 5BN5B 4GXQA 3T34A 4KN9S 1TTQB 3AUAA 4GLOA 3OIUA 4KRXA 4RTQA 3V4PB 3I9V6 3F71A 3P19A 3G4SV 2AFIE 4LJSA 2EW8A 2GEBA 3WSVA 1XEFA 3BILA 5L45A 3CF0A 3ID6C 1JIVA 1ZK4A 3NJ8A 1KVTA 1QH8A 2J85A 1HE8B 3MCZA 4WNCA 4FFOA 3T6KA 1ABBA 3PR3A 4O1HA 1BHJA 2MW2B 4GQBA 2HK7A 1C7EA 2H08A 2P4VA 1Q81H 3JZAA 2IDKA 3HCNA 4FDVA 4AJPA 1TDJA 4BO1A 2QU8A 4C81A 3ZVMA 1JIUA 4W1QA 2P6RA 3FRIA 1LY1A 3LG2A 4P4NA 4XTCS 3QVLA 1TF7A 2UUOA 3X2SA 2GBIA 3DGFC 4FVMA 4K2AA 1M90W 3GWKC 3CJHB 2R87A 2RAPA 3RC3A 1KKDA 2PU7A 4IIJB 4QM6A 1V35A 1X80A 4UAJA 5ENVA 2OCCC 2J9FB 2R8PA 3LLCA 4IV0A 3RRYA 1MORA 4ETNA 1SXQA 2BH2A 2HD4A 4TMVA 2NU6A 1SVMA 2ASVA 3CMMA 1IM5A 1W0KD 2Y71A 2POQX 3OOHA 4TT8A 5B2FA 3JYQA 4ZO9A 5CCXA 2AZ2A 9MHTA 1IV2A 4UHHA 1GNRA 4YJHA 2QD1A 3TH5A 1C7IA 2ZQZA 5BV8A 1IJFA 3DBHB 3MS4A 2WIBA 3N0XA 3TAUA 3WK4A 1W36D 5DYNA 3B13B 3FKSA 3HFGA 3C3CA 3LLSA 5CPFA 4PDMA 1JHDA 4DOMA 3ZXYA 1XHOA 3IDFA 1G8SA 5HSGA 3O8QB 2I67A 4PLVA 3W9UA 1BHAA 2VOEA 4F91B 1N33O 5L3CA 4Q39A 3O26A 5DXJA 3NM4A 3KT8A 421PA 1NJIW 4LBWA 3TX6A 3QF4B 2OHJA 1THTA 2SECE 3KHTA 2P1ZA 3Q9UA 3P2OA 5DCYA 1IZ7A 4DEYA 4EEXA 3SFTA 4W5WA 1GSIA 1W5SA 1CJSA 2JGRA 3TM5A 1JQEA 1KH1A 1DUVG 1FFAA 3MTQA 3PDIB 4CIYA 4X93A 3RYCB 1XP8A 3NWPA 1GLGA 1PNRA 4P35A 2C84A 2IIVA 3RODA 3WLAA 1F8GA 4RLFA 2D5LA 4W1RA 4Y0AA 1UJ6A 1E6CA 3VU8A 4E5VA 4WFIA 3C5CA 3S99A 2GSWA 2AYYA 3Q3VA 4AN1A 4GW3A 1RXYA 4MAMA 3ABTA 1OC2A 4IJMA 3REFA 4FJCC 1WETA 2Q5QA 4LX0A 1L5OA 4XFJA 2F66C 4YMWA 1P2VA 3FCYA 1SK8A 3KQQA 4QGAA 2Q8VA 2GZHA 2HLDD 2R1VA 3NV7A 1B76A 4FMDF 1CRPA 3F6RA 3C70A 3FNIA 3NAQA 4ASUG 1T2AA 4BB6A 1CPYA 1LDEA 2WJAA 3D6MA 