1FNJA

Crystal structure analysis of chorismate mutase mutant c88s/r90k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKSIKVMMTVQTDVPQDQIRHVYLEKAVVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (CHORISMATE MUTASE)
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 30
structure length 114
sequence length 115
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnjA00
1QAHA 3R0PA 2UYJA 2EWCA 2UYNB 1QU9A 4NWOB 3D01A 2CHTA 2UYPA 1ONIA 1DBFA 1PF5A 3I3FA 2CW4A 3MQWA 3QUWA 2CVLA 3ZOPA 3GTZA 2CWJA 1JD1A 2OTMA 1FNKA 3VCZA 1UFYA 4ZK7A 1J7HA 3I7TA 3LMEA 3L7QA 3M4SA 1NQ3A 1XRGA 2IG8A 1XHOA 2UYKA 1COMA 2UYNA 5HP8A 3KJKA 3ZP4A 3K12A 3V4DA 3ZO8A 3KJJA 2B33A 5HP7A 2DYYA 1FNJA 1UI9A 1ODEA 1QD9A 3M1XA 3K0TA 1X25A 2CSLA 3ZP7A 2CHSA 3LYBA
chains in the Genus database with same CATH superfamily
2BO1A 3I55F 1W59A 4G4VA 3IR9A 3JCMM 3WGNA 4BT6A 4BVTA 1W55A 2NMUA 3T80A 2OZBA 3NK6A 4DRXB 1U3PA 1IV4A 1X52A 3MCAB 2KGWA 1T0KB 1TUBB 3N4ZA 3V4DA 3U0OA 2B33A 4ZI7A 2K1SA 3HTNA 1FSZA 2ZAUA 5C8YB 4BT5A 3SIUA 2N48A 2UYPA 1TUBA 2Z1TA 4BVSA 5HY1A 4O2BA 1GO0A 5A2QM 4BT3A 3VIUA 2RHJA 3F0DA 5IT9M 1KNKA 2FC3A 3E22B 5CA1B 1VK3A 3KE1A 1K9MH 2VAPA 3V3TA 3CPWF 1K8AH 4ERHA 1COMA 2GVIA 1CK2A 3CMAF 2FGYA 5HP7A 4NUTA 4X1YB 4BVQA 3VYUC 4O2AA 3E22A 5CA1A 3P0ZA 1U43A 1YJNF 5JQGA 5MN6A 3PAFA 1IV1A 1SZQA 3GTZA 3CCUF 1XBIA 3J81M 1FNKA 1GZ0A 2ZF8A 5HY2A 2LBTA 1KQSF 3L7QA 3HKCB 3VI6A 1XHOA 5J2TA 1SA0B 3WXMB 3HKEB 1YITF 4I50B 2Q1XA 1U3LA 4B46A 3JAMM 3M1XA 4ZOLB 2KTVA 2IAFA 5LOVA 1VQLF 5IYZB 3HKCA 4X3MA 2UYNB 1SA0A 3S02A 3HKEA 1QU9A 3JVHA 4X3LA 2P6YA 4I50A 5KX5A 4LCKA 5HXZA 3F6MA 4ZHVA 3D00A 2R6R1 3LFOA 3N2KB 3HWUA 1UFYA 2AIZP 1QVGF 1IV3A 4BW0B 4NQ3A 4TV8B 1H7MA 2Z1UA 2Z1FA 4TV9B 2UYNA 3RYHA 1VQKF 3NMUC 3RA5A 5IJ9B 5GIPC 4M8IA 3VOBA 3N2KA 1VQOF 3GYQA 2Q1YA 5LP6B 2KG4A 3J7AR 2HX0A 2VAMA 5LA6B 3S03A 4TV8A 1Q7YH 3HKDB 4TV9A 2CHTA 1JFFB 3F0EA 5AVMA 1ONIA 4ZHQA 3HKBB 3WJPA 4X1KB 3QUWA 2GZLA 4O4IA 2QEXF 2JNBA 2OTJF 5LP6A 2AIFA 1YGYA 5LA6A 3S06A 5EZYB 1YI2F 2F9ZC 2LCAA 3KJJA 1VQ6F 2QTPA 4X1KA 5G4VC 3RYIA 3WJQA 1X25A 3HAXD 3K14A 1M1KH 2IQQA 1VQMF 4R40B 1VQ8F 5EZYA 