4I50B

Crystal structure of tubulin-stathmin-ttl-epothilone a complex
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
429
structure length
422
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 158
structure length 422
sequence length 429
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4i50B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4i50B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4i50B01
3N2KB 3RYIB 4U39A 3RYCB 4M8IA 5IJ0A 4X1KB 3VO8A 5CA1A 5LOVB 3HKCA 5FNVA 4XCQA 3WGLA 3RYIA 5LYJB 3RYCA 3JALB 2VAWA 4B46A 4O2AB 4X1IA 5LOVA 5MN6A 5LA6A 5EZYA 4EI8A 5LYJA 4O4IB 4O4LB 4I55B 5J2UA 1W59A 5J2TB 1RQ7A 3WGNA 4O4LA 4O4JB 4I4TB 5C8YA 2RHHA 4ZOLB 4TV9A 5LP6A 5J2TA 4YJ2A 3RYHB 3M8KA 1OFUA 1RQ2A 4IIJA 3N2GB 3WGMA 4U3JB 5BMVB 4X20B 4TV8B 4O2BA 2BTOA 5JCOC 3V3TA 3N2KA 4U3JA 4X20A 4TV8A 4X1KA 1TUBB 2R6R1 1W5FA 5CB4B 3ZBQA 5MN4A 1Z5VA 3JALA 1TVKB 4O2AA 3HKDB 1FSZA 5IJ9B 4X1YB 1FFXB 5JVDB 5CB4A 4I50B 4ZI7B 4O4IA 4I55A 1TVKA 1Z5WA 3HKDA 4DRXB 5IJ9A 4X1YA 4B45A 3JAKB 2XKAA 2VXYA 4O4JA 4I4TA 2VAPA 3JAWB 4ZOLA 5JH7B 4WBNB 3JAKA 2RHJA 3UT5B 3JAWA 1SA0B 3HKEB 4TUYB 3JASB 3E22B 3RYHA 5EYPB 4WBNA 3ZBPA 4O4HB 3N2GA 4TUYA 2BTQB 4EI9A 3E22A 5BMVA 4O4HA 4F6RB 4FFBB 2RHLA 5JQGB 3RYFB 3CB2A 4E6EA 2GVIA 4F6RA 1TUBA 3JARB 4EB6B 1W5EA 4LNUB 5JQGA 2Q1XA 2R751 2RHOA 1W5AA 3JATB 5LP6C 3RB8A 5IYZB 4ZHQB 4EI7A 4EB6A 3WGKA 4LNUA 4KWEA 5JVDA 1FFXA 5IJ0B 4I50A 4ZI7A 5CA1B 5IYZA 5FNVB 5LXTB 4DRXA 4IHJB 5MN5A 4X1IB 3WGJA 5LA6B 5EZYB 5LXTA 5KX5B 4IHJA 4ZHQA 5GONB 5CA0B 5JH7A 1W5BA 3M89A 5ITZB 5J2UB 5JCOA 3UT5A 4YJ3B 1SA0A 3HKEA 1JFFB 5KX5A 4DXDA 3JASA 5M7EA 5GONA 5EYPA 5CA0A 5C8YB 5ITZA 5EIBD 5KMGB 4TV9B 4HNAB 4YJ3A 5LP6B 1JFFA 2BTQA 3VO9A 3C8LA 4YJ2B 5EIBC 5KMGA 4FFBA 1RLUA 4HNAA 3ZIDA 3VPAA 3RYFA 3HKBB 3VOAA 4IIJB 2VAMA 3JARA 1W581 3VOBA 3JATA 3R4VA 4O2BB 3HKBA 3HKCB 2XKBA 2Q1YA
chains in the Genus database with same CATH superfamily
2ZEJA 4FZRA 1ZW6A 2GPJA 3RBXA 1W4BA 5BSVA 1TQ6A 1QAHA 4CHGA 1I6KA 4DV5B 1HX7A 2GA8A 5ENZA 1M6WA 4A5SA 2C8LA 4MWDA 3L6DA 3OJLA 4EHFA 2XA2A 2YHBA 4RQBA 3VYRB 3RV4A 3NUQA 4WFAV 5KTRA 5DTRA 3T7RA 3GJ5A 3QO8A 4DLSA 2GDJA 4K6GA 2OXFA 1JLSA 4UFNA 3HADA 3SFVA 4E5UA 4DV0O 5DW3A 3F0DA 3T1HB 3ZU5A 4HYEA 4KX5A 2Q4PA 1D4ZA 1KNJA 3KAQA 4K6OA 4YNBA 4EW6A 2DC1A 1QZUA 4AY3A 3AETB 4X3PA 3EOBI 4I14A 1SHTX 1Z6XA 1PT8A 3EYAA 1HZZC 5E8JA 2B4RO 1HYGA 1U99A 3M3HA 1R0ZA 3USES 4CEIB 2OV2A 2Y0CA 3KLOA 4NICA 2D62A 4CRWB 1IYZA 2HF9A 4KRYA 1D9XA 4I55F 3EN0A 5HGXA 3MLAA 4QBKA 1V95A 5JNWA 4UHCA 1OXVA 2J9YB 5AJHA 2PGDA 5JPCA 4GSYA 3JPWA 3V46A 1SHUX 3SR3A 5H82A 4M83A 1GEEA 3RHFA 2WHQA 1N25A 3VXKA 1NLZA 4GGPA 3NHRA 1M74A 4ICIA 3KC2A 4ZANA 1XHXA 4TV8A 5CBPA 3V7NA 4BZPA 5JYDA 2W2LD 4AD8A 4F3NA 2VJNA 4M86A 1O95A 1AKYA 3SEAA 4LKRA 2CF6A 3O74A 4D57A 2IXTA 2I2BA 2J9FA 2J3IA 3QHAA 3RB8A 2Z6AA 3BIWA 3GGJA 4AP6A 3G6WA 3VAYA 4RHAA 1Y5RA 1PGJA 3IJEB 4OXXA 1GRNA 4D9FA 2KLHA 2I76A 3R8XA 1DQSA 4XM2A 2WWWA 1DIHA 3K0DA 4IWNA 2R1ZA 4YRRA 5I8WA 1DG1G 4KQWA 5EXXA 1UDBA 2HGSA 2WA1A 2WBLC 2GDZA 2X7RB 4KQGA 3C6MA 4PHFA 4E33A 4FS3A 4XYLA 4KEAA 5IG2A 3UCSC 1K6XA 3EORA 3H65A 1MT3A 1GHTA 4KR2A 4AXXA 5B6IA 3GG2A 2DQ0A 1IOWA 3HKDB 3EXIB 4R1TA 4KGVA 4EEQA 1ONSA 4TQ9A 3DV2A 3WBFA 1P80A 2BE3A 2NQTA 1QYCA 1NZ6A 3OBYA 2GJAA 3CC2F 4N3AA 2HQOA 3WKDA 3M81A 4FFRA 3KJEA 3SSNA 3UJCA 4PXAA 3L77A 1XMIA 4FOSA 1D5NA 2YXYA 3AESA 2GZDA 3CLTC 2YXBA 3A1CA 2IJKA 3U4HA 5ITZB 1F5SA 2XMRA 2H4WA 1TF7A 1QU2A 4YCNA 5CYPA 4BDSA 4JKIA 2NU9B 3NT4A 4UNPA 2NU6A 1JG7A 3IR6A 4GRDA 2DUWA 1UP4A 1K34A 5BUZA 4TTJA 2BHNA 4XRGA 2FPPA 3AEKB 1JZTA 1T9BA 4ZOCA 3DXFA 4WT7A 3DZKA 1BHAA 5HP7A 4NEGA 4OXQA 1A8QA 1V2GA 3R9XB 1NBHA 2Y0IA 4WBXC 5GV8A 4EHAA 3O93A 4OIFA 5D6NA 1AQYA 3JU3A 4B31A 4H60A 2WFAA 4MKRA 2FDRA 4I9GA 3PP8A 2XQKA 5I4BA 2AEFA 2RAFA 3SLRA 1WTAA 2PWBA 4MVJM 3ETEA 2BL4A 3B1ZA 1JIIA 2P41A 3FLBA 3U1BA 2BUBA 1YZUA 4LX8A 3OE1A 4NCXA 4ITVA 2BBTA 4H4DA 1QQ6A 4RKFA 5BOSA 2IYNA 5KLVH 2WQ7A 1S2IA 1E2EA 1I0IA 4F96A 5G4UC 2FN3A 3GT4A 4IIGA 4CDRA 2EBUA 3IUBA 5ERYA 5IT5A 5ALJA 1JFFA 1G60A 1YK0A 3EJ6A 3B5EA 3TK1A 1SO8A 4GMFA 3HGTA 4ZVKA 4FFSA 2QYOA 2PZEA 1ODFA 4MQFA 2JJ2A 1RMTA 2H31A 1EZJA 2QJOA 4RIEA 4MB0A 1UKAA 4X62B 1Y6GA 4CIWA 3ITNA 2HHAA 2J0UA 1MNQA 1GU0A 1KAHA 1L1QA 4C08A 3MT9A 1XSEA 3WRYC 4GPAA 2QJRA 2UXDB 1R0RE 4ALKA 3KFLA 4J1QA 3H5TA 1FNNA 3HWWA 1H69A 2BE9A 5E8RA 3HABA 4PC6A 3L7CA 4EO4A 4TXNA 3R3XA 2NQ8A 3V5NA 2Q4RA 4CHTA 2VK8A 2WNSA 1JKFA 1S4MA 4YVFA 4C4AA 1CR4A 1KUQA 4X64B 5FWXA 5BNWA 1NUSA 1PR6A 2ZBFA 1UBMS 1B23P 1S4QA 5H9WA 4UUPA 4FJ1A 2C2MA 5E7MA 3IALA 3DL0A 5GADl 1PFQA 3FI9A 3VNQA 2DYSC 2D2FA 1IOLA 5DGDA 4WA7A 1DQRA 3RUFA 4RJTA 2H9IA 3NC1C 2CK3A 3MTBA 3I2HA 4RTOA 3AQIA 3NXSA 1I36A 3SC2B 3GT0A 1ZUIA 4M1SA 4TVKA 5B64A 3BE4A 1KKCA 1C8BA 4RTKA 4BKPA 4HXFB 3OZVA 1QCEA 4J1SA 4MCHA 1ZVKA 3W2FA 4PDRA 4JQZA 3TIGA 3QTLA 3H2GA 5K0BA 5HPYB 1D2GA 4XAQA 4F7DA 1KEPA 1H2WA 3UG7A 4FM2A 1ZK1A 3OIYA 1WCIB 2PJDA 4AO7A 4JB2A 2FQXA 1NKSA 4EMBA 2CJFA 3T3DA 1V11A 3IL2A 3FB5C 4GKBA 3MD9A 4PTLA 2WIGA 1MVLA 