4I50B

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
429
structure length
422
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 158
structure length 422
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i50B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i50B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i50B01
1W581 5LA6B 3RYIB 5LP6B 2VAPA 5M7EA 4ZI7B 4O4JA 2BTQA 4I55A 4O2BA 4DRXB 4DXDA 3JATB 5J2TA 4XCQA 5C8YB 4O4IA 3WGJA 4O4LB 5JVDA 1JFFA 4X1IB 4HNAB 1FFXA 3HKEB 2GVIA 2Q1XA 4LNUB 5CB4B 5IYZA 5JQGB 3WGLA 1TVKB 2RHOA 3N2GB 5LXTA 5J2UA 4ZHQB 2VAWA 5KX5A 5CA1B 5JCOA 3JASB 5EYPA 3RYHB 5KMGA 3VOBA 1RQ7A 4FFBB 3E22A 4TUYA 4IIJB 4EB6B 5IJ0B 4TV8A 5LYJA 4IHJA 4I4TA 3UT5B 4I50B 3JALB 3V3TA 3VO9A 5LOVB 4X1YB 4WBNB 4X20B 4B46A 3ZBPA 4X1KA 2VXYA 5ITZA 3RYCB 4YJ3B 1TUBB 4O4HB 4ZOLB 5FNVA 3CB2A 4O2AB 5JH7A 2RHJA 5BMVB 3RYFA 5MN5A 2XKAA 4KWEA 5GONB 5CA0A 3N2KB 2R6R1 4F6RB 2BTQB 4I55B 4TV9A 4DRXA 1W5FA 3ZBQA 1Z5VA 3JAKA 4O4IB 4O4LA 1RLUA 4M8IA 3HKCA 5JVDB 1Z5WA 1SA0A 3WGNA 5MN4A 3JAWB 5IJ9A 3HKBB 1FFXB 3HKEA 2RHHA 5CB4A 5IYZB 5CA0B 1FSZA 4U39A 3HKDA 3JARA 4YJ2B 1TVKA 3M89A 4ZHQA 3VOAA 1W5EA 4U3JA 5CA1A 5EZYA 3RYHA 2VAMA 4FFBA 4TUYB 4EB6A 5LA6A 3RYIA 4TV8B 5LYJB 5LP6A 3UT5A 3R4VA 4E6EA 4ZI7A 4O4JB 3M8KA 4O2BB 4X1YA 3JATA 5J2TB 4X20A 1W5BA 5C8YA 5EIBC 4X1KB 1OFUA 4EI9A 3VPAA 1JFFB 3RYCA 4YJ3A 4X1IA 4HNAA 1TUBA 4ZOLA 2R751 4O2AA 3RB8A 5BMVA 4LNUA 3WGMA 5JQGA 3N2GA 3N2KA 5LXTB 5J2UB 2RHLA 3VO8A 5KX5B 4F6RA 4B45A 3JASA 5EYPB 5KMGB 4TV9B 3WGKA 3E22B 4IIJA 3ZIDA 3JAKB 5IJ0A 3HKCB 4I4TB 1SA0B 4IHJB 3JALA 4I50A 4EI8A 3JAWA 5IJ9B 5LOVA 3HKBA 1W5AA 4WBNA 3C8LA 5LP6C 1W59A 3HKDB 5ITZB 3JARB 4YJ2A 4O4HA 5FNVB 4U3JB 1RQ2A 5JH7B 5EIBD 5EZYB 4EI7A 2Q1YA 5JCOC 2BTOA 3RYFB 5MN6A 2XKBA 5GONA
chains in the Genus database with same CATH superfamily
5BV8A 3HR0A 4Y2HA 5F98A 1KQ3A 2WSSD 1MZFA 3R5HA 1TEHA 5I8PA 2OXCA 1M6VA 4HWTA 4DM4A 2KG7A 3L1UA 1QYRA 2C20A 2PSEA 3KEQA 4HLUC 3EXAA 4MGIR 1PEKE 5LJLA 1O6FA 3SKYA 5HK9A 5FUBA 2Q4TA 3LCMA 4HDNA 3B77A 5B2EA 3C85A 1XDBA 1NQ3A 4E09A 2C2GA 1C0LA 1LBEA 2PD3A 2ZXWC 4PD4F 4J49A 1YGPA 1VHDA 3PT5A 1BCRB 2N46A 4JFAA 1BFKA 3GARA 4FK8A 4QELA 1Y7HA 3T1HB 2PGNA 4HAMA 3B85A 4GOKA 4S1TA 3IKMB 5AESA 3AJEA 3T06B 1O97C 2Q1TA 1KEEA 4R05A 4ETNA 1KEKA 1MQAA 4GBED 1IXYA 5TQ2A 5LQNA 4CMKA 1G4HA 4QVGA 1RKUA 2NM0A 3ZIAA 1G8MA 4CLOA 1W75A 3JR7A 2OIEA 4GLOA 2ZJ7A 1YB4A 3TTVA 2QM8A 2ZYHA 1KMIY 3IDOA 1GN3A 4RQTA 3RC7A 4NCBA 4UUMA 4OVKA 3W1EA 1IM2A 1PEAA 3AJ9A 2HIGA 5HA5A 2HW8A 3LL7A 1MORA 2W2MA 3WLLA 5M2QA 1WPXA 3G71V 3NOVA 3I34X 1M5UA 4ALMA 3JQRA 1CB7A 3RJTA 3QUWA 1E3QA 3OICA 5CW1A 5IMSA 2VXCA 2PBFA 4DM7A 4EF6A 4HAUA 5DCWA 4K9RA 3H5WA 2WPDG 5K1XA 4L7QA 3OUUA 4RORA 5ALTA 1Y76A 2EKLA 1ZLZA 4H9GA 5ALXA 1FKAO 4BX9A 5A1TA 3FOFC 2GSMB 5JR3A 2I87A 1NVPB 4BT6A 4ZJUA 3OCZA 1I80A 2K2WA 4LY3A 4M0MA 1CK4A 1FMCA 5FUWA 4D79A 1IAVA 4H33A 3LDCA 1SU8A 4V0LA 3RT7A 2HXGA 3LY9A 4BCCA 3F6BX 4DQKA 3BOSA 3BF7A 4ZAYA 4BKMA 5I6DA 2AUTA 5C1OA 5FLXM 2UYPA 1AI7A 5FPHA 4ODIA 4HEQA 2ACKA 2ONKA 2AG1A 2VHXA 5KKCA 4MVJH 2ZOSA 4PYMA 3PQ5A 4KQXA 3ASVA 4A91A 1OFUA 2PFSA 4BXOA 1SXGA 1T5EA 1BG6A 2FFBA 4C06A 4F5EA 1YA4A 2V7GA 1GPBA 4U7FA 4DT1B 5CN0A 3GRKA 1QG0A 4KN8A 1ZX3A 1SC5B 4KI7A 1XILA 2JIPA 4N39A 1QQTA 4PS0A 4RABA 4HGZA 4Q3OA 1F4VA 1VQ7V 3N2GA 4RBNA 3I6ZA 5EYPB 1XLTC 5T6BA 4OLHA 1EM8B 1JA1A 2BFEA 3BGSA 4DJAA 4C05A 3RAFC 4FHFA 4JC8A 2RG7A 5TMBA 4RHUA 5FJIA 5DFAA 3WIVA 4DUPA 4C2UA 5BYBA 1VC2A 3LWPC 4TVSA 1MV8A 4PO8A 5ITSA 4WL0A 4MA5A 2EC5A 2EKZA 2V9CA 2Y66A 2AHOA 3KKNA 3E58A 4ZQEA 4EUNA 3AYZB 1ZUD1 1NDQA 3ZMTA 3SX2A 1QAQA 2R86A 1BMDA 1D7AA 1NMSA 5FYQA 1OCRC 1Z0SA 3WK5A 3WRXC 4BQSA 2UYCA 1JR2A 2D2CB 2ID7A 1KMHB 2KJQA 3FMIA 3LHIA 4OHVA 4ZZ2A 5KTYA 2VH2A 3D00A 3LNTA 2G1PA 3VPDA 3EK2A 3BUSA 2XA2A 5KQRA 1HR0B 1S3FA 3IHWA 1E2HA 3ZRXA 4P8RA 3HDHA 3WYGA 3K58A 3I9V1 2EQ5A 2WJYA 2FW1A 1YJCA 5HGJA 1CZLA 2A4MA 4MITA 2VH1A 2IIPA 4IDNA 3RKSA 2C29D 3NTRA 1RCUA 3VR6D 4KFCA 5TJ9A 3DC6A 8ATCA 2HCBA 1ZX1A 1QLJA 2SKEA 3BWXA 2XKJE 1VPVA 3ONEA 1TM2A 4B7AA 1E79D 3K5IA 1T8RA 2HU8A 4YNBA 1IBCA 1UJ6A 1X9HA 1DC4A 1SAYA 2H2GA 2QSYA 3EYAA 3K0BA 1GFWA 3DAFA 1GZ5A 3IVMA 3QVOA 4NMXB 5FAXA 3SFTA 4RLSA 3VDNB 2AFVA 4X88A 4BU1A 1EFLA 2LO1A 4KGZA 3HVHA 4Z7QB 3ORRA 5K3FB 1MMMA 2QENA 1D2EA 2AG8A 4IHKA 3AEZA 3FYHA 2G08A 1GMGA 2G77B 1IJEA 2ZSFA 3HN2A 3CX4A 2IEDA 4YJ3F 2CTQA 1XVVA 3IO5A 4NYMR 1PR4A 2GK6A 3D7KA 4UHKA 2I4MA 2Q3MA 5ALPA 3SY8A 4KPUA 2WG0A 4KV7A 4P3PA 4UBIA 3E9CA 4U7JA 5LWHA 2ECOA 2IHJA 5FPKA 3LTNC 1NATA 1QLWA 1H7MA 3KR0A 5HXUA 2CAZC 2QB5A 1L4UA 1CY4A 3AHFA 2PUAA 1LUVA 1VQMF 1VCIA 1XKQA 1JS1X 3N74A 1MP0A 2E7ZA 3RFVA 4LYAA 3MRTA 1Q7CA 1S0UA 2ARKA 3QELB 1DWUA 1QVFF 4F6RB 1DPFA 4QYXA 1RDFA 1SFRA 5DGCA 4DSZA 4POOA 2XASA 2X6TA 2UYHA 4ACAA 2Q68A 2DR3A 2YOFA 3E7PA 1NUUA 3O8OA 2Y0CA 5GANK 1JNYA 1G5HA 1ZUWA 2YV3A 2W8BB 3B5JA 3JZFA 5HZMA 3E1YA 5IFKA 3UJNA 1EFHA 5ED0A 4PSVA 4C04A 3VGPA 4FZRA 4BN5A 2AYYA 2DMXA 2VP3A 3BWEA 3V1YA 3DO6A 2V55B 1Y63A 4HNGA 2IG8A 1F17A 3EGXA 