3GPBA 2LW7A 1IUNA 4MYCA 5IBRA 2QTHA 3AG5A 3SG0A 3T7AA 3H1BA 2DPLA 3DOEA 5M2QA 1Q5OA 1HE1C 1RKXA 3ESCA 1RWPA 3U7QA 1OBOA 3BK2A 4AY4A 2JJ2D 2CLDX 3PUVA 4JTAB 3RVKA 4Y2RA 3Q4HB 2Z9BA 2YWEA 4JY7A 1E89A 3JD1A 3ZLVA 3VYTC 2RCYA 3PDJA 4MQFA 2WT9A 2W8BA 2XV1A 2ACEA 1M0TA 2GJSA 3HU5A 5DLEA 4QGFA 3C97A 4E2YA 4G24A 4LC9A 1XEWX 3IT3A 5ECGC 4YRLA 1SKBA 1EJBA 1PJ4A 4BAZA 1NQ3A 5FV7A 4ALIA 2G76A 3R9XA 1RRCA 3FTFA 1QGYA 1XPJA 2P5OA 3TUZC 1PJCA 4YA6A 4B3MB 2GMWA 3IIKA 1FW6A 3ISJA 2ZM5A 4MKIA 4OHFA 3OLYA 3OMXA 3F6EX 5IF9A 3K92A 4M9XA 4MPRA 1CF9A 4XI9A 1YGYA 4MR8B 3PENA 4AW9A 3PWZA 4DMMA 4ZCTA 2KM1A 3JZDA 3FHTA 2GHQA 4YQYA 5A5DA 3PTAA 3RW0A 1SVLA 3C7KA 2CBXA 3DVLA 3K08A 4XCVA 3HXQA 4LKOA 1KO5A 4LYEA 4B3DA 4BB5A 3EXEB 1OA1A 3EY9A 3VO9A 4NC9A 3HXPA 2W2KB 4I19A 3FMPB 3T4PA 4AYXA 3OOYA 1N2EA 4NPAA 5ELXA 4GIBA 1M67A 2GBFA 2Q1WA 2VYVD 1RVV1 4H33A 2XT6A 5EHNA 5B1SA 1L5LA 1RWOA 4HPXB 1DBIA 2K2QB 4M9CA 4GX2A 1BXGB 5JDCA 3TEMA 1VQMF 2VS0A 3TFWA 2E9SA 2OM2A 1I5RA 1QCYA 1PPJH 2P2NA 3PT5A 4YFVA 2PGLA 1K9VF 4LFBB 3KJJA 4LYGA 2C5BA 2J6IA 5LDDC 3HR7A 3C6MA 1YDXA 4D9EA 3GJRA 4DUZO 1FEZA 4FEYA 5EEGA 3HP4A 3TBFA 3IPXA 1OWOA 1POXA 1KKCA 1NI4B 2BHTA 3ZCCA 5EP1A 2YJ6A 3HXKA 1LPPA 1I2DA 3BJZA 1Y7LA 3CBGA 4U7FA 3B3AA 4YT2A 3UCXA 3ZDRA 1ZESA 4IAOA 2F4VO 1K5GA 4Q93A 4CL8A 3RV4A 4N23A 2BTQB 2DPXA 1JU3A 3K5IA 1FS4A 3KAJA 1T0HB 3QY9A 3UTCA 4YV0A 1DKPA 4ZAYA 3ETJA 4A27A 4HPJB 5LZ4A 2DUJA 3DZFA 3ABKB 3NTQA 5JD4A 1FMCA 1QPGA 1UJNA 3S0HA 2W70A 4N21A 3PLAE 2NUAB 1F2VA 4QXOA 4BGIA 4HV4A 4G0VA 2W6ZA 1E6KA 4L8LA 3U11A 1DAPA 1MXFA 1DC3A 1GH6A 2BKVA 2VKTA 3KQPA 4YWHA 3U7RA 