3SZUA 1S2LA 2VF2A 1JB9A 2B7BA 5FOSA 1QG4A 1A1VA 1NQWA 3SR4A 2V54A 1X7HA 2D1FA 3BG5A 3K73O 2G63A 4XWKA 3EUWA 1C3OB 2EJUA 1G2QA 5JBNA 1M67A 5CT4A 4ESVA 3ROPA 2XECA 2BO1A 2PL3A 4ENQA 1XE3A 1TM2A 1BE1A 1UMBB 3B6JA 4IVRA 1VG1A 1X7GA 1KZ4A 2IZ0A 2R68A 5EEGA 5AKZA 1ICEA 3V7QA 1SKAA 1LX6A 4I1SA 1PUIA 1IBKB 3IEUA 1H2RS 2VZ9A 4D9MA 4LOAA 4L8GA 3K0GA 1J8FA 3HQ4O 2CAZC 1J95A 1NVEA 1IXMA 3H0KA 2LW1A 3DKIA 2Z9BA 3K70C 4O3FA 2OWDA 1VSBA 4L8LA 3SYQA 1NW6A 2EW1A 3JVDA 5BSWA 1UBGA 1W0KD 1UFRA 4E2LA 3M33A 3V48A 5C18A 5IDVA 2JK0A 4G8JA 4NFHA 1G6HA 2OZVA 3OFND 4DYVA 4FEEA 2PCLA 3Q3GE 1AN9A 1CQPA 5CVUA 1WZUA 3H87A 4BO1A 3P32A 1KAMA 1ILWA 3F5WC 2ZATA 1ZGJA 2E89A 2YVQA 1FQOA 3LBAA 5FORA 4MVJA 3BK2A 5NLLA 4KUHA 1HLFA 4V3BA 3NEPX 5ICEA 1SOWA 4L0CA 4DQ0A 4IUYA 5AVWA 4OP1A 2ZVZA 3BEHA 1O87A 4DV2B 3ZIUA 5K3FA 2X6AA 3SPHA 2QSJA 1CY4A 4LNUB 2DBQA 2CXHA 2HUNA 4KAXA 3KYBA 1JHVA 4M54A 1DAPA 4UDNA 3EIFA 4TXLA 1CEZA 4LV6A 1XNJA 1EUDB 3BD6A 3OX4A 3ZGYA 3PWZA 3TQRA 3E5RA 3TE6A 3IQFA 4KXWA 5FKJA 2WUDA 1N9GB 3VUEA 4LMPA 4PAOA 1FNMA 3FWPA 4OFZA 2IV7A 4WJKB 3T7CA 4ALJA 3RS2A 2HSWA 5FYDA 13PKA 4FSHA 2IXAA 1X1DA 1HG1A 3ZX6A 3FNQA 3PN1A 5I47A 1H65A 1P39A 4BO2A 3ROXA 3TBFA 4L0MA 2YHIA 1XL1A 3EXG2 3GJ7A 4IF4A 3V1TC 1ZIPA 4CM4A 2GI4A 2P5TB 3S8EA 4ZV7A 3STZC 1U0SY 1L5HB 4D1YA 1LEHA 2EL9A 1BROA 2YHAA 1D2EA 1Z17A 1UT6A 2ZR0A 3PGVA 1QHIA 1N8RW 2E48A 1KJ9A 1YS4A 3RFUA 5JT1A 1E9CA 1XF9A 2QUKA 4BO5A 2Y76A 3IEKA 1Q0TA 5EIBD 3D36C 3I83A 4TLBA 4HZUB 1QQAA 3O8OA 5TS3A 1JNYA 1G98A 5FB3A 5CJ2A 2WAXA 1QIJA 4OJTA 3JWHA 3RYIA 2OBYA 4E30A 4RWUA 4NKRA 5A0TA 4S24A 2RB5A 2VJMB 1N5MA 4V0LA 4UBJA 5T3UA 3Q40A 4LHWA 4RESA 2GN9A 4QTXA 1N8TA 2R6CA 2J9ZB 3GEHA 1P1KA 3DP9A 3ZE8A 1FTQA 4B80A 5BORA 3WGHA 2UVPA 2JJ8A 3LPMA 4W5WA 4NG4A 2HU8A 3WV5A 2QL9A 4KAFA 4LW8A 5HIIA 3L1JA 2CWWA 2JFYA 4G5XA 2HSDA 2MTBA 4RBNA 1D2AA 1SKBA 2OLEA 4HSGA 1BW9B 3I4LA 3LLMA 4ZMBA 3T4EA 5GAPK 4A4DA 3GU3A 1ZPDA 4HTAA 3OTWA 3FN4A 2OO7A 2BTUA 4IPTA 3U4QA 1W47A 2P6NA 4NIMA 1BMTA 2AMYA 4EFLA 3HUFA 3RC3A 5T4EA 1KOLA 3GAMA 4ERHA 3DW3X 3DD1A 4O63O 2ZPTX 1DDOA 3IV9A 3LHDA 3ZHRA 3L0YA 3K1ZA 5ELXA 5JHGB 4TTVA 1P1RA 1BEEA 1IN1A 4QYXA 5KNBA 5T4HA 4C2TA 3RRNA 3BMCA 3AH8A 3KZCA 4DIMA 1GDTA 5SZJA 4KQIA 5DX8A 4CMJA 1PR3A 1G7RA 4RQAA 1OFVA 4YFYA 1NMYA 2GPTA 2Z8ZA 3COPA 3S44A 4V0KA 3DV9A 1B73A 2ZYHA 4OU5A 4IOJA 4IFIA 2SHKA 2KLBA 4BNKA 4EG0A 3DOFA 3GUUA 1YUNA 3NJ4A 1AB6A 4GAEA 4MQMA 3PPIA 2JNWA 3EK2A 3PDIA 2DULA 1CCWA 2D59A 3R1IA 4QUAA 3OZWA 1UPCA 1B6TA 4NBVA 4FFLA 3L8YA 4B7ZA 2BE7A 1F8XA 1XK6A 3R74A 4KFCA 2F67A 4QNRA 1OGJA 4G0NA 4PG7A 1E3QA 1JPJA 2O1EA 4ZTZB 2XD4A 1AR4A 2KQUA 3VU9B 4QE9A 3FTFA 1NTZH 1E1QD 1E6KA 1AUPA 3EUAA 5JMOA 4LAFA 2QMHA 4L76A 1W0KG 1W5FA 5JBIA 3ZJ4A 3COJA 1NV8A 5CB4A 1QANA 1FXHA 2JHPA 1EFDN 1UBNA 1FSGA 4ENPA 1VHWA 4C0BA 1KS2A 3FZEA 3VPBA 3DTVB 2ILMA 3FOCA 3FH0A 1BO6A 2R47A 1PL8A 4J3JA 4PONA 4PHHA 1TYEB 1W0JD 4DJ5X 4MP3A 5CHEA 2WTMA 1IJEA 3KKEA 5GIPE 4YMHA 1SBCA 4B7CA 4S0ZA 3ZJUA 4OXNA 4K6MA 1HH4A 4U2DA 5KVQA 4KAAA 4CKBA 1GA4A 3AC0A 3V8VA 4IHKA 4UFOA 4EHDA 2YWCA 5C4MA 3AKZA 4GC9A 1OU0A 4JV5O 1Y4MA 4MKFA 4WLVA 3ZLVA 4YC7A 4HAVA 2WWFA 4GNKA 3WX0A 3CCLV 1DEKA 2QP9X 4LQLA 5EIHA 1IEXA 5D6OA 1P6XA 2P27A 3GCZA 4MVQA 2YUAA 1K08A 4DMCA 2QTTA 4RFVA 4C78A 3V1MA 3AILA 4HAWA 3DXRB 1REQA 2HA0A 4YRDA 4ML3A 1SG0A 5T4BA 3IH5A 4ZVOA 4XLZA 1G0NA 4M0UA 3VTZA 4F1JA 2C7PA 2FTKA 3VOTA 3IAHA 6ADHA 4OHWA 4URHA 4HUTA 5BOVA 1JFRA 5JRJA 1QOQB 2HF8A 4AUMA 2REXB 4W9NA 3QVWA 4EA9A 3JASA 3OZFA 1LTHR 1V39A 1DKNA 1W88A 1L9KA 3EVDA 3G6KA 4CIVA 2JGDB 1RCFA 3OURA 4K35A 2ZI3A 1UMDB 1Y34E 3CZAA 3KUDA 2BFOA 4IX1A 2IYZA 3ER6A 5BSEA 4H37A 3QX8A 1MXFA 4BLPA 3PJRA 3MAGA 3I23A 1Q3EA 4D3DA 4MDEA 4K8ZA 3F0GA 4J4HA 2YZGA 3RS9A 2PBFA 2VATA 1N2BA 1NBME 4JDUA 1KI8A 3JRXA 1J1UA 1Q1GA 2UYGA 1GNSA 4MLDA 1VMGA 4P0PB 2OGWA 1ODJA 1AJNA 4V0RA 1VC2A 4DYLA 1ZBQA 4MVRA 2YINC 3DGEC 4RY0A 2Q2NA 1DXYA 1X3LA 5GMOA 1D2MA 4GXTA 2PUVA 3LWDA 3K9CA 3TCXB 1RS0A 2AXNA 3AM1A 3ZMZA 2VHXA 2OTLF 1VECA 1SA0A 3PSAA 3F4BA 3OUSA 5TMEA 1CE8A 1SIBE 3I64A 3AK4A 2Q3JA 4U5QA 5T41A 1V7PC 3L8FA 4L72A 2D5BA 4HGPA 2ZB2A 1A9PA 2B2XA 4GX5A 2JKZA 1PJ2A 3EUEA 1NTMH 4JBWA 1SWWA 4YRIA 2BI4A 3OA2A 2FPGA 3MJFA 3UJ7A 1RIIA 1WIWA 5A9SA 1P73A 1U0HC 3KYJB 4E88A 3AMVA 2IZ1A 2OT5A 1KETA 2BMDA 2VYVA 5CH5A 2ODBA 1QF9A 2QJTA 1YZYA 4LE1A 2F3SA 3PRHA 2JJ1G 3NORA 4EWLA 2Z3ZA 1R0XA 4OHUA 3SGIA 1TAHA 3V9PA 2P0AA 3FIUA 5TPWB 3PE3A 3OJCA 3FCAA 1H4SA 1GG8A 4WLUA 2FUKA 2G1AA 4BB0A 2PLAA 2KGWA 2NUTA 4LVOA 2FRVA 1R7RA 3FROA 4UAVA 3FFWA 4O25A 4A0SA 5BN3A 4J7AA 1R2QA 1SUEA 2AHZA 1P7BA 5CPFA 3ZLUA 3SSAA 2WF5A 3EZ9A 1Q0ZA 5DCWA 3IUPA 4Q7LA 3B8HA 3ZK9A 2VBFA 1VL2A 3ZBTA 4I66A 1UPXA 4EOGA 3AJ9A 3BDAA 2BGJA 3A3PA 5FTJA 1SXJC 1ILEA 4EFDA 4XJVA 1GQYA 4KO3S 2EDCA 2FW7A 2W43A 2K5UA 2VWJA 3T3PB 2FZEA 4LISA 5BUQA 3WLJA 3KZ1E 3LYLA 4CIAA 3RUDA 3TIFA 1O7JA 1KJ8A 3CJTA 5JAQA 5JVDB 5GTDA 2FWNA 2OZEA 1VG9B 1R64A 3TLGA 4Q1CA 3L0IB 4HR7A 2ZCUA 1MGPA 4GS5A 1G8SA 3PE6A 4OMCA 1D0VA 4RV5A 3E3OA 3CH5A 1ISPA 3B6KA 3WYCA 4JQSA 1ZUWA 1MEJA 1Q19A 