1M5RA 5K8TA 3CO5A 4U39A 3OHMA 2Q5EA 2WINI 5EZQA 2Y4OA 5IAOA 4FWTA 3CINA 1K7CA 1ZCZA 1WZNA 3OFJA 4D8XA 5EBWC 1SCBA 1J5EB 1GTZA 2J5QA 3C1TA 2XADA 3IEIA 4INJA 2BGRA 2AMVA 5EXEA 5HJEA 1HEUA 1V7CA 3DL4A 4F85A 3J80A 1WZ2A 1Q6YA 4L78A 3GRZA 3BXXA 4UDXX 4JI6B 2CW4A 3UFBA 2XCTB 1GTL1 4WFHA 1FU8A 1PT7A 4PHZA 4TMXA 5BO5A 3WY9A 3TTSA 2EJ7A 3ZOPA 3L02A 1NYTA 3CM0A 4HAYA 7REQA 1DKOA 2I71A 4LGMA 1L0LH 4OXSA 3S06A 1S4QA 1OI4A 4BZPA 5JS8A 2D1TA 1OD6A 2Q50A 1T4GA 5BYAA 4R98A 5CB0A 3TLKA 4IIGA 4C29A 2JBAA 2XH8A 5EB0A 4DMHA 1UBHS 3BMOB 5L3QB 2QVGA 1I10A 2DJIA 3I5YA 4WXMA 5EPUA 3UVEA 2FQXA 3KP1A 3UAVA 4IINA 2GV9A 5JSHA 1JIVA 1KI6B 2GH1A 3MN1A 5FP0A 3ZI0A 2VUSA 3FPIA 5CJ2A 3IQXA 1CNFA 3M1YA 5HKAA 1HTTA 3LYBA 2VHUA 1KZ1A 3EZ2A 2ADPA 1U2SA 2XUJA 3M5CA 5H0IA 1JG2A 3R3XA 1YZTA 1UBFA 2QT0A 4DR4B 4NRDA 3HPRA 4CIXA 3OPQA 1A5AB 1TM3E 1FRFS 4W7IA 1R1BA 5EGNA 1Z2NX 1PSDA 2ZEJA 3FLMA 3W06A 1R4AA 1RPJA 2CMFA 2QUHA 4MCIA 1ZSVA 3F3YA 2FCAA 3O31A 5IHXA 5G0WA 2X2OA 5BWNA 1AN9A 3GT0A 4W1SA 4UB6Z 1KGSA 3GCWA 3UJ8A 3AR4A 4OX9B 3C3BA 1QIDA 2PX3A 1OIVA 1VLZA 2VP9A 3EPPA 1MCZA 5ELMA 3DAGA 1G16A 3TXAA 4D8YA 1LQUA 1UQRA 5AMXA 4DLSA 2GQ0A 4J0JA 1JXQA 2FSSA 3R7WB 2ZI4A 4PQRA 2A92A 1BJTA 2L42A 4M7OA 3KOUA 4QDTA 3TYXA 3SC3A 4NYJQ 4XOIA 3IAM6 3VOBA 4YP7A 4P0PB 3E9MA 2IEIA 4HWGA 4L27A 1W49A 2IEZA 3T3PB 2NO9A 1ZXBA 3ZKWB 3I62A 3RIXA 1PR5A 4WKCA 4ZK2A 5KA5A 1DUIA 3JALB 1PZMA 4O5OA 2XAGA 1NM5A 1UBJS 1X80B 2XCQA 4KLNA 4YIPA 1FUYB 1II0A 4GGOA 5IDJA 3ADPA 1P61B 1NXOA 5EMJA 2DQYA 3WO1A 1S6YA 2ZE7A 4Q7LA 3DXYA 3WNDA 1AKWA 5JS2A 3UMYA 3U16A 2RGGA 3E9DA 2XCOA 3HN6A 5ALGA 1GPWB 1PYOA 5HTKA 2BLLA 3SD7A 4EJFA 1IXSB 2XLBA 1I3LA 2ZE5A 4V0OA 3D1LA 2K1SA 1UP4A 4JOSA 2BGNA 2XJ9A 4D81A 4YT4A 1HC7A 1YDHA 1HDIA 2JVKA 4PQEA 1D2RA 1T5OA 2ZXFA 5F4ZA 3KQSA 1D9ZA 4N21A 1G41A 1F2TA 3IOCA 5KOYA 1W5FA 1Z5VA 1RZ3A 4LCKA 3E9QA 4KDFA 5LDGA 3SEAA 3TLBA 4YQEA 5KNCD 2UAGA 3MLAA 4QOIA 3UO3A 2HEPA 1A4XA 3HJNA 4E2ZA 5JBQA 4ML3A 4MR9B 2VIIA 2VP2A 2E3CA 4X9XA 1V48A 4F7WA 1PKXA 4F93B 1V5GA 3A3KA 3FW1A 4YHBA 1F06A 4Z4QA 1YHYA 4QJ3A 5DX8A 4MDFA 1FXWF 1M34E 1O96B 1I7LA 3ON1A 2NYUA 4KXUA 3N2LA 4MTCA 2JIOA 2CDAA 1U5BA 4X3MA 4HYEA 5LYJB 2JIBA 1DXHA 2OLEA 4U7OA 4D26A 1UKVY 1ZD4A 1MO5A 4PA9A 2O3TA 3WYDA 1TDJA 5EIBC 1BWRA 3I58A 2P2LA 2AXPA 1SQPH 2GYWA 1V8DA 3NWBA 4ARVA 4BNZA 3JXEA 5J23A 1SB9A 4UM7A 3RE3A 4OP2A 1Q91A 1YZVA 4E7OA 2HDWA 4OAOA 2C4VA 2PZAA 3HXOA 3OEEG 1IVNA 4LFBB 1CPYA 1SG0A 3PRHA 4JJ7A 3ITKA 3N2KA 1N1MA 2GDZA 2KM1A 4BKQA 5JT1A 1ZI6A 1KEWA 3WWZA 2ZROA 4BFVA 3WFZA 4JUDX 3LNCA 1ZJZA 2AMFA 2ASEA 4P35A 4XYBA 2HYDA 5AKLA 2B6HA 3JYNA 1VLHA 5JZBA 4UNSA 4MDEA 3QH4A 3IAEA 5E7IA 4FFMA 4J75A 4QTZA 4NBVA 2DKNA 2PY6A 2RC5A 5HJ2A 5AW5A 2PR2A 3A27A 4PAQA 3GU3A 1Z0IA 1U1GA 3WJQA 1N2EA 1XEXB 3QE4A 3KZXA 2WWIA 1W35A 3BJIC 4RVGA 3W7TA 3COPA 1QVGU 3KS9A 2NXNA 1CQZA 1XMSA 4MEJA 5LL6P 1B0ZA 3WHIA 1ODFA 1DJLA 4Q4AA 3BGWA 2G1KA 1IJBA 2NSYA 2O06A 2GYUA 4DN6A 2R48A 4JKYA 4URUR 4BEJA 3OX4A 2FQ1A 5EJ9A 1GADO 3DL2A 1WAMA 3MQ2A 1KDYA 3N1UA 4ATNA 2JHPA 4WCFA 1JAZA 1BCSA 1SO8A 3QJ5A 4TMZA 1FAFA 1OFIA 3QA9A 4G23A 1XQ1A 4C0SA 3B3GA 2IBSA 3QNUA 1LDMA 2ENUA 3ZXUB 1N4DA 2AG6A 2QPAA 3KSUA 3PHGA 5HXZA 3QY9A 4PC6A 2PYLA 3TVDA 2WKWA 2ORIA 3P0RA 4QJ4A 1G0OA 4UBMA 1VF5B 1JKMA 4JLSA 5EWMB 2XVYA 1QDEA 1QYXA 2RH4A 5JD3A 1P6XA 4FB5A 2O2EA 2HO5A 4IJ5A 4ZQGA 3K9AA 3MT7A 1H2SB 2BCJQ 3FBAA 3PPWA 3HS3A 3E22A 3IPCA 3K9HA 1GNLA 2OY0A 4FFOA 4NMWA 1M3SA 4UDYX 1C9DB 1CQJB 1OWMA 4AQDA 5DJ5A 1WP8A 5ERGB 3WBFA 4YAKA 2GN0A 2HP8A 2QWNB 2GBLC 3E8SA 3HYSA 5A3SA 2EARA 1HT2E 3DT8A 3I2GA 4B7EA 4GPD1 4FGSA 3DLCA 3ZBPA 4JXJA 4WN9A 4C5BA 4EG0A 2ZJ3A 4JWKA 5SYAA 5EAIA 1Y3BE 3ROZA 3L49A 3ROTA 1DHTA 2WK1A 1KK1A 1MIHA 1SXJD 3F9CA 3I83A 1GSAA 2YIDA 3AB7A 4YUYA 2FJ0A 4NPHA 5GPBA 3ROFA 2DXIA 4G9GA 3P9SA 5FBWB 2QTAA 1KK3A 4P2ZA 1XEWX 2GNPA 2GTPA 3RM3A 3TJZA 2JHCA 2C57A 3DAPA 3PFBA 2P06A 4FS8A 4YGYA 2WTMA 3QKSA 3ZBQA 4ENWA 2JEUA 3FF4A 3KK0A 2E75B 2FOXA 3WXBA 2FOIA 4H0LB 2VSOA 3B2EE 4D41A 3V7WA 4G2KA 2FPIB 2PRSA 2GHTA 4BUJA 5U1PA 2O8FA 1GCUA 4MVJD 4ZCQA 1JLHA 1P7ZA 2PMFA 1GSHA 2WRZA 5CTAA 4R31A 4YMGA 5KNCH 2WWRA 4CIVA 4PQYA 4YACA 4PG8A 2Y1KA 2XD9A 4BVKA 4RFSA 4ZOQI 3FYUC 1VCHA 1AK1A 2PZMA 4CQMA 4ZHQA 4ZJPA 3L4BC 2HHAA 4WNYA 2ZXUA 1DKRA 2VP6A 3S1AB 2GUWA 2AJCA 1KQSU 4CM3A 1N2OA 1OWLA 3AG1C 5TDHA 3TD6A 2ZSUA 5F7OA 3WK8A 1XJCA 1XD9A 2N42A 3AH8A 4EA7A 4O4JB 3CG0A 1OXTA 3OMWA 4NQRA 3KIZA 1VBFA 4DRZA 4PFSA 3TD9A 3DB1A 3DPSA 5DXAA 2DFTA 2JIZA 1L4FA 3IMEA 3IUQA 1XGKA 4Z5XA 3KEGA 3MCAA 1JA8A 4HNAA 1IBKO 3BA9A 1FMLA 2BI4A 3AUTA 3CS3A 3I9JA 4FJ0A 2VTDA 3NTVA 4RWZA 3BHPA 5C4IA 2PRKA 2DT5A 2XUMA 4ZU6X 4GX0A 2WD7A 1JDNA 2GBOA 2ZJ1A 4FEYA 5J1TB 2UXBO 2X40A 4NJMB 3WNCA 3D3WB 1NLYA 1P74A 1A9QA 1BXGA 3CCCA 4HTAA 4AWXA 5LZ8A 3Q5EA 1T2NA 3RA6A 3IV6A 1BROA 1USKA 1TQ6A 1XFDA 1YZKA 4Q7JB 4X64O 1P1HA 1G2PA 1VKJA 1WHSA 3AF3A 3NS7A 5AJYA 5LU8A 1L8LA 3SFZA 4D9FA 4I0XA 1U3CA 4KIJA 1AIPA 1KA9H 3EOAI 2VHJA 5HVNA 3NB0A 4LF6O 5ELLA 3D8CA 3DE7X 4ED9A 3MB8A 4FZ1A 4QHSA 4C7OA 2VHVA 2GO7A 4LYDA 