1F6BA 4C89A 2R44A 3GGGA 2WINI 1WZCA 3AUFA 5IXJA 1G8PA 1RACA 5KHHA 1V6SA 3NDIA 1ELOA 1QE3A 4RMNA 1FAFA 1R0XA 3BM5A 4UBLA 3WJAA 3TG8A 1QE0A 1M57B 2Z9CA 2BMEA 2AZ0A 3MHSC 1V55C 9LDTA 2E82A 1Z75A 3KVRA 3N2GB 2CHTA 4MGYR 4UW9A 1XNQB 3EQ2A 3ADPA 2GZ2A 1VL5A 4O4JB 2AN3A 3LLVA 3OQOA 2HSWA 2WLHA 3JVHA 2GILA 2MU1A 3TQFA 3GX1A 4GVLA 1QBGA 4IDCA 4WLUA 3CW9A 3E9ZA 3FKJA 1YITF 2DHCA 3LGSA 2YDXA 3NYWA 1A2OA 3T1HB 1L8OA 3GQBB 3K9LA 4NYMR 2D5IA 4OP1A 1N0JA 1D9XA 3A1DA 1B6RA 1TA9A 3EFFK 2BGTA 3D7SA 2EBWA 3F6SA 3GFRA 3KXIA 4K7JA 4MA0A 3LL4A 3IILA 1JTEA 1TQ8A 1HE3A 1P62B 2I6TA 1V95A 1VRCA 3SZMA 1Z8FA 3UV7A 1QIDA 1PNVA 3TE6A 4ER3A 1ONNA 3KB1A 2XUJA 3OZ7A 3Q0TA 3T5DA 2LDBA 2PGDA 5E9QA 3L43A 4V0OA 1SOUA 3RROA 2NOAA 3PCXA 4RHUA 3VTFA 5BSEA 3Q7IA 4CR6A 1NDHA 1VIDA 5LUBA 4K03A 2R62A 1E4VA 3H1GA 4MV6A 1L8LA 4M1YA 1YNSA 2QW8A 2Q6VA 1A27A 6REQA 3R8CA 1VQMV 3UUGA 4QNMA 4AO8A 2C5SA 5CNJA 4I3FA 3FMOB 3WFZA 3HU2A 1NMUB 3QNEA 1RMTA 2VTDA 4JJ8A 1FSPA 1XD8A 2IXAA 1IWPB 4M46A 4RY8A 3T5TA 1U5AA 2GCOA 3T3HA 4JBYA 5DCLA 1EVYA 3R8FA 1YQUA 1DWPA 5FFFA 5M34A 3PC7A 2EXXA 2VAMA 4OJNA 3CX3A 4OU5A 3H18A 5IYZB 1KYQA 4GGOA 4AZVA 5JWRA 3CVUA 1JT9A 4Q02A 4D4GA 2OV8A 4V03A 2IZ1A 2ZRLA 2FPOA 3ZP4A 1CR6A 2N74A 3W9BA 4UEWA 3IC9A 1W2BF 4UC0A 1KFBB 1KD1W 2O8NA 4ACBA 5BRJA 2HQSC 4QUJA 4R2MA 4TQ9A 1M2KA 1PDOA 2FUEA 1C8VB 2F3QA 2Z1MA 2QYOA 3DUWA 3C3KA 4WCFB 1QV9A 5KJ1A 4J29A 1TRHA 2XT9A 1FP2A 4KQKA 4A5SA 3RARA 3ZHQA 1FRNA 4HWOA 5LP6F 1C0PA 1ONPA 3LQ2A 4KDEA 5A06A 4QKQA 1NVUQ 4D92A 3JATA 5IJ9B 3U2QA 3A6PC 3D4BA 3MQ4A 3MB8A 4Q7LA 2HGSA 1L5NA 1U8ZA 4C0LA 1KU6A 2B37A 3A6GA 1RJFA 2A30A 