1PK8A 5D51S 4BFUA 3OQJA 4I8XA 1O9GA 4FGKA 4C0KA 2ZVJA 2YMMA 3WG7C 2J6HA 4WA8A 1XV5A 4C05A 3DZGA 4ND5A 3VO9A 4FILA 1XRGA 1W0JG 4R7CA 4IRXA 4ZVTA 3BF8A 4CKWA 3BMOA 2EEZA 2XITA 2AE2A 2XNDD 3HM2A 3JQFC 1X86B 5K0TA 1MG5A 3OCWA 5IKMA 1U11A 4XRRA 2HVJC 1ND5A 3O8DA 4RYDA 1PT5A 3NDIA 1XC7A 2WE8A 3O38A 2CUNA 5FFNA 3H5IA 1M0EA 5EY5B 4CMEC 1ULUA 3KFVA 2UU9O 4GUNA 4GZLA 4ZK6A 2RNBA 3E2EA 2JAOA 4WXHA 1DKRA 3C6XA 5F51A 4C5CA 1XMJA 1CF2O 3IVXA 3G79A 4BEVA 1H6DA 4BCCA 1ZNYA 1T5OA 1X9HA 3LF1A 2R4QA 1J99A 3GQVA 2OENG 1V25A 4ECEA 5LMZA 3N59A 3HBLA 5IAOA 2JFXA 5EIXA 2HRCA 3HN2A 1XHOA 1T2CA 2HMSA 3LXXA 2V7BA 3KVYA 2AN5A 4PV1B 3IEWA 3IKJA 2CUKA 1W48A 1H42A 4Z51A 3NLLA 3L1VA 4HBGA 4J49A 3R7DA 5IMSA 1JR2A 1RQGA 2MR6A 4A36A 1SZDA 1JQDA 1G5QA 3ZMTA 4LZAA 3NHKA 4HC4A 3AIKA 3IQWA 4JGGA 1L5YA 1HEYA 2Z8YM 4EKNB 1FYWA 1P19A 2IHJA 1E6UA 5ISMA 1T5IA 2YIMA 2IPOA 4JC0A 4K03A 4J9YB 4R2IA 2CHUA 3LU1A 4DV4B 1P7GA 2A2ZA 1N2XA 1QHGA 1H8EA 4R2LA 4KKVA 2LIVA 3T0FA 2Q1XA 3PQ8A 4DREA 4DRXA 1M2HA 5A2QM 3KWLA 4KXMA 1YKSA 3CC7F 2XB6A 3GIWA 1R4NA 3SQOA 5LOVF 5J4HA 2A9KA 1RFLA 1ULBA 3HO6A 2A0YA 4OEHA 4O0LA 1B8NA 3EVEA 1E5LA 5EHZA 4M0CA 2N05A 2BW0A 2KSQA 2EX0A 3RAFC 3AVYA 1PQ4A 1ZRNA 1RJGA 1E77A 4B8ZA 3R3JA 4H1TA 1YR9A 3IBFA 2DPHA 121PA 3B9QA 1WW3A 3SS8A 1ETHA 2QENA 4NL4H 2XGMA 1UXJA 3MILA 2BEKA 3F90A 2YWGA 4DWVA 1JVNA 3D6JA 2OFPA 3O47A 4NU6A 4JELA 1JG4A 4N1AA 1YDHA 1KARA 1AXRA 3U37A 3K58A 3OHPA 4WZBB 1W8IA 5DM1A 3T99A 4JK3A 4QFMA 3UXEA 3TOCA 2ZI6A 3MWLA 4UEWA 3HDVA 8LDHA 1VLLA 3L5OA 5COQA 2AXTZ 4YRAA 4EZBA 1TM1E 3U1TA 4MWOA 2XGOA 1GK9A 1UXIA 2QL5A 4YCJA 3RS5A 1VQPV 2QWNB 1H2ZA 4R6ZA 3CG0A 4YXWA 3RK1A 5ALFA 3DC6A 1D5WA 1U8XX 2HEIA 4AT1A 1XDGA 3QEMB 3ONEA 3CW8X 3D3NA 3KDPA 3S2YA 1ZIOA 3A9RA 4L6AA 1E79G 3W9SA 2OHOA 3P4UA 4RPKA 4KI7A 4BMVA 2C3UA 4L9AA 4G0UA 4RF4A 4UHEA 5KJ1A 4G0WA 2FU5C 4BL5A 4S2EA 5FEUA 2MSWA 3L8GA 1T2FA 2CE7A 3LYAA 1O3YA 4J7KA 3INTA 3D43A 3CC8A 3FWZA 4GOKA 4YX9A 1DBQA 2QTCA 3C8ZA 1QX4A 4KE8A 1O89A 1NV9A 2QY9A 1XTUA 3IVAA 3NC0C 2AVNA 2PKYX 1G8HA 3WHPA 3OGCC 2CVQA 2X76A 3HJFA 2FFJA 3VNVA 1QPGA 1IX9A 1BDJA 3OZBA 2BKXA 2EV9A 4J0JA 4F8JA 2BOCC 5JZOA 1S3IA 2RQ6A 5EZYF 2ZSFA 5J47A 4FYPA 5AM4A 4QEKA 3WC4A 1WV1A 5K8TA 1V9LA 3KHUA 5HR5A 3I5UA 2G8LA 1GGVA 2IC5A 3BJRA 4YLYA 5KREA 3GO4A 1YFLA 1NVUQ 4JLOA 2BGNA 1XWFA 1NF2A 1L3BA 1ZGCA 3FUCA 2V6BA 4LXXA 3K1AB 3KIZA 4KAJA 2IJIA 3KEOA 3HFSA 7ABPA 2OPBA 3JXEA 3I3SR 4PHCA 2RC5A 1RWOA 4V0SA 2QRPA 4YRGA 4EA6A 1XDZA 1R88A 4MV0A 1T0IA 1E20A 2WHXA 1XBTA 5EWJA 4KG7A 2NSHA 2CMFA 5E0KB 1QIMA 1DIRA 2ZRAA 4RHUA 3ZH9B 1PTJC 1PZXA 2PRKA 3IBCA 5A06A 4AUEA 1BXRA 3UATA 1TM7E 2E7ZA 5CMLA 1J21A 1K5PA 1TJYA 4H0FA 2XUIA 3DOOA 3FCXA 3FOWA 2AMTA 4ZRMA 5LP6B 2Q6OA 2X2PA 1SQ0A 1WO8A 3MQWA 3QOYA 1EVJA 2D4HA 3EVAA 1J2EA 3WLKX 3TIXB 3PQ7A 1ZNQO 5LA6A 4B40A 4A6EA 2YHUA 2QB5A 2Z8YA 4KYIB 1U1FA 4IMIB 1ULAA 3QVKA 3GYBA 4TMXA 3JWEA 3WIEA 3M6MD 5CXUA 5IYCO 3T3EA 4FE4A 5EE3A 3L7IA 1JIQA 4JKOA 1QO7A 3LE8A 4CF6A 2B4YA 1FP7A 3UAGA 4J3FA 1OGYA 3CNBA 2MDTA 4JU8A 1IWPB 3MRTA 2VQFB 2QPTA 4JJGA 3D8CA 3RGBA 2X86A 5L8VA 4JI7O 2A88A 1QVZA 1T8YA 5HCIA 5A2QA 3L74H 4RLFA 1KIMA 1ZAYA 1U3VA 5C5EA 5E1AC 2XD9A 1T8TA 4JODA 3KD3A 2NYRA 4X88A 2CXPA 4LZLA 1K6MA 1CB0A 3O4VA 3T1NA 4P3OA 4IIFA 3RW0A 4F5ZA 3FSGA 5A4KA 5HKKA 1YR3A 5IJ0A 1OJ7A 3G9ZA 2Q49A 2EGUA 1NWCA 3L5KA 2JFGA 4AX4A 1JXQA 3HFRA 1AN0A 2UYJA 5BPHA 3WLPA 2UYNB 2CVZA 2YFQA 1N2OA 1Y3BE 3CEIA 1ZMRA 1CR1A 3DHEA 1UJNA 5BUCA 4XIYA 4CL3A 4H3VA 4O2RA 4CV3A 5T8KA 3DLCA 1OBVA 2AOUA 4OP3A 4K9NA 3RBZA 1A2QA 1JDBB 1E2IA 3FXAA 3UO2A 2QR4A 3R7AA 5JS7A 1N5DA 4E14A 4R0NA 3P9RA 4MLZA 3MINA 1K9VF 2CB9A 1O96B 3WGTA 2OGSA 2VL7A 1NN5A 2JA1A 1KMIZ 1CZOA 3ZCQA 1NJ6A 5DN6A 2J07A 3LWNA 3ZIDA 5B2EA 3WGQA 3DO8A 2CLKB 5CNIA 2IP4A 4FR5A 1OLUA 5LQKA 1DX9A 5FL7A 2RHCA 4CGYA 1BFDA 4KR7A 1V16B 3UJNA 1SD5A 2D0OB 5JMPA 1OFHA 3UMYA 4RQUA 4Q7MB 5E6SA 5JPIA 3DAGA 1W75A 3VQTA 4TL9A 3TR6A 1N2CB 2W93A 4YP6A 4FFOA 2E4UA 3W9UA 3S55A 1BX0A 4CMBA 3RG8A 4EUNA 1N0VC 3V8EA 1QR9A 2MIIA 5IVDA 4ZPJA 4GXNA 3OQHA 5FNVF 4EPYA 1N32O 1UOPA 5FA8A 3I6QA 5LZ9A 2Q9UA 1J20A 1QC5A 4WBSA 2GERA 1LKZA 4Z3KA 5DBFA 1BRTA 1EU1A 2Y9PB 4FIZA 4WI1A 2YXDA 1IG0A 3FB1A 5DHTA 3IT0A 4HJXA 4MRMB 4RVCA 3H1HH 5F5LA 2ONZA 4F71A 4I3HA 2WLLA 1RRFA 1Y3DE 4V1CI 4FW8A 1JE1A 1TQDA 4EFMA 4FN5A 5A5EA 3TVTA 4KCGA 2ZDIC 1MJNA 1NQTA 2WE7A 2BSQA 2QROA 1AOXA 1WXDA 4FT2A 3Q5DA 3ND5A 5JYBA 3CUYA 3UMBA 3IJPA 1SVMA 4HAMA 1JS1X 4Q82A 2HPAA 1QGZA 2HJGA 3ZU3A 3TSWA 4W1PA 4D3SA 4P4NA 4ITRC 1EUQA 3PDJA 2WJZB 4JC8A 3JQ9C 3L01A 3SY8A 2VTVA 4DIEA 5ILQA 1EJ6A 1AUVA 4H6PA 5LXTF 3R09A 4LYHA 4D41A 3MUEA 4LWPA 5CTJA 5JHHB 5JQWA 3FAZA 2M6LA 3QI7A 3RUCA 1LD3A 2JIRA 1WE2A 2D2XA 1EK6A 1Q57A 1UP6A 4A82A 4ZOQI 2J4FA 1GZHB 3PTLA 5A7FA 3OZIA 3GD5A 4K8RB 2JZCA 3TZKA 2JHCA 3PTZA 4XOUA 4Q24A 1HOXA 4CH3A 5EPEA 3R0PA 4UD2A 3K09C 4ZVVA 2GZ2A 3G59A 1Z2DA 3K05A 2G9QA 1OAOC 2ZJ7A 4EA8A 5A5GA 3M4NA 4TQAA 4PR0A 1KQOA 1EINA 2VKTA 4DJJA 3THRA 4DG9A 2FW8A 2G0TA 4HDSB 1AGNA 5HRAA 1A9SA 3JVUA 2AJBA 4DV3O 5G0WA 2F48A 5REQA 5IULC 3S1SA 4UPVA 