2AC4A 2WIKA 2HMYB 2EHDA 4N41A 2BFFB 4ZKDA 2WLMA 4X64B 2NYVA 5HR5A 1MABG 3BFJA 1OV9A 2O8CA 2W93A 2QE6A 1K92A 2H2IA 4YN3A 3EDRA 4XD2A 1LRKA 5TXGA 1E7QA 2CNWD 2R9RB 5ISMA 3P2IA 3JD2A 4U1RA 2PYZA 1JFFA 2D5IA 4OH7A 2R3SA 3AP3A 2WBLC 5H9CA 1DT3A 4LNUB 2R8ZA 3DTNA 4JUBA 5EOVA 1QYCA 1FUEA 2NO6A 5EK0A 1TM7E 2NYRA 2BGGA 4Z2WA 3FSEA 1ES9A 2P3QA 3EC1A 2V5UA 5JV5A 2XRZA 3IEQA 1CQPA 2BYTA 1WEHA 4HCJA 3UF0A 1OJHA 3NPAA 4IMRA 2W0XA 3OE7G 1A3CA 1P0IA 3AYXB 3V3TA 4R8KA 3KJHA 3RVRA 1T2FA 2OBBA 2AF3C 3L1VA 2ODAA 1HE2A 1E3WA 1G8YA 3IC9A 2JFYA 4Y2RA 1E5VA 1YCGA 2QRLA 2WF5A 4WFJA 3O3OB 4YDRA 4NICA 2JAOA 1UBOS 1ODLA 2JI6A 1D09A 3HACA 3TE7A 1VOTA 4O4HB 2PUTA 4V0KA 3VJRA 4DV4O 3OOHA 4Y2SA 1N1EA 3A7DA 1EVEA 1SWWA 5T6MA 3RSCA 3TW8A 1PW7A 3HUDA 4MLCA 1IVYA 2QEXF 4US1R 1KNJA 1PK8A 2P6MA 3LA6A 4MUYA 4WNAA 2FEOA 4OGWA 3F4BA 2EKDA 1JVNA 3QWIA 1V39A 4X41A 4Y6LA 4PG6A 1S2DA 5KCMA 2CHSA 2Q7GA 1YUMA 1QAOA 1Z73A 2O20A 5ALIA 1PNVA 1XFAA 4EZEA 1TYEB 4M46A 2ZQZA 1GN8A 3GI1A 1T10A 1Z0FA 4PZPA 1QOPB 3T4EA 3G2PA 5CCBA 1YFLA 1OZHA 4IMIB 3GYBA 3AVTA 1VQ4V 1PUIA 2UUBB 1HH4A 2DY0A 2NVOA 3IMKA 4KAJA 4YIHA 1QG6A 1RSZA 2WD8A 1ZICA 4IO0A 4AK9A 2X41A 3L6EA 5FRDA 2OFFA 5C2JB 1MPTA 1WXIA 4HAIA 4KBGA 4WCVA 4GKJO 5DKFA 5JCPA 5CCEA 1VQOF 2ATKC 1HTWA 1Q0QA 3FVWA 3IH5A 4ZHVA 4KVAA 2UZ1B 4LI0A 4MB0A 4X1OA 5AUPB 3FBWA 1O8BA 3MHHC 3KWMA 3TW0A 3D7RA 1QVRA 4DDMA 4EA8A 4C3ZA 3RGWS 3OZUA 3MAQA 1YAHA 4L4RA 4ND7A 4ZZIA 1Q0PA 3IULA 3VQVA 3E3OA 4C4YA 1FYFA 2Q0XA 3ITNA 1TZBA 3I9V6 2OCHA 2DHEA 2H3HA 2AI1A 3HI6A 3I01M 5JRJA 4L51A 4M9ZA 4QIWF 1FZQA 3EXEB 1PZEA 1SUIA 3UHOA 3X3HA 1HRKA 5FEUA 1K33A 1YAJA 4JJZA 2V0CA 4PLVA 4IDAA 3JASA 2AFIA 4HDOB 2VSYA 1R5JA 4QRDA 5C3MA 5CFMA 3LFHA 3A11A 4MW8A 5BURA 1I2CA 3PJRA 2ZSIA 4Q15A 2B4TO 3SQXA 3R9XB 3ZCSA 4FM0A 2VF5X 1JIKA 3RT3C 1K6MA 5ECYA 4LNAA 4CTJA 2XUIA 1FP4B 4ZYYA 5I7OA 1BW9A 4J3NA 1FJGB 3G1UA 4X89A 1EUDA 4M99A 3I3SR 3M4XA 2C5SA 4OHOA 5IARA 2XXAB 1NZ6A 3SGIA 1X13A 4XXHA 4EY4A 5C8DA 3L7NA 1KD1H 4D9CA 3PXDA 5DULA 5ADHA 1N5MA 4D6YA 3UO2A 1Z0JA 5CT5A 1CQIA 2OHWA 2FWRA 1NG9A 3UK1A 1RM1C 3TGPA 2Z2KA 1N32O 2PYIA 3DJFA 5JARA 3H1EA 1GRCA 3NBZC 4FSDA 5DW0A 2QTMA 2FZVA 1Y80A 2PBRA 3BRCA 2XQJA 3JV7A 3SDZA 3U3JA 4PPQA 5KZMB 2C59A 3D6UA 3D8UA 3M9LA 4P4LA 2KHZA 2XCIA 2ZSEA 3JQ6A 4PN3A 3ILSA 1OJ7A 3ADOA 1BMTA 3VPAA 1U3DA 4CEJA 2Q1XA 2FFHA 2BRUC 2Q4OA 3BAFA 3C5HA 5KYVA 3ORFA 1G6KA 3FMVA 3IXMA 2JLRA 3U40A 6PFKA 2CXUA 3HO6A 3ELUA 1DCKA 3P7MA 3I05A 2L6LA 1KC8W 1O8CA 4QHTA 2PTMA 4N6GA 2F9MA 3MMNA 4AJEA 4RADA 4I08A 1YR8A 2DHRA 1JQJC 2TRSB 3GVIA 4FJ1A 5COAA 2ZRQA 3V7QA 3WNBA 2GEUA 4W5RA 2VT3A 2E55A 4Q02A 3LUFA 4QL3A 1IJFA 4FOLA 3UJ3X 4I3HA 4EJ6A 4WJLA 3R65A 2V9PA 2WHPA 3CYPB 2XNDA 4BWFB 1VARA 2AHZA 3K04A 2LIPA 1PWXA 2EJWA 4OQMA 4UBKA 1Z39A 3TNLA 4BAUA 3TXXA 1CQXA 1XRPA 3O1LA 2EVWX 4DCUA 2C7RA 1VE6A 3GELA 3LSTA 3O2QB 5EFZA 4LAFA 1O9BA 3QEMA 1P6QA 5AM5A 1JIXA 1ZL0A 3FZYA 5T8KC 4AKEA 5AHKA 4HWRA 2O4CA 4BKPA 1G8GA 4B6PA 2AB0A 4TV9A 5HIAA 4U2GA 2HDHA 1T26A 2JFBA 1UJ4A 2QN2A 4BQOA 1ECPA 4N0QA 4NR0A 2WWWA 1MENA 1DWPA 1MW9X 3E89A 2IYXA 4MTXA 1TLTA 1V11A 5DHRA 1G5PA 5F33A 3SF8A 4S24A 5AVKA 5G41A 3WMEA 3ZE6A 2A8YA 4MW3A 2PIAA 1I08A 5DNCA 2NTEA 1K97A 4BFTA 1YZHA 2AL7A 3M89A 5E6SB 2NR5A 3CD6V 1ISGA 3GFRA 1IPHA 2R6DA 4J1QA 4M9UA 3LVQE 4W99A 3DFMA 2QMYA 1ZIYA 4C8GA 1WDLA 3GJ8A 2ZBVA 5BV7A 1V55B 1II9A 4UHEA 2CTPA 3RVLA 4J42A 2PH3A 3WHLA 3N70A 4B3RB 4PLZA 3M6AA 4CNBA 5ICGA 5JJBA 5JXIA 2X6QA 3DBRB 2QAGB 4MI1A 4U7DA 4HOYA 1BMFD 4HUJA 3X2FA 4IW3B 2LBTA 2BDEA 2H54A 1SD2A 1W19A 2O8BA 1PF7E 2EULA 1OAPA 4B1FA 4KHPB 1N5IA 4BTVA 1QF9A 5FXMA 3S0HA 2RIPA 1LNZA 3NOQA 5COQA 3DOIA 1R9MA 3G68A 4RLFA 1L7DA 1XOUA 2G5PA 3NNSA 4KK3A 4WBSA 3VDRA 3WLFA 1TEXA 2ZJFA 4NYJR 1YRAA 1VKRA 4ZRNA 2XTZA 4N5NA 5CURA 4Z0HO 3WKCA 2PSSA 3V8MA 4ZCIA 3EWSA 3EC2A 4MQ5A 1VE9A 2DFNA 2AOVA 1DIGA 4HYYA 5AD1A 2FW7A 4CDNA 1C7ZA 2HUPA 3UN1A 1Q7RA 3VPXA 4RUKA 3H7AA 1Z22A 5JS1A 2BV3A 4PPYA 1PQWA 2FFRA 2WWGA 3COZA 1UBUS 4Y3UA 1VL5A 1IZ8A 4RZQA 1R4NB 3U44B 1U6JA 4F11A 2V7UA 1JIUA 2Q99A 3IVGA 3KYJB 5HF6A 3ZZMA 5IM4A 3BCSA 3B9QA 1DFGA 5L6LB 2P67A 5A0TA 5CLLA 4MAMA 4XWKA 1DTSA 5JCOC 3DZCA 4BMDA 4UJ3A 3Q4GA 3RIMA 2CNNA 3RBVA 1KYYA 3D2CA 4CF5A 2O23A 3KT6A 3X2QB 4N18A 5JISA 1U0BB 2C5FA 2HIMA 2JK0A 1TUGA 4PHHA 5L3CA 4IIUA 1RAGA 1UPBA 3ZJYA 3MT0A 3R0XA 4QVKA 5DZSA 4F3CA 1JZQA 5D6NA 1R6TA 1DAFA 4BL5A 1DOHA 1A0OA 4BO2A 3WGQA 1OH8A 4LTMA 1OJLA 4YCSA 1T3ZA 4UHBA 1FQOA 4O1MA 2OAEA 3QTLA 5A6SA 1L7RA 2E89A 4KJXA 2LJ2A 3ZNNA 2Q8VA 2WKPA 3NIWA 1OCCB 4BFLA 3ABUA 4J3JA 1XVTA 3KHKA 4BBPA 4YPVA 1Q6HA 3JQBA 1U2ZA 1FNSA 3FRJA 1X7YA 4TQUS 2EKQA 1NYRA 2IYUA 4FFBB 1P5ZB 1WXDA 3L05A 3QHPA 2HHHB 5AOCA 1HZZC 3K0FB 3TLXA 2DU8A 1NRWA 1NAIA 2ZVYA 3W5CA 1Q17A 4IX1A 1YRWA 4IX9A 5DMHA 1BGWA 1XA3A 2ZI5A 3HL4A 3AVWA 3HLYA 3Q5DA 4LYYA 4YT5A 3ZLVA 5LQCA 3R24A 1EQUA 1L5YA 4E31A 1GAQA 1M5IA 2IXDA 3QU7A 3DLIA 4JJ6A 4JS0A 5HM8A 2V0GA 4J0HA 1HE3A 1KJYA 2BF4A 5ER9A 4YAEA 5KQLA 3NWPA 3S5UA 3V48A 3NHAA 1KC3A 4HL6A 1E2GA 2OV2A 2H4FA 2F3SA 3WQBA 3KAPA 1HM5A 2QP3A 