3AI2A 3RU3A 4CI9A 1OX4B 1PJQA 3S68A 1JQ0A 4C8EA 2I3BA 1RHMA 2GK3A 2YYZA 2MSCB 2ZJ8A 3EPRA 3GJ7A 4HYQA 5J63A 2ATIA 4DR1O 5E7MA 2XDYA 1IZYA 3DVSX 3BE8A 2VHYA 2UUAB 2DFTA 3E61A 2M7WA 1NPDA 3R77A 3LSYA 4K3UA 2LBWA 2CFOA 3OPYB 4EAAA 2CNWA 1CY6A 2G06A 1JKIA 3GVHA 2ZJYA 3R66A 4DCMA 4OXRA 4RF5A 3TXYA 5A4AA 4CM1A 2O23A 1TLTA 4CKBB 1EN4A 1SUDA 1WJZA 4X95A 4B3TO 2CWJA 1E58A 4KFSA 3ZG6A 1CS4C 5K3OA 1TA0A 3LWDA 2QPLA 3DEIA 3E9EA 2X0LA 1DAGA 1KI9A 1TYCA 1QP0A 3QSGA 3FDZB 1H9AA 1GK9A 2ORYA 3AXTA 4UXNA 4LHYA 3V3KA 1OXTA 5LA6B 4C1BA 1KHHA 1UDXA 1Z3IX 4EYSA 1TIKA 4L57A 5B7PA 1YKGA 3G5MA 3KHKA 1KQSU 5EE5B 3T12A 3T1CA 4WOBA 1JEYA 3VQXA 1SQSA 5F35A 2LW1A 4JITA 5JU6A 2RI0A 2C07A 3LX5A 1YZTA 3IUQA 3DAYA 3ZY6A 3ANYB 3D6AA 3A32A 3A6FA 3CZMA 2PUAA 1GDTA 3VH2A 2J1LA 2QPOA 4PQGA 2P6NA 4A10A 2V3VA 3EFOB 3TKLA 4EI9A 1CQJA 2Z8XA 4QFDA 1Z0KA 2X2EA 4V0LA 3QBEA 4UZFA 3ZD7A 4PNEA 1YRAA 3GFQA 3E18A 3RYFB 4MUEA 5EN4A 3QI7A 1ADJA 3VKUA 2IJHA 5GADl 2Z83A 2RE8A 2ZVDA 2W93A 2WMOB 2HA6A 4PA7A 5LZ7A 1LH0A 1JWLA 4MUKA 3AG7A 2VBGA 3PF9A 3JZMA 4E5UA 2N1BA 3HVUA 1SS3A 4LOKA 1ZM7A 4GPD1 4EG8A 5CDSA 5K5EA 4H4EA 1FZTA 5CFLA 3CZ5A 4RD2A 4OQLA 3M8AA 5CFZA 5HW0A 1PQWA 3T1YO 4G9BA 4F6EA 3WK7A 4FCTA 3HYSA 4W1PA 1NZDA 1Q2UA 1Z4JA 4IFIA 2FLWA 2YNMC 5JSYA 3QPCA 3NIBA 4ZV4A 3VOSA 1PGQA 5AHWA 5JNSA 3ZRVA 4DHWA 1ZUNA 1L7RA 2IIPA 3RQSA 5BWOA 1E20A 2RK6A 3O4HA 4UNSA 4DT1B 4JMPA 3QYPA 4NBSA 2QAGB 4MCHA 5EKTA 4CUZA 3C8MA 2EGGA 3H1EA 3ZPXA 3ZY2A 2ZJ7A 3KLMX 3I2HA 4F04A 4CIBA 2RGBA 4E5YA 5HKKD 1YZNA 2XGSA 3PDHA 5EK0A 1IAVA 1QG2A 1BX1A 3QITA 4ZOEA 3TR5A 2I65A 3VV2A 3S40A 4DWJA 3VC1A 