1FNJA

Crystal structure analysis of chorismate mutase mutant c88s/r90k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKSIKVMMTVQTDVPQDQIRHVYLEKAVVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords PROTEIN (CHORISMATE MUTASE)
total genus 30
structure length 114
sequence length 115
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnjA00
3K0TA 3QUWA 3ZO8A 1PF5A 2CW4A 2UYKA 1QD9A 1COMA 3GTZA 1ODEA 1NQ3A 3K12A 5HP8A 1XRGA 5HP7A 1X25A 3I3FA 3R0PA 2UYPA 3KJKA 3LMEA 2CSLA 1QAHA 2UYJA 3I7TA 3D01A 3M1XA 1QU9A 4NWOB 3ZOPA 2OTMA 1ONIA 1UI9A 3ZP7A 4ZK7A 2DYYA 1UFYA 2EWCA 1XHOA 1J7HA 2CHSA 1DBFA 3L7QA 3ZP4A 1FNKA 2CHTA 3VCZA 1JD1A 3M4SA 3V4DA 2CWJA 2B33A 2CVLA 3LYBA 3MQWA 1FNJA 2UYNB 2IG8A 3KJJA 2UYNA
chains in the Genus database with same CATH superfamily
3G6EF 3B6NA 1ODEA 5IJ9B 1H48A 3JALA 3OBYA 2N48A 2LBTA 1YJ9F 5IYZA 2RHLA 4O2AB 1SDSA 3JVHA 3HKDB 5CA1B 5J2TB 5GIOC 2OTMA 4C4WC 3VTIC 5HXUA 3JAWB 3HKEB 1W57A 5LOVA 3S0HA 1S72F 3J81M 4G4VA 1IV1A 2YYEA 2H8CA 3TD4A 3KHNA 3C9TA 3ESJA 3QUWA 3JARB 4U3JB 4O4IA 1X7OA 3CCUF 2LCAA 1NQ3A 3JCMM 4ERHA 5CA0B 3D00A 4O2BB 3S0WA 5HY1A 2MQEA 4ZHYB 4O4IB 4X1IA 5KMGA 5JQGB 1IV4A 2OZBA 1YJWF 3IEQA 1FFXB 5JQGA 2BTUA 4LCKA 1DBFA 1T0AA 5GINC 4DRXA 1W5AA 1JJ2F 1U43A 3LYBA 2ZAUA 3CCRF 2QA4F 3KJJA 2HS3A 5AVMA 4B62A 2NMUA 3IR9A 5A2QM 5MN4A 1IV2A 1Q82H 3I56F 1DT9A 4X1YA 5ITZA 1H7MA 1W41A 3CPWF 4I50B 3VMFB 3HTNA 1VQLF 1VQ7F 1CK2A 5DCVA 3S0YA 4X20A 3GHZA 3VCZA 2CWJA 3P4EA 3N2GA 3WGMA 3RYFB 3CG6A 4O4HB 3AGKA 4ZHQB 3IEWA 1W40A 1M1KH 1U3LA 5MN5A 3GYQA 5HP8A 3HKEA 5LOVB 5LP6C 5GIPC 3DC2A 4ZOLA 1Q86H 2UYJA 1QU9A 4ZHVA 2R751 3ERNA 3WGNA 1ZWZA 2RHOA 3SIVA 1QVFF 1J7HA 2Z1UA 2Z1EA 3JALB 1JY8A 3WGKA 3D54A 4EB6B 5MN6A 3CCJF 3CC7F 3LWPC 3F0FA 5LA6A 1FNJA 5HWEA 4EI7A 3OBWA 5GONB 2UYNA 1OFUA 4C8EA 4TUYB 4I4TB 4IHJA 2CW4A 3VOBA 2BTOA 5LXTA 4DRXB 4I55A 3P0ZA 5IYZB 5FNVA 1GX1A 1RA4A 3PAFA 4FFBB 1Z5WA 3M1XA 4WBNB 2BO1A 5IJ0B 3CXCF 1W2BF 1VQPF 3N2KA 4TV8A 1UFYA 5JVDA 2CHSA 5EIBC 4O2BA 1VQ5F 3T80A 3CYQA 5IJ0A 2L26A 4YJ2A 1M90H 4LNUA 2JNBA 3JATA 3K12A 1W5EA 3C9RA 5EYPB 3I3FA 5LXTB 5HY0A 1RLGA 1KQSF 1QAHA 