1L8OA 2F8MA 5G1OA 1GLGA 1U3WA 3CLRD 4W82A 1H94A 3GUYA 4IV8A 3RVOA 2QBYA 3UYKA 5CXQA 2ZUEA 2UXDB 5I7RA 1IEXA 1EMDA 3N3BC 4LDQA 4BTLA 4E14A 4EHIA 1H5NA 2ZD9A 2DF8A 5HKKD 2J0UB 4NMHA 1G60A 1MO6A 3GQBB 1VQ8V 4QHYA 3O7MA 5CB4A 2FNAA 2HA0A 2BR4A 4GWKA 2IJIA 1XLUA 2A1TR 2P0AA 2EOAA 3KQYA 3R0PA 1E2IA 1U7PA 1T9HA 4HXFB 4DQXA 1HPLA 4OJQA 2DPMA 4F3KA 3E8XA 2RGCA 4OK5A 3OJWA 3W8EA 4A23A 3NHUA 4YMVA 1EZ4A 1A72A 2O7RA 2JLZA 3OFNG 2GM3A 3E03A 4MWCA 2ARHA 1W2BF 4CIBA 4C0LA 1PV1A 3WNZA 1FSGA 2DFDA 5CK4A 2BFPA 5ER6A 5JADA 3TRHA 3DCIA 3KKQA 3BTOA 3X2EA 4TTIA 4N5DA 1MR3F 4L5AA 2XAUA 5E7JA 4ZODA 2E2WA 3AHHA 3HPLC 4NEHB 2HQSC 3PQ7A 3NHRA 1RACA 1KE1A 2HLDD 2JGFA 2LP4Y 5AK5A 3VNVA 3L8EA 2QMOA 1FDOA 1TW2A 4L3VA 1FTGA 5GVRA 1U90A 1T24A 4RD3A 4WOPA 2H1WA 2Y69C 4XDGA 3IQGX 4BT2A 2A5YB 2J3QA 4ND1A 3K6SB 4OY3A 2CV1A 3O38A 1Q6UA 1P18A 2OOKA 3PUKA 4RTQA 5B1OA 1GNPA 4QXPA 4X63A 3UJAA 1E0JA 1EWVA 5FX2A 2I65A 1I7FA 3E7XA 3UENA 1WZUA 2RGWA 5AXDA 2OIGA 4BNMA 4JY7A 1GTVA 4RA6B 1QO9A 3W5SA 3PE4A 3CRVA 1JBEA 1OX4A 1VJRA 4V3BA 5ENVA 3NP7A 4GX1A 4WFKA 5AKXA 5GGXA 521PA 2IL1A 4TLAA 3WKDA 1QYIA 1JJ2F 2GZHA 3NWOA 3OZ7A 4EKGA 1KOGA 2AZ4A 2G1AA 2KWIA 1KTVA 3PC3A 4YJDA 1DVRA 1K8AW 4Z9FA 2FETA 2JEZA 3LUKA 1Y9AA 1A1SA 4EG3A 4J7JA 4O4IA 2ASVA 1Y8AA 1XCBA 4G1BA 5ECDA 1PLLA 1HNZB 1JR3E 1DBRA 1Y5RA 2FSGA 3IEXA 3JU3A 3P2JA 4G0ZA 4RJKA 4ALLA 5EVJA 5BUSA 3DUFB 4QWWA 4MWTA 2HPVA 4U7PB 4Z9AA 4PA3A 2P2DA 3KXKA 1RLMA 3BRSA 2Z3YA 1M5TA 2H0RA 2HHJA 3LY7A 5DTRA 5JFOA 4MIKA 1JXAA 5IKPA 3UOWA 1ONPA 1NKDA 1PI3A 2J9XB 4C4ZA 1XU9A 1EX9A 4CS4A 3NAMA 3D02A 4QNNA 4ZAXA 3WFIA 2FQWA 4ECAA 4ZN6A 3GF4A 3KOYA 3MCTA 2PAAA 3H0CA 1JKIA 3SR3A 1S2GA 1T4MA 3DFKA 2F00A 1GO1A 3EAGA 3G4SF 4EJ0A 2IJJA 4PI2A 1TUIA 1E4VA 3CVOA 5AYVA 4IIVA 4ZYUA 4W1PA 1NKSA 5HDQA 3EVAA 1OYYA 3QXHA 4ME6A 3CSXA 2N1MA 3OIDA 4XGRA 1K1EA 2Y68A 2D0DA 4DXHA 4R9NA 4Y0VA 2IZ1A 3W8NA 2RHGB 4JBNA 2VHTA 3GFTA 3G2IA 1AR4A 1FYEA 4RD0A 1U6KA 1U04A 3C3TA 1DWOA 2HCRA 3CH7A 2GVNA 2PTHA 2IC5A 3P9YA 1K4YA 1SF9A 2H63A 4KRYA 4ZOLF 3RRFA 4A8JC 2FZWA 5FR2A 1EFCA 3L7LA 4MCAA 4CLRA 3NBAA 1RI3A 4MMZB 5LMNB 4A8TA 4YPOA 2REBA 1OILA 1ZH6A 3DT6A 4DY6A 1UC4B 4FZ5A 4KEAA 3HKEA 4JI5B 4TKUA 1SKAA 3LWQC 1NXWA 4CTNA 4LWZA 4F71A 1JR3A 3S28A 4LHWA 4WUTA 5JEDA 4IYIA 3JCMM 2LIVA 5E3JA 2ZODA 3ZIUA 3EEIA 3X1JA 3LNNA 1FCJA 2DWPA 1MABA 1VQ5F 1L5GB 2JIDA 1R1DA 2DPLA 2PYDA 4TWAA 4UD2A 2JLXA 3IT3A 3OLZA 3UPUA 3H01A 3C3CA 3P9QA 3F96A 5EIWA 4MKFA 4PO3X 2OA0A 3RI3A 3ZQKA 3AZQA 4DCMA 1RPZA 4E70A 3JD4A 1N78A 3U7GA 4TLMB 3NZEA 3PFGA 3K5LA 3I28A 3K53A 3N0XA 5FPSA 1UXKA 1VPDA 3M6UA 3OSZA 3QWBA 4FHDA 4URWR 5K45A 4B4OA 3SJAC 1QRDA 3EA5A 4NAUA 3W8DA 5BOSA 4B75A 1E6KA 5K0CA 3RV4A 5CFOA 3CE2A 4FLUA 4YCDA 4AKHA 4FZJA 3MFQA 1JOYA 4ZZ1A 3DEZA 3H5AA 3W05A 1JI0A 2FB5A 1C30B 3NOOA 2R9AA 4EPTA 4YAIA 1QG4A 2A9KA 2BGKA 3WMWA 2CDRA 3AI7A 2BW0A 1PZHA 1QS0B 5ESDA 3Q9NA 3MBOA 3QEOA 3VYWA 3SG0A 4FM2A 2GI4A 1PJ8A 2YH2A 3T1NA 4TXJA 3H4TA 1WCWA 1Z8DA 4AIRA 1RLJA 4Z9XA 4K7JA 3MTBA 3HB3B 3VIUA 4Y0AA 4H7HA 2CSLA 3M34A 4JZ2A 1NVKA 2C9YA 1LKZA 2QLNA 1AZSC 3AW9A 4LX8A 5HJ7A 5L4SA 3C9SA 4ON9A 4WZ6A 2N0SA 4W8HA 5JH7B 3DTTA 3QLVA 4JEUA 4ZEVA 1ILWA 1Z5NA 4KX5A 4I46A 3BBPA 2H8CA 1CLEA 3QUCA 4P83A 4R8VA 4BQPA 2GM5A 3QIAA 3PNPA 4N5MA 5YASA 5KTMA 1E2FA 2VQ6A 1BHBA 3JCZA 4C0AC 1PKEA 4D3XA 4XTRA 2WV9A 2BI8A 2XWQA 5ABPA 4TL6A 3N53A 4A16A 1VHQA 1G5FA 1QBKC 2A3RA 2I6UA 3BE8A 1XF1A 2ZRJA 4CF6A 5GJCA 1GD1O 4B9AA 4XYLA 1B8NA 2BEWA 3GMIA 1HZZA 2DYYA 3H17A 1GCGA 1TK9A 4ZT2A 3GRAA 3K09C 2JFVA 1JH8A 2CC2A 4AG3A 1AK2A 1V9CA 4ITUA 2DWCA 4Z0NA 2BPOA 2DUNA 821PA 3LQ1A 3A6DA 1PT9A 4PZUA 1UMCB 3LSYA 5HILA 4JYZA 4GOND 2Z2IA 5AJHA 4FLXA 1QR6A 4FWBA 3OX2A 3VDMA 1YITF 1JMYA 1O87A 1WNTA 3CF6R 2HX1A 4U63A 4MUBA 2P27A 1AP5A 3HM2A 5DHUA 3G2MA 3ZGYA 5BNTA 4D56A 2J3MA 4Q4HB 4XA8A 1OYVA 1YVDA 2BCGY 3AG5A 2WPDD 4GG1A 2HEGA 1IZ3A 2GPTA 3IDFA 4FLWA 5FTLA 3QU2A 2Q0HA 3SM9A 3GEHA 1JZTA 2BC9A 1E3EA 1Q5OA 2DLDA 2IUYA 3RC9A 2YNMD 3EFOB 5HS4A 3F8SA 4BFYA 1B23P 2QLBA 3KQPA 1A2OA 4FX5A 4Y2PA 4B82A 1CUSA 3V4OA 3QE9Y 4YFVA 1XP8A 3LBAA 3SLGA 1P9RA 4Z8YA 5DLDA 4PZZA 1GTG1 1DKUA 2AJTA 4G5SA 4PSDA 2DH5A 2PSFA 3CZRA 3N8NA 2KBFA 5GM2A 5T64A 4DDVA 4YJKA 3JAKA 2K1EA 2J5KA 2PFKA 1SQ5A 1KFCB 2I66A 1N2IA 1NM5C 2RI0A 3REGA 3ME5A 3QFRA 1LW7A 4FYKA 3PFIA 4WTOA 2F17A 3R7SA 5JALA 2NAPA 2BEKA 1IWOA 3HWWA 4J2OA 4O0MA 3QKTA 1RWNA 1TO2E 2ZSDA 2P9ZA 4MEBA 2Q7XA 5H02A 1XYVA 1VM6A 3MJDA 3ROMA 4EUSA 5IRCD 4RAIA 1P5HA 1SCJA 4AULA 3BILA 3LK6A 5DVZA 1RRCA 1EFRG 1WD5A 4PA6A 3N4ZA 1TZMA 2CMHA 2PKCA 2Q45A 2ZK7A 3A06A 3PA6A 5IW8A 2NPFA 4X0EA 3TVTA 2AR7A 5K3EA 3UT5A 4ZI7A 4MR8A 1GKUB 3U9SA 5B37A 3ZMSA 1WMAA 4D43A 3JW8A 1XROA 3ABMC 1WABA 1SXHA 3SDLA 3GLRA 4ESEA 1HYEA 1OKKA 2AUNA 3CGWA 4NF2A 4P3OA 2V4ZA 1AO3A 4CV0A 3VKGA 5I9LA 1FXKB 3IQFA 3KV3O 4ID9A 1M7GA 2FX2A 3GRYA 1NOKA 4H31A 5LC1A 4J8PA 3F5FA 2P4SA 4TMVA 3RC2A 1TZ2A 3C48A 1M0TA 1JHYA 4KBFA 2HVJC 1X8XA 2CUTA 5GADl 1OCRB 1G8FA 3KFXA 4IMJB 4I66A 1KI1A 1DFHA 2YYSA 3K1AB 3IAHA 1ABFA 1G8AA 3P71T 3TSYA 1KZGB 2GMWA 