1FNJA

Crystal structure analysis of chorismate mutase mutant c88s/r90k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKSIKVMMTVQTDVPQDQIRHVYLEKAVVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 30
structure length 114
sequence length 115
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnjA00
3MQWA 2CW4A 1DBFA 3R0PA 2B33A 1QU9A 3I3FA 1PF5A 2UYKA 1XHOA 3D01A 1FNKA 3M4SA 2UYNB 5HP8A 2EWCA 2CVLA 1ONIA 1FNJA 2DYYA 1X25A 3LMEA 1QAHA 2IG8A 1J7HA 1COMA 3V4DA 2OTMA 1NQ3A 3ZOPA 2CSLA 1UI9A 2UYJA 1ODEA 3L7QA 2CHTA 2UYNA 3QUWA 4NWOB 3KJJA 5HP7A 3I7TA 3K0TA 3K12A 2CWJA 3LYBA 1UFYA 1JD1A 3KJKA 3ZO8A 3ZP4A 3M1XA 2UYPA 2CHSA 3ZP7A 1QD9A 3GTZA 4ZK7A 1XRGA 3VCZA
chains in the Genus database with same CATH superfamily
1GO0A 3I3FA 4X3LA 3CXCF 5EIBC 2UYNB 4DXDA 3U0OA 1YJWF 3LMEA 4BW0B 1COMA 5CA1A 2V9YA 4G4VA 3WGLA 1H7MA 3C8LA 3OBWA 4LNUA 3CCSF 3OW2F 1VQ9F 3NVKE 1TVKB 1S72F 2BTOA 3KJKA 1FFXA 3ZP7A 4IIJA 1NJIH 5LYJA 4EI8A 5HXZA 5JQGA 3TD4A 2OTJF 3MQWA 3OBYA 3CPQA 5MN4A 2ZVZA 3K14A 3JALB 3P4EA 1JFFB 4ZHYB 3CMAF 2QA4F 3S0YA 3M84A 5CB4A 1Q82H 5LA6B 3ELCA 2ZODA 2HP0A 1X25A 4F6RB 2BTUA 1M1KH 3MBMA 2HS4A 2Q1XA 3KHNA 5ITZA 3K2XA 4ZOLB 1XV2A 2Z1TA 5HP7A 1RA4A 4X1YB 1R1MA 1VHAA 4O2BB 4TUYB 3NMUC 5GIPC 5EZYA 2B33A 5MN5A 4EI9A 2UYKA 1KNKA 5FNVA 3SIUA 1VQVA 3HKDB 5C8YB 5J2UA 3FD5A 3JVHA 3CCUF 1T0AA 3HJWC 1H47A 2BTQB 2HRUA 3JATA 3K0TA 4C8EA 2Q1YA 3RYIB 1TUBB 3CYQA 4B46A 4EB6A 3KE1A 2RHLA 2VGNA 1W40A 3GYQA 3N2KA 3S03A 1SA0A 3JAKA 4LCKA 2Z1EA 4DRXB 1Z5VA 5EAZA 5BMVB 1KD1H 2ZF8A 5GONB 2JNBA 4B62A 3ESJA 3CMEF 1JY8A 3JASB 5CA0B 3LDTA 2RHJA 3N2GB 1UI9A 3IEQA 1VQ6F 3S0HA 3VYUC 2VXYA 3UT5A 4B5CA 1Z5WA 4M8IA 2FGYA 1W57A 4O4JB 2VAMA 4F6RA 4I4TB 3CCLF 1H48A 3E22A 5IJ9B 1XRGA 3WPXA 3HKCA 4ZI7A 1KNJA 4C81A 4TZZA 2CVLA 4BVQA 1CK2A 2L26A 5JH7A 1VQPF 4E6EA 4O4LB 1NQ3A 1XBIA 3IKFA 1IV2A 1OFUA 1W5AA 5LP6B 3MCAB 4BVSA 2KGWA 3CPWF 3HKBB 4BT7A 5KMGB 1YJ9F 3CD6F 4PWTA 1RLUA 2GLZA 4TV9B 1GX1A 3V7QA 3I56F 3DC2A 3HKEB 4O4HB 3VOBA 1ZWZA 4YJ2A 3DDNA 4O2AB 3RYIA 5KX5B 3WGMA 2ALEA 5EB1B 2DT4A 4G88A 2DYYA 3NK6A 3BYQA 3RYCB 1VQ7F 1CLIA 4BT5A 5IYZB 