4TZZA 4G4ZA 4TUYA 3CC2F 3FFMA 1YJNF 1VH8A 3KIZA 3I55F 3HKDA 5CA1A 2OTLF 2ZF8A 2VXYA 3NVIB 4BY9D 4E6EA 1NMUB 2EWCA 1K9MH 1XHOA 4TV8B 2CZWA 5JH7A 4HNAB 1GO0A 2G9IA 4WBNA 1RQ7A 2I6RA 4HNAA 3F0DA 1VHAA 3M84A 2UZHA 4ZOLB 4F6RB 3GTZA 3K2XA 3IMPA 3MDOA 4BT7A 1U40A 4X20B 5CA0A 4TV9A 5HP7A 3RA6A 1X52A 3PLAC 4BT2A 4IHJB 4G4WA 4NUTA 3LWRC 3ELCA 2RHJA 2GLZA 3CCLF 3S06A 3RYFA 1UI9A 1W5FA 3JAKA 3RYCA 1GO1A 3UT5B 2RHHA 5EB0A 2H8EA 2FGYA 3U0OA 5GANK 3CMEF 2CHTA 3RYHB 2HVYD 1KD1H 2CVLA 3VO8A 2VGNA 2DT4A 3VI6A 4B5CA 2ZOVA 4C8IA 3K14A 3HAXD 3FPIA 2GVIA 4NWOB 2HP3A 2R6R1 5KMGB 1Z5VA 3CPQA 2KTUA 2RB9A 4ZHWA 2I6DA 2BTQB 3WXMB 5LYJB 4NQ3A 3FD5A 4YJ3B 3J80M 3HJWC 4O4HA 3VYUC 3CCEF 3FD6A 4FFBA 4X1KA 2F9ZC 1KNJA 2HS4A 3JAMM 3F6MA 3TD5A 1W42A 1W59A 3G71F 5GAPK 4BT3A 4RHAA 4BT5A 5LA6B 4ZK7A 3LDTA 5BMVA 3NVKE 3S03A 1KC8H 4BVTA 1SA0A 1SA0B 2OTJF 2FC3A 3O85A 1JD1A 2Z01A 2IAFA 3CCSF 3JAKB 4ZHQA 1H47A 4LNUB 3K0TA 3ZO8A 2QTPA 1PF5A 3N2GB 2UYKA 5CB4B 4O2AA 4M8IA 3P10A 3RA5A 1IV3A 3MCQA 5CB4A 3R0PA 1OAPA 1W5BA 2V9YA 5EB1B 4XCQA 1VQ4F 5HY2A 1FSZA 4I50A 3N4ZA 3WJPA 3IKFA 3E22B 3WJRA 3LWVC 2HQSC 2HP0B 3VIUA 1W581 2H6LA 5ITZB 3N4YA 3Q8HA 4X1YB 2LBWA 3LWQC 3MBMA 2KG4A 3MQWA 2ZVYA 3V7EA 5KX5B 1RLUA 1YQNA 5J2TA 2AIFA 2VAPA 5G4VC 5KX5A 3KE1A 3EORA 1YHQF 1X25A 3JATB 3V7QA 2CSLA 3RYCB 3CMAF 4X1KB 2P6YA 3WJQA 4YJ3A 4EI9A 2Q1XA 5EWRA 3E1YA 1CLIA 1W55A 4U39A 1RQ2A 1VQ6F 1NJIH 3HKCB 1SZQA 2Z1TA 3C9UA 4ZI7B 1TVKB 3QTYA 3VYSC 3E22A 3IKEA 2Q1YA 3QHDA 1VQNF 1TVKA 3VYTC 2KTVA 2ALEA 2PHNA 3TD3A 1TUBA 5G4UC 2AIZP 1KNKA 3NK6A 4IIJB 3C9SA 3LWOC 5JCOC 4C8GA 3CD6F 4DXDA 2OHWA 2DYYA 4O4LA 3RYHA 5EYPA 3V3TA 3RYIA 3JAWA 4G4XA 3UT5A 3NK7A 3HWUA 3CYPB 1VQVA 2IG8A 4YJ2B 2VAWA 1K8AH 1X7PA 1QD9A 5EZYB 5LP6B 1JN1A 5EIBD 4G4YA 1XV2A 3CB2A 2W8BC 5JVDB 3S02A 3CCQF 1VQMF 5HXZA 4F6RA 2IQQA 4BW0B 4C82A 1W3EX 4X1IB 3JASB 3CCVF 3MCAB 2KGWA 4TV9B 4C81A 4B46A 1U3PA 3V4DA 5JCOA 1R1MA 3JASA 1VQOF 1XBIA 2YXZA 1CN7A 1GZ0A 3DDNA 3HKBA 3G4SF 5JH7B 3WPWA 1COMA 3WGJA 3RE3A 2ZODA 3RYIB 2VGMA 1XRGA 3LFOA 5FJ4C 2K1SA 2Z1FA 3KJKA 5C8YB 3J7AR 3D01A 1JFFA 1JFFB 1QVGF 3VOAA 3FBAA 5C8YA 1N8RH 4EB6A 