2VZLA 1OH7A 5ALDA 1H2EA 1W85A 2CZGA 1CZKA 1Z29A 3HV2A 4QE3A 2O0KA 4CN9A 1Y67A 3DLHA 1H9CA 1H1DA 3ST7A 1RC8A 5FI0B 2BSXA 3QVSA 3LUGA 3MWDA 2UXCO 4LV8B 1KRWA 4PLGA 3V2IA 1EFRA 1P1RA 3MUEA 2AN3A 3FDIA 3ABQB 4EZIA 3QI7A 4YDHB 1JG4A 1X7ZB 4QBTA 4ZVQA 3REFA 4XPIB 1P2BA 2QXTA 3ZY2A 1N1DA 2GUZA 3APOA 1NIJA 1D6MA 2DSTA 1J8DA 3J7AR 2VDPB 3A36A 2ZBQA 5AI5A 4CT4B 1R5OA 1FW8A 3HY3A 2R8OA 1B8OA 2A1IA 2GPNA 1IY9A 2DKOA 4LY9A 1VI2A 4GE0A 5FLYA 1XZQA 3RFXA 5CFRA 1T4DA 3BZWA 5JY1A 1MZVA 1EUCA 4DNXA 5LMUB 2FY8A 1EQ2A 1QC5B 3L0IB 1GNTA 3HDYA 4PX5A 4ZEWA 4HT3B 4EYOA 4QGPA 1E7WA 3A14A 3H87A 4YMSA 2W2KA 5CU7A 2WOJA 4A73A 1YQDA 2PLWA 1PVDA 4S35A 1UXIA 3LGAA 4YASA 1M90W 5I9MA 4J16A 2IFTA 1XRLA 2WSYB 3NJ8A 4J0GA 3G2KA 2AN1A 4W5OA 5FD8A 1YE3A 1AGXA 1E7YA 1PFGA 2IPNA 3BJEA 4JB2A 3OFND 5HW0A 3MWLA 3MWEB 3PWKA 3CLUC 1WL8A 1U9ZA 3OCUA 4OHCA 3UH1A 1V35A 3GNSA 3KU1A 4PPFA 4QXAA 3ZPXA 2BHSA 2I7CA 2YHSA 3D0QA 3NV7A 2XOKG 2IIQA 3HWSA 1JDJA 2A33A 4Z3DA 1H8EG 2RKBA 3BYZA 4P7BA 3SPIA 1YZYA 3FPKA 5C51B 1L1RA 3GDHA 3M7MX 4BVRA 3SYNA 4YCAA 5JLJA 2NX2A 2LW7A 1VJGA 5JYBA 4N48A 4R0VA 2NXJA 2Q07A 4R68A 3K70B 4Q9IA 2Z56A 2AW5A 2QD5A 4LRWA 4AS3A 5F2NA 1FDRA 1YR2A 1B0PA 1H3FA 1SU6A 1GDHA 4YIKA 5TNXA 4FYVA 3SHQA 1E1RD 1DUVG 1CUJA 4M37A 3QA3E 4IOMA 3RIGA 2A3QA 4YH1A 3QEBZ 1XTKA 2L2QA 4I3FA 3AESB 4CM6A 2F43B 1ZIOA 1CEXA 1F38A 3CCJF 1E1CB 2QAGC 3L8FA 5AIAA 1TVKA 1FS0G 4RKEA 3LPAA 2ZSKA 4TWRA 3X2SA 2XNHA 1ZN8A 5FB3A 1G20B 5AVRA 3Q1KA 1RQGA 3T3MB 1F8UA 3E0XA 3ND5A 4HDSA 1VZ3A 1VF7A 1KAOA 4HDAA 4B4WA 5KQGA 1HR0O 3MK31 2JJ1D 4IILA 2P62A 2HCJB 4O2BB 2ZVQX 2UYQA 2A1UA 3VJLA 2J0QA 3CEIA 3RHTA 1QQAA 1ADCA 4KFSA 4G0MA 1J0EA 4J0FA 4WOCA 2PUFA 2SBTA 3ZCCA 4JB0A 1Q43A 1L5HA 4M8KA 4UXNA 4BVFA 1F3OA 4H1TA 4XVUA 1MNGA 2XAAA 3L8HA 2OZEA 2W43A 4H1VA 5I9SA 1MEEA 1Z83A 1SG9A 3GLIE 4AY2A 3G0CA 2JHAA 3ZK8A 1UAYA 1FVOA 1C8LA 1PR6A 3MQFA 3IXQA 5K3BA 3ZNPA 2PLRA 4YV1A 3PU6A 4Q9LA 1NI4A 4OPAA 4B45A 2GD2A 3E27A 2DETA 3E5MA 3CC2V 1M74A 4FVMA 1AV7A 4M8SA 3VR0A 1GAJA 3B53X 3H99A 1T43A 3E2IA 4P33A 3HKCB 2I6QA 1AMNA 1VKNA 3U3OA 5KYGA 3IQWA 3F73A 1YCFA 2FAXA 4X66B 1SKQA 5KYYB 1OTXA 2YHAA 3M2PA 1IV2A 2HR1A 2JFOA 3WDLA 1JJ2U 1DKPA 3GLQA 4U3JB 4S0ZA 5IK2A 1YVEI 4B9EA 3KJJA 1SH7A 2CLHB 1IQ0A 3L7JA 3QX7A 3TBFA 2NQ2C 1DB3A 4DLVA 4LJSA 4REQA 1FJXA 2P6YA 3SSAA 4C81A 2CLEB 1RJFA 2CVFA 4N82A 4W9NC 3KJQA 4K9NA 4MW5A 2GF2A 3Q9SA 1CTQA 3RJMA 2MYTA 1IV4A 4TTQA 5HCIA 4ABMA 1FPQA 1NP7A 3TLAA 5LL6Y 3DMNA 4K8RB 4RACA 4R69A 4UTRA 5CCXA 1C9EA 1U8XX 4X93A 1WUHS 3K15A 2ZTLA 4Y7CA 1ZH2A 5IYDO 1J1IA 2EXXA 3HY4A 3VZRA 4CMHA 5K99A 1XX6A 5HK8A 4MVJG 2ES4A 3CE6A 4J29A 2WVGA 1RM5A 4HQNA 1IBRA 1ZJ5A 1AHIA 3AKYA 1T36A 3L93A 4DA0A 4NOLA 1CFZA 4LYFA 1AKTA 3HRKA 3IURA 5FBHA 3MYYA 2RI1A 1BDHA 3KR9A 4OYRA 1OBVA 3CO0S 4C20A 1LS6A 3GH3A 4ZV7A 3S3XA 3WSWA 5FAKA 2BGWA 4BEWA 1OTYA 3E83A 2IRWA 2OD2A 4WRRA 1QYVA 2W6ID 4YRKA 3FUUA 2DT4A 3GVPA 1ZZGA 5GOZA 4E2LA 3WWDA 4Y2GA 1M2OA 5JNRA 5EIOA 2D2XA 2GWRA 1JWBB 3AUYA 3UJHA 3F71A 4J7XA 2GKGA 3LHKA 3FFAA 2O7QA 2XZLA 3DOEA 2BO1A 1P2GA 3SIUA 5E6UB 1Z08A 1XQYA 1JG6A 1VQ5V 2E3JA 4IIYA 1FLNA 2XOKD 3G2OA 4MVJI 4DBLE 3HCOA 1YTUA 1FSPA 4B08A 2B9ZA 3WRWA 3CEAA 2R4QA 3ZS8C 1I3OA 1Z13A 2LW1A 3H9GA 3NDRA 2IDJA 2EYQA 1IHDA 3A6JA 3FTDA 3PYMA 2NUTA 4N4AA 1JQAA 3R0QA 5JVDB 5LA6F 3STUA 4F7DA 1YRHA 2PQ0A 2H7XA 2XY4A 3L6CA 1YDFA 2M98A 3SIVA 2OWEA 1THGA 3KB6A 2MSLA 4NR1A 4N1AA 5JDIC 5C9ZA 4RVSA 5JTUA 1QGYA 3W1VA 1P7WA 1QOQB 2GCEA 3A4LA 3DFUA 3AHEA 3P9IA 5GIPE 2RD2A 2KBEA 4ESVA 4B84A 3K35A 4QPCA 1VIBA 2VJMA 3SFVA 4N0EA 2TSYB 3WL7A 2RK3A 5KVAA 2WLNA 1J23A 3B2NA 1LI5A 3S2EA 1V4BA 3FOAA 3M3DA 5DF1A 2G9ZA 3LCUA 5ARBA 2XAHA 1G8HA 2POCA 2N05A 2WD9A 1TLLA 3FNFA 3M4YA 4FHCA 4GRDA 2EG9A 1PNRA 1M2VB 4JJFA 4DIFA 2ANBA 1P7YA 4Z6KA 3HBFA 3LYAA 2QIOA 1ZXLA 1XQ9A 3GLHE 1GQ2A 3OUFA 3P2YA 3ZGVA 3AIIA 3MNFA 4CLDA 3RYCA 4UTXA 3HEMA 1X8KA 4MQFA 1KC8H 4CC5A 3NP9A 1KKLA 1VPTA 3F0DA 1QQCA 4GPEA 1DEAA 3MJFA 4WWHA 1PFWA 2QV7A 4ANFA 1UBCA 2XSZA 5EJAA 1U2GC 3EG5A 4BWGA 1N2HA 2CEAA 2HF2A 2Q0QA 1ZJ6A 2FLKA 1HRDA 4H77A 4G88A 2J7PD 2OBXA 4LUCA 3CUWA 2AI3A 1OB2A 1T2UA 4WLVA 3TQQA 4YXFA 3SQWA 1Y7PA 3PNYA 2XNDG 1TUEA 2YXEA 3OE7D 4MX8A 3F6MA 5GINC 4UU7A 3KHNA 1OHHG 1XTJA 4P4NA 1N32B 1N2BA 4PW0A 5AWFC 3CGGA 4F06A 4PDMA 1AKVA 3INGA 1QZZA 3C45A 3KSMA 4ZI5A 3OJLA 10MHA 2CB9A 3KJEA 5EVCA 4RLHA 4C6TB 4PLCA 1FYXA 1TEVA 3O74A 1DC5A 3CXUA 4Y9DA 4UE3S 1IPEA 4JJ4A 2O3SA 1XKLA 2G4LA 3OMNB 4XX1A 3NASA 4DV1B 1DTWB 4U7HA 2B69A 3RRNA 1ZDMA 1WN7A 1XZ8A 1JLLA 4MLDA 4KE8A 3GIDA 3GJYA 1P81A 3D8SA 5I7HA 3ZEAA 4O4LB 2M6LA 1SU7A 2PZBA 2QTNA 5JSKA 4YJGA 2MHCA 3T7SA 4B34A 4D4HA 1GRRA 3UHFA 2W58A 1KO5A 4GCZA 2VKQA 2W48A 4UVAA 2G04A 3KJNA 1D0SA 3B8MA 4KQKA 3GZNB 2HRDA 4YXWD 3MBKA 3E8FA 1PD3A 3W2GA 4C01A 2P7HA 2J3HA 5HY1A 3FYUB 4G0VA 2AMTA 4URYR 2IH4A 3L5KA 4V1CA 1QHYA 1P0CA 2QVCA 3ZHSA 5JI2E 2OCCC 4RQAA 4FFSA 1PQUA 1H66A 3V7EA 2HD4A 5E3IA 1CG6A 1Y33E 3DVAB 5EL0A 2O2JA 4QUJA 2QF7A 1S3IA 3BERA 4Q9NA 4UV8A 2NUPA 4O4HF 2YSUB 1MA3A 1IZ7A 3E2EA 3VKHA 4CL0A 3ICCA 