2JVDA 5KNCH 2X4LA 1KO8A 2RK3A 2HBZA 3X2QB 4KPUB 1XVVA 5ADUS 1ZIDA 1WZEA 4PLFA 1JOYA 3VR5D 1RWWA 3M6IA 1XNGA 4LYAA 3CE2A 5K8JB 3DFKA 2L69A 2P9BA 4L8FA 4RJLA 5JSYA 3U19A 4PLGA 4O4LF 2XT9A 2VUTA 4JB0A 4OQDA 1F5NA 3KCXA 1NUQA 4AKTA 4I55B 4C0HA 2UXCO 1ADJA 3CC2V 4D9KA 4XM0A 1BN6A 4MHSA 4RMIA 2SKCA 3IBGA 3I28A 1YS1X 5KVCA 5KTKA 4GKVA 1BDIA 1LWNA 4CM8A 1DO8A 3QE3A 3FWYA 1NATA 1WXQA 2RGDA 4AF6A 5BWNA 4OQEA 2AIFA 2B8NA 1HWYA 1QV6A 1Z0SA 4LHXA 2L6LA 1RP7A 1N8NA 1L9XA 3LQ2A 2HW8A 3R0JA 3EGVA 5E3HA 2H1OA 1VJTA 3EGIA 2WJ3A 3ETQA 2LXNA 1MAWA 3EDCA 3K5MA 3O8QA 2EG9A 3HPQA 3CRQA 1UANA 3C4JA 3TSOA 4EPVA 3DBHA 2JFWA 3EQZA 4ZXPA 2ADFA 3A9VA 4UZSA 4I5FA 4K0RA 2FGJA 3KYDA 4M89A 4Z7OB 1YBMA 2YDXA 2WZBA 4JYZA 3G8BA 1GKUB 1MW8X 4HG2A 3VDXA 4D0SA 5FI3A 4U3JB 4QXQA 1QJ4A 4LHSA 4LY6A 2WLSA 3QLTA 5ILGA 3SZMA 3D0RA 4FNAA 5FADA 4RJ2A 4H77A 3B1JA 1H2MA 1YJ5A 1U5AA 2PTMA 2LFRA 1QCDA 3OKCA 1XDUA 5IJZA 3U5TA 3VYVA 2ZT9B 3LCRA 2QIPA 2D74A 2M6YA 2PZ8A 3QEOA 5F7XA 4OHRA 4GPD1 5KSZA 4E2YA 4P0TA 4R40A 3GDWA 3S2EA 3ZEAA 3CHYA 2Q21A 1O4WA 4C6HA 1A50B 2ZR2A 4GL2A 4RGQA 3RANA 4Y6QA 2UZ4A 3QVTA 3CRMA 4B3IA 4JJIA 3UT0A 1IB0A 5FOVA 1ZGAA 2GHTA 3N74A 1SC9A 1WB5A 3UMMA 3H0CA 4U7TB 1Q0QA 3AETA 3BRWD 1P9LA 2GM3A 1TB4A 4B4KA 1KJYA 2DFVA 5GM2A 2E9SA 4EKDA 1K5GA 4YUXA 4AZ0B 3ZN2A 3EFOA 3BCSA 4F6LA 1J0EA 4JLKA 3N8KA 4KR0A 3P0RA 3CA8A 3U62A 4G0XA 2Q7GA 1H2HA 2HJFC 2O14A 4OXKA 1H8HG 4HO1X 2DYSB 3AFNA 4WASA 3RKUA 3W5CA 2C2YA 4C2UA 3KOZA 2OYRA 4YRPA 5IVHA 3GVIA 4CKEB 1MJGM 4YO7A 1X1CA 4QQFA 2HSZA 1X8JA 2B94A 1VQ7F 2QN2A 4IUBS 1RJDA 4IO0A 3UPDA 3OPQA 3LFOA 4M6WA 5ICSA 5CR9A 1TAQA 5CNMA 3SF8B 2I87A 3RRJA 2XLCA 5F1KA 2OR3A 3L0CA 3F6YA 4MLCA 1BQ3A 2O7RA 3ZTTA 1CS4C 2PEZA 1JJ2F 3L70H 5BR8B 3GZJA 2CVLA 1I14A 2XLBA 3PCRB 3F7NA 5JWRA 3KJFA 1OBHA 1WMDA 4DLNA 2YNMC 1L8LA 3I0NA 3MWFA 5EN4A 1U4SA 2PUGA 1SQBH 2VHYA 2JAWA 1QFZA 1JALA 4P36A 4KO1S 3AF5A 1M6NA 1VQKF 4EKWA 1P9WA 1USWA 3LQKA 4RLHA 5KAMA 4Z8YA 1T1SA 4RTMA 1DT9A 1YRHA 2GXQA 1CHDA 1RJWA 4RIHA 1X1RA 4KJZA 1SM4A 3E03A 4FWIB 5JSKA 1Z26A 1GT6A 2X1VA 2JGMA 3E8XA 4HB4A 3TG2A 1NQVA 5AW2A 1UM9B 3WGLA 2EBOA 1U8UA 4OLHA 3VQXA 3SSOA 3B6ZA 3AKDA 3A4YA 2R6GA 1YB1A 2PMFA 3VR4D 1XRLA 2NU9A 1M2GA 3GEMA 1RXWA 3GMSA 4JI6O 3EIQA 4EB0A 2PBLA 3A1TA 4LZNA 2HYIC 1T43A 2W7TA 1B3RA 3ICWA 1LJUA 3K0FB 3AEKA 5EK0A 1NFRA 2RH4A 3N1UA 4IICA 1PIWA 3KJQA 3H2IA 3TUJC 3TTXA 1H05A 3ILSA 3IVMA 4AJKA 1XIVA 3F46A 4IS2A 3DEJA 1NDUA 3OT4A 2CN1A 3DBVO 2DQZA 1TNDA 1OLOA 4DKJA 2EYQA 1FDIA 2EFYA 2H1VA 1KMNA 5M34A 1DCTA 5KEIA 1FB5A 1FJHA 4QGAA 5D85A 3DOHA 3G6EF 2D2CB 1Z2NX 5LD2C 2VPQA 7GPBA 3VSCA 2FC3A 1IBCA 3QHPA 1NURA 2ZBQA 3H1JH 4K28A 1KZGB 3RROA 3ETLA 2K4MA 5J5CA 3I2YX 4X44A 1E3DA 3VHRA 4QT0A 2Q67A 3QTTA 3GLFE 5BNIA 4PDVA 2C88A 1UZMA 4RY8A 1UK7A 5FNZA 2PX2A 3Q6IA 3Q7IA 1MIOB 2AFIA 5E1OA 2C2XA 3QLVA 3OLWA 4BNVA 1B15A 2A7WA 3K15A 2GVIA 1BQEA 2V3VA 1MA0A 3ZLJA 5EIFA 2O2HA 1R12A 1J0CA 2ZB7A 1AVMA 5DT2A 3JD4A 3UB2A 5KINB 5ESRA 1GNVA 4JBGA 3M0EA 3ROQA 3IOMA 4AJLA 4ARCA 4KMMA 1JEYB 1YB6A 3PWKA 4ND7A 3JD1A 3SNHA 2GEBA 5DZSA 2XGGA 1J39A 4NOLA 5DHQA 5B58C 4TQUS 4FZ1A 4K2HA 2QWPB 4G97A 2W8BC 2R9IA 1NPYA 1KQ3A 1U2SA 2DW4A 2G28A 4HAYA 2NQ2C 2I71A 4Y7CA 1UBFA 2C2WA 2RGGA 5A6SB 5CEJA 2GF0A 3CY6A 3K9LA 1MAUA 1YD7A 3C5HA 2FSVC 2HFKA 4RQOA 1GZ4A 4L51A 1YJWV 1T2UA 5CFQA 5C7LO 3NR7A 3LCCA 1MJGA 2RC6A 3FYUA 1E5VA 1YA6A 3AHFA 2IPAB 2J5KA 2PAAA 3WL5A 5AWFC 4HFMA 5EIOA 1TEVA 4PICA 1PJRA 2GHRA 2JK1A 1C7FA 5DH9A 5I7EA 5WRFA 2JS7A 1A5TA 1U97A 4JLMA 3WU2Z 5EP2A 2FP4A 5JNRA 1E96A 5CGQB 1W2BU 4G6ZA 4I6JA 3EHBB 1E9FA 3T7TA 3ZVMA 4CF4A 4BRZA 4AFNA 3C6QA 1E7WA 1WCIA 3V6MA 1E9EA 1DT3A 3T7KA 4RIFA 1YOBA 3BICA 1FNKA 4RFSB 4ESHA 4L4UA 3RKRA 4GOXA 1EXMA 3UEOA 2RK4A 4ZCIA 3F8WA 1R50A 4UC0A 2VQDA 4C3ZA 1P0PA 3ZQ4A 1RHMA 4A23A 2QM3A 5DLYA 4M0KA 3E1KA 4QTTB 5D8DA 1COMA 1RHRA 4FX2A 2F9ZC 2BTQB 2ZTHA 3R0IA 1ZMOA 4HX5A 3OGIB 4J1TC 4B79A 2XCIA 1TEHA 4DEVA 4LWQA 3GFPA 1HKUA 2C20A 4P7JA 5FV4A 1FTGA 3PCXA 1YQTA 2DOSA 1YOVA 4PAGA 4L15A 3CLUD 4HAIA 4DT1B 3SXJA 4BEWA 1U43A 4PAMA 1RPTA 2BD0A 1OY1A 4TMVA 1PT9A 1LH0A 2ZJBA 4GPBA 1TRHA 4JXXA 4HMQA 4HNTA 1VKRA 4BY9E 1Y3HA 1K7CA 2HVYD 1CQZA 3EEQA 2QDOA 2ZZMA 2ZWIA 4RX1A 4RQTA 2NZWA 1Z4QA 3FPSA 3D8HA 3VKFA 4I50F 3MBKA 1PVOA 3KJIA 2AEJA 3DZFA 3ZE2B 2CLEB 4TLCA 2FLVA 3AV0B 3GGPA 4MCAA 1ZFNA 3CW2A 4B7AA 3WB1A 2Z01A 3IBTA 4KVAA 4XPIA 3CYFA 3KPVA 2ZJAA 2KWIA 4D99A 3QWHA 1T9ZA 1ZHHA 4OYLA 3WKCA 4XIJA 2HKOA 1IXSB 1Q14A 4PC1A 3AU8A 3KB2A 3DT6A 5HJ7A 4HH1A 1IPFA 1GA6A 4M87A 4JB3A 3P10A 1XKLA 3F6BX 5IDJA 2B6HA 1YJNV 3SE7A 1QM5A 2NGRA 3ND9A 5LQAA 3G3EA 3K4PA 1H0SA 4Z0NA 5F78A 4F9EA 1QP8A 1EUDA 5CT8A 4Z4IA 5B1SA 3R5JA 3OF5A 3HWSA 5DGTA 4D8UA 4XGIA 4P1ZA 4Q3NA 1GPKA 1N9GA 1U2GA 5FP0A 1ZJ5A 3H9EO 1TO2E 3L3BA 1V3VA 4W99A 4JTDB 1PJ3A 3AONB 1DAOA 1UUFA 1XTTA 1E99A 1AS2A 2EAUA 1HW7A 1BHBA 2BAGA 3ZY3A 4LCJA 1PXWA 3BGSA 3NFRA 4HAUA 3PHBE 2TSYB 3TKLA 1YJWF 3ENZA 5FF9A 3ZZUA 2GJ4A 2QPAA 1HDOA 3BZBA 4GI1A 1LQUA 3MCUA 5BV7A 3QVGB 3A4VA 2F1OA 4X95A 4RD3A 4IQ4A 2Q4OA 3D7MA 1EI9A 4Y0AA 4KDEA 