4B45A 3ZP4A 2LBXA 4PWTA 5IJ9A 4O4JB 3ON1A 2QI2A 1FFXA 5J2UB 3WPXA 4R40B 5J2UA 3C8LA 1YIJF 3F0EA 1E7KA 2VAMA 3OONA 4O4JA 3OW2F 2QEXF 5FNVB 2GZLA 4I55B 3SIUA 5B8FA 4BVRA 2UYPA 3N2KB 3LMEA 1YGYA 4U3JA 4X3MA 4BT4A 1YI2F 3ZOPA 5EAZA 4BVSA 1VQKF 3E20B 2WALA 1FNKA 5LP6A 3M4SA 5EZYA 5BMVB 2B33A 4I4TA 3NMUC 4BVQA 1T0KB 2UYNB 4KWEA 4IIJA 1PXWA 1VK3A 5IT9M 4G88A 1TUBB 4X3LA 5FLXM 3CC4F 4BT6A 2PMPA 4O4LB 1Q8RA 3BYQA 3F0GA 1IPAA 2AMTA 3HKBB 1VQ9F 3I7TA 4EI8A 3CCMF 2HRUA 2HS0A 5LYJA 2ZVZA 1ONIA 4RQOA 5HY4A 5EO3A 3ZP7A 1Q81H 4ZI7A 1K73H 2HX0A 3HKCA 2HRYA 3WGLA 3L7QA 1Q7YH 2HP0A 3JARA 1VQ8F 1YITF 5GONA
chains in the Genus database with same CATH topology
3K0TA 3QUWA 3ZO8A 1PF5A 2CW4A 2UYKA 1QD9A 1COMA 3GTZA 1ODEA 1NQ3A 3K12A 5HP8A 1XRGA 5HP7A 1X25A 3I3FA 3R0PA 2UYPA 3KJKA 3LMEA 2CSLA 1QAHA 2UYJA 3I7TA 3D01A 3M1XA 1QU9A 4NWOB 3ZOPA 2OTMA 1ONIA 1UI9A 3ZP7A 4ZK7A 2DYYA 1UFYA 2EWCA 1XHOA 1J7HA 2CHSA 1DBFA 3L7QA 3ZP4A 1FNKA 2CHTA 3VCZA 1JD1A 3M4SA 3V4DA 2CWJA 2B33A 2CVLA 3LYBA 3MQWA 1FNJA 2UYNB 2IG8A 3KJJA 2UYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0T A;  3QUW A;  3ZO8 A;  1PF5 A;  2CW4 A;  2UYK A;  1QD9 A;  1COM A;  3GTZ A;  1ODE A;  1NQ3 A;  3K12 A;  5HP8 A;  1XRG A;  5HP7 A;  1X25 A;  3I3F A;  3R0P A;  2UYP A;  3KJK A;  3LME A;  2CSL A;  1QAH A;  2UYJ A;  3I7T A;  3D01 A;  3M1X A;  1QU9 A;  4NWO B;  3ZOP A;  2OTM A;  1ONI A;  1UI9 A;  3ZP7 A;  4ZK7 A;  2DYY A;  1UFY A;  2EWC A;  1XHO A;  1J7H A;  2CHS A;  1DBF A;  3L7Q A;  3ZP4 A;  1FNK A;  2CHT A;  3VCZ A;  1JD1 A;  3M4S A;  3V4D A;  2CWJ A;  2B33 A;  2CVL A;  3LYB A;  3MQW A;  1FNJ A;  2UYN B;  2IG8 A;  3KJJ A;  2UYN A; 
#chains in the Genus database with same CATH topology
 3G6E F;  3B6N A;  1ODE A;  5IJ9 B;  1H48 A;  3JAL A;  3OBY A;  2N48 A;  2LBT A;  1YJ9 F;  5IYZ A;  2RHL A;  4O2A B;  1SDS A;  3JVH A;  3HKD B;  5CA1 B;  5J2T B;  5GIO C;  2OTM A;  4C4W C;  3VTI C;  5HXU A;  3JAW B;  3HKE B;  1W57 A;  5LOV A;  3S0H A;  1S72 F;  3J81 M;  4G4V A;  1IV1 A;  2YYE A;  2H8C A;  3TD4 A;  3KHN A;  3C9T A;  3ESJ A;  3QUW A;  3JAR B;  4U3J B;  4O4I A;  1X7O A;  