2DKFA 3IOYA 2VP5A 3VHXB 4X24A 4DY4A 3I2YX 1DPGA 4IOLA 5IAAA 3I4CA 4RVNA 1CERA 2P5YA 1FY2A 2PWYA 1TM5E 2H4YA 3H18A 4YCJA 5IPFA 3WBKA 5JSFA 3GEEA 1IQPA 2M32A 4FT4A 2WJJA 3GGPA 3JWGA 3TFWA 1TC2A 4LYEA 3T9CA 3GK3A 2Z5UA 1GITA 1NMUB 1GSIA 3AY7A 2B3TA 3R1IA 2WALA 3UB3A 3JSXA 3RJ5A 1RJDA 1TZCA 2I67A 1NP6A 2IVFA 2Q9UA 3HI4A 2MTBA 3AFNA 4OQNA 4YMIA 4BIOA 1JCHA 3KKZA 2J9RA 3N0TA 4MDHA 3WWEA 1B14A 2J5RA 1L8XA 1LB1B 3R7NA 2GX6A 1I24A 1S2OA 1THZA 2FDRA 1NLMA 2X0NA 5CIWA 2NXCA 3VYRB 5TEWA 4ICGA 4RJJA 3L84A 4DWVA 1NURA 1JTEA 1WUJS 4D3FA 2NZUG 3BREA 3MVEA 1SC9A 1PNTA 1YGYA 2G6TA 3MA0A 3CKMA 1UZUA 4C7KA 4R7ZA 3NDIA 4OQEA 3ZV7A 1M72A 1EWQA 2B9VA 3IIEA 4XGIA 1ACMA 4KL1A 4EHFA 4XGQA 1JJ7A 3NR7A 4XVRA 3MOIA 4G0OA 3A4VA 2PX4A 3RGGA 4OYHA 4KYIB 3VYTC 4V0QA 1GEGA 1E2BA 2C0PA 2PBZA 4CKBA 2PZKA 3AGQA 4U9HS 1VI6A 4LBYA 5FUXA 2HI0A 1TJNA 2VJLA 2G06A 4QA9A 3ZYZA 3DXZA 2EEPA 3HUEA 5HRAA 2R68A 3KQNA 4QBIA 1GN6A 5A71A 2B5OA 1DF4A 1JXMA 3CG4A 4JV5B 1I2MA 1OT5A 4MKRA 4PCUA 2OBFA 4A0HA 2WG1A 3RR2A 1RHKA 3OM8A 1FNJA 3QOWA 3UOAB 1EP9A 3CNEA 3SAJA 1SPBS 2P75A 4RDCA 1I4LD 3OZFA 2I91A 3B6KA 1PNQA 3FD9A 4WBNF 3OEYA 1XJ5A 2QTWB 3KT0A 1OLXA 1ZGJA 1L4GA 3GLUA 2R65A 2JGJA 4REMA 4V2IA 2JLYA 2YS7A 3HUTA 3CEMA 1XEWY 5D8DA 2NSDA 4NYIR 4LDRA 4HUQB 2VJOA 2Q5QA 3KPUA 1EP1B 1I2ZA 2OZLB 1YWGO 2ZIWB 4XQ9A 3VTZA 4WZBB 2XB9A 1FX1A 1E9VA 4U7GA 3N2YA 4MWOA 4JF3A 3H75A 3VR4H 5CBGA 2FOLA 3VSCA 5B36A 4G1FA 2UVDA 2I54A 4WFIA 3FZQA 3GGOA 1AMOA 1FDSA 3LT5A 4ZTBA 2HU5A 4GF5A 4IFIA 4ESOA 1YJQA 3ZHUA 4FMDF 4AF7A 1E5TA 3A0UA 2V45A 4YWHA 4ZPJA 1ENZA 2OTLV 3OFVA 2BTQA 2WVJA 4OHRA 1WBBA 3F1KA 1MX1A 1NJ6A 1UAGA 4MVUA 2CJWB 4OOEA 3RJZA 4UAJA 1MB4A 4R3UC 4PC1A 1J2JA 1JHAA 3WA6A 3PI7A 4I2NA 3JTEA 4JVSB 1L7XA 3ND7A 4D02A 2JJ8A 2X0KA 4DREA 1T5TA 2M6RA 3C8DA 4ZYLA 1SCIA 1YL5A 3KDAA 3K0CC 1EUYA 3AEYA 2FUCA 4ENVA 4URXR 3JD3A 1LA2A 5DIFA 1T25A 3I7TA 3I12A 4R4JA 3HFGA 1RYBA 4LQDA 3TJTA 1X42A 1B3BA 4XM0A 1X1QA 2VEDA 2HGSA 1MGPA 1YACA 4TKZA 3ZI4A 3CC4V 1Y98A 4FDUA 5DWVA 1XELA 5B1SA 5IC6A 3SHFA 5LGNA 2C9CA 4QOGA 1MB9A 2CL5A 4ZAGA 1QAHA 2WJ3A 1BVYF 3C7DB 3G2QA 2PZGA 2WU4A 4LC9A 4IGKA 3VNAA 2ANCA 2PMPA 4NENB 3UBTA 4XDYA 1ZSPA 3KEFA 4B4UA 1C3JA 2F9LA 3HP7A 1L0BA 3PHJA 4IZ6A 1CIPA 4U9IS 1NUPA 3ZCRA 4PLPA 4HRVA 4N23A 3IJ5A 3PR3A 2D2FA 3OETA 3WIUA 4EA9A 2I4IA 4YCBA 5JAMA 1MV5A 3LC2O 4IF4A 5EWJB 4BBAA 3L7BA 3K30A 4YPFA 4RTPA 3C98A 1NL3A 1TQ4A 2BE7A 1PEYA 1CJUC 1P75A 3GP5A 4CDGA 2QGZA 1JFTA 5AW7A 4R2MA 2Q73A 4GVPA 1ONBA 3BWBA 3FOBA 1ZMXA 3OBBA 2V6MA 2D0OB 3BSSA 1YQQA 2FX3A 1VP7A 4WIAA 1R0XA 4P81A 2HRYA 4II7A 1ISRA 2G70A 1EZVH 3SLRA 2GRUA 3G82C 2XRYA 4PSUA 5KIAA 1DCFA 3SDSA 4BRUA 2AIFA 2FGYA 2ENWA 2QL5A 3NETA 4YEDA 1CUFA 2AGAA 4L8JA 3EMBA 3FDZB 3PUXA 2ZT7A 4DWOA 4KQ1A 3STTA 1C2TA 3EG9B 2EF1A 1T1GA 4QU0A 3B7PA 1TGVA 3LLSA 3K9GA 5HCNA 2WLLA 2CXHA 4G8DA 3JWIA 1Q7YH 2ZP1A 3MPOA 3ZWXA 4DCSA 1N6LA 1OW3B 2XUFA 3F7TA 3MINB 2OENG 1YU9A 1K73H 4ZOLA 1DAOA 2XT0A 3O91A 4LMAA 1GTJ1 3BGDA 3GLKA 3T54A 4IYHA 2WFAA 1I2BA 4XUDA 4IIDA 3MTEA 4XUGB 4YUVA 1DBFA 3IT0A 3COYA 5I9TA 3RS7A 1ADJA 1N8RH 4EB0A 1ZM3A 2XMPA 3P10A 1XRSB 1WV0A 2WTNA 4K9PA 2CXSA 5L3SB 5CNMA 4WOJA 1K7YA 5CEFA 4P9NA 3VZSA 4R1PA 2H6EA 3AU8A 4G8BA 3OGCC 1WY5A 1DIAA 3W2HA 4WGGA 4C14A 4NNPA 3W7XA 1EZ1A 4MWSA 3TNYA 5HX7A 2F3TA 3RPEA 4OL9A 2ISSD 1M34A 5KWSA 1W59A 4X62O 2XDQA 5FBRB 1ZGAA 2F8SA 1L5VA 2ONJA 2P6JA 1E96A 3L8MA 5IE9A 3R8FA 4P6VF 5C1PA 3CVJA 1Z6PA 2Z4SA 4EECA 2Q5CA 2W42A 2DQKA 3TOZA 1ORWA 4DMFA 2AWOA 4LWSB 5BRNA 4RQEA 4WI1A 1YV9A 1TKRA 4MRMB 4IOJA 2UZHA 1VQLF 1TK3A 3PT9A 4IICA 2AMJA 3L92A 2FN4A 2RK4A 3G8DA 5CYOA 1VXOA 4ZCMA 1NVTA 2CLSA 4LZWA 2GDSA 4Q5IA 2WKQA 3THYA 1HYGA 5REQA 3QKWA 4QPZA 3BKXA 4HYQA 2IIVA 5SZJA 1E1QA 1VP9A 3I76A 1AQLA 3ZNQA 1VFNA 2W71A 1FYVA 2E4AA 3H3JA 1T0PA 1GGFA 1YQTA 4BLQA 4IDEA 4LFCO 3HFJA 1VA4A 3Q5GA 3EH2A 2B4KA 3VU9B 3QWFA 4ABTA 2F55A 4DB2A 2WFLA 2EJBA 5DM4A 2GXQA 3SLKA 5CDTA 3N39C 5DBHX 4I50B 1P9LA 5IDXA 2NZVG 2P78A 1GWNA 3IQZA 2C1ZA 2FPGA 5F73A 5TEVA 2RHDA 3IELA 1RPRA 4YRMA 3QF4A 4ZZ0A 3UPTA 1OI3A 1TMKA 4MHTA 2Y1XA 5IH3A 1QGED 3DQQA 5JANA 4JI7O 2NZYA 2DULA 1MZPA 2EDCA 3F78A 3T7KA 2EYUA 3CCRV 2ZAOA 3VVMA 4QO8A 3R0JA 4G2TA 2ODQA 5LQMA 2CWWA 1QMGA 2O9JA 3WLIA 2O6HA 2I80A 2MR5A 3L7OA 4PYOA 3HR7A 1NJFA 2ADQB 3K9NA 3IUBA 1VQ8F 3AHDA 1I4EB 1QNFA 1II8A 4ZOCA 3W90A 2A58A 4Y1GA 2P4HX 3GJ7A 4GL2A 4KN5A 1QCDA 2DWUA 1IM8A 4HFNA 3CCMF 2RHHA 1IBLB 1AD2A 1FLAA 4AMGA 5ELXA 1G5TA 1B8VA 4AJKA 2JDID 3W9SA 4G86A 2F1HA 2OVFA 4ZCRA 2WTUA 5DNEA 2Q3HA 1LLFA 1DJNA 3M33A 4NP6A 4C6HA 3T1YO 2JEOA 1ZITA 2W2VA 2RG1A 4TYQA 1SEVA 3IBYA 3EAFA 1NLUA 2Q5HA 2BGJA 2D5CA 4TKVB 4GSYA 3MXOA 2HU2A 4BYMA 4CM8B 4CKEA 4XDLA 4YAWA 4ZT7A 3C6YA 4RY2A 3PB3A 3DLBA 2XE8A 3K59A 3B13B 2E1RA 4GMXA 1V3UA 4Z7JA 3KQMA 4TYWA 1IY2A 1KI9A 3LKVA 3RUIA 4HGNA 3COSA 4LYJA 2CBXA 2QX6A 4TV8F 1NOJA 2YUIA 4I3GA 1G98A 1YB1A 2ERYA 3PAFA 1ZW6A 5G4KA 3ZTTA 2N47A 2ZATA 3ZZ1A 3GOQA 4PR0A 1EZZA 5FNZA 1RE0A 3UFXB 5AHRA 5T4EA 4FQ5A 3S44A 1YMVA 1S3JA 2PA0A 3EJ6A 3IKVA 1VQKV 5FBQB 3RD5A 3LWBA 