4TLDA 1WB8A 3CUTA 2HHAA 3QJGA 2IJJA 1RIFA 3CH4B 2JH3A 1NW3A 2WEKA 4OA5A 4DNXA 3HGQA 4AS3A 5HM8A 1TMGE 1DIAA 4EDFA 5L4NA 1QGOA 1JFFA 1JB9A 1SVUA 1T9GR 1FTWA 3KQVA 2HRZA 2J3LA 4CH6A 3B7PA 3GEDA 4L27A 3ZWNA 3GFTA 4OHZA 4JVSB 3A3KA 3RO7A 4WASA 2Z09A 1PSDA 1R6BX 3PU6A 2WNSA 3NG1A 1G60A 1DKNA 3RRJA 2QRJA 2HA4A 5A1JA 1I36A 1Q83A 1QVZA 2B20A 4WMLA 4XDZA 2XE8A 1UBSB 4BQIA 1BDBA 1ZSYA 4H08A 1I3OA 2VZ0A 3G9TA 3R20A 2WJZB 4R84A 1DHRA 1YRWA 2AI3A 4R2IA 1EN6A 4W8HA 5FHRA 3RIHA 3SI7A 4Q3DA 4WZAE 2WW8A 3QHPA 1RPNA 1SOMA 1V8OA 3HRKA 2P7TC 3DKPA 2O2IA 4OU4A 1TVEA 3EVTA 4BIMA 4K9DA 5C4MA 1UFOA 4KGZA 3RBVA 5J3JA 1N2OA 4MQEA 2R6R1 2R6FA 5TMBA 1BHSA 3THWB 1MABA 3HUDA 4P08A 1Z0SA 2FFJA 3BGOS 3N2LA 4C8IA 3W3ZB 3MHPA 2WJWA 4E5DA 3CBQA 3T2MA 3JR7A 2XKBA 4W5JA 5ALGA 1P45A 3WG7C 2UYJA 2ZYUX 2XJ9A 4RYLA 3UWKA 3ZY5A 3IBSA 5DASA 3GA7A 3L1UA 2Z6UA 1I4LD 3K15A 1P1JA 4NOMA 4FI3F 4NKRA 1OMOA 5C80A 1OREA 4AQ7A 3M6FA 4MYDA 1OROA 2AIZP 1V2GA 3OA2A 5CMLA 5DULA 1CT9A 1XVIA 5KMGA 3LO8A 5DYTA 4JUBA 3KFLA 2IOFK 5DYYA 3CC7V 1PJRA 5CITA 3AKYA 3H9EO 5L40A 4DCUA 1Z4OA 2H5LA 1EXVA 4GI2A 1QDLB 1NU1H 4ZEVA 1ABEA 4CR7A 2EILC 3STLC 3QA3E 1F2DA 1M1ZA 1SCBA 3DNMA 2EIKB 2XGOA 1XD2B 2VP0A 1UQUA 2DMRA 2J46A 1Z9BA 4EEKA 5JMTA 1LEHA 4IOKA 1YI2V 2RIRA 5G02A 5CT8A 4YIKA 5ALMA 4DJEC 1WBBA 5I7WA 5JIBA 1SG6A 4HH3C 4B62A 4NBWA 4DHEA 1CIJA 2NZJA 5FDFA 3TK1A 4PWZA 1Q8IA 1CZLA 2XYHA 4IDGA 1FPQA 1JJVA 2O2EA 2Z5UA 2WUFA 3L46A 3UH0A 4AQDA 4QQ8A 4XVRA 4P84A 4DCJA 2VYFA 2COUA 3P2MA 4NESA 3FPIA 2X8BA 5FOXA 1CVLA 1GJRA 1RYBA 3GEHA 4FXOA 1WXQA 1V1MB 2BFDB 1XHZA 2CJWA 3ZVNA 3S7ZA 4MGZR 1EM8B 2E37A 2XNJA 3BMCA 4EZIA 2ZUCA 3RWBA 3H1IH 2AHRA 1HOXA 3NETA 5DO9A 5FD8A 3WIUA 2BGKA 1W5FA 5IY5B 1YULA 4ZU1X 1J06A 4LMPA 2XZPA 4TYYA 4NBVA 5EIBC 4B3SB 3PICA 1KQNA 4DR3B 4IYJA 3RSHA 5H4GA 1EA5A 1OCOC 4ZHQF 1SF9A 5DNVA 3N2ZB 2EZOA 3IUMA 3C5WP 3MWLA 4X41A 3FYEB 3RWOA 1A76A 4ZD6A 4TXMA 5K0ZA 3W6OA 2YFHA 1Y8ZA 3VFDA 5HZKA 4KOEC 4DLSA 3AHCA 4XSHA 1RAGA 1Z18A 1Z37A 1J2TA 2CHGA 3G68A 1K4DC 2P3OA 1R4MB 3GROA 1O9HA 2XH8A 2VDKB 3B51X 2W6OA 1QV7A 4WLEA 5EIHA 2DJVA 2WIFA 4CV1A 4TTIA 5LDHA 2O8DA 4RQOA 3RVMA 3W04A 3DOFA 3LGXA 4AB1A 5K1ZA 2ZAGA 5JZSA 2QQFA 4HS9A 2AX3A 3KP1A 1K97A 3DDWA 1Z47A 2Z2ZA 4PD4F 1ZWIC 5JQGA 1IN6A 1G20B 1I2ZA 1NJ6A 1USIA 2KWIA 2SKEA 1NN3A 4N82A 4UE3S 5B30A 3FMVA 5DFAA 1MHTA 3K9FC 3ZJ5A 2LBTA 3E86A 2B7CA 3SJAC 1O87A 2PVSA 1TKRA 4U2BA 5E8RA 4PC6A 5HY4A 2JW5A 3V8BA 1U0GA 3CPJB 4ZMBA 2GGSA 4LJ7A 3EZXA 1XTRA 3ENWA 4DLYA 5JYDA 2AOTB 4ZQEA 1WXFA 2JFXA 3JALA 3HGTA 2X58A 4Q3NA 2C2XA 3TNYA 1G17A 4DC9A 1T6ZA 5IDJA 2ZUUA 1GRCA 3OLWA 5K3CA 5HCIA 1XL4A 3M2PA 2J3DA 2VK4A 1H9CA 3E8SA 3LBHA 3FSRA 1KK1A 4YCBA 4GKKO 4MV8A 4CM5A 4EFMA 3H84A 1SCIA 4L4SA 3ROMA 1SB9A 4CF3A 2YIAA 3MJDA 4RZ3A 3DEAA 2OV4A 3SBOA 1UXHA 1OJ7A 4ZVQA 2J0VA 1AGRA 3DWFA 3F8WA 2ACKA 3M83A 5GINC 4DTCA 3PLAC 1OCZC 1IAQA 4I9UA 1U43A 2B9VA 3NATA 2O1EA 3L70H 5JWHA 2G04A 1C9NA 4MX8A 1FJHA 3M6LA 4EI2A 4GBJA 4TWIA 2WI8A 5DRTA 3RFRA 3WNBA 3VVLA 2G9NA 1Q77A 2CDRA 2LCAA 2JVJA 4ZQGA 2ZBEA 4M0KA 1Y1RA 4KBGA 5C1PA 2I7XA 3DFKA 1JJFA 1UP6A 4UBJA 2VVTA 4FEAA 1IBLB 2G6BA 3R24A 1D04A 1EX9A 1P9RA 1L7QA 2D1SA 3K0FB 1N25A 2I4OA 3KPUA 4NI5A 5DXAA 3UMBA 1F0KA 3WGHA 1QTQA 3T4XA 3A6EA 