1ZMTA 3NDPA 1L5HA 1WTCA 2FJPA 4CMIB 2OORA 1UOOA 1ZX3A 4G01B 5JMTA 1H94A 1SG6A 2XX3A 4EKGA 4CV2A 3Q3CA 4O1HA 4U4AA 4DCTA 2QJWA 1IY9A 1EGMB 4YONB 4BY9D 4GSLA 3BJEA 2UXBO 3L0BA 3TRHA 5SV2A 4X60A 4KSBA 1Q21A 3ABKC 4E2XA 2VNAA 3WGMA 1DE0A 5G41A 5KSOA 4UCOA 2AW9A 4OAPA 2VPTA 4NWOB 3JQAB 3GLQA 1GT91 5E3JA 3SBOA 1USKA 2O7NA 2QL6A 5JH7F 1VJ1A 5DYNA 4FNMA 2WJPA 2OTJF 4PBSA 1DWPA 3GEEA 1P1JA 2BEUA 5CNJA 4YRKA 3D4IA 1TK9A 2JFZA 1PP4A 2I7TA 1LVHA 4FJCC 4FUTA 3JZIA 1YI2F 2PH7A 5K3OA 1UFQA 3ZV6A 5KB3A 4YP7A 4JI4O 3CRVA 4ZQFA 4QZVA 1KZ7B 2NTVA 4IHJA 3CYQA 2W0MA 1F4VA 1KYVA 1TU3A 3PDUA 2LCAA 3EVTA 1Z6YA 1XNQB 1TZ2A 4EFBA 3EPJA 1J6UA 5M29A 4R9SA 2FWMX 2HT1A 4X3MA 3OU2A 5DYGA 4UATA 3GCDA 3FPLA 1Y48E 3W7AA 3F97A 3VKUA 5AHXA 2G9ZA 2FG6C 5CEEA 4BVBA 1AK2A 4BBJA 4RTJA 1G5PA 3GLTA 3BMNB 1KNXA 2QJ1A 3RTGA 2KG4A 2HA2A 3OCXA 5F1OA 3IPLA 2YBDA 2J09A 1KERA 5KHAA 3TD6A 2YY6A 2FR8C 4PIPA 2OTLV 2IHNA 1DFIA 2NYVA 5F3DA 3S2UA 1NRWA 4FMBB 1K66A 3LKZA 4L74A 5IT0A 4OQQA 3WXMB 3HZHA 4B5KA 4E21A 3QELB 2IYLD 1SXQA 2HMWA 2HA4A 4Y9SA 2IZ6A 5L3FA 2ZT8A 3SQWA 1O08A 4UAGA 3F78A 4MSUA 3DMYA 1MENA 1LDBA 1AUOA 1XCGB 1YJNF 2XB4A 1ZSPA 4Q03A 4DTIA 5FIUA 2ZB4A 3OC6A 1ZD1A 4FIPC 4TTRA 4EG8A 2GBLA 3K9GA 3Q0EA 3GMTA 4B9EA 3OPXA 3BH7A 2CTQA 3NM5A 1ONIA 3ASOC 3OFNG 4Q02A 3X3HA 4GR5A 3NS7A 1GYRA 1BMQA 4KGZA 4EY8A 4AULA 3F5SA 3CKMA 3ESAA 3QLEA 4UM9B 3G0GA 1TCAA 4D5EA 3F6CA 1NONA 1RKUA 3C9UA 1JV2B 4G0VA 3FOAA 3E20B 1E2NA 3JQBA 1R3IC 3ZWWA 3AIOA 2ZIWB 2XUJA 3EBOA 3HNRA 4IYIA 2UUCB 2QWRB 1ZGHA 3WWPA 2WLNA 2VNJA 3IX7A 3DBIA 4GLXA 4IVNA 1LY1A 2NPIA 1NJ1A 4L3OA 2BR5A 4UUJC 1JLHA 1JSRA 1B74A 1ZNXA 3PD0A 2PX5A 3L1KA 1Q1EA 2ONCA 2XA1A 4QM7A 4L8WB 1VL6A 5FBVB 1C9JA 5IS2A 4IDOA 2IOYA 5B2ZA 3SYCA 5HOEA 1L1EA 3QWFA 1XMOB 1N0WA 4JBXA 1Z47A 3HZZA 5BXQC 5H80A 2VBIA 1SCUA 1UFOA 1FLAA 4A2QA 1E5TA 2HV8A 3VPDA 4IDQA 3IV7A 3T41A 4XWWA 3WG7B 4CCYB 4YDQA 2X0DA 3PVZA 4BVLA 1FP2A 2VDOB 4PDLA 2FFQA 5ALPA 2ATKC 1YHQF 3RBAA 2WPDA 4DR6B 2RGBA 2FSPA 4UEOA 3SLKA 1A7AA 1G4UR 1GUDA 2W6ID 2Z95A 4RK6A 2OE2A 5LGUA 1VF5B 4ZDKA 3STXA 2EWWA 2F90A 3BFJA 2SNIE 3MT8A 5AM2A 4ABTA 1OB5A 3SFTA 2AN3A 3HXPA 2YFHA 1HDGO 1WCWA 3C5VA 3U9TA 2OCCB 2ZUWA 1GGFA 2Q7EA 2HXYA 1V54C 3U4AA 3ZDZB 1E94E 3VZDA 3AP2A 3IGAC 4PG4A 2Q6KA 2CFSA 4KDRA 2JGDA 2UZHA 4I2NA 1UMDA 3M99B 4JEUA 4RPIA 3GJ0A 2AD1A 2IEGA 4B3CA 2DPXA 3LA6A 4Z7JA 3KJGA 2PZFA 3L9WA 3GNQA 3PT9A 4XBFA 4YHHO 1IZYA 1QBKC 2HJVA 4JYPA 4JI2B 1QX3A 3KQNA 3DMPA 3K9AA 3PTAA 3RUPA 2EWVA 3G02A 4GI7A 2C4UA 5E7IA 1J5EO 3NP9A 3LK6A 2FW6A 2JD2A 2ODMA 4HATA 3QKIA 2Q07A 4LFBO 2YZMA 2ZRKA 5G02A 2NTNA 3GGOA 4DV1O 4BT7A 2ZJ0A 2RMKA 2GFIA 2GBFA 4AP5A 1BS2A 1K9MH 5CVTA 3CJHB 1SCQA 1WMFA 1U5CA 4UHKA 3NBMA 3PEFA 4TLMB 3DQZA 3RE3A 4JHXA 3ICEA 4ZYYA 1O6GA 3ZCXA 3MHSC 3FPKA 3P94A 1XPUA 2CNWA 1U2RA 2EJ7A 1GL9B 3A6HA 4RS3A 3KYCB 1LFAA 2RJ3A 3V2IA 3CC7V 4CT5A 1AV7A 3FHLA 1KEKA 2PH5A 3Q8HA 3K8ZA 1DJOA 4C6SA 1RXIA 5DKFA 1YONA 4DIOA 1S3FA 5K8VA 3AVOA 1AKUA 4HADA 5L4LA 3FD6A 4QU9A 3NT2A 4X1IB 1PGQA 1RC0A 3SF0A 1EXWA 2JIMA 4ZJUA 3K0CA 5EERA 4BBAA 2OTMA 1O57A 4ZKIA 2FFAA 4MTCA 1UKCA 4CZ2A 2PUFA 3GTZA 1NBMD 3BKXA 3TUIC 4DLLA 1T9KA 3UJPA 4CUKA 4DUGA 1XKQA 3PJGA 3GWKC 4EVIA 2QGNA 1K4KA 4HLUA 1PQUA 3H9CA 4INAA 3FDJA 5A4IS 3KPWA 2YQ4A 4KXQA 3VMMA 3Q10A 2V9YA 1E1QG 1LK5A 4U7JA 5ARDA 4CZZA 3H1TA 5IEBA 1XYYA 5F76A 4NVPA 3KZVA 1EYZA 5C8XA 3RVPA 2LNDA 1QFYA 1VHAA 1XL6A 2Q6AA 4DARA 3SHQA 3PEYA 1P5HA 3ZNNA 4K8OA 4GEKA 4W5NA 2IJGX 3TXXA 4IDFA 4DR2B 4B6GA 5BP7A 4EUSA 3WKEA 4YAOA 4IOKA 1E2JA 1FFBA 3DF7A 5JVDA 1J1ZA 4YQYA 4LVUA 3TTWA 3B9BA 2BHTA 1R3UA 1P1HA 3THOA 5AVKA 4LNAA 3RO7A 4LDAA 1JJBA 3G1UA 1LWOA 1Y42X 2RDMA 1WPBA 2XMSA 1DCKA 3VOAA 3F2IA 1ULHA 2ZQ5A 5LOVB 1NVVQ 4ZT7A 2YX1A 4HN4B 3VA7A 2IP2A 2HJDA 3QKSB 1YL6A 2OBMA 3OIUA 2BFDB 1FMLA 5FLXM 3UJDA 5IXSA 4HHEA 4TL7A 4TWZA 2RB9A 3KCNA 3U3MA 5AVXA 4HYYA 2VHZA 3DDUA 4MW7A 4HD8A 3C8HA 5HKBA 3NW9A 3AVXA 3M3PA 2EWMA 4OQFA 3H3JA 1U7TA 4URVR 2OCHA 2HAEA 5FUWA 3TMAA 2RHDA 1E1CA 4NTYA 3F0EA 4BN0A 3GP5A 4BMYA 1W6UA 2IWHA 4BNGA 5UKDA 3R5TA 3EEIA 1N4CA 3EC2A 1F51A 4ILKA 1AF4A 4U1RA 4POOA 4HFNA 3ABRB 5I9SA 3MWDA 1TYZA 1BCSB 1O95D 3H5WA 1TKCA 2P2ZA 1M7BA 2W6IG 2EZPA 2XA9A 2R7KA 3NXKA 1IN8A 4OBBA 4U00A 4DR3O 1F2TB 1T10A 1B4DA 5JARA 3A6JA 2E6UX 2FPIB 5LWQA 3WZMA 1UJ4A 2WZQA 3PD7A 2Y1CA 1L7RA 4O4JF 1GV0A 3AJ8A 5EKTA 1NH2D 1TAUA 4HEA1 1LJ8A 4J7UA 3WDKA 4J03A 1XTKA 2V9CA 4R3UC 4GYJA 2I6SA 1Y4ZA 4LJYA 5L3BA 4ER0A 4GP9A 1KQGA 4FCTA 4QUEA 4UHFA 2IDZA 2WHPA 3OLXA 1Q11A 2W11A 1AF7A 1E4VA 4V2IA 3ZR4B 4R50A 5ARCA 1MZFA 2O19A 1IVSA 3EWSA 1FJ2A 4EJ6A 4G36A 3FIJA 4F85A 1ZOIA 2HN9A 4QUHA 1M2EA 3O95A 5BPFA 1Q2XA 2H1IA 1ID1A 1DWUA 3DM5A 2GOYA 2R6HA 2YYAA 2QLMA 4OQNA 4DY4A 1BHJA 4QDUA 4KR6A 4CNBA 1CQIB 1ONNA 2AFIE 4GSKA 1WW8A 4J0DA 3VFDA 4PWZA 1GTL1 2YHSA 1EQ2A 3ZZNA 5HG0A 1R74A 2O8BB 2OAEA 3KQOA 4L5CA 3QA3E 3CCBA 4E22A 2QX7A 3T1VA 5KJEA 4US0R 1M6HA 1VL5A 4BQRA 4ZK7A 1URPA 4QSHA 3SSMA 3X1MA 3ZDRA 1GPWB 2H1CA 1XP8A 3L1HA 2JPDA 4CUJA 1XRMA 2IU0A 2J7KA 1YE8A 5I9TA 4UBMA 5CG2A 3NMUC 2AJLI 5KWSA 