4B43A 5THXA 2RGNC 4RIEA 2JS3A 4P92A 3NBKA 2XTAA 4R5MA 2D5BA 4Y6GB 5EE9A 4QAJA 1W36C 1XZEA 2QW1A 4ZGWA 4CETA 2PCJA 1JLKA 3KOWA 1A9XB 1KYTA 3VH1A 1LX7A 3EQ7A 2YIJA 1BAPA 2NPIA 2KB0A 3DO5A 3BCHA 3GTZA 3LSUA 4WZAA 1HT0A 1XD8A 2JKZA 5I48A 3L8YA 2YJZA 3LZCA 4QOHA 1ZK1A 1A8SA 3UAGA 4E21A 3VPCA 3TQCA 6GPBA 1DO0A 3LIPA 1TEZA 5ITZB 3SYQA 1SOUA 2OYRA 3TWOA 3OM3B 2J6BA 3VR5A 1J8QA 4WOKA 3R6LA 3HXMA 1QGUA 2HKOA 2CJYA 3O3MB 2L26A 2AFHB 3P2EA 2VYVA 3AP2A 2OV3A 2XMCA 3OZVA 4KIUA 3W9BA 1OBFO 4XDHA 3UH0A 1S7GA 4N9WA 3P2MA 3K2XA 3VI4B 1ZHOA 2FSPA 2HL6A 3BIOA 2WSBA 5EKDA 1P3Y1 1KJIA 3AX6A 2IYLD 3QVLA 5M34A 2CGEA 1KE2A 3I5MA 1CUCA 2PZLA 3LDHA 3OPYA 2BFDA 1LPMA 4NKGB 4BY9E 2W6QA 4TPKA 1DC3A 1LBTA 3FB7C 1GL9B 4MMYB 1GLNA 3WB0A 3FI0A 2HX0A 4IL5A 5JRZA 5LMCA 4X5OA 2QSZA 5I9IA 5CA1B 2M1ZA 4WCDA 2DUJA 5JYDA 3IJPA 2FEKA 4W4KA 4NU0A 4R3NA 3RS5A 1IJKA 1H1LB 4RIFA 4BKOA 4J2HA 1JR9A 1RXSA 3T52A 1N0WA 2D1YA 3P2OA 3X1MA 4BQQA 2PVSA 1I94B 3EIUA 2IU3A 2XUGA 2ZBDA 4B6GA 5FWXB 1N5LA 2G0NA 4XE5A 5EG5A 4CIDA 1D2NA 5EE3A 3M1XA 1KKUA 1NULA 3LUJA 3MYRA 5EHQA 4HVLA 2Q6AA 2FL4A 1F0NA 3F2IA 4FM9A 1V54B 2Z1UA 4JP5A 1H6CA 1PZNA 5A1JA 1T8UA 2O05A 2P0EA 2R8PA 4GOMD 4RSGA 5JCJA 4FOOA 1TB4A 1C3OB 1NSYA 2P9YA 2YUTA 1WB4A 3PF8A 2RB4A 1WDTA 4I9NA 4KLZA 3UT0A 1DBWA 3L74H 4IIHA 4XASA 5F77A 3T0GA 2E5WA 2GAAA 3FSRA 3TOCA 3WBJA 3U7IA 5EIEA 1VZ2A 4LH6A 1XXLA 3SXJA 4CMEC 2AXNA 1SVIA 4XYEA 5I7WA 3N2ZB 4HSEA 4NCAA 2WUGA 4Q4JB 1GU7A 3FDJA 1QCYA 3IC5A 3SC2B 3TRFA 1ORTA 2RB5A 3CZ9A 3KLMX 3BIFA 1SEPA 2HNBA 2WSMA 3BA1A 3FNIA 5IEJA 2YEVB 4K8XA 2HK7A 2PGDA 2PD4A 3V8VA 3KETA 3AUAA 2ZRFA 2JBHA 4JYAO 3VBBA 5JZSA 2JJMA 3VDQA 5BUQA 4AJPA 1K4DC 1BZYA 3LX5A 4RNCA 2QKCA 1TU0A 4G0PA 3GYQA 5HUHA 6REQB 2QW8A 2DH6A 4HFJA 3OPNA 1OC4A 3OEED 5TV2A 3SJZA 3R0ZA 3TOXA 2NU8B 5KYUA 2EZTA 3UJ7A 2ZYIA 2XCSB 2GF9A 4ALKA 3TI7A 4KUHA 2YN2A 3CZ4A 1KK2A 1R8XA 4ARBA 2J48A 2CDNA 4QGFA 2G67A 2I4LA 5FADA 4HVCA 5JG7A 2K9PA 2RAPA 3LVRE 3MSCA 4WUVA 5JRDS 1FVXA 4YRCA 4BV3A 4JTDB 1B7GO 1USWA 3ZQJA 3D5QA 2D4AA 4MIOA 3PFKA 4GX2A 4GT1A 4QFMA 3ORQA 3WLNA 1BVHA 1NXTA 4HZ3A 3LWZA 1SA0B 1NE7A 3KQTA 5B1IA 5CB8A 5KSYA 1MOFA 1I0ZA 1LI7A 4HLDA 1TGYA 3U4IA 4KJZA 1K9MH 4NZPA 1NW8A 4JLVA 4OBXA 5HS6A 5PNTA 2PEZA 3O26A 1EFVB 2YMQA 4Z9YA 3ENVA 4EKNB 2ZR8A 4E4YA 3CTMA 2ZTVA 3L6DA 1ZSYA 1D1PA 5IN5A 4LSZA 1KBQA 1D2MA 1FEZA 1CRZA 2G40A 5CVEA 4MMXB 5PGMA 3UT6A 2G7MC 4TLLB 5JFGA 2JC3A 3IT2A 3LDFA 1RJ9A 1C1XA 1KR2A 3CCUV 1Q7TA 2ZJOA 1X7HA 3O73A 4EATA 2X4GA 5AI9A 4QE9A 1UOOA 2CNWA 3E5HA 3H5TA 3DAOA 5KCZA 1X2EA 4MCJA 3KJKA 5B3SC 3DC7A 2GFHA 3MGKA 4FDVA 3PD7A 3P45A 5E7QA 4UNRA 4RULA 1WE2A 1WXGA 2Q7HA 4J91A 4TT8A 3UATA 1Y82A 4P84A 1X0XA 4EG8A 3WLEA 5A3QA 4M98A 4UCOA 1MRSA 2LR0A 5K6AC 4RS4A 4ZU3A 1ZD9A 3T15A 3OZIA 5KJCA 4Q1VA 2IA5A 2FMXA 5BRAA 4TUYA 3P97A 2H16A 3B78A 1KIMA 3PWZA 2DZDA 1EFRD 5BWMA 4G5GA 3KXDA 1Y1PA 2WQZA 4OG2A 4BOYA 4BQIA 5DM70 1ODTC 1ADYA 3PQ4A 5EERA 4EPXA 1VJDA 1YS4A 4CG2A 2IODA 1HLFA 1MC8A 3FCOA 3ZDAA 4IGIA 3CPJB 2X8WA 1JEYA 2VS0A 2LCFA 4J80A 2ERCA 1CX9B 4KNVA 4J41A 1EHCA 4XSGA 1DBPA 3E61A 3OM1A 3EVCA 3FZNA 5ICSA 1RAIA 1VXRA 2IP1A 2D7DA 1S72F 2GDJA 3DPIA 1D2DA 3JVDA 2ZYDA 3VR3A 1XYYA 4IQFA 2D7JA 1PD1A 2H18A 3F47A 2COKA 1CXZB 1LDEA 2B25A 2UVQA 3EXFB 2X8BA 2B7CA 3FCAA 3L6RA 4R2LA 4UPDA 2AD1A 4YAJA 4B5CA 3TF5A 1HNWO 2Q0AA 4ZCTA 1ZL2A 3O1HB 9LDTA 1KR5A 5JYEA 5LBUA 1MKYA 2VA8A 1R6BX 4KXMA 4RV5A 3STVA 3TLJA 5J4HA 4AQYO 1LVUA 1BVRA 2J7KA 2I2CA 2HSDA 2CNBA 2R97A 3D8HA 3G8CA 3OFNA 1Y1RA 4BJHB 4XWWA 1C9KA 1ODEA 3K7EA 3HJGA 4L4ZA 1KHTA 4CHTA 2HMWA 3ZMUA 1X8JA 2VF7A 3S81A 2BI7A 5AVZA 4HXGA 2I6SA 4L08A 4YREA 1IEQA 3FPFA 4MV3A 5EZYA 3OU7A 1ULSA 3A8TA 3DVRX 4XFJA 5JHHB 3GHHA 3E70C 3L8GA 2B2NA 1XC7A 2HLDA 1IRIA 4JEIA 4MQUA 4OEHA 5EIHA 3MGBA 4AF6A 3MCZA 2VYCA 4NXMO 4NFHA 4Q6WA 4ZHYB 1VYTA 2ZXWB 2JHGA 3M8KA 3I0MA 4Y9RA 2QJ1A 4ZAFA 2PV0A 4K2HA 3QBDA 3OKCA 1Q74A 2LFRA 2X9LA 4M54A 5KU1A 2IX3A 1ZVQA 3H1AA 4J43A 2P5UA 4F6EA 3V4PB 5JS6A 9ABPA 4MEAA 4TWKA 3UWDA 4B3RO 2EWWA 2PCLA 1UANA 3EQ9A 4LYGA 5CBPA 4JBIA 3H2IA 3UQZA 1W94A 3L4BA 3OLQA 5D3ZA 3APQA 2B4QA 2VDWA 4ACBA 1GAXA 1P7CA 2W22A 4OSOA 4URFA 3SYRA 3PK0A 1U8YA 1MIOB 3FBGA 1I01A 3HABA 1JALA 2Z2YA 3FAVB 2IYVA 3EBLA 1Q1NA 3V1KA 3KU4A 1U40A 4JASB 1TO1E 2PKEA 4HY3A 5FOVA 4I9QA 1OAKA 3ITDA 3WG7B 5I7VA 1VLLA 3PKZA 1J22A 2WKRA 2FK8A 1MAVA 1JDTA 2CFRA 3BS4A 3P27A 1EU1A 2FZEA 1HE4A 3PCRB 3R23A 4MV6A 5IUKC 1Z4LA 3I6IA 4FLMA 3V97A 3VNRA 5HYVA 5KQMA 3K32A 1LJLA 3EHEA 1N8SA 1LQTA 3CJHA 2HDOA 4QEKA 5FOWA 2OE2A 5LD2C 1RXIA 4YP0A 4Z8XA 2WUDA 4UVGA 4YAGA 5IZCA 3NNDA 2C8JA 2FPKA 3GGJA 2Q6LA 3C6QA 3HHEA 1MG5A 1SRQA 4QUBA 2HUNA 2JARA 2I2AA 2HBZA 2B4YA 1GUFA 2GLUA 2VDOB 2WTAA 2QTBA 2DBRA 4RCVA 4L0DA 5BQPA 1FXVA 3WZ2A 5AKZA 2R6ZA 2HM7A 3ZWNA 3F67A 4AJIA 3HCWA 3ZU6A 3USCS 4QEZA 2PQ2A 3FB6C 1R74A 4EHKA 1QH0A 4TQ9A 1L9XA 1XZJA 1J7HA 2J46A 2MSKA 5KMGA 3VAYA 1TF2A 2IYEA 3D64A 5FTJA 1TXGA 1PF5A 4AZVA 3R7FA 3CXHF 1Z17A 3R0IA 3WLSA 2QT1A 1B1AA 1O58A 4I4TA 3UNXA 3C9RA 5EESA 3FCUB 3WDKA 1AU9A 3H8WA 4ZHQF 2Y05A 