3JARB 4I50A 4BT3A 3O85A 2UZHA 4U3JB 1VQ8F 3G6EF 3KJJA 4C82A 3RA6A 3G71F 3RYHB 3LFOA 4X20A 2Z1UA 1RQ2A 4X1KA 2K1SA 5LOVB 3J7AR 5AVMA 4R40B 4O4JA 2RB9A 5J2TB 2GVIA 3JAWA 3CCJF 1XHOA 1ONIA 2HX0A 2OHWA 1FNJA 2FC3A 3E1YA 3E20B 3VYTC 4X1IB 4BT6A 1VQLF 3FD6A 1CN7A 2CSLA 3C9SA 3VI6A 3N4YA 1IV3A 1X7OA 3B6NA 3V3TA 4ZHWA 2IAFA 1X7PA 5LP6C 5JCOC 3P0ZA 3CC2F 1JN1A 2CW4A 1W5BA 1RQ7A 2QTPA 4WBNB 5JCOA 1IV4A 3AGKA 2W8BC 3F0FA 4TV9A 3KIZA 1GO1A 4ZHQA 2LBWA 4I55A 3VYSC 1W3EX 3PLAC 3ZOPA 4IHJB 3C9RA 1YJNF 5GANK 3GHZA 2UYNA 3JCMM 1E7KA 2CZWA 3HWUA 3RYFB 1VK3A 5EYPB 3IMPA 2AMTA 3ZO8A 5B8FA 1YITF 3WJRA 2R6R1 3P10A 1QU9A 1TVKA 1PF5A 1W5FA 4C8IA 5IJ0B 1U40A 1U3LA 2IQQA 1IPAA 4EI7A 2RHOA 2F9ZC 3WJQA 1W41A 3VMFB 4BT2A 1KC8H 3JALA 3C9TA 4NUTA 3J81M 4O4IB 1ODEA 1JFFA 3ON1A 3L7QA 3CG6A 1W581 5LA6A 4BT4A 3LWPC 1UFYA 3MDOA 2YXZA 1Q81H 4ZOLA 2BO1A 1X52A 1W59A 5A2QM 2OZBA 5CA1B 2OTLF 4X1YA 5EIBD 4C8GA 4LNUB 4TV8B 5HY4A 4G4YA 2ZOVA 2HQSC 2QI2A 4O2BA 4TUYA 4G4XA 4C4WC 1FFXB 3RE3A 4HNAB 1QAHA 4IIJB 5HWEA 5LYJB 1J7HA 2OTMA 3WGKA 5JQGB 4XCQA 3WGNA 2UYJA 1YGYA 2MQEA 3HKDA 5C8YA 3CC4F 2H8EA 2CWJA 2PHNA 3CC7F 2H6LA 3M1XA 2CHSA 2NMUA 4X3MA 1VQ5F 5CB4B 1W42A 3VIUA 4KWEA 2HP0B 5FJ4C 4B45A 5ITZB 5EYPA 3IR9A 1VQMF 2I6DA 3NK7A 3FBAA 1TUBA 3J80M 1OAPA 3CCRF 2HP3A 3F0GA 4NQ3A 2GZLA 1VQNF 4DRXA 3VOAA 1W2BF 5BMVA 5EZYB 5GONA 5LXTB 3K12A 3JASA 5CA0A 2UYPA 5J2UB 4ZHVA 1U3PA 3N2GA 1T0KB 2I6RA 4G4ZA 5HY1A 3LWVC 1JJ2F 1W5EA 2ZVYA 3C9UA 3D01A 2LCAA 3LWQC 4I4TA 1KQSF 1VH8A 3JATB 3S0WA 5IJ9A 5DCVA 5HY0A 3FPIA 4YJ3B 1N8RH 3CCVF 1VQ4F 4EB6B 4BVRA 1QVGF 5G4UC 4TV8A 1YI2F 3N2KB 3VO8A 1SA0B 3LWOC 3JAKB 2WALA 1VQOF 1YQNA 4HNAA 3S06A 1Q7YH 3FFMA 4O4LA 1QD9A 3WGJA 2HVYD 5LP6A 3QTYA 2Z01A 3D54A 4FFBB 3HKBA 1FNKA 5HP8A 1SZQA 5KMGA 3UT5B 4RHAA 4BY9D 3Q8HA 5JVDB 2HRYA 3HKEA 2HS3A 3MCQA 1IV1A 4O4HA 3V4DA 1NMUB 3E22B 1U43A 3G4SF 4O2AA 2H8CA 5KX5A 3HKCB 4NWOB 3I7TA 4ZI7B 2VAPA 3LYBA 4ERHA 3ZP4A 3RYCA 2QEXF 3S02A 3LWRC 5IYZA 2N48A 3ERNA 4ZK7A 1PXWA 3JARA 3EORA 5FLXM 2PMPA 5JH7B 2P6YA 4U3JA 5LXTA 3SIVA 2HS0A 1GZ0A 3I55F 3CYPB 4G4WA 1RLGA 3RYHA 2EWCA 1FSZA 3IEWA 2ZAUA 