1FNJA

Crystal structure analysis of chorismate mutase mutant c88s/r90k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
114
Chain Sequence
MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKSIKVMMTVQTDVPQDQIRHVYLEKAVVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 30
structure length 114
sequence length 115
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnjA00
3V4DA 1QU9A 3MQWA 4ZK7A 3ZP4A 1QAHA 1JD1A 1ODEA 3ZO8A 3D01A 1NQ3A 2CSLA 1XHOA 2OTMA 2UYKA 2UYPA 5HP8A 3K0TA 2UYJA 3VCZA 2B33A 2EWCA 3LYBA 4NWOB 3R0PA 1X25A 2CWJA 3GTZA 1FNKA 2CHSA 2IG8A 3LMEA 2CW4A 2CVLA 3QUWA 1FNJA 3K12A 1COMA 1XRGA 1DBFA 3KJJA 3L7QA 3ZOPA 5HP7A 1PF5A 2DYYA 2CHTA 3M1XA 1J7HA 1UI9A 3ZP7A 1ONIA 3M4SA 3I7TA 2UYNA 1QD9A 1UFYA 2UYNB 3KJKA 3I3FA
chains in the Genus database with same CATH superfamily
3V4DA 1W41A 5GIPC 3DDNA 5LOVA 3T80A 3ESJA 3HKCA 4ZI7B 3RE3A 1RLUA 1ZWZA 5LP6A 1CLIA 2EWCA 4ZHYB 3R0PA 3WJQA 3TD3A 5EIBC 1VHAA 1JY8A 3CCVF 5LXTB 2Q1YA 5JVDA 2HP0B 5IYZA 3F0EA 4RHAA 3P0ZA 5MN4A 4G4ZA 3VYTC 5LYJA 2HS4A 3JALB 3ELCA 5MN5A 3V7EA 2KG4A 1W42A 3V7QA 1QU9A 4G4WA 4I50A 1JD1A 4X1KB 5GANK 2HP3A 3HKEB 5KX5B 3WGKA 2P6YA 2PHNA 4ZOLB 2YYEA 3TD5A 1VQOF 1KQSF 3LWRC 3U0OA 3NK6A 3VOBA 1XRGA 5ITZA 3PLAC 4BT3A 3WGJA 4I4TB 5HY2A 5JVDB 5CA1B 4EI8A 3SIVA 1J7HA 1UI9A 5B8FA 2ALEA 4EI9A 3OBWA 4YJ2B 5IT9M 2HRUA 1GO1A 4O4IA 1W3EX 4G88A 3JCMM 4I50B 4U3JA 2OTMA 3FD6A 2UYPA 3IR9A 2HQSC 2BTQB 5DCVA 3CCQF 3G71F 1QVGF 4B46A 3MBMA 5JQGA 1W57A 2FGYA 3J81M 1DBFA 1DT9A 1Q7YH 5CB4A 2ZODA 3HWUA 3HKDA 3I3FA 5C8YB 4O2AA 2Z1UA 4X1IA 3CXCF 2LCAA 1KNJA 4O4IB 3RYFA 5G4UC 1XHOA 4U3JB 5HP8A 2F9ZC 4O4JB 4PWTA 1E7KA 5GIOC 3E22A 3QTYA 5EWRA 1W5BA 2IG8A 4ZHVA 3LMEA 1COMA 4BT5A 1JN1A 2VXYA 4BVTA 4DRXB 3NVKE 5HY0A 4FFBA 3ZP7A 2HVYD 3N2GA 3CCRF 1W581 2HX0A 4BT4A 2HS3A 3F0FA 4ZK7A 4O2AB 1T0KB 1ODEA 2RHOA 3RYFB 2CSLA 2KTVA 2QA4F 2RHJA 4IHJB 3TD4A 3LDTA 2BTUA 3E22B 3CCUF 3F6MA 3SIUA 3F0GA 5LXTA 3HKBA 1SZQA 3L7QA 3IMPA 3D54A 1VQ4F 2HP0A 3C9UA 5BMVA 3JASB 1N8RH 3S0YA 4TZZA 1U3LA 3PAFA 3P10A 1JJ2F 1W5FA 5FLXM 3CMAF 4ERHA 1H48A 2AMTA 4X1KA 3HKEA 3LFOA 5MN6A 5G4VC 5EIBD 5KX5A 