4G8BA 4JNCA 1EZZA 2QRZA 4K9NA 5BSMA 3TLKA 3F6YA 4L7VA 1SETA 3PC6A 4EB6A 4M1OA 2H52A 4JHXA 2PQMA 4HUQB 4ZQIA 2FW7A 4CV2A 1GOTA 1HYHA 3FSGD 4HBGA 3WVNA 1RJDA 1RAAA 1OXXK 5KYUB 5DBOA 4KR3A 1NW9B 3BJIC 1KSHA 2CB9A 3QPVA 3TD4A 4JUAA 4C0SA 5ICCA 2IZ0A 4YRTA 3IPRA 3X1KA 5JC1A 3RC1A 4N7JA 4OQXA 4GGPA 2DFDA 3HKBA 1MT3A 2OBLA 3FKSD 3S2GA 4FM1A 2ID7A 4DA9A 3KETA 4AJ4A 4C82A 1Z33A 1UPXA 1HDEA 3HR0A 2FV8A 3R7SA 3D6HA 4E7PA 3JWHA 2NZWA 3TLYA 4E88A 1XA3A 1SQ5A 3F47A 3O8OB 4ZVPA 3OIDA 2VG8A 4PFQA 2IC5A 4RK0A 1HH4A 5IAKA 1AO0A 2VT3A 5DNWA 4F1JA 5JBNA 3HPLC 2ZYTX 4ZYUA 2X7XA 2G17A 2J0UB 2XNDD 1NT2A 1JW9B 2X23A 3KOXA 2X6BA 1FTNA 3A4YA 4MS1A 4YBZA 4YRRA 1VPTA 4BVTA 4KWHA 1TTTA 1T2VA 1ADCA 2HDHA 3CXHF 4Q15A 4E5SA 3IA7A 4WGFA 3SJ7A 2H3OA 1TJPB 5EE1A 3OWHA 4L78A 2WYVA 1P2GA 1GAXA 2H17A 2PZSA 3QX8A 2AEMA 2CXTA 1PAUA 2AOVA 2R751 2ZVZA 3B70A 1I2BA 1RRFA 2ZSBA 1EZ1A 1ESCA 3TPFA 1I10A 1ZQ1A 2HCBA 4IRXA 4OB7A 2FPIB 4XFDA 3HR8A 5KZMB 2EIHA 2PQ2A 3KYDB 2ZIEA 4C0JA 2D0OB 4C14A 2GRJA 1GTVA 3HO6A 3A4IA 2VT2A 3L8ZA 4OJMX 1IV3A 5BV0A 1D1TA 2K1SA 1JB1A 2AMVA 1P7BA 2H1LA 2MOKA 4RMGA 4IZHA 4BUCA 1NT2B 1FXWA 2RH4A 1VF7A 5H6QA 3QPBA 3TPCA 1G4UR 2HNKA 4COKA 1UBCA 4XTRA 1QX4A 3JYLA 2VP5A 4TVOA 3VCZA 1ZZEA 2ECPA 3C98A 3ESRA 1SURA 2R8RA 1EFAA 5D84A 2VBIA 4IP0A 4CJXA 4OYRA 1NW7A 1XA4A 3SFVA 3PXBA 2H8EA 2BHNA 3LIIA 3TOVA 2Q6OA 1UM9A 1PK7A 5G1OA 2R6JA 1MO2A 1LGYA 2BJWA 3GMSA 5KNBD 4BXOB 5ARDA 1D2GA 5JAOA 1Y74A 2IKSA 4PQFA 3RJZA 1AHPA 1KU0A 3EHDA 2DQSA 2APJA 3ZWOA 5KUKA 4RD4A 1I7PA 1MG5A 1W4RA 4EL0A 5K4AA 4UCSA 1T4MA 1Z4KA 2MHCA 1M93A 3AB8A 4AJ9A 3NCTA 5JSZB 4P0QB 3TJMA 