4RQOA 2AIZP 5LOVA 1K9MH 2IG8A 3WJPA 1SDSA 5J2TA 3OONA 4YJ3A 4YJ2B 1YHQF 3CCQF 3IKEA 2KG4A 4X1IA 5EB0A 5GIOC 3F0EA 3GTZA 2G9IA 2Z1FA 5G4VC 1DBFA 3R0PA 2LBXA 4I50B 3N4ZA 3M4SA 3D00A 3F0DA 3WPWA 2KTVA 5HXUA 3QHDA 1Q8RA 3CB2A 3WXMB 4O4IA 2VAWA 3TD5A 4WBNA 3CCEF 4X20B 4FFBA 3VTIC 4X1KB 3CCMF 2CHTA 3JAMM 1W55A 5GAPK 2VGMA 5EO3A 5JVDA 1VQKF 3F6MA 4BVTA 1QVFF 3JAWB 1JD1A 1Q86H 4IHJA 5MN6A 1YIJF 5EWRA 3V7EA 1K73H 3RYFA 1M90H 3NVIB 2LBTA 4U39A 3HTNA 2RHHA 2YYEA 3T80A 5IJ0A 2R751 3RA5A 3QUWA 5HY2A 5GINC 3PAFA 5IT9M 5FNVB 2KTUA 1DT9A 3TD3A 1K8AH 3HAXD 2AIFA 4ZHQB 3VCZA 4I55B
chains in the Genus database with same CATH topology
3MQWA 2CW4A 1DBFA 3R0PA 2B33A 1QU9A 3I3FA 1PF5A 2UYKA 1XHOA 3D01A 1FNKA 3M4SA 2UYNB 5HP8A 2EWCA 2CVLA 1ONIA 1FNJA 2DYYA 1X25A 3LMEA 1QAHA 2IG8A 1J7HA 1COMA 3V4DA 2OTMA 1NQ3A 3ZOPA 2CSLA 1UI9A 2UYJA 1ODEA 3L7QA 2CHTA 2UYNA 3QUWA 4NWOB 3KJJA 5HP7A 3I7TA 3K0TA 3K12A 2CWJA 3LYBA 1UFYA 1JD1A 3KJKA 3ZO8A 3ZP4A 3M1XA 2UYPA 2CHSA 3ZP7A 1QD9A 3GTZA 4ZK7A 1XRGA 3VCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQW A;  2CW4 A;  1DBF A;  3R0P A;  2B33 A;  1QU9 A;  3I3F A;  1PF5 A;  2UYK A;  1XHO A;  3D01 A;  1FNK A;  3M4S A;  2UYN B;  5HP8 A;  2EWC A;  2CVL A;  1ONI A;  1FNJ A;  2DYY A;  1X25 A;  3LME A;  1QAH A;  2IG8 A;  1J7H A;  1COM A;  3V4D A;  2OTM A;  1NQ3 A;  3ZOP A;  2CSL A;  1UI9 A;  2UYJ A;  1ODE A;  3L7Q A;  2CHT A;  2UYN A;  3QUW A;  4NWO B;  3KJJ A;  5HP7 A;  3I7T A;  3K0T A;  3K12 A;  2CWJ A;  3LYB A;  1UFY A;  1JD1 A;  3KJK A;  3ZO8 A;  3ZP4 A;  3M1X A;  2UYP A;  2CHS A;  3ZP7 A;  1QD9 A;  3GTZ A;  4ZK7 A;  1XRG A;  3VCZ A; 
#chains in the Genus database with same CATH topology
 1GO0 A;  3I3F A;  4X3L A;  3CXC F;  5EIB C;  2UYN B;  4DXD A;  3U0O A;  1YJW F;  3LME A;  4BW0 B;  1COM A;  5CA1 A;  2V9Y A;  4G4V A;  3WGL A;  1H7M A;  3C8L A;  3OBW A;  4LNU A;  3CCS F;  3OW2 F;  1VQ9 F;  3NVK E;  1TVK B;  1S72 F;  2BTO A;  3KJK A;  1FFX A;  3ZP7 A;  4IIJ A;  1NJI H;  5LYJ A;  4EI8 A;  5HXZ A;  5JQG A;  3TD4 A;  2OTJ F;  3MQW A;  3OBY A;  3CPQ A;  5MN4 A;  2ZVZ A;  3K14 A;  3JAL B;  3P4E A;  1JFF B;  4ZHY B;  3CMA F;  2QA4 F;  3S0Y A;  3M84 A;  5CB4 A;  1Q82 H;  5LA6 B;  3ELC A;  2ZOD A;  2HP0 A;  1X25 A;  4F6R B;  2BTU A;  1M1K H;  3MBM A;  2HS4 A;  2Q1X A;  3KHN A;  5ITZ A;  3K2X A;  4ZOL B;  1XV2 A;  2Z1T A;  5HP7 A;  1RA4 A;  4X1Y B;  1R1M A;  1VHA A;  4O2B B;  4TUY B;  3NMU C;  5GIP C;  5EZY A;  2B33 A;  5MN5 A;  4EI9 A;  2UYK A;  1KNK A;  5FNV A;  3SIU A;  1VQV A;  3HKD B;  5C8Y B;  5J2U A;  3FD5 A;  3JVH A;  3CCU F;  1T0A A;  3HJW C;  1H47 A;  2BTQ B;  2HRU A;  3JAT A;  3K0T A;  4C8E A;  2Q1Y A;  3RYI B;  1TUB B;  3CYQ A;  4B46 A;  4EB6 A;  3KE1 A;  2RHL A;  2VGN A;  1W40 A;  3GYQ A;  3N2K A;  3S03 A;  1SA0 A;  3JAK A;  4LCK A;  2Z1E A;  4DRX B;  1Z5V A;  5EAZ A;  5BMV B;  1KD1 H;  2ZF8 A;  5GON B;  2JNB A;  4B62 A;  3ESJ A;  3CME F;  1JY8 A;  3JAS B;  5CA0 B;  3LDT A;  2RHJ A;  3N2G B;  1UI9 A;  3IEQ A;  1VQ6 F;  3S0H A;  3VYU C;  2VXY A;  3UT5 A;  4B5C A;  1Z5W A;  4M8I A;  2FGY A;  1W57 A;  4O4J B;  2VAM A;  4F6R A;  4I4T B;  3CCL F;  1H48 A;  3E22 A;  5IJ9 B;  1XRG A;  3WPX A;  3HKC A;  4ZI7 A;  1KNJ A;  4C81 A;  4TZZ A;  2CVL A;  4BVQ A;  1CK2 A;  2L26 A;  5JH7 A;  1VQP F;  4E6E A;  4O4L B;  1NQ3 A;  1XBI A;  3IKF A;  1IV2 A;  1OFU A;  1W5A A;  5LP6 B;  3MCA B;  4BVS A;  2KGW A;  3CPW F;  3HKB B;  4BT7 A;  5KMG B;  1YJ9 F;  3CD6 F;  4PWT A;  1RLU A;  2GLZ A;  4TV9 B;  1GX1 A;  3V7Q A;  3I56 F;  3DC2 A;  3HKE B;  4O4H B;  3VOB A;  1ZWZ A;  4YJ2 A;  3DDN A;  4O2A B;  3RYI A;  5KX5 B;  3WGM A;  2ALE A;  5EB1 B;  2DT4 A;  4G88 A;  2DYY A;  3NK6 A;  3BYQ A;  3RYC B;  1VQ7 F;  1CLI A;  4BT5 A;  5IYZ B;  3JAR B;  4I50 A;  4BT3 A;  3O85 A;  2UZH A;  4U3J B;  1VQ8 F;  3G6E F;  3KJJ A;  4C82 A;  3RA6 A;  3G71 F;  3RYH B;  3LFO A;  4X20 A;  2Z1U A;  1RQ2 A;  4X1K A;  2K1S A;  5LOV B;  3J7A R;  5AVM A;  4R40 B;  4O4J A;  2RB9 A;  5J2T B;  2GVI A;  3JAW A;  3CCJ F;  1XHO A;  1ONI A;  2HX0 A;  2OHW A;  1FNJ A;  2FC3 A;  3E1Y A;  3E20 B;  3VYT C;  4X1I B;  4BT6 A;  1VQL F;  3FD6 A;  1CN7 A;  2CSL A;  3C9S A;  3VI6 A;  3N4Y A;  1IV3 A;  1X7O A;  3B6N A;  3V3T A;  4ZHW A;  2IAF A;  