3M6UA 4EG4A 3RS8A 3VV3A 4DPMA 4RVDA 1FXKA 4QNHB 1LNZA 1G8FA 1I51A 5LYYA 2WALA 3PQ3A 2I0FA 2CKMA 3BTVA 4I4CA 1ZJZA 2WSMA 2WKQA 3AERA 3K6KA 4MR7B 4FGLA 2OZKA 2KQXA 5CNKA 4LF9O 3KR2A 1H2KA 4GL4A 4CETA 5AW4A 1JR9A 1NBMG 2CVHA 4ZGGA 2P9QA 2G1PA 4D2IA 2HO4A 1HRDA 4Q16A 2PMEA 4KC0A 2F3PA 5TGZA 3V4DA 4LRUA 3C1AA 2PNFA 5EWLA 1KSHA 1JWBB 4M7RA 2Q99A 4V1CB 1X38A 1PZEA 5DM4A 5JQGF 3RWBA 1S3SA 5JECA 4JLBA 4XM1A 3T3IA 2JJ2D 3P2JA 3GD7A 4PNZA 3H1IH 2MJLA 1PS9A 3ZOKA 4F6EA 2JRLA 3KSZO 3U3OA 3ICQB 4TTSA 3QF4A 1NUUA 4HAOA 2CJWA 4A10A 3LVRE 4RM2A 2LCQA 2GJ9A 3X43A 4HZIA 4NXNO 4TZZA 4A6DA 2BP7B 2YXPX 5FPTA 3PE4A 2JASA 3K30A 3GJXC 3DG9A 4UPEA 3W9BA 2O4CA 2CUTA 3KJJA 2P9HA 3ZDBA 3QK7A 1BS3A 3PEUA 1CP3A 2XNDG 5AJVB 2HP8A 5HZGA 4E51A 2YMLA 4NJMA 4PZLA 4L9RA 4JR2A 5CDTA 1O58A 2IU4A 5FLXA 2I6XA 1Z15A 2GESA 4ZCSA 1J33A 5CCEA 5KSWB 3BL6A 4F5WA 1WSDA 3DMDA 3R7FA 3UK1A 3L9XA 1GSIA 3MTDA 3BXOA 4BVAA 1ZXLA 1N4DA 1Q0HA 2P35A 1H0KA 5IEJA 4EKEA 4TYQA 3VVBA 2CK3D 3HBFA 3I32A 2AN1A 2DKFA 4D6TH 4ISCA 4E7OA 3DVRX 4K87A 5GONF 1MVOA 1MB9A 1K4CC 3PGA1 4N8EA 2IIBA 2NXCA 3I76A 3GGDA 1XB2A 1NPDA 4ZKDA 1JEEA 4NOKA 3FD8A 1BZYA 2FJ0A 4X92A 1R15A 4FD3A 1L4YA 3E8FA 5DP2A 1BOFA 4MVJE 3HSKA 4DG5A 1C9DB 3INGA 1SVSA 3WG9A 4YQZA 1X8KA 4E5VA 4FCCA 1RC8A 2B8WA 5LP6A 3R0ZA 2HK7A 2J32A 3SHVA 1Y4UA 3DAOA 1AMOA 1JYFA 4PPFA 3VR1A 1T3SA 2QAGA 1V5WA 2C5GA 3V2UA 4PLZA 4LFCB 2AMVA 4TZ0A 1BDHA 1MG0A 5AM1A 3Q7PA 3ZZMA 2PSEA 1K73H 4CCAA 1S2MA 2FL4A 4YCAA 1DMSA 3GLKA 4OI0A 5EKUA 3KQVA 4RMHA 3M7IA 2R3SA 3C3PA 621PA 3NKVA 5DULA 3ZWQA 5FNVB 2A94A 2GN0A 5B6PA 4FTWA 1QIDA 1STOA 1SUCA 3GFGA 3BYZA 4IMPA 2Y66A 1ACLA 4WN3A 1FL9A 1GKKA 3N7UA 1FA9A 2R7AA 2NP6A 2ZNJA 1SKUA 3MEQA 4NF2A 2B1JA 3CZCA 2X6BA 4KXLA 3TLXA 2OCLA 3A27A 3A6ZA 3L6UA 5FCDA 2OHJA 1TGOA 2VPYA 3K31A 2H08A 3G0BA 4FFMA 2ZTSA 3HCPA 2VHTA 3EFEA 1OXMA 1ULTA 2XAAA 4BP8A 1AKTA 2HDHA 3N0RA 3GK3A 2Q8NA 2YV4A 1DTOA 4MZXA 4L5JA 4H3KB 2C2ZA 3ZHUA 1YL7A 3Q8WA 1AKEA 3UY4A 4IX9A 1VCOA 3N2LA 3N75A 2HQ1A 3O4RA 4CLRB 2MOKA 5BUSA 5JS1A 2XZOA 2R85A 1S9DA 4LS3A 3Q15C 2NO0A 2E55A 1NRXA 2M32A 4FLEA 3KQMA 4QASA 4R2XA 3DLIA 4D92A 1LC3A 5HIJA 3PX2A 5LXTB 3VNAA 1A69A 3HXLA 3IR5A 5IXYA 1IDSA 2FQ1A 1H1TA 1K89A 2ZSBA 3JVHA 4MVJD 1G5TA 3LI2A 3RUAA 1L5KA 5HK9A 4B3SB 3C3KA 2QVXX 2VDJA 4CXMA 2FOXA 3VKHA 1C7RA 3FRJA 2O2ZA 3L7LA 4O6VA 4DJTA 1E62A 1K8AH 1D3AA 3IR9A 5GGYA 3KTAA 4WOKA 2WTEA 4DIFA 4QYIA 5DECA 1KC3A 3VZSA 4A0QA 1GN4A 3TW8B 4Z5XA 1G8MA 2ZKLA 4IP0A 1ESNA 1FSZA 4N5MA 4ZZ3A 4ZBMA 1JVMA 4YK7A 3FAVB 3R6GA 2PVCA 1X39A 3ZX5A 5B3KA 4WEQA 4JUAA 5T64A 2XE7A 2HHLA 2W2KA 2OIGA 2V7XA 4DS3A 4G4IA 5ELLA 4UMFA 5L9AA 3QXJA 2DY1A 1XFAA 3GZNB 2YS8A 5AW0A 3I2FA 4DMFA 4F2PA 1T24A 2QM7A 2XKBA 1D4OA 3WLQA 2C1EA 1V45E 5I48A 5DI9A 1D1PA 2PWZA 4O4LB 2GXUA 1F9EA 1JXMA 1QKIA 1QS0A 3L0PA 4L1KA 5LMUB 2ZJFA 1XP5A 1AB3A 1KY5A 3MAAC 2QN6A 1Y6QA 3B52X 2V5AA 1E1MA 4LQCA 2BOBC 4HI0E 4FSDA 4M53A 1VCMA 2IFTA 5ICGA 1ZUNA 5CW2A 3AJDA 1OMOA 3OOYA 2B83A 3AUFA 1P0IA 1UIMA 2UUAB 1OI7A 2XAQA 2CK3G 3VDQA 2BH2A 1LDGA 4XCXA 4YREA 4IGIA 4MS1A 3OT1B 1P5FA 5K01A 3ZWKA 4WGGA 2WYVA 4NARA 3QHDA 4E08A 3EW7A 1CN7A 1MB4A 2NZ2A 5G2OA 4PGMA 1Z8HA 3ZZ0A 4QPDA 1DBVO 5IC6A 3QKUA 2QSZA 4XX1A 4K86A 1Q3KA 3FJ1A 4C43A 1P0FA 2W2OA 2ZRFA 1VGVA 3TTUA 3OTOO 1VQ7V 2AZDA 1NBIA 4GEGA 1MX1A 1TPZA 3N6XA 1FS0G 5EJ6A 1XCOA 2POCA 1J97A 3VU3A 1XDDA 4L95C 4N3CA 3SYAA 4Y2RA 2X2EA 3B13B 5ALYA 1TRKA 2FQWA 3CEAA 2NWQA 3DULA 1QR8A 3B5IA 1A88A 3A4TA 4HDSA 5KNBD 4K7JA 3ZP7A 4NTWA 1Y1SA 1MX3A 4G5SA 3RU9A 5D1HA 3CMCO 3W6ZA 3TQSA 3I9OA 2PNJA 2PJRA 3EC1A 1LLUA 3IJRA 4IRMA 3DXXA 4OBEA 2NZUG 4LJ8A 2Z3YA 2GCPA 1TT7A 1GILA 5EKXA 4BRUA 2DKNA 4DHWA 1SKVA 2DPLA 2J31A 3HJCA 4DA4A 3IA2A 1M33A 1ENZA 1VIVA 5JU6A 3TW4A 1UK8A 3EIXA 4CU5A 5DCVA 4UVHA 5BSKA 1FE8A 3FBWA 3TGLA 3KDAA 2FTKE 3KSMA 4PGGA 1BTOA 3C7DB 1J07A 3OCYA 1M0SA 3MHHC 3NVAA 4HGOA 3GUZA 2BN4A 1VQKV 1X7YB 3K1JA 4C88A 1NG9A 5EAIA 4I55A 4QBTA 3IAUA 3JD0A 2Y4NA 1DGSA 3GQBB 2OV3A 3UGQA 4FSXA 4ZU1X 1MA3A 5C4GB 3OZUA 2P9CA 1QNFA 4KV9A 1QKJA 4ZVQA 1MO3A 3RN4A 1QYXA 3WB0A 2DBYA 5AUOB 3C1UA 2D1SA 1UJMA 4N8SA 4X1OA 4YPOA 5L3SB 1P29A 3KOUA 4QPNA 1I4WA 3VMFB 1H3FA 4I4IA 4QOEA 1C4WA 5BSHA 2QRKA 3BXGA 3UWSA 2O2XA 4NYIR 5LFAA 4B34A 1BVHA 4QPJA 4IJ6A 5F1YA 3PXUA 4AKEA 1VQ8V 3S4YA 1Z6ZA 1N7HA 3JX9A 2H5IA 3D5QA 2XVXA 3H2ZA 2ISQA 4G4SP 4M98A 3RLFA 2WSYB 5EQJB 3TD2A 2GILA 2JS3A 1OWMA 1T5SA 3CX3A 5EA2A 1Q74A 1NMXA 4U02A 3DC2A 3KDSE 4F4JA 3TAUA 2Q4EA 3QBJA 4OP2A 2DFDA 1F4MA 4CM7A 2ZM5A 3OE7A 4CS4A 1CW2B 3G6EV 3RT7A 1NYQA 2PUHA 3AIIA 3Q8KA 4DIUA 2ANBA 1WQ1R 1UF9A 2FQYA 3U7RA 3BWEA 3W3AA 4QOHA 3LX4A 3LC2O 3CEHA 1O77A 3RJZA 1ZIXA 4F4IA 4QGPA 4DB4A 1D2NA 4AN1A 4AY4A 4RNCA 1U6KA 4FYVA 2TMDA 1I32A 4PZCA 4RNDB 3T8YA 4CEIA 1QVAA 4YYEA 1DRUA 5JADA 2ZZNA 3VC2A 3DTYA 5DNVA 5G3YA 4NOJA 2ROQA 4JAUA 2QORA 2IEBA 2Q2OA 4JJKA 2PGLA 4H2DA 5FLYA 4L27A 4HB0A 2ABWA 5AG2A 1CV2A 4N5DA 2XASA 1A8HA 3NKLA 4V38A 1FLNA 1P7YA 1HFKA 2JGFA 3M7MX 1IM8A 3TNLA 5DFAA 2QGFA 4OHOA 2A58A 1I7DA 4JYYA 3E3AA 3IXLA 4X6UA 2NSDA 1EBOA 2Q0XA 3AHIA 