1Q86H 4WBNB 3TD3A 3RE3A 2CW4A 1DT9A 4ZI7B 3VYTC 2VAWA 3P4EA 4ZK7A 4B5CA 3V7QA 4HNAB 3VTIC 1NQ3A 1W40A 2H8CA 4G88A 3GHZA 2ZVZA 1VQPF 2QA4F 4B45A 3K12A 1H47A 1PXWA 4WBNA 5HXUA 4G4XA 4O2BB 4RQOA 1M90H 5JCOC 4BVRA 5BMVB 2HS3A 5HY0A 4HNAA 3IEQA 2UYJA 1NJIH 4U39A 3S0YA 4IIJB 3HJWC 3CC2F 3MCQA 3CG6A 3G6EF 1QVFF 5FNVA 2CVLA 3IKEA 5BMVA 1W5FA 4O2AB 4EI9A 5KMGB 3QTYA 2I6RA 4C4WC 1JJ2F 2ZOVA 3ZP4A 4IIJA 5JQGB 4I4TB 3VOAA 3E1YA 3WPWA 4C81A 5LXTB 5EB0A 3LWQC 5CB4B 3WJRA 5KMGA 5J2TB 3QHDA 1IPAA 3DC2A 2OHWA 1PF5A 4ZHYB 4I4TA 3WGMA 1NMUB 5LXTA 1KNJA 3JALA 4BT4A 5CB4A 1TVKB 5LOVB 4F6RA 2GLZA 3PLAC 5IJ0A 3EORA 3NK7A 1ZWZA 3KJKA 3OW2F 1N8RH 3VMFB 3WGJA 3UT5B 5KX5B 4O4JB 1W42A 4TZZA 2YXZA 1RA4A 3N2GA 3JARA 3K0TA 2VXYA 2AMTA 2CSLA 3C9TA 1TVKA 5EB1B 2QI2A 3VYSC 3RYHB 3BYQA 4IHJA 1RLGA 3UT5A 4O4JA 2BTOA 4C8EA 2BTUA 5GIOC 1XRGA 3C9SA 1VQ5F 5EWRA 3KIZA 4EI8A 3LWPC 2H6LA 5EYPB 3WGKA 4ZHQB 3ZO8A 4EB6B 2KTUA 1UI9A 3LDTA 2HP0B 4O4IB 2RHHA 3C9RA 3ZP7A 2HS4A 5LYJA 2VGMA 2RHLA 2Z1EA 3OBWA 5EYPA 4C82A 3N4YA 1S72F 5ITZB 4EB6A 3RYIB 2HP0A 5FLXM 3Q8HA 2HQSC 2Z01A 5DCVA 1FNJA 1OFUA 5ITZA 1ODEA 1T0AA 1YQNA 5CA0A 3JAKA 1RLUA 3JAWB 3CCRF 2EWCA 3OONA 1OAPA 5MN4A 3DDNA 5GANK 3ZOPA 3O85A 3CCJF 2CWJA 1YHQF 3RYCA 5JCOA 3LWVC 3FBAA 3JAWA 3D54A 1R1MA 2HP3A 1K73H 3CXCF 3WPXA 4O4HA 5FNVB 2UZHA 5JH7A 1W3EX 3JATA 4I55A 1Q82H 3CB2A 3IMPA 1W2BF 2I6DA 1U40A 1W5EA 3G4SF 3CMEF 1YJWF 1CLIA 3VO8A 5B8FA 4KWEA 5EIBD 1GX1A 1Q8RA 5JVDB 2RB9A 3K2XA 3FD6A 1H48A 3CYPB 4B62A 1VQ7F 4BT7A 4X1IB 1Z5WA 3C8LA 1W41A 2R751 3V7EA 4RHAA 2RHOA 3E20B 5GAPK 3JALB 4DRXA 1Q81H 5JVDA 2DYYA 2CHSA 3CCEF 4F6RB 1FFXB 2VGNA 5IJ0B 3D01A 3CYQA 1DBFA 3CCSF 4E6EA 3MQWA 3S0HA 4X1IA 3G71F 3N2GB 3JARB 2CZWA 3B6NA 3I7TA 4YJ2B 3M4SA 4G4ZA 4O4LB 5C8YA 4DXDA 1FFXA 3ELCA 1RQ7A 3FPIA 3CC4F 4IHJB 1E7KA 3ERNA 3KHNA 4C8IA 3TD5A 1VQ4F 1VQNF 3S0WA 3I56F 5J2UB 1KC8H 4YJ2A 1VQ9F 2MQEA 3F0FA 4O4LA 2PMPA 3WGLA 2HVYD 1Z5VA 3OBYA 4U3JB 3TD4A 2G9IA 3CCMF 5EO3A 4X1YA 3P10A 3CPQA 3ON1A 2WALA 3CCLF 3VCZA 2W8BC 3NVKE 5J2UA 2ZVYA 3C9UA 5LYJB 2DT4A 3ESJA 5MN5A 4U3JA 3MBMA 1XV2A 2H8EA 5G4UC 1QD9A 1JY8A 1VHAA 4BY9D 5EIBC 