3CCU F;  2LCA A;  1NQ3 A;  3JCM M;  4ERH A;  5CA0 B;  3D00 A;  4O2B B;  3S0W A;  5HY1 A;  2MQE A;  4ZHY B;  4O4I B;  4X1I A;  5KMG A;  5JQG B;  1IV4 A;  2OZB A;  1YJW F;  3IEQ A;  1FFX B;  5JQG A;  2BTU A;  4LCK A;  1DBF A;  1T0A A;  5GIN C;  4DRX A;  1W5A A;  1JJ2 F;  1U43 A;  3LYB A;  2ZAU A;  3CCR F;  2QA4 F;  3KJJ A;  2HS3 A;  5AVM A;  4B62 A;  2NMU A;  3IR9 A;  5A2Q M;  5MN4 A;  1IV2 A;  1Q82 H;  3I56 F;  1DT9 A;  4X1Y A;  5ITZ A;  1H7M A;  1W41 A;  3CPW F;  4I50 B;  3VMF B;  3HTN A;  1VQL F;  1VQ7 F;  1CK2 A;  5DCV A;  3S0Y A;  4X20 A;  3GHZ A;  3VCZ A;  2CWJ A;  3P4E A;  3N2G A;  3WGM A;  3RYF B;  3CG6 A;  4O4H B;  3AGK A;  4ZHQ B;  3IEW A;  1W40 A;  1M1K H;  1U3L A;  5MN5 A;  3GYQ A;  5HP8 A;  3HKE A;  5LOV B;  5LP6 C;  5GIP C;  3DC2 A;  4ZOL A;  1Q86 H;  2UYJ A;  1QU9 A;  4ZHV A;  2R75 1;  3ERN A;  3WGN A;  1ZWZ A;  2RHO A;  3SIV A;  1QVF F;  1J7H A;  2Z1U A;  2Z1E A;  3JAL B;  1JY8 A;  3WGK A;  3D54 A;  4EB6 B;  5MN6 A;  3CCJ F;  3CC7 F;  3LWP C;  3F0F A;  5LA6 A;  1FNJ A;  5HWE A;  4EI7 A;  3OBW A;  5GON B;  2UYN A;  1OFU A;  4C8E A;  4TUY B;  4I4T B;  4IHJ A;  2CW4 A;  3VOB A;  2BTO A;  5LXT A;  4DRX B;  4I55 A;  3P0Z A;  5IYZ B;  5FNV A;  1GX1 A;  1RA4 A;  3PAF A;  4FFB B;  1Z5W A;  3M1X A;  4WBN B;  2BO1 A;  5IJ0 B;  3CXC F;  1W2B F;  1VQP F;  3N2K A;  4TV8 A;  1UFY A;  5JVD A;  2CHS A;  5EIB C;  4O2B A;  1VQ5 F;  3T80 A;  3CYQ A;  5IJ0 A;  2L26 A;  4YJ2 A;  1M90 H;  4LNU A;  2JNB A;  3JAT A;  3K12 A;  1W5E A;  3C9R A;  5EYP B;  3I3F A;  5LXT B;  5HY0 A;  1RLG A;  1KQS F;  1QAH A;  4TZZ A;  4G4Z A;  4TUY A;  3CC2 F;  3FFM A;  1YJN F;  1VH8 A;  3KIZ A;  3I55 F;  3HKD A;  5CA1 A;  2OTL F;  2ZF8 A;  2VXY A;  3NVI B;  4BY9 D;  4E6E A;  1NMU B;  2EWC A;  1K9M H;  1XHO A;  4TV8 B;  2CZW A;  5JH7 A;  4HNA B;  1GO0 A;  2G9I A;  4WBN A;  1RQ7 A;  2I6R A;  4HNA A;  3F0D A;  1VHA A;  3M84 A;  2UZH A;  4ZOL B;  4F6R B;  3GTZ A;  3K2X A;  3IMP A;  3MDO A;  4BT7 A;  1U40 A;  4X20 B;  5CA0 A;  4TV9 A;  5HP7 A;  3RA6 A;  1X52 A;  3PLA C;  4BT2 A;  4IHJ B;  4G4W A;  4NUT A;  3LWR C;  3ELC A;  2RHJ A;  2GLZ A;  3CCL F;  3S06 A;  3RYF A;  1UI9 A;  1W5F A;  3JAK A;  3RYC A;  1GO1 A;  3UT5 B;  2RHH A;  5EB0 A;  2H8E A;  2FGY A;  3U0O A;  5GAN K;  3CME F;  2CHT A;  3RYH B;  2HVY D;  1KD1 H;  2CVL A;  3VO8 A;  2VGN A;  2DT4 A;  3VI6 A;  4B5C A;  2ZOV A;  4C8I A;  3K14 A;  3HAX D;  3FPI A;  2GVI A;  4NWO B;  2HP3 A;  2R6R 1;  5KMG B;  1Z5V A;  3CPQ A;  2KTU A;  2RB9 A;  4ZHW A;  2I6D A;  2BTQ B;  3WXM B;  5LYJ B;  4NQ3 A;  3FD5 A;  4YJ3 B;  3J80 M;  3HJW C;  4O4H A;  3VYU C;  3CCE F;  3FD6 A;  4FFB A;  4X1K A;  2F9Z C;  1KNJ A;  2HS4 A;  3JAM M;  3F6M A;  3TD5 A;  1W42 A;  1W59 A;  3G71 F;  5GAP K;  4BT3 A;  4RHA A;  4BT5 A;  5LA6 B;  4ZK7 A;  3LDT A;  5BMV A;  3NVK E;  3S03 A;  1KC8 H;  4BVT A;  1SA0 A;  1SA0 B;  2OTJ F;  2FC3 A;  3O85 A;  1JD1 A;  2Z01 A;  2IAF A;  3CCS F;  3JAK B;  4ZHQ A;  1H47 A;  4LNU B;  3K0T A;  3ZO8 A;  2QTP A;  1PF5 A;  3N2G B;  2UYK A;  5CB4 B;  4O2A A;  4M8I A;  3P10 A;  3RA5 A;  1IV3 A;  3MCQ A;  5CB4 A;  3R0P A;  1OAP A;  1W5B A;  2V9Y A;  5EB1 B;  4XCQ A;  1VQ4 F;  5HY2 A;  1FSZ A;  4I50 A;  3N4Z A;  3WJP A;  3IKF A;  3E22 B;  3WJR A;  3LWV C;  2HQS C;  2HP0 B;  3VIU A;  1W58 1;  2H6L A;  5ITZ B;  3N4Y A;  3Q8H A;  4X1Y B;  2LBW A;  3LWQ C;  3MBM A;  2KG4 A;  3MQW A;  2ZVY A;  3V7E A;  5KX5 B;  1RLU A;  1YQN A;  5J2T A;  2AIF A;  2VAP A;  5G4V C;  5KX5 A;  3KE1 A;  3EOR A;  1YHQ F;  1X25 A;  3JAT B;  3V7Q A;  2CSL A;  3RYC B;  3CMA F;  4X1K B;  2P6Y A;  3WJQ A;  4YJ3 A;  4EI9 A;  2Q1X A;  5EWR A;  3E1Y A;  1CLI A;  1W55 A;  4U39 A;  1RQ2 A;  1VQ6 F;  1NJI H;  3HKC B;  1SZQ A;  2Z1T A;  3C9U A;  4ZI7 B;  1TVK B;  3QTY A;  3VYS C;  3E22 A;  3IKE A;  2Q1Y A;  3QHD A;  1VQN F;  1TVK A;  3VYT C;  2KTV A;  2ALE A;  2PHN A;  3TD3 A;  1TUB A;  5G4U C;  2AIZ P;  1KNK A;  3NK6 A;  4IIJ B;  3C9S A;  3LWO C;  5JCO C;  4C8G A;  3CD6 F;  4DXD A;  2OHW A;  2DYY A;  4O4L A;  3RYH A;  5EYP A;  3V3T A;  3RYI A;  3JAW A;  4G4X A;  3UT5 A;  3NK7 A;  3HWU A;  3CYP B;  1VQV A;  2IG8 A;  4YJ2 B;  2VAW A;  1K8A H;  1X7P A;  1QD9 A;  5EZY B;  5LP6 B;  1JN1 A;  5EIB D;  4G4Y A;  1XV2 A;  3CB2 A;  2W8B C;  