3LC7O 2B8EA 1IV2A 3V3KA 3K0AB 1I9GA 5ALDA 2VUHB 5J1SB 1HORA 1WVMA 4AZ0A 4HWRA 4ZZ1A 4K9QA 2WYHA 1KD1H 4BX3A 1JSZA 2H2IA 3CISA 2V0CA 3SHTA 1V8FA 4KE9A 1XJ0A 1BKDR 2W8BB 3AM5A 3Q7TA 5JCPA 5H1YA 1TPYA 1FOEB 1PWXA 1GRRA 4P32A 3BTUA 5KC9A 1OCCC 3RABA 3THWB 3N8HA 1KOFA 2PWAA 2XMDA 2AMJA 1I10A 2OK8A 4QPKA 4RCYA 5B3LA 2PI5A 2P2LA 3EIEA 1W1WA 4F6CA 3EFHA 1GG2A 1UPTA 2WJAA 5DWVA 4RXTA 4H6WA 2PTGA 1ETUA 1RFGE 3WMXA 1NOJA 5FOXA 4Z9AA 2JHAA 5EMMA 4JYAO 3T0GA 1HQDA 2PBZA 3CURA 2OZLB 4MPDA 3B12A 2G38A 4FFVA 2ZJ3A 1UZUA 3IQGX 1JR6A 2X8AA 2BHLA 4JLWA 3VOSA 2R6ZA 2H8EA 2B5UA 2JJMA 3HKDA 3EXIA 3NU1A 4PNHA 3MMXA 4IIYA 5AVUA 1YVWA 3EDRA 4FHEA 1RWKA 3H2YA 3WFJA 4FMCF 4PYRA 4KQKA 1KC8H 3V7EA 3A10A 1EGHA 2VYVD 4X90A 2VQ3A 4DNXA 4WY5A 3IT3A 5LNK6 4EY6A 3O8NA 5ITZA 2YRXA 2C7GA 2CZCA 1Y1RA 3QYAA 3Q8LA 2X58A 3AFMA 2QQEA 4KGDA 3BCCH 2AMLA 3LRTA 4ZC1A 3E84A 2AF3C 1VQ8F 3K5NA 4PJ0Z 2HF2A 5F9FA 3K70B 4LFAB 2MMCA 4PXYA 4P58A 1SXIA 1ESDA 3R9XA 1FSSA 5AK3A 4OLBA 1V9CA 3RVDA 2HHHB 4YJKA 3VNSA 5IC5A 2HNAA 1UM9A 5KNLA 3I52A 1U7WA 3PC7A 3CUTA 2E5LB 3FR8A 1Z35A 3MC1A 2YW9A 1RXVA 2L19A 3N2EA 3UPTA 3EMVA 1EFVB 1YULA 1DADA 3WJ2A 1RVDA 3AKEA 1A2OA 1P91A 3LM8A 3D7SA 2EATA 4XZ3A 2AG0A 2FPKA 3O8LA 1A9ZA 3PK0A 4MDHA 1TJ4A 2HCBA 1KKDA 1G7TA 2DWCA 1TF2A 4ZQGA 3GVXA 4BPBA 2GDSA 9ABPA 4N5LA 3TTYA 3KKKA 2C96A 4KDFA 8MHTA 1WQ3A 2OLJA 3B8EA 1Z07A 4H1WA 1WRBA 2QR5A 5B5SA 3ZMVA 4I0WB 1X13A 2X4DA 2Q2QA 4MW2A 3CVOA 2MCFA 1M56C 5AW3A 3CKLA 1ADCA 2XH8A 1THMA 4PA4A 1T5TA 4FYJA 3FHOA 2C5BA 2SECE 5KYYB 2BGWA 4Q3KA 4QXMA 4PANA 4QODA 3RTEA 2NV2B 2W4QA 3IQEA 3FPBA 4RVHA 5U1PA 4Z4EA 1RZRA 4D7SA 3NC4A 3HU3A 2ZRGA 2VOJA 3PENA 3CZRA 2XTAA 3GNTA 5AVOA 4BMCA 1QAMA 3WLHA 3VQYA 4BMZA 2ZDQA 3OM1A 3K4QA 5AMXA 3ZHOA 1MB2A 1NZDA 3T4XA 1VG0B 4FZJA 3HBAA 1CVLA 5BQXA 1Q6ZA 3WOHA 2Q69A 2C3OA 2YIBA 1SKMA 1E58A 3HA7A 2DHCA 1G4YB 3IE2A 2AWOA 2DT8A 2V6JA 4OLJA 3G6BA 3ORSA 1IU9A 4ARAA 3GJ6A 1EP3B 1Y6FA 1CZHA 1K5QA 2YVAA 3DEZA 4OX9O 1L5RA 4AG6A 1J42A 4LHEA 3TMKA 1HBJA 3SC2A 4DA7A 3QUCA 1JEYA 4NQ3A 2R00C 3UIEA 4DV5O 3GH1A 4V0OA 16PKA 2IVZA 1Q12A 5IWAB 3VGJA 3EY4A 4I50B 3WBJA 3RT3C 3OM8A 4WVFA 1W76A 3V55A 1KBZA 4OJKA 4UZEA 2LFSA 1ECFA 3CQ9A 1QLWA 2ZRMA 3OF2A 4FLTA 4X63A 5CBKA 4X7RA 2DERA 1G63A 2IYOA 4BZZA 3TN7A 3UAXA 4YR7A 1BX1A 2ID4A 3A6KA 5ALVA 1VDZA 2H0RA 3HU2A 3ZHZA 4EBBA 4GCZA 2J3DA 4O29A 3T1HO 1FPQA 2O3QA 4TSFA 1X9IA 4ZTUB 4B3MO 4HT3B 1H8ED 3M89A 5DWQA 4DRZA 2GAIA 2VLBA 3KKOA 3ETHA 3SYOA 1AGRA 2OTJV 3SEZA 2JLVA 2HGZA 1PWEA 4HH4A 4IG9A 3TO5A 4Q1VA 2AI1A 1GNTA 1I4TD 3GBVA 1Y6JA 3SJBC 1GM7A 1C3OA 3QITA 4X6XA 1QHNA 1YI2V 5F21A 1G16A 4BVKA 2ZS9A 5H6RA 5DXAA 2PS9A 2RGNA 2VNHA 5HIKA 1UMBA 4HYOA 1RJFA 4YRFA 3I8XA 3HJNA 5LL6Y 3C90A 2ZP1A 3WLTA 2IUSA 1PRYA 1T8RA 1UJCA 3W7BA 1GKFA 3SYKA 3V4FA 2XMCA 3VAZA 4BVQA 3I9KA 1TM5E 3MS7A 2WWHA 1VDMA 4IVQA 3EX7C 5F4ZA 4NY1A 3DTNA 4DSZA 5TLSA 3ZVKA 4LE0A 3ORQA 1PGPA 2BTQA 4CQMB 2ZIUB 1XGKA 1Y80A 1QORA 1I6WA 3HKBB 2K1EA 4W4LA 1EGQA 1ZGZA 1AQUA 3L7KA 3UMGA 1I0ZA 1U1IA 1XTJA 4C2AA 4ARSA 3MPUA 4HDRB 1GPAA 4OBWA 4JUBA 1DWQA 2EIJC 2AEMA 1XELA 1CUGA 2P79A 4UU1A 1TMGE 3AX6A 4X6YA 2Z0AA 4MUAA 2FDXA 3EZ6A 3RF7A 1WG8A 2UYCA 4JVMA 1RXSA 3QNWA 4YYZA 3DKRA 1ZHFA 1M6YA 3DDOA 3VBBA 2RARA 1QBZA 2GEJA 3HHEA 1Q92A 2PUEA 2GFHA 5I7FA 2ILTA 1U80A 4QARA 1EP2B 1CY0A 1LPOA 5JH7B 1UKZA 4YXWD 1VQNF 3T7JA 3H4VA 2WWXA 1MEEA 2R66A 3MCTA 1NQAO 1TCVA 4X97A 1CX9B 4LNUA 2HS3A 4KWEA 2GCEA 3ASOB 1QRAA 3AHJA 4LPKA 4UU8A 3FPCA 5E0OA 3QYJA 3B85A 3KVOA 2N0SA 1DQPA 4YIOA 3K0HA 3C3TA 1LB1B 2FFHA 4MO9A 1SQ5A 3RYTC 3BGVA 5TB5A 4KNWA 1KO5A 1EXVA 3FHCB 5JRZA 4ESEA 3G0IA 3PQ4A 3ILYA 3I6MA 2FETA 5AK6A 2CLDX 4Q47A 4RY2A 5AHWA 3UQYS 1CJCA 3KJHA 3WLIA 1QHFA 2C5SA 1FYVA 4M8NE 2I55A 4M88A 3IHLA 1R4MB 5E6RB 4GLJA 1MAVA 4LNHA 1J5XA 5JI3E 2FF7A 4KLZA 2F8TA 3KXLA 1T13A 3K9BA 4BIZA 3KSUA 4PX2A 1YUMA 3ZQUA 2O2DA 4J16C 2BF4A 1IULA 4FK5C 2VNIA 3AR8A 1OVMA 3GNSA 3VDRA 3EXFB 1NJ8A 3Q72A 2VHQA 3H19A 5DEDA 2H6EA 5FYQA 2OBNA 4BQEA 2RCNA 1EDOA 1ZL0A 4HZUA 3PPVA 3S5UA 4LECA 4RW0A 1ZZEA 3EAGA 3QVGA 5IABA 2E4AA 1DZ3A 2PLRA 4EX7A 1YHQV 4AZTA 3DE1X 2HYDA 2VJMA 4FLFA 5EC8A 2IDMA 1E69A 5GAJA 5JFGA 2K2WA 4DDMA 4X62O 4BZQA 4PZDA 2EJWA 3LJKA 5BMOA 3I01M 4Z0HO 1TZBA 4WXRA 2F1JA 1IXKA 3SPGA 2UXDO 1DRJA 4IJMA 5JZVA 1N33B 1A4IA 3IUYA 1Y9AA 2V1DA 3JQAA 4MA5A 1BW9A 5EINA 3E9YA 4ZJPA 3W77A 2VDRB 1EZVH 1GLNA 4R7TA 3AM3A 3ZZTA 3GVHA 4DR5B 1VMKA 4FQ8A 4LBEC 3G68A 3TR0A 2QV0A 3ZG6A 1U0LA 4X64O 1UFYA 2YYSA 3A9WA 3ZXIA 2RK6A 2PEYA 2O0MA 1U8TA 1A1SA 3R9KA 2D5IA 1SQSA 2HXGA 1KEEB 4ZN6A 3ZD9A 4TMKA 4CV0A 2X0FA 4RJJA 2R6DA 5EJ8A 2A1IA 4BQFA 1QLJA 4B2PA 3SJQC 5SY4A 3FG9A 4FLUA 2I7VA 3QFHA 4S3MA 2V7VA 1KOJA 1JI0A 1ESZA 4K6KA 1H2BA 4LMAA 2KS6A 2RKOA 3FSGD 5HKKD 1FX0B 1PE0A 1Q0LA 2UZ1B 4KWIA 3VYUC 5IWCA 1IMOA 1MPXA 3ZY4A 3HI4A 4X24A 3IIIA 5JJKA 1BWRA 4F4FA 3JARB 1TEXA 2QT9A 4NNOA 4PI0A 4YJ3F 3G7UA 1T3GA 3O9OA 3IAYA 1C30B 2VO1A 4S1WA 3UFBA 2J4CA 3WADA 1WLSA 1NHWA 2P5UA 5TSDA 1RYZA 1GM9A 2GASA 2CVFA 1RAEA 3EPRA 1WABA 2CHTA 3N4ZA 3QELA 3A1SA 1HY3A 4BNMA 1OB2A 2QTSA 