2WAAA 1UP7A 1W1IA 4HDKA 2Q5IA 3T94A 3ZCVA 4EAQA 3T1HO 1OLSB 1REQA 4U3FH 4GH5A 2WNIA 4X00A 5AXAA 4A8JB 2VK4A 2GHRA 3L0PA 4B3FX 3QXCA 3FXAA 2REQA 4FW9A 5ERXA 4CKYA 2RE8A 1QGOA 2GXUA 1H2LA 1PUJA 4IDPA 1NFRA 4KWEA 3AV3A 3EF3A 4Z0PA 3D31A 2YHUA 4B48A 2B94A 4XX0B 2OO5A 3GRPA 4G97A 3SJBA 3WQRA 1N2CE 1KETA 1YKSA 4CE6A 2WHYA 4BFUA 1C0KA 2QPLA 3M6MD 3KR2A 2G9IA 3H1TA 1WVGA 3KVNA 3T9EA 3CSDA 1PWYE 2O1WA 4LJ4A 2WMOB 5IH7A 2ZBEA 3AM1A 3MWFA 1S4MA 1EB8A 3RC3A 3DKPA 1AF4A 1E3DA 3C6KA 1TCBA 4IXNA 4MTLA 1HOXA 1QNMA 1SUSA 5EJIA 4IH1A 5HQJA 1GA1A 4GMKA 3THSA 1OR8A 3PVZA 3UJBA 4YMHA 2XMGA 3UMFA 2HWYA 4M1YA 2FRDA 1EFPA 1B43A 1SJ9A 1X3LA 1GL6A 1UBNA 2RN9A 3ER6A 4M1QA 4J10A 3K3WA 2H11A 5EE0A 2CK3D 5BW5A 3CCJV 4YY3O 2C96A 4N0DA 2P90A 2KKWA 2Y48A 4BT7A 2D3TA 1YBVA 4EARA 3UAWA 1GEEA 1U7HA 2A57A 1W8IA 3FX7A 3A1TA 4PSAA 3STYA 3ZWMA 3TR0A 5AW6A 3I4LA 3O6VA 2BEUB 1GPJA 3BRWD 3KQHA 3CEHA 3U3DA 1GKLA 1RAFA 2GEKA 3KAJA 1IV1A 4URZR 3A3OA 3HL0A 1D6JA 1RVDA 2B2CA 3O7WA 4ZV4A 5KX5F 4JXZA 3UYLA 4JJAA 3X1DA 5DRYA 1BHO1 2JJYA 4A0QA 1KVSA 2D0PB 4JLJA 4RKFA 1T29A 5BNFA 2CHUA 3UWMA 1VI5A 2V6BA 1KI8A 3NVKI 4ZHWA 2H85A 3PD1A 1RFLA 5B55A 1P3DA 1BE6A 1ZONA 2YWRA 4FTWA 4HMPA 3AFHA 5DLPA 3OWOA 1XHXA 4UBLA 1V41E 3FHJA 3GJ5A 1LJ8A 4ZAVA 4DWJA 3CZMA 4DDWA 2RI6A 3TIFA 1RCTE 1GKKA 2PKRA 4PZCA 5EJGA 4ESHA 3P4YA 4ZZ3A 1JHXA 3B3JA 1KWKA 2WZCA 1FBTA 1Q7EA 4LEIA 4NX2A 3PRYA 1GGVA 3AKZA 1TI7A 4XH9B 5CTJA 3OCJA 4G4SO 1QTRA 1R4MB 3HMKA 3QOYA 1T4CA 4NCIA 5AUNB 3BA6A 3EW7A 3AWIA 3QX8A 2VHEA 4Q66C 3IKEA 4DZTA 3HR8A 2I99A 3RARA 3DKRA 3BHJA 5AVQA 4EHJA 4A15A 4I55A 4TSFA 4KHZA 5HNKA 5F9HA 4LSMA 4UCRA 5CM2Z 5HQ3B 1FF9A 6LDHA 1WB8A 2W8BC 4TQAA 1VYHA 16PKA 1QP4A 2D5LA 1HA3A 2I2BA 3CUTA 4P34A 4NNJA 5TQJA 4D0SA 3AFGA 2EP8A 2WPDA 1OXSC 3GDWA 1DAIA 1VCMA 4NATA 2DTDA 5F21A 4R51A 5A9GA 1T0JB 3U4AA 3G7UA 3DXFA 5J2UF 4P3NA 4FYPA 3PX7A 1HY3A 4DVJA 4Z4IA 3M6WA 1U0LA 3TOSA 3R7DA 1IZZA 1Q3HA 4DRYA 5JSQA 1Y3IA 4XEUA 4UMFA 4GSLA 2HS0A 2REOA 1X0VA 2EDAA 3FYCA 1PRYA 4NIMA 3NMUC 1UDCA 1WY7A 2B8EA 5F12A 5BQOA 4NKRA 3AM4A 5DP2A 2CMGA 5DTQA 5A2QN 2VPZA 3OFSA 4AJNA 1V7PC 2C3PA 4NESA 2V3VA 4AZ0B 3O8BA 2XGMA 1ZK2A 4RC9A 2X4IA 5B4UA 1QIJA 4J03A 1COWD 5GP1A 5CA0A 5K1PA 1W4RA 4JBHA 1T6BY 1RYEA 2UZ0A 2JH3A 1GGHA 3MWKA 1E61A 3IR7A 3PVSA 4RZ3A 2CWJA 5C8XA 3EN0A 2BE9A 1KF0A 2AW9A 1GO0A 3ANLA 1HX7A 1NV9A 3QBVA 1R8YA 4MVZA 4PRZA 4R16A 4RF2A 1UFQA 4JSRA 1M57B 2DWDC 1YR1A 3OE5A 1TQHA 5G4UC 3C1AA 2R1VB 2SHKA 1WA8A 3HDVA 1GUAA 2MSDB 1U3VA 1IU9A 1SD1A 4UCFA 4UHCA 5AHXA 3VSEA 1NVEA 1SMKA 3H6GA 3ML1A 3AEKA 1A27A 1W6RA 1X9GA 1U0RA 1YZLA 2FN9A 2FSUA 2N04A 1OWNA 3PL5A 2J85A 2NUAA 2XWPA 3I1YA 4X8LA 2VA9A 3RSFA 1DAPA 1MOPA 3OBYA 3A6EA 4JVMA 4U5XA 2ZUWA 4RDIA 4DCJA 2P2YA 2ACVA 2BP7A 1E1LA 1GZSA 4UUQA 2FVYA 3ISJA 3V1MA 2OCPA 1RI1A 1QRSA 2Z4TA 1NUTA 1T2CA 2IT1A 2VDLB 4I81A 5J2TB 5BN5B 2JLVA 2J9ZB 4AY6A 5FFFA 4HNUA 5CXUA 1NJIH 1T5LA 4P58A 2QE7D 1LSJA 4KO2S 4R2KA 2I1WA 5F7JA 1P31A 1YDGA 1LDBA 1C1DA 1ZJYA 2O2CA 4JUIA 2ZJYA 5C5IA 1MLDA 5DGDA 4AXXA 3DFFA 2Q4DA 2BOVA 2VJQA 3TX6A 5JI3E 5J1SB 3UZUA 2O8EB 4P32A 3WIEA 1J00A 3QVTA 4ND4A 2Z8YA 3SPGA 4UULA 3C97A 1H2NA 4UU8A 1J20A 5C1IA 3PXEA 2R8BA 5CDSA 1WF6A 5JSZA 3L6BA 5E1DA 3WDMA 4PO1A 4K81B 1I5RA 4OAPA 4IXDA 4OJYA 1UPFA 1W96A 3VNQA 3KL2A 4IFBA 1L7NA 2AI2A 3R74A 2I9KA 1NN0A 3JQGB 3CCBA 3ASYA 5FTMA 1TCVA 5I3CA 1ARZA 2IWRA 4A3SA 3JARB 2YHBA 3WE7A 1G21E 5ALYA 3Q6IA 5KO2A 2F95B 3CV3A 3THWA 4RKYA 3PXBA 1W5TA 1KMIZ 1L8AA 2GZDA 1K3TA 1XVIA 2Z04A 4LBZA 4B35A 1AG9A 3GRCA 1T5HX 4HX5A 4OI2A 3VTFA 4AMBA 5LKAA 2BEJA 3PP8A 1L1EA 1KJQA 1QGZA 2FN7A 1YS6A 1S5LZ 1ZJ4A 1SOWA 3PRJA 4K03A 4V02A 2W2QA 5CA3A 2BKLA 1QVVA 1SQBH 3UPDA 1J0DA 1JDUA 1JQKA 3I9MA 5A9SB 1QNLA 4PE5B 1DAEA 4URVR 1RZRA 1EPUA 2EX3A 3T35A 3VZPA 5BR7A 2EQBA 4E2WA 3RT9A 3SBXA 3H97A 4M7WA 5BWBA 3QHDA 2UUCB 1XD2A 1TTTA 1D07A 1QK5A 4IJVA 2GEBA 3CMEF 5JCOA 4DV0O 2WA2A 3LW8A 3GNTA 4Y2TA 1RRKA 2FMIA 3PGKA 4WGFA 3U4DA 1ENPA 4NB5A 2WB4A 4JLDA 1LZLA 4PPNA 1O94D 4IVNA 4CLXA 1JHQA 4TV9F 4X20B 2AN4A 4IQ4A 4PICA 5T7BA 3U49A 2IQ5A 3O2JA 2RBGA 2RHCA 4H3HB 5TVGA 4BBJA 5EC2C 5EIFA 1C7IA 1NT2A 1UMKA 2I1QA 3Q0EA 1FDUA 1H0HA 3E86A 2OGSA 1IBKB 4E5MA 2V7BA 5AOBA 4UCQA 2MOKA 4X97A 1VQKF 3KJGA 4JEHA 3GAMA 3NM6B 4MCHA 1KAEA 3CZAA 1XK7A 1TT7A 1QHEA 1BS9A 2WLSA 3NO4A 4RH3A 3T8YA 2Q5JA 3Q6NA 3QMWA 2K6GA 4HHEA 1KYOF 4I1IA 4PAGA 4OKNA 1L7BA 3CLUD 4GXRA 4U00A 3W4JA 5JO0A 5L6MB 2Y1LA 3BH7A 2GRAA 3SR2C 3DUWA 1Z0UA 3CE9A 3VYVA 3ILVA 5B6IA 3ER9A 2PG3A 1U0NA 4CCYB 3RHZA 3Q7EA 3GLHA 2G1JA 1K9MW 3J7AC 4G01B 2G4VA 2RH9B 4EAAA 2UKDA 3ZLTA 1POWA 1U9CA 1ZINA 3IIKA 5DV9A 1Q50A 2UXXA 1YMQA 5ALUA 5TSDA 3WKEA 3IC7A 3OBWA 4M7RA 4A03A 2QAJA 2B33A 3FSGD 4QC2A 1KJNA 1I2AA 1F7UA 1JJBA 2WLIB 3RRZA 2C9ZA 2XUQA 3RS0A 4EY3A 1JFVA 1FNDA 1QVAA 2F1KA 4Z49A 3BHMA 4PWYA 5K0JA 1M1UA 3NHSA 1ENOA 1KY2A 2IPLA 5B3SB 1A5SB 1ZLYA 1ZYUA 4LJAA 2WIBA 3LU1A 2A9QA 1CY6A 2AQIA 4MJ7A 5FPQA 5A5EA 2LBXA 3N7AA 2HVKC 3GDOA 5KOJB 1X94A 3R5XA 4BE7B 1F60A 1U81A 3HSSA 4I4TF 4MULA 4AM8A 4PX3A 1T4BA 1GGEA 3R3JA