3LWOC 4BT2A 1GO1A 3IEWA 2L26A 1RQ2A 3LYBA 1QAHA 4XCQA 3R0PA 1VH8A 3I3FA 3AGKA 5GONB 3SIVA 1YJ9F 4ZOLA 5CA0B 1JD1A 1J7HA 3JAKB 5EAZA 5HWEA 1CN7A 3JASB 5IYZA 2IG8A 4G4YA 2HRUA 2OTLF 2UYKA 4LNUB 3CCVF 3FFMA 3MDOA 5HY4A 3RA6A 1W5AA 3FD5A 1W57A 5GONA 2V9YA 2PHNA 4YJ3B 4X20B 3RYCB 2YYEA 2ZODA 3F0GA 4TUYB 5GINC 3JASA 2LBWA 1KD1H 3RYFB 4G4WA 1VQVA 4NWOB 4LNUA 5IJ9A 4FFBB 3NVIB 1SDSA 4C8GA 3LWRC 4PWTA 4O4HB 3J80M 2OTMA 5JH7B 4YJ3A 2ALEA 3LMEA 3JATB 4X20A 4I55B 1W5BA 1X7PA 2HS0A 4TUYA 3CCQF 3IKFA 1IV2A 3RYFA 5HP8A 3HKDA 3CD6F 2LBXA 1JFFA 4EI7A 3HKBA 1JN1A 4ZHWA 4FFBA 1X7OA 2HRYA 3CC7F 1W581 5FJ4C 2BTQB 5LP6C 1YIJF 3M84A
chains in the Genus database with same CATH topology
1QAHA 3R0PA 2UYJA 2EWCA 2UYNB 1QU9A 4NWOB 3D01A 2CHTA 2UYPA 1ONIA 1DBFA 1PF5A 3I3FA 2CW4A 3MQWA 3QUWA 2CVLA 3ZOPA 3GTZA 2CWJA 1JD1A 2OTMA 1FNKA 3VCZA 1UFYA 4ZK7A 1J7HA 3I7TA 3LMEA 3L7QA 3M4SA 1NQ3A 1XRGA 2IG8A 1XHOA 2UYKA 1COMA 2UYNA 5HP8A 3KJKA 3ZP4A 3K12A 3V4DA 3ZO8A 3KJJA 2B33A 5HP7A 2DYYA 1FNJA 1UI9A 1ODEA 1QD9A 3M1XA 3K0TA 1X25A 2CSLA 3ZP7A 2CHSA 3LYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAH A;  3R0P A;  2UYJ A;  2EWC A;  2UYN B;  1QU9 A;  4NWO B;  3D01 A;  2CHT A;  2UYP A;  1ONI A;  1DBF A;  1PF5 A;  3I3F A;  2CW4 A;  3MQW A;  3QUW A;  2CVL A;  3ZOP A;  3GTZ A;  2CWJ A;  1JD1 A;  2OTM A;  1FNK A;  3VCZ A;  1UFY A;  4ZK7 A;  1J7H A;  3I7T A;  3LME A;  3L7Q A;  3M4S A;  1NQ3 A;  1XRG A;  2IG8 A;  1XHO A;  2UYK A;  1COM A;  2UYN A;  5HP8 A;  3KJK A;  3ZP4 A;  3K12 A;  3V4D A;  3ZO8 A;  3KJJ A;  2B33 A;  5HP7 A;  2DYY A;  1FNJ A;  1UI9 A;  1ODE A;  1QD9 A;  3M1X A;  3K0T A;  1X25 A;  2CSL A;  3ZP7 A;  2CHS A;  3LYB A; 
#chains in the Genus database with same CATH topology
 2BO1 A;  3I55 F;  1W59 A;  4G4V A;  3IR9 A;  3JCM M;  3WGN A;  4BT6 A;  4BVT A;  1W55 A;  2NMU A;  3T80 A;  2OZB A;  3NK6 A;  4DRX B;  1U3P A;  1IV4 A;  1X52 A;  3MCA B;  2KGW A;  1T0K B;  1TUB B;  3N4Z A;  3V4D A;  3U0O A;  2B33 A;  4ZI7 A;  2K1S A;  3HTN A;  1FSZ A;  2ZAU A;  5C8Y B;  4BT5 A;  3SIU A;  2N48 A;  2UYP A;  1TUB A;  2Z1T A;  4BVS A;  5HY1 A;  4O2B A;  1GO0 