2IAFA 3S0WA 3CCEF 4ZOLA 2I6RA 1X7PA 3O85A 3MDOA 1FNKA 4TV8B 3S02A 1K8AH 3CCJF 2QTPA 3HKBB 4I4TA 2QI2A 2LBTA 2FC3A 1YJNF 4X3MA 5CA1A 3VIUA 5BMVB 3MCQA 2KGWA 3RYHB 4X20B 4YJ2A 4BT2A 2VAPA 4TUYB 2Z01A 4C8EA 3WPXA 4C4WC 3CC4F 2UYKA 5CA0A 3CMEF 4BVSA 3VOAA 5KMGB 3NVIB 3G6EF 2MQEA 1X25A 1SA0B 2RB9A 3CG6A 1GZ0A 2PMPA 4HNAA 3CC7F 3CCSF 2YXZA 3VYSC 3DC2A 1PXWA 3JARA 1KC8H 3M4SA 3QHDA 3VI6A 2Z1FA 3ON1A 2CZWA 1VQVA 1X7OA 5C8YA 2GZLA 3CCLF 3MQWA 4B45A 1K73H 4F6RB 5J2UB 4BY9D 3BYQA 1GO0A 2VGMA 4O4JA 2L26A 1YJ9F 5CA0B 4R40B 3UT5B 2CHSA 3RYCA 3CD6F 1RLGA 3VO8A 3QUWA 2OHWA 1IPAA 1OAPA 2VAWA 1PF5A 2RHLA 4HNAB 1YJWF 4DRXA 4C82A 3EORA 1IV1A 5EB1B 3JARB 1RQ2A 4C8GA 4X1YB 3LWVC 3KJKA 1YI2F 3KE1A 1VH8A 3RYIB 2VGNA 5IJ9B 2NMUA 1VQMF 3ERNA 1Z5VA 3WJRA 1QVFF 4IHJA 1VQKF 2CWJA 2OTJF 5FNVB 3RYCB 3WGNA 2H6LA 2OZBA 4DXDA 4EB6A 1YHQF 3IKFA 3JASA 2R751 1M1KH 2HRYA 5JH7B 4BVQA 3OONA 2LBXA 5IJ0B 3S06A 3ZP4A 1QAHA 3N2KB 1YQNA 1RQ7A 1Q8RA 1TUBB 2R6R1 2BTOA 3LYBA 3HJWC 3N4YA 3CC2F 1M90H 4TV8A 1VQPF 2CVLA 2I6DA 3C8LA 1IV4A 3CB2A 3IEQA 2CHTA 4EB6B 4O4LA 5A2QM 3OW2F 4E6EA 3RYHA 3FPIA 4X20A 1W59A 3MCAB 1H7MA 4IIJB 3JATB 3IEWA 4TUYA 2Q1XA 2ZAUA 2LBWA 1U40A 3WPWA 3CYQA 2V9YA 3V3TA 4M8IA 3WGLA 1IV2A 2B33A 4WBNB 5KMGA 1T0AA 5FJ4C 3RA5A 1SA0A 3FBAA 1X52A 1Q86H 2VAMA 5J2TB 1H47A 4O2BA 1U3PA 4G4YA 1U43A 4O4LB 4LNUB 2Z1EA 3JAWB 1QD9A 2IQQA 3CPQA 4I55B 4ZHQA 3K2XA 3OBYA 4NQ3A 5AVMA 4F6RA 5J2UA 2GLZA 5HXZA 3K0TA 5GONA 2AIZP 3UT5A 4YJ3A 3K14A 1W55A 1FFXA 3JAMM 4BW0B 1VQ6F 3K12A 5HP7A 4BT6A 3I55F 1Q82H 1K9MH 5EO3A 1W40A 5HXUA 4ZHWA 1ONIA 1RA4A 3C9SA 4O4HA 4O2BB 5LA6B 3S0HA 2UYNA 4X1YA 1VK3A 5EYPB 1NJIH 3RYIA 4ZHQB 2ZVYA 3VTIC 5IJ9A 3M84A 5LOVB 3HKCB 3GYQA 1Z5WA 2KTUA 5LP6B 2UYJA 5GONB 1IV3A 2DT4A 2UZHA 4NUTA 3AGKA 3HTNA 3C9TA 4YJ3B 5FNVA 3KHNA 2ZF8A 1FFXB 3NK7A 1XBIA 3FD5A 3ZOPA 4G4VA 3LWOC 5IYZB 3WJPA 3J7AR 3E20B 1W2BF 3M1XA 3CYPB 1CN7A 3C9RA 5LYJB 4O4HB 1KNKA 5JH7A 1UFYA 2UYNB 2G9IA 1CK2A 5IJ0A 1GX1A 3N2KA 1JFFA 3VMFB 4KWEA 3HAXD 1R1MA 4B62A 4G4XA 1VQ9F 1TUBA 5HY4A 5EZYA 3VCZA 1YITF 2ZOVA 4RQOA 4NWOB 3FFMA 2ZVZA 1FNJA 3KJJA 5ITZB 1S72F 3JAKA 2DYYA 3GHZA 