1U94A 3RLIA 2AIFA 3T7SA 4Q1DA 2ZSFA 3T4ZA 3QYAA 2ONJA 1M2OB 1IZ3A 2Y1EA 1BFDA 3AUYA 1WMAA 4L3WA 1JLSA 3N8HA 2ZCUA 3F73A 4LF8B 5LMZA 3PQ8A 5AW6A 2VZ8A 1QLJA 1Y1KE 2FPLA 4YP0A 1R6KA 2EBHX 3E9CA 4Z4IA 1S77D 2UYKA 1M34E 3EOAI 4ZANA 1XDCA 3ASNB 1UL1X 3LVRE 4AO6A 2P62A 4OIMA 1OAAA 2P9GA 2VF7A 5I6DA 3D36A 4DRXB 3S8EA 2CHFA 4AS2A 3LQ4A 1X42A 3GW8A 5DOZA 4KXNA 1TQ2A 4WSOA 4DXDA 3DNPA 4EBBA 3KVNA 2DYSB 4I8DA 3C6QA 1TUBA 1TQDA 5AW1A 2YBDA 5EVJA 4D4KA 2R60A 1R6XA 2EKDA 4KN6A 4PZPA 1O8CA 2CK3G 2DWEC 2QD2A 2J7PD 3DFMA 4MIOA 2EFEB 2E76B 4QVGA 2IWRA 2CVOA 3W8EA 4EKWA 3OEHG 3ZU4A 2WNIA 4RM3A 3VTZA 1S6YA 3LD9A 4GS5A 3O8CA 2ATKC 4QDOA 3NXSA 3MMNA 4DA7A 4EG1A 2UVQA 8GPBA 2RGEA 5EIBD 1GYRA 4TTSA 3M5CA 1N1MA 4YAUA 1VF6C 1AY0A 2PY6A 1DTOA 3I5UA 4IKOA 1BT8A 4K6KA 2WSSG 3OT7A 2IDZA 4F4IA 3IEMA 1GGHA 2X15A 1RHKA 1HXHA 5ARBA 3CVXA 4H2DA 1GZSA 2VNAA 2XCOA 3A6ZA 2QMEA 4M88A 3W5CA 1KKMA 2V7GA 1ETUA 1Q82H 1JECA 1I3KA 2HS4A 2HMSA 5FL7D 3WK9A 5KWSA 2X5NA 1O5OA 1I32A 4GQAA 3SQNA 4ZQCB 3DBOB 2NT4A 3PQ3A 2IHTA 4I50A 2Z3YA 1NWHA 2IQIA 3E2PA 4JWTA 2EJTA 3BCUA 4C0KA 2QRGA 3VBBA 3AEIA 3DFZA 4I5GA 1XTTA 3TQHA 4WTOA 4TZKA 3A9SA 4A91A 2WM3A 3FAVB 1XMQO 2NYVA 4MKGA 4PDLA 1QYWA 4JAUA 4N5HX 2ZOVA 2ZTVA 1Z28A 3OI7A 1B8UA 2DT5A 1FFEA 1RYZA 2AZ4A 4J16C 2A5YB 1FBNA 3T4UA 5CBKA 5CBPB 1N5MA 1PFYA 1PX2A 4Y2GA 4HWSA 1E5DA 1VMEA 1N2CB 3GT7A 2GAAA 1UT8A 3AIOA 2FOLA 4RLQA 4R8KA 3UJ8A 3S2UA 4BMCA 4HYOA 4LBVA 2DETA 3ERCA 5K1PA 1UBMS 3R7FA 2RK3A 2W6JD 3ZE7A 2GEUA 5CNIA 3SNKA 4F1WA 2YFYA 2FB9A 2SKCA 1J0CA 1OCEA 3FLMA 4HNUA 1VARA 1E6MA 3QU9A 4OQEA 4YLEA 5K05A 4M9SA 4Q9AA 3JQFA