A;  5A2Q M;  4BT3 A;  3VIU A;  2RHJ A;  3F0D A;  5IT9 M;  1KNK A;  2FC3 A;  3E22 B;  5CA1 B;  1VK3 A;  3KE1 A;  1K9M H;  2VAP A;  3V3T A;  3CPW F;  1K8A H;  4ERH A;  1COM A;  2GVI A;  1CK2 A;  3CMA F;  2FGY A;  5HP7 A;  4NUT A;  4X1Y B;  4BVQ A;  3VYU C;  4O2A A;  3E22 A;  5CA1 A;  3P0Z A;  1U43 A;  1YJN F;  5JQG A;  5MN6 A;  3PAF A;  1IV1 A;  1SZQ A;  3GTZ A;  3CCU F;  1XBI A;  3J81 M;  1FNK A;  1GZ0 A;  2ZF8 A;  5HY2 A;  2LBT A;  1KQS F;  3L7Q A;  3HKC B;  3VI6 A;  1XHO A;  5J2T A;  1SA0 B;  3WXM B;  3HKE B;  1YIT F;  4I50 B;  2Q1X A;  1U3L A;  4B46 A;  3JAM M;  3M1X A;  4ZOL B;  2KTV A;  2IAF A;  5LOV A;  1VQL F;  5IYZ B;  3HKC A;  4X3M A;  2UYN B;  1SA0 A;  3S02 A;  3HKE A;  1QU9 A;  3JVH A;  4X3L A;  2P6Y A;  4I50 A;  5KX5 A;  4LCK A;  5HXZ A;  3F6M A;  4ZHV A;  3D00 A;  2R6R 1;  3LFO A;  3N2K B;  3HWU A;  1UFY A;  2AIZ P;  1QVG F;  1IV3 A;  4BW0 B;  4NQ3 A;  4TV8 B;  1H7M A;  2Z1U A;  2Z1F A;  4TV9 B;  2UYN A;  3RYH A;  1VQK F;  3NMU C;  3RA5 A;  5IJ9 B;  5GIP C;  4M8I A;  3VOB A;  3N2K A;  1VQO F;  3GYQ A;  2Q1Y A;  5LP6 B;  2KG4 A;  3J7A R;  2HX0 A;  2VAM A;  5LA6 B;  3S03 A;  4TV8 A;  1Q7Y H;  3HKD B;  4TV9 A;  2CHT A;  1JFF B;  3F0E A;  5AVM A;  1ONI A;  4ZHQ A;  3HKB B;  3WJP A;  4X1K B;  3QUW A;  2GZL A;  4O4I A;  2QEX F;  2JNB A;  2OTJ F;  5LP6 A;  2AIF A;  1YGY A;  5LA6 A;  3S06 A;  5EZY B;  1YI2 F;  2F9Z C;  2LCA A;  3KJJ A;  1VQ6 F;  2QTP A;  4X1K A;  5G4V C;  3RYI A;  3WJQ A;  1X25 A;  3HAX D;  3K14 A;  1M1K H;  2IQQ A;  1VQM F;  4R40 B;  1VQ8 F;  5EZY A;  1Q86 H;  4WBN B;  3TD3 A;  3RE3 A;  2CW4 A;  1DT9 A;  4ZI7 B;  3VYT C;  2VAW A;  3P4E A;  4ZK7 A;  4B5C A;  3V7Q A;  4HNA B;  3VTI C;  1NQ3 A;  1W40 A;  2H8C A;  4G88 A;  3GHZ A;  2ZVZ A;  1VQP F;  2QA4 F;  4B45 A;  3K12 A;  1H47 A;  1PXW A;  4WBN A;  5HXU A;  4G4X A;  4O2B B;  4RQO A;  1M90 H;  5JCO C;  4BVR A;  5BMV B;  2HS3 A;  5HY0 A;  4HNA A;  3IEQ A;  2UYJ A;  1NJI H;  4U39 A;  3S0Y A;  4IIJ B;  3HJW C;  3CC2 F;  3MCQ A;  3CG6 A;  3G6E F;  1QVF F;  5FNV A;  2CVL A;  3IKE A;  5BMV A;  1W5F A;  4O2A B;  4EI9 A;  5KMG B;  3QTY A;  2I6R