1X7P A;  5LP6 C;  5JCO C;  3P0Z A;  3CC2 F;  1JN1 A;  2CW4 A;  1W5B A;  1RQ7 A;  2QTP A;  4WBN B;  5JCO A;  1IV4 A;  3AGK A;  2W8B C;  3F0F A;  4TV9 A;  3KIZ A;  1GO1 A;  4ZHQ A;  2LBW A;  4I55 A;  3VYS C;  1W3E X;  3PLA C;  3ZOP A;  4IHJ B;  3C9R A;  1YJN F;  5GAN K;  3GHZ A;  2UYN A;  3JCM M;  1E7K A;  2CZW A;  3HWU A;  3RYF B;  1VK3 A;  5EYP B;  3IMP A;  2AMT A;  3ZO8 A;  5B8F A;  1YIT F;  3WJR A;  2R6R 1;  3P10 A;  1QU9 A;  1TVK A;  1PF5 A;  1W5F A;  4C8I A;  5IJ0 B;  1U40 A;  1U3L A;  2IQQ A;  1IPA A;  4EI7 A;  2RHO A;  2F9Z C;  3WJQ A;  1W41 A;  3VMF B;  4BT2 A;  1KC8 H;  3JAL A;  3C9T A;  4NUT A;  3J81 M;  4O4I B;  1ODE A;  1JFF A;  3ON1 A;  3L7Q A;  3CG6 A;  1W58 1;  5LA6 A;  4BT4 A;  3LWP C;  1UFY A;  3MDO A;  2YXZ A;  1Q81 H;  4ZOL A;  2BO1 A;  1X52 A;  1W59 A;  5A2Q M;  2OZB A;  5CA1 B;  2OTL F;  4X1Y A;  5EIB D;  4C8G A;  4LNU B;  4TV8 B;  5HY4 A;  4G4Y A;  2ZOV A;  2HQS C;  2QI2 A;  4O2B A;  4TUY A;  4G4X A;  4C4W C;  1FFX B;  3RE3 A;  4HNA B;  1QAH A;  4IIJ B;  5HWE A;  5LYJ B;  1J7H A;  2OTM A;  3WGK A;  5JQG B;  4XCQ A;  3WGN A;  2UYJ A;  1YGY A;  2MQE A;  3HKD A;  5C8Y A;  3CC4 F;  2H8E A;  2CWJ A;  2PHN A;  3CC7 F;  2H6L A;  3M1X A;  2CHS A;  2NMU A;  4X3M A;  1VQ5 F;  5CB4 B;  1W42 A;  3VIU A;  4KWE A;  2HP0 B;  5FJ4 C;  4B45 A;  5ITZ B;  5EYP A;  3IR9 A;  1VQM F;  2I6D A;  3NK7 A;  3FBA A;  1TUB A;  3J80 M;  1OAP A;  3CCR F;  2HP3 A;  3F0G A;  4NQ3 A;  2GZL A;  1VQN F;  4DRX A;  3VOA A;  1W2B F;  5BMV A;  5EZY B;  5GON A;  5LXT B;  3K12 A;  3JAS A;  5CA0 A;  2UYP A;  5J2U B;  4ZHV A;  1U3P A;  3N2G A;  1T0K B;  2I6R A;  4G4Z A;  5HY1 A;  3LWV C;  1JJ2 F;  1W5E A;  2ZVY A;  3C9U A;  3D01 A;  2LCA A;  3LWQ C;  4I4T A;  1KQS F;  1VH8 A;  3JAT B;  3S0W A;  5IJ9 A;  5DCV A;  5HY0 A;  3FPI A;  4YJ3 B;  1N8R H;  3CCV F;  1VQ4 F;  4EB6 B;  4BVR A;  1QVG F;  5G4U C;  4TV8 A;  1YI2 F;  3N2K B;  3VO8 A;  1SA0 B;  3LWO C;  3JAK B;  2WAL A;  1VQO F;  1YQN A;  4HNA A;  3S06 A;  1Q7Y H;  3FFM A;  4O4L A;  1QD9 A;  3WGJ A;  2HVY D;  5LP6 A;  3QTY A;  2Z01 A;  3D54 A;  4FFB B;  3HKB A;  1FNK A;  