5HWEA 4XCQA 4C81A 3G4SF 4U39A 2HS0A 1VQLF 1NMUB 2AIFA 3KIZA 1TVKA 4IIJA 3JATA 1KD1H 4EI7A 2BO1A 1XV2A 5GINC 3LWQC 3LWPC 3ZO8A 4X3LA 1JFFB 3D01A 3E1YA 4TV9A 1NQ3A 3WGMA 2JNBA 4WBNA 5EZYB 1VQNF 3GTZA 1VQ8F 2RHHA 4B5CA 5JQGB 3N4ZA 4C8IA 3I56F 5JCOC 1VQ5F 5J2TA 5EAZA 3JAKB 4BT7A 5CB4B 4BVRA 3IKEA 3J80M 3I7TA 5EB0A 2Z1TA 2H8CA 2H8EA 4LNUA 3JAWA 3HKDB 4I55A 3D00A 3NMUC 3CPWF 1TVKB 3JVHA 4X1IB 3CCMF 3RA6A 1SDSA 1OFUA 3VYUC 3F0DA 4ZI7A 1VQ7F 1YIJF 4TV9B 5GAPK 3B6NA 5JCOA 3Q8HA 2N48A 2GVIA 1W5AA 1Q81H 2W8BC 2CW4A 3S03A 1W5EA 5LP6C 4LCKA 3P4EA 2QEXF 4FFBB 2WALA 1YGYA 1FSZA 3JALA 3WXMB 3N2GB 5LA6A 5HY1A 2OTLF 5EYPA 2K1SA
chains in the Genus database with same CATH topology
3V4DA 1QU9A 3MQWA 4ZK7A 3ZP4A 1QAHA 1JD1A 1ODEA 3ZO8A 3D01A 1NQ3A 2CSLA 1XHOA 2OTMA 2UYKA 2UYPA 5HP8A 3K0TA 2UYJA 3VCZA 2B33A 2EWCA 3LYBA 4NWOB 3R0PA 1X25A 2CWJA 3GTZA 1FNKA 2CHSA 2IG8A 3LMEA 2CW4A 2CVLA 3QUWA 1FNJA 3K12A 1COMA 1XRGA 1DBFA 3KJJA 3L7QA 3ZOPA 5HP7A 1PF5A 2DYYA 2CHTA 3M1XA 1J7HA 1UI9A 3ZP7A 1ONIA 3M4SA 3I7TA 2UYNA 1QD9A 1UFYA 2UYNB 3KJKA 3I3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4D A;  1QU9 A;  3MQW A;  4ZK7 A;  3ZP4 A;  1QAH A;  1JD1 A;  1ODE A;  3ZO8 A;  3D01 A;  1NQ3 A;  2CSL A;  1XHO A;  2OTM A;  2UYK A;  2UYP A;  5HP8 A;  3K0T A;  2UYJ A;  3VCZ A;  2B33 A;  2EWC A;  3LYB A;  4NWO B;  3R0P A;  1X25 A;  2CWJ A;  3GTZ A;  1FNK A;  2CHS A;  2IG8 A;  3LME A;  2CW4 A;  2CVL A;  3QUW A;  1FNJ A;  3K12 A;  1COM A;  1XRG A;  1DBF A;  3KJJ A;  3L7Q A;  3ZOP A;  5HP7 A;  1PF5 A;  2DYY A;  2CHT A;  3M1X A;  1J7H A;  1UI9 A;  3ZP7 A;  1ONI A;  3M4S A;  3I7T A;  2UYN A;  1QD9 A;  1UFY A;  2UYN B;  3KJK A;  3I3F A; 
#chains in the Genus database with same CATH topology
 3V4D A;  1W41 A;  5GIP C;  3DDN A;  5LOV A;  3T80 A;  3ESJ A;  3HKC A;  4ZI7 B;  3RE3 A;  1RLU A;  1ZWZ A;  5LP6 A;  1CLI A;  2EWC A;  4ZHY B;  3R0P A;  3WJQ A;  3TD3 A;  5EIB C;  1VHA A;  1JY8 A;  3CCV F;  5LXT B;  2Q1Y A;  5JVD A;  2HP0 B;  5IYZ A;  3F0E A;  4RHA A;  3P0Z A;  5MN4 A;  4G4Z A;  3VYT C;  5LYJ A;  2HS4 A;  3JAL B;  3ELC A;  5MN5 A;  3V7E A;  2KG4 A;  