A;  4C4W C;  1JJ2 F;  2ZOV A;  3ZP4 A;  4IIJ A;  5JQG B;  4I4T B;  3VOA A;  3E1Y A;  3WPW A;  4C81 A;  5LXT B;  5EB0 A;  3LWQ C;  5CB4 B;  3WJR A;  5KMG A;  5J2T B;  3QHD A;  1IPA A;  3DC2 A;  2OHW A;  1PF5 A;  4ZHY B;  4I4T A;  3WGM A;  1NMU B;  5LXT A;  1KNJ A;  3JAL A;  4BT4 A;  5CB4 A;  1TVK B;  5LOV B;  4F6R A;  2GLZ A;  3PLA C;  5IJ0 A;  3EOR A;  3NK7 A;  1ZWZ A;  3KJK A;  3OW2 F;  1N8R H;  3VMF B;  3WGJ A;  3UT5 B;  5KX5 B;  4O4J B;  1W42 A;  4TZZ A;  2YXZ A;  1RA4 A;  3N2G A;  3JAR A;  3K0T A;  2VXY A;  2AMT A;  2CSL A;  3C9T A;  1TVK A;  5EB1 B;  2QI2 A;  3VYS C;  3RYH B;  3BYQ A;  4IHJ A;  1RLG A;  3UT5 A;  4O4J A;  2BTO A;  4C8E A;  2BTU A;  5GIO C;  1XRG A;  3C9S A;  1VQ5 F;  5EWR A;  3KIZ A;  4EI8 A;  3LWP C;  2H6L A;  5EYP B;  3WGK A;  4ZHQ B;  3ZO8 A;  4EB6 B;  2KTU A;  1UI9 A;  3LDT A;  2HP0 B;  4O4I B;  2RHH A;  3C9R A;  3ZP7 A;  2HS4 A;  5LYJ A;  2VGM A;  2RHL A;  2Z1E A;  3OBW A;  5EYP A;  4C82 A;  3N4Y A;  1S72 F;  5ITZ B;  4EB6 A;  3RYI B;  2HP0 A;  5FLX M;  3Q8H A;  2HQS C;  2Z01 A;  5DCV A;  1FNJ A;  1OFU A;  5ITZ A;  1ODE A;  1T0A A;  1YQN A;  5CA0 A;  3JAK A;  1RLU A;  3JAW B;  3CCR F;  2EWC A;  3OON A;  1OAP A;  5MN4 A;  3DDN A;  5GAN K;  3ZOP A;  3O85 A;  3CCJ F;  2CWJ A;  1YHQ F;  3RYC A;  5JCO A;  3LWV C;  3FBA A;  3JAW A;  3D54 A;  1R1M A;  2HP3 A;  1K73 H;  3CXC F;  3WPX A;  4O4H A;  5FNV B;  2UZH A;  5JH7 A;  1W3E X;  3JAT A;  4I55 A;  1Q82 H;  3CB2 A;  3IMP A;  1W2B F;  2I6D A;  1U40 A;  1W5E A;  3G4S F;  3CME F;  1YJW F;  1CLI A;  3VO8 A;  5B8F A;  4KWE A;  5EIB D;  1GX1 A;  1Q8R A;  5JVD B;  2RB9 A;  3K2X A;  3FD6 A;  1H48 A;  3CYP B;  4B62 A;  1VQ7 F;  4BT7 A;  4X1I B;  1Z5W A;  3C8L A;  1W41 A;  2R75 1;  3V7E A;  4RHA A;  2RHO A;  3E20 B;  5GAP K;  3JAL B;  4DRX A;  1Q81 H;  5JVD A;  2DYY A;  2CHS A;  3CCE F;  4F6R B;  1FFX B;  2VGN A;  5IJ0 B;  3D01 A;  3CYQ A;  1DBF A;  3CCS F;  4E6E A;  3MQW A;  3S0H A;  4X1I A;  3G71 F;  3N2G B;  3JAR B;  2CZW A;  3B6N A;  3I7T A;  4YJ2 B;  3M4S A;  4G4Z A;  4O4L B;  5C8Y A;  4DXD A;  1FFX A;  3ELC A;  1RQ7 A;  3FPI A;  3CC4 F;  4IHJ B;  1E7K A;  3ERN A;  3KHN A;  4C8I A;  3TD5 A;  1VQ4 F;  1VQN F;  3S0W A;  3I56 F;  5J2U B;  1KC8 H;  4YJ2 A;  1VQ9 F;  2MQE A;  3F0F A;  4O4L A;  2PMP A;  3WGL A;  2HVY D;  1Z5V A;  3OBY A;  4U3J B;  3TD4 A;  2G9I A;  3CCM F;  5EO3 A;  4X1Y A;  3P10 A;  3CPQ A;  3ON1 A;  2WAL A;  3CCL F;  3VCZ A;  2W8B C;  3NVK E;  5J2U A;  2ZVY A;  3C9U A;  5LYJ B;  2DT4 A;  3ESJ A;  5MN5 A;  4U3J A;  3MBM A;  1XV2 A;  2H8E A;  5G4U C;  1QD9 A;  1JY8 A;  1VHA A;  4BY9 D;  5EIB C;  3LWO C;  4BT2 A;  1GO1 A;  3IEW A;  2L26 A;  1RQ2 A;  3LYB A;  1QAH A;  4XCQ A;  3R0P A;  1VH8 A;  3I3F A;  3AGK A;  5GON B;  3SIV A;  1YJ9 F;  4ZOL A;  5CA0 B;  1JD1 A;  1J7H A;  3JAK B;  5EAZ A;  5HWE A;  1CN7 A;  3JAS B;  5IYZ A;  2IG8 A;  4G4Y A;  2HRU A;  2OTL F;  2UYK A;  4LNU B;  3CCV F;  3FFM A;  3MDO A;  5HY4 A;  3RA6 A;  1W5A A;  3FD5 A;  1W57 A;  5GON A;  2V9Y A;  2PHN A;  4YJ3 B;  4X20 B;  3RYC B;  2YYE A;  2ZOD A;  3F0G A;  4TUY B;  5GIN C;  3JAS A;  2LBW A;  1KD1 H;  3RYF B;  4G4W A;  1VQV A;  4NWO B;  4LNU A;  5IJ9 A;  4FFB B;  3NVI B;  1SDS A;  4C8G A;  3LWR C;  4PWT A;  4O4H B;  3J80 M;  2OTM A;  5JH7 B;  4YJ3 A;  2ALE A;  3LME A;  3JAT B;  4X20 A;  4I55 B;  1W5B A;  1X7P A;  2HS0 A;  4TUY A;  3CCQ F;  3IKF A;  1IV2 A;  3RYF A;  5HP8 A;  3HKD A;  3CD6 F;  2LBX A;  1JFF A;  4EI7 A;  3HKB A;  1JN1 A;  4ZHW A;  4FFB A;  1X7O A;  2HRY A;  3CC7 F;  1W58 1;  5FJ4 C;  2BTQ B;  5LP6 C;  1YIJ F;  3M84 A; 
#chains in the Genus database with same CATH homology
 1QAH A;  3R0P A;  2UYJ A;  2EWC A;  2UYN B;  1QU9 A;  4NWO B;  3D01 A;  2CHT A;  2UYP A;  1ONI A;  1DBF A;  1PF5 A;  3I3F A;  2CW4 A;  3MQW A;  3QUW A;  2CVL A;  3ZOP A;  3GTZ A;  2CWJ A;  1JD1 A;  2OTM A;  1FNK A;  3VCZ A;  1UFY A;  4ZK7 A;  1J7H A;  3I7T A;  3LME A;  3L7Q A;  3M4S A;  1NQ3 A;  1XRG A;  2IG8 A;  1XHO A;  2UYK A;  1COM A;  2UYN A;  5HP8 A;  3KJK A;  3ZP4 A;  3K12 A;  3V4D A;  3ZO8 A;  3KJJ A;  2B33 A;  5HP7 A;  2DYY A;  1FNJ A;  1UI9 A;  1ODE A;  1QD9 A;  3M1X A;  3K0T A;  1X25 A;  2CSL A;  3ZP7 A;  2CHS A;  3LYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...