5HP8 A;  1SZQ A;  5KMG A;  3UT5 B;  4RHA A;  4BY9 D;  3Q8H A;  5JVD B;  2HRY A;  3HKE A;  2HS3 A;  3MCQ A;  1IV1 A;  4O4H A;  3V4D A;  1NMU B;  3E22 B;  1U43 A;  3G4S F;  4O2A A;  2H8C A;  5KX5 A;  3HKC B;  4NWO B;  3I7T A;  4ZI7 B;  2VAP A;  3LYB A;  4ERH A;  3ZP4 A;  3RYC A;  2QEX F;  3S02 A;  3LWR C;  5IYZ A;  2N48 A;  3ERN A;  4ZK7 A;  1PXW A;  3JAR A;  3EOR A;  5FLX M;  2PMP A;  5JH7 B;  2P6Y A;  4U3J A;  5LXT A;  3SIV A;  2HS0 A;  1GZ0 A;  3I55 F;  3CYP B;  4G4W A;  1RLG A;  3RYH A;  2EWC A;  1FSZ A;  3IEW A;  2ZAU A;  4RQO A;  2AIZ P;  5LOV A;  1K9M H;  2IG8 A;  3WJP A;  1SDS A;  5J2T A;  3OON A;  4YJ3 A;  4YJ2 B;  1YHQ F;  3CCQ F;  3IKE A;  2KG4 A;  4X1I A;  5EB0 A;  5GIO C;  3F0E A;  3GTZ A;  2G9I A;  2Z1F A;  5G4V C;  1DBF A;  3R0P A;  2LBX A;  4I50 B;  3N4Z A;  3M4S A;  3D00 A;  3F0D A;  3WPW A;  2KTV A;  5HXU A;  3QHD A;  1Q8R A;  3CB2 A;  3WXM B;  4O4I A;  2VAW A;  3TD5 A;  4WBN A;  3CCE F;  4X20 B;  4FFB A;  3VTI C;  4X1K B;  3CCM F;  2CHT A;  3JAM M;  1W55 A;  5GAP K;  2VGM A;  5EO3 A;  5JVD A;  1VQK F;  3F6M A;  4BVT A;  1QVF F;  3JAW B;  1JD1 A;  1Q86 H;  4IHJ A;  5MN6 A;  1YIJ F;  5EWR A;  3V7E A;  1K73 H;  3RYF A;  1M90 H;  3NVI B;  2LBT A;  4U39 A;  3HTN A;  2RHH A;  2YYE A;  3T80 A;  5IJ0 A;  2R75 1;  3RA5 A;  3QUW A;  5HY2 A;  5GIN C;  3PAF A;  5IT9 M;  5FNV B;  2KTU A;  1DT9 A;  3TD3 A;  1K8A H;  3HAX D;  2AIF A;  4ZHQ B;  3VCZ A;  4I55 B; 
#chains in the Genus database with same CATH homology
 3MQW A;  2CW4 A;  1DBF A;  3R0P A;  2B33 A;  1QU9 A;  3I3F A;  1PF5 A;  2UYK A;  1XHO A;  3D01 A;  1FNK A;  3M4S A;  2UYN B;  5HP8 A;  2EWC A;  2CVL A;  1ONI A;  1FNJ A;  2DYY A;  1X25 A;  3LME A;  1QAH A;  2IG8 A;  1J7H A;  1COM A;  3V4D A;  2OTM A;  1NQ3 A;  3ZOP A;  2CSL A;  1UI9 A;  2UYJ A;  1ODE A;  3L7Q A;  2CHT A;  2UYN A;  3QUW A;  4NWO B;  3KJJ A;  5HP7 A;  3I7T A;  3K0T A;  3K12 A;  2CWJ A;  3LYB A;  1UFY A;  1JD1 A;  3KJK A;  3ZO8 A;  3ZP4 A;  3M1X A;  2UYP A;  2CHS A;  3ZP7 A;  1QD9 A;  3GTZ A;  4ZK7 A;  1XRG A;  3VCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...