1W42 A;  3V7Q A;  1QU9 A;  4G4W A;  4I50 A;  1JD1 A;  4X1K B;  5GAN K;  2HP3 A;  3HKE B;  5KX5 B;  3WGK A;  2P6Y A;  2PHN A;  4ZOL B;  2YYE A;  3TD5 A;  1VQO F;  1KQS F;  3LWR C;  3U0O A;  3NK6 A;  3VOB A;  1XRG A;  5ITZ A;  3PLA C;  4BT3 A;  3WGJ A;  4I4T B;  5HY2 A;  5JVD B;  5CA1 B;  4EI8 A;  3SIV A;  1J7H A;  1UI9 A;  5B8F A;  2ALE A;  4EI9 A;  3OBW A;  4YJ2 B;  5IT9 M;  2HRU A;  1GO1 A;  4O4I A;  1W3E X;  4G88 A;  3JCM M;  4I50 B;  4U3J A;  2OTM A;  3FD6 A;  2UYP A;  3IR9 A;  2HQS C;  2BTQ B;  5DCV A;  3CCQ F;  3G71 F;  1QVG F;  4B46 A;  3MBM A;  5JQG A;  1W57 A;  2FGY A;  3J81 M;  1DBF A;  1DT9 A;  1Q7Y H;  5CB4 A;  2ZOD A;  3HWU A;  3HKD A;  3I3F A;  5C8Y B;  4O2A A;  2Z1U A;  4X1I A;  3CXC F;  2LCA A;  1KNJ A;  4O4I B;  3RYF A;  5G4U C;  1XHO A;  4U3J B;  5HP8 A;  2F9Z C;  4O4J B;  4PWT A;  1E7K A;  5GIO C;  3E22 A;  3QTY A;  5EWR A;  1W5B A;  2IG8 A;  4ZHV A;  3LME A;  1COM A;  4BT5 A;  1JN1 A;  2VXY A;  4BVT A;  4DRX B;  3NVK E;  5HY0 A;  4FFB A;  3ZP7 A;  2HVY D;  3N2G A;  3CCR F;  1W58 1;  2HX0 A;  4BT4 A;  2HS3 A;  3F0F A;  4ZK7 A;  4O2A B;  1T0K B;  1ODE A;  2RHO A;  3RYF B;  2CSL A;  2KTV A;  2QA4 F;  2RHJ A;  4IHJ B;  3TD4 A;  3LDT A;  2BTU A;  3E22 B;  3CCU F;  3F6M A;  3SIU A;  3F0G A;  5LXT A;  3HKB A;  1SZQ A;  3L7Q A;  3IMP A;  3D54 A;  1VQ4 F;  2HP0 A;  3C9U A;  5BMV A;  3JAS B;  1N8R H;  3S0Y A;  4TZZ A;  1U3L A;  3PAF A;  3P10 A;  1JJ2 F;  1W5F A;  5FLX M;  3CMA F;  4ERH A;  1H48 A;  2AMT A;  4X1K A;  3HKE A;  3LFO A;  5MN6 A;  5G4V C;  5EIB D;  5KX5 A;  2IAF A;  3S0W A;  3CCE F;  4ZOL A;  2I6R A;  1X7P A;  3O85 A;  3MDO A;  1FNK A;  4TV8 B;  3S02 A;  1K8A H;  3CCJ F;  2QTP A;  3HKB B;  4I4T A;  2QI2 A;  2LBT A;  2FC3 A;  1YJN F;  4X3M A;  5CA1 A;  3VIU A;  5BMV B;  3MCQ A;  2KGW A;  3RYH B;  4X20 B;  4YJ2 A;  4BT2 A;  2VAP A;  4TUY B;  2Z01 A;  4C8E A;  3WPX A;  4C4W C;  3CC4 F;  2UYK A;  5CA0 A;  3CME F;  4BVS A;  3VOA A;  5KMG B;  3NVI B;  3G6E F;  2MQE A;  1X25 A;  1SA0 B;  2RB9 A;  3CG6 A;  1GZ0 A;  2PMP A;  4HNA A;  3CC7 F;  3CCS F;  2YXZ A;  3VYS C;  3DC2 A;  1PXW A;  3JAR A;  1KC8 