5JVD B;  3S02 A;  3CCQ F;  1VQM F;  5HXZ A;  4F6R A;  2IQQ A;  4BW0 B;  4C82 A;  1W3E X;  4X1I B;  3JAS B;  3CCV F;  3MCA B;  2KGW A;  4TV9 B;  4C81 A;  4B46 A;  1U3P A;  3V4D A;  5JCO A;  1R1M A;  3JAS A;  1VQO F;  1XBI A;  2YXZ A;  1CN7 A;  1GZ0 A;  3DDN A;  3HKB A;  3G4S F;  5JH7 B;  3WPW A;  1COM A;  3WGJ A;  3RE3 A;  2ZOD A;  3RYI B;  2VGM A;  1XRG A;  3LFO A;  5FJ4 C;  2K1S A;  2Z1F A;  3KJK A;  5C8Y B;  3J7A R;  3D01 A;  1JFF A;  1JFF B;  1QVG F;  3VOA A;  3FBA A;  5C8Y A;  1N8R H;  4EB6 A;  4B45 A;  3ZP4 A;  2LBX A;  4PWT A;  5IJ9 A;  4O4J B;  3ON1 A;  2QI2 A;  1FFX A;  5J2U B;  3WPX A;  4R40 B;  5J2U A;  3C8L A;  1YIJ F;  3F0E A;  1E7K A;  2VAM A;  3OON A;  4O4J A;  3OW2 F;  2QEX F;  5FNV B;  2GZL A;  4I55 B;  3SIU A;  5B8F A;  4BVR A;  2UYP A;  3N2K B;  3LME A;  1YGY A;  4U3J A;  4X3M A;  4BT4 A;  1YI2 F;  3ZOP A;  5EAZ A;  4BVS A;  1VQK F;  3E20 B;  2WAL A;  1FNK A;  5LP6 A;  3M4S A;  5EZY A;  5BMV B;  2B33 A;  4I4T A;  3NMU C;  4BVQ A;  1T0K B;  2UYN B;  4KWE A;  4IIJ A;  1PXW A;  1VK3 A;  5IT9 M;  4G88 A;  1TUB B;  4X3L A;  5FLX M;  3CC4 F;  4BT6 A;  2PMP A;  4O4L B;  1Q8R A;  3BYQ A;  3F0G A;  1IPA A;  2AMT A;  3HKB B;  1VQ9 F;  3I7T A;  4EI8 A;  3CCM F;  2HRU A;  2HS0 A;  5LYJ A;  2ZVZ A;  1ONI A;  4RQO A;  5HY4 A;  5EO3 A;  3ZP7 A;  1Q81 H;  4ZI7 A;  1K73 H;  2HX0 A;  3HKC A;  2HRY A;  3WGL A;  3L7Q A;  1Q7Y H;  2HP0 A;  3JAR A;  1VQ8 F;  1YIT F;  5GON A; 
#chains in the Genus database with same CATH homology
 3K0T A;  3QUW A;  3ZO8 A;  1PF5 A;  2CW4 A;  2UYK A;  1QD9 A;  1COM A;  3GTZ A;  1ODE A;  1NQ3 A;  3K12 A;  5HP8 A;  1XRG A;  5HP7 A;  1X25 A;  3I3F A;  3R0P A;  2UYP A;  3KJK A;  3LME A;  2CSL A;  1QAH A;  2UYJ A;  3I7T A;  3D01 A;  3M1X A;  1QU9 A;  4NWO B;  3ZOP A;  2OTM A;  1ONI A;  1UI9 A;  3ZP7 A;  4ZK7 A;  2DYY A;  1UFY A;  2EWC A;  1XHO A;  1J7H A;  2CHS A;  1DBF A;  3L7Q A;  3ZP4 A;  1FNK A;  2CHT A;  3VCZ A;  1JD1 A;  3M4S A;  3V4D A;  2CWJ A;  2B33 A;  2CVL A;  3LYB A;  3MQW A;  1FNJ A;  2UYN B;  2IG8 A;  3KJJ A;  2UYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...