3LXUX 1ZMXA 4R6WA 5CMUA 3P9XA 3KT0A 3VU9A 2QYSA 3E9RA 1F2UB 3FTDA 1EJ0A 1SXJB 3FOFC 1IN5A 3ZS8C 4K26A 2OCBA 5DN6D 4RZXA 5I45A 3HLTA 2V0GA 1PFKA 3W1EA 1EHCA 3HBJA 1LPPA 1U2EA 4KFSA 3QXGA 4MVYA 2QRUA 4MEJA 4MARA 1KVRA 5HKLA 1MF7A 3BVPA 3TVYA 3CNNA 1GNQA 5FL7D 3C7KA 3DTVA 1KZHA 4JS0A 4QFDA 3GJYA 1SQQH 3PX3A 3M34A 4FN4A 4LJLA 3CX5F 4AQ7A 4YXWG 2GPYA 3U40A 4MYTA 1XVUA 2XWPA 2WPNA 1U8AA 1CC1S 2DJ5A 1F2VA 1IBKO 3AI1A 1JQ5A 3Q1LA 1M0WA 2QRHA 4R1QA 1O9HA 1UBRS 4C0XA 1A27A 2KBEA 4XIFA 2A59A 1EDZA 2D5AA 2O7QA 1WULS 5A1TA 5MN6A 1D04A 2CHQA 3JWIA 4YTEA 3SQNA 4JEHA 1UWVA 1CJKC 4NCBA 4QWWA 2B20A 3D1JA 4E09A 1Y7IA 2I2FA 4TSRA 4QGFA 5HM6A 4GM1A 3EWAA 1CUHA 1U3DA 1UCFA 4CM6A 4P98A 4Y6OA 3MGAA 3B89A 3KZNA 4MGZR 3WHIA 2PMWB 3NHAA 3EGDB 4E4EA 4MO2A 1CULC 4U7DA 2Q50A 3WGGA 3DXRA 4C4OA 2VCYA 3VI6A 4HEHA 5KCZA 4C5AA 2C5HA 4V0NA 1VBFA 4AYTA 2B8JA 1FDVA 5IUNC 4M46A 2COKA 1EZ4A 2WINI 1K7EB 2V03A 3QO7A 4DV2O 1D0IA 1PJSA 4HZ3A 4QIWF 2YUTA 4AK9A 4QUGA 2GX6A 1IJFA 1Q0PA 4R2JA 5CFLA 2HNKA 4DO2A 2J3KA 1SY7A 2BFAA 5I3ZA 5B58T 3FMPB 5G40A 4DCUA 2X1HA 4BJHB 1ACMA 4FZ0A 4UARA 3A26A 1Y0BA 3IXMA 3HMQA 4UDYX 1RYYA 5BRJA 1MA1A 4U2EA 3AUSA 3CM0A 1GKYA 2FEKA 2VWGA 4HDAA 1JHAA 2FB5A 2W00A 3CYPB 4KYTA 1QG2A 4LDNA 2F6RA 3X1ZA 1WJGA 3I01A 1W93A 5GQSA 2QR3A 3OE5A 4YJFB 4IMJB 3Q98A 5FBWB 3O9ZA 4UHBA 3D3JA 4A8HA 1EFKA 3A6DA 3QOXA 3UZUA 4B3BA 1T3LA 3DKPA 3CD6F 3K0BA 4HNVA 2RI1A 4I5GA 4JP1A 3PT5A 4ZP1A 3QX7A 4QJ5A 3NOVA 2UYHA 4IV0A 3LV8A 3FAKA 2XYRA 4CG0A 3PL5A 4K46A 4P4TA 3WB9A 3R8FA 1FMJA 3ML0A 4ETMA 2CHVA 3QLJA 3OW2F 1PT7A 4F8YA 3B8NA 2F43B 3QEKA 3RU3A 4FDLA 5IKOA 3VH2A 4S1VA 4MVOA 2EWCA 2B3DA 1SIUA 5EUQB 3DDZX 1Z29A 2AJTA 2XDWA 4HY3A 1CNMA 5JC8A 1C1DB 3MXTA 4OHBA 1L5MA 4NBRA 4FYXA 4ZFNA 2A84A 5GTHZ 3CWZA 3TW0A 4DA0A 2JIDA 2W42A 3W8RA 4M36A 1G59A 3GRKA 1GTZA 3ZUGA 1R0SA 4F3RA 4ZCTA 4Q1DA 1R1DA 3ETGA 4V03A 4TYWA 5ALWA 5TPWA 2GM4A 5EHQA 5HA5A 4DNQA 2PGIA 1DFHA 3FB7C 1KFJB 3RA6A 3P2EA 4R68A 5KA5A 3OIFA 1H47A 3K12A 1JLRA 1BYIA 2X5NA 2OD2A 2EHJA 1DOAA 1XX6A 1RZVA 1IDOA 2H2DA 2PSFA 1Z5PA 3OVMA 1S2OA 2AQHA 1AK9A 3AI2A 2TMKA 1QIHA 2ZUUA 5M7EA 1AURA 1DIBA 1VLVA 1LXCA 2WKSA 1SCKA 1XQ9A 1ZSVA 3PFWO 4L50A 5I4CA 2XTZA 5TF4A 1JLKA 2Z98A 4LDJA 4P54A 2ZRNA 4X1IA 4BMXA 5BR1A 1V0JA 3S0WA 1E9VA 5CM8B 4IQGA 2SBTA 3IUJA 3BULA 1VQ9F 3PV0A 2X14A 2FPUA 4OV6B 3G89A 2ODNA 3H8WA 1NI5A 3IMEA 4UBOA 1OHHA 2BEWB 2ZROA 2O50A 2D7DA 4NCNA 4EIWA 2R8BA 3EF0A 2GARA 3MGKA 4JVLA 1E1KA 2WD9A 3ZBUA 5D7BA 1NN0A 2NG1A 3OESA 1V7ZA 2XMBA 2CYBA 3I45A 1XZGA 5CLQA 4EBFA 5EHIA 5D87A 5FL7G 2CJYA 1LZKA 1QK3A 3OZXA 5SZHB 4GKAA 5JAZA 1GQ2A 2ZJ6A 1HDCA 1PNRA 4EYQA 1PW7A 4OGQB 4DDWA 4OLFA 4BW9A 2JKVA 1XKTA 3O75A 3S0HA 2D7JA 4H7JA 3ZGVA 3ZTYA 2ZWVA 5JSQA 2CXUA 3VAAA 3P0JA 4H7IA 3EARA 3NHWA 4KQMA 2FP3A 1U7XA 3ISVA 2ADMA 5TNXA 2F8LA 3BHIA 1MO2A 1ZJ4A 3E9EA 1QGED 4F5YA 2I6TA 4M3NA 2Q0SA 1PAUA 2XMZA 1NLFA 3SOPA 5ICMA 3G0OA 3ESZA 5IJ9B 2W6PA 3H42B 1ML4A 3GRUA 5GWXA 5I4IA 4D97A 4N01A 4OFBA 3QKSA 3ZRXA 3ZGNA 1AI7A 2FN4A 2XODA 4IIVA 4YRMA 1HNWB 1KL7A 5EVJA 3ADOA 4D9HA 4RH0A 5SYNA 3NRBA 4LF4B 1U65A 1TU0A 3N0WA 1OR8A 1U7UA 3V4SA 2O3SA 2JI9A 3NMUF 1PUJA 5BQOA 3T5MA 1HC7A 3G2IA 3PQFA 2IY8A 1TC1A 4C0SA 4GPEA 5ALHA 1TJ5A 5HWEA 4FKZA 2IXBA 3WFIA 5BWLA 4X61A 4NUTA 3GHYA 1R8SA 2BRUA 2R8YA 3HVRA 1HUQA 2H3EA 3OMLA 3RSZA 5L95A 1PBTA 4N23A 2PD3A 3C3MA 4FBGA 4JI0B 2ZB8A 2QF7A 3AM4A 2A5DA 3D2BA 1ZD8A 3WICA 1CTQA 3ZY2A 4GLFA 1L7PA 4LYGA 3SAJA 3FNRA 4EP1A 1I4EB 2AMFA 3GOQA 3D5TA 4IEIA 4OK3A 2R96A 1PU2A 1BGWA 3M5WA 2FPIA 1OH8A 2XTNA 4C01A 3ZJ5A 5JQGB 5EJ4A 3W79A 1P2DA 4CC6A 1CFJA 3EOZA 2PL1A 3BAFA 5EL0A 2FOLA 4Y1FA 2F9FA 3CF0A 1P1FA 1JE0A 2ODEA 4RIGA 2PT5A 5EZYB 4F4CA 5DHFA 4HP8A 2GNAA 1E66A 1U04A 3CCRF 1NF3A 2XVYA 3MG9A 4GPIB 3RWRD 2AWNA 3FVRA 1K8XB 1U0FA 3KKNA 1ML3A 3ZV3A 1WCV1 5KKAA 1V8ZA 4KN6A 2PAFA 4P6VF 4UTNA 1RWBA 1IOZA 2ZSHA 5FUBA 4L5YA 4O5AA 3GP8A 4Z2AA 3H2JA 1P60A 4BEBA 1YUBA 5JCJA 4PINA 4UTXA 1GGNA 1UIRA 3F1KA 1M6VB 4CTKA 1OX6A 3MQ4A 3RRFA 5LBTA 3WTCA 1MOPA 2OXCA 2E0IA 2WD7B 2YY5A 3SDSA 1EWVA 4WZBA 2H92A 1JECA 1SZQA 4CQJA 4PSCA 4H1VA 3ASNC 3C5EA 2VS0A 1HL3A 2FPMA 4IFTA 3FJYA 4CEHB 4C7XA 5GONB 3C41J 3IP1A 3CCSF 1S02A 2XSZA 3ZQJA 3O3OB 4Z7NB 3LZCA 1N3BA 1VCHA 1J0XO 4OF4A 1Q2UA 2I6QA 3VZQA 1PK9A 5AYVA 3KHTA 1K7YA 2QTVB 3OICA 3I6ZA 1KTIA 3QEMA 2PMBA 1YQWA 3TJTA 4R98A 3AEZA 2GN6A 2WSIA 2GRJA 3EZLA 1T0BA 2F3QA 1FVFA 3O84A 2IIQA 3UAYA 1R5JA 3VR2A 8OHMA 1NN3A 3GCXA 4ZVNA 1L5FA 3QU5A 1J2JA 3O3MB 1F2DA 6Q21A 2CT8A 3H2KA 2G5PA 1C50A 2BYTA 4DBVO 1EP1B 3V1LA 4IJ5A 3J7AC 3AG3C 3G88A 1VI2A 1RQXA 2WOOA 4L78A 4MRAA 4E2FA 4XD7A 3LSSA 3H86A 1F12A 5DI3B 2RG1A 4V1CA 2A3RA 1QB7A 5AKGA 4PRKA 4B8WA 3CRCA 3DFUA 2BLNA 5I7AA 4RVSA 2X0NA 2N75A 4ZZ0A 1QBGA 4WDRA 1HE4A 3Q3HA 3Q3JB 2QYTA 4XW2A 1VZ3A 3LFHA 2PFSA 1UDAA 1XUOA 2XNJA 4I8DA 4N21A 1S89A 2BH9A 2BP7A 3K1AA 2WHYA 1U7ZA 4QOGA 1R16A 1YQNA 3WO0A 3HCNA 3CIOA 7AT1A 1AZLA 4J0GA 4CL8A 2P2CA 4P4UA 3M6WA 4RWEA 5DASA 2COUA 3PHLA 1MNAA 2W2MA 4L02A 2DAPA 2WK1A 2FZ4A 3DAPA 5HTKA 3H6GA 3PFNA 1XZ8A 3WIDA 3T1YB