H;  3M4S A;  3QHD A;  3VI6 A;  2Z1F A;  3ON1 A;  2CZW A;  1VQV A;  1X7O A;  5C8Y A;  2GZL A;  3CCL F;  3MQW A;  4B45 A;  1K73 H;  4F6R B;  5J2U B;  4BY9 D;  3BYQ A;  1GO0 A;  2VGM A;  4O4J A;  2L26 A;  1YJ9 F;  5CA0 B;  4R40 B;  3UT5 B;  2CHS A;  3RYC A;  3CD6 F;  1RLG A;  3VO8 A;  3QUW A;  2OHW A;  1IPA A;  1OAP A;  2VAW A;  1PF5 A;  2RHL A;  4HNA B;  1YJW F;  4DRX A;  4C82 A;  3EOR A;  1IV1 A;  5EB1 B;  3JAR B;  1RQ2 A;  4C8G A;  4X1Y B;  3LWV C;  3KJK A;  1YI2 F;  3KE1 A;  1VH8 A;  3RYI B;  2VGN A;  5IJ9 B;  2NMU A;  1VQM F;  3ERN A;  1Z5V A;  3WJR A;  1QVF F;  4IHJ A;  1VQK F;  2CWJ A;  2OTJ F;  5FNV B;  3RYC B;  3WGN A;  2H6L A;  2OZB A;  4DXD A;  4EB6 A;  1YHQ F;  3IKF A;  3JAS A;  2R75 1;  1M1K H;  2HRY A;  5JH7 B;  4BVQ A;  3OON A;  2LBX A;  5IJ0 B;  3S06 A;  3ZP4 A;  1QAH A;  3N2K B;  1YQN A;  1RQ7 A;  1Q8R A;  1TUB B;  2R6R 1;  2BTO A;  3LYB A;  3HJW C;  3N4Y A;  3CC2 F;  1M90 H;  4TV8 A;  1VQP F;  2CVL A;  2I6D A;  3C8L A;  1IV4 A;  3CB2 A;  3IEQ A;  2CHT A;  4EB6 B;  4O4L A;  5A2Q M;  3OW2 F;  4E6E A;  3RYH A;  3FPI A;  4X20 A;  1W59 A;  3MCA B;  1H7M A;  4IIJ B;  3JAT B;  3IEW A;  4TUY A;  2Q1X A;  2ZAU A;  2LBW A;  1U40 A;  3WPW A;  3CYQ A;  2V9Y A;  3V3T A;  4M8I A;  3WGL A;  1IV2 A;  2B33 A;  4WBN B;  5KMG A;  1T0A A;  5FJ4 C;  3RA5 A;  1SA0 A;  3FBA A;  1X52 A;  1Q86 H;  2VAM A;  5J2T B;  1H47 A;  4O2B A;  1U3P A;  4G4Y A;  1U43 A;  4O4L B;  4LNU B;  2Z1E A;  3JAW B;  1QD9 A;  2IQQ A;  3CPQ A;  4I55 B;  4ZHQ A;  3K2X A;  3OBY A;  4NQ3 A;  5AVM A;  4F6R A;  5J2U A;  2GLZ A;  5HXZ A;  3K0T A;  5GON A;  2AIZ P;  3UT5 A;  4YJ3 A;  3K14 A;  1W55 A;  1FFX A;  3JAM M;  4BW0 B;  1VQ6 F;  3K12 A;  5HP7 A;  4BT6 A;  3I55 F;  1Q82 H;  1K9M H;  5EO3 A;  1W40 A;  5HXU A;  4ZHW A;  1ONI A;  1RA4 A;  3C9S A;  4O4H A;  4O2B B;  5LA6 B;  3S0H A;  2UYN A;  4X1Y A;  1VK3 A;  5EYP B;  1NJI H;  3RYI A;  4ZHQ B;  2ZVY A;  3VTI C;  5IJ9 A;  3M84 A;  5LOV B;  3HKC B;  3GYQ A;  1Z5W A;  2KTU A;  5LP6 B;  2UYJ A;  5GON B;  1IV3 A;  2DT4 A;  2UZH A;  4NUT A;  3AGK A;  3HTN A;  3C9T A;  4YJ3 B;  5FNV A;  3KHN A;  2ZF8 A;  1FFX B;  3NK7 A;  1XBI A;  3FD5 A;  3ZOP A;  4G4V A;  3LWO C;  5IYZ B;  3WJP A;  3J7A R;  3E20 B;  1W2B F;  3M1X A;  3CYP B;  1CN7 A;  3C9R A;  5LYJ B;  4O4H B;  1KNK A;  5JH7 A;  1UFY A;  2UYN B;  2G9I A;  1CK2 A;  5IJ0 A;  1GX1 A;  3N2K A;  1JFF A;  3VMF B;  4KWE A;  3HAX D;  1R1M A;  4B62 A;  4G4X A;  1VQ9 F;  1TUB A;  5HY4 A;  5EZY A;  3VCZ A;  1YIT F;  2ZOV A;  4RQO A;  4NWO B;  3FFM A;  2ZVZ A;  1FNJ A;  3KJJ A;  5ITZ B;  1S72 F;  3JAK A;  2DYY A;  3GHZ A;  5HWE A;  4XCQ A;  4C81 A;  3G4S F;  4U39 A;  2HS0 A;  1VQL F;  1NMU B;  2AIF A;  3KIZ A;  1TVK A;  4IIJ A;  3JAT A;  1KD1 H;  4EI7 A;  2BO1 A;  1XV2 A;  5GIN C;  3LWQ C;  3LWP C;  3ZO8 A;  4X3L A;  1JFF B;  3D01 A;  3E1Y A;  4TV9 A;  1NQ3 A;  3WGM A;  2JNB A;  4WBN A;  5EZY B;  1VQN F;  3GTZ A;  1VQ8 F;  2RHH A;  4B5C A;  5JQG B;  3N4Z A;  4C8I A;  3I56 F;  5JCO C;  1VQ5 F;  5J2T A;  5EAZ A;  3JAK B;  4BT7 A;  5CB4 B;  4BVR A;  3IKE A;  3J80 M;  3I7T A;  5EB0 A;  2Z1T A;  2H8C A;  2H8E A;  4LNU A;  3JAW A;  3HKD B;  4I55 A;  3D00 A;  3NMU C;  3CPW F;  1TVK B;  3JVH A;  4X1I B;  3CCM F;  3RA6 A;  1SDS A;  1OFU A;  3VYU C;  3F0D A;  4ZI7 A;  1VQ7 F;  1YIJ F;  4TV9 B;  5GAP K;  3B6N A;  5JCO A;  3Q8H A;  2N48 A;  2GVI A;  1W5A A;  1Q81 H;  2W8B C;  2CW4 A;  3S03 A;  1W5E A;  5LP6 C;  4LCK A;  3P4E A;  2QEX F;  4FFB B;  2WAL A;  1YGY A;  1FSZ A;  3JAL A;  3WXM B;  3N2G B;  5LA6 A;  5HY1 A;  2OTL F;  5EYP A;  2K1S A; 
#chains in the Genus database with same CATH homology
 3V4D A;  1QU9 A;  3MQW A;  4ZK7 A;  3ZP4 A;  1QAH A;  1JD1 A;  1ODE A;  3ZO8 A;  3D01 A;  1NQ3 A;  2CSL A;  1XHO A;  2OTM A;  2UYK A;  2UYP A;  5HP8 A;  3K0T A;  2UYJ A;  3VCZ A;  2B33 A;  2EWC A;  3LYB A;  4NWO B;  3R0P A;  1X25 A;  2CWJ A;  3GTZ A;  1FNK A;  2CHS A;  2IG8 A;  3LME A;  2CW4 A;  2CVL A;  3QUW A;  1FNJ A;  3K12 A;  1COM A;  1XRG A;  1DBF A;  3KJJ A;  3L7Q A;  3ZOP A;  5HP7 A;  1PF5 A;  2DYY A;  2CHT A;  3M1X A;  1J7H A;  1UI9 A;  3ZP7 A;  1ONI A;  3M4S A;  3I7T A;  2UYN A;  1QD9 A;  1UFY A;  2UYN B;  3KJK A;  3I3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...