1FNJA

Crystal structure analysis of chorismate mutase mutant c88s/r90k
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
115
structure length
114
Chain Sequence
b'MIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTMQEMDVTGGLKKSIKVMMTVQTDVPQDQIRHVYLEKAVVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHORISMATE MUTASE)
molecule tags Isomerase
source organism Bacillus subtilis
publication title A strategically positioned cation is crucial for efficient catalysis by chorismate mutase.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 115
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2000-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07736 CM_1 Chorismate mutase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 1fnjA00
1JD1A 3ZP7A 4ZK7A 3KJJA 3ZO8A 5HP8A 3GTZA 3KJKA 3LMEA 2UYPA 2EWCA 3M4SA 3ZP4A 2OTMA 2UYNB 3LYBA 3I7TA 3D01A 3VCZA 1UI9A 3V4DA 2IG8A 3MQWA 3L7QA 1COMA 2UYJA 2UYKA 4NWOB 3K0TA 2CW4A 1QU9A 1DBFA 2CWJA 1XHOA 1FNJA 3QUWA 1J7HA 1XRGA 3K12A 1X25A 3I3FA 1QD9A 3ZOPA 1FNKA 2CHSA 1NQ3A 1PF5A 2CVLA 2UYNA 2DYYA 1UFYA 5HP7A 1ODEA 1ONIA 3M1XA 2B33A 3R0PA 1QAHA 2CHTA 2CSLA
chains in the Genus database with same CATH superfamily
5EIBD 1RA4A 3HWUA 4IIJB 2UYPA 1DT9A 1X7PA 2FC3A 2UYNB 4X1IA 4B62A 2HP0B 4EB6A 2IG8A 4R40B 5EB0A 2CWJA 4ZHYB 4O4LB 1U43A 2RB9A 3PLAC 2AMTA 1K73H 4LNUA 4ZHQB 2IQQA 1VQ9F 3N2KB 2KG4A 5HXUA 2CZWA 3F6MA 2QEXF 3CCJF 4C82A 1YJ9F 4YJ2A 4G88A 5MN4A 4B5CA 1SDSA 4G4XA 4KWEA 4TV9B 5CA1A 1SA0A 3FFMA 1Q7YH 1UI9A 3HKBA 1ZWZA 3RYIB 5EYPA 4C81A 3N2GB 1PXWA 3S02A 4I50A 2UZHA 3K0TA 3K2XA 3FPIA 5IJ0A 4BT6A 5CB4B 1VH8A 3IEWA 1X52A 3MCQA 1QD9A 5CA0B 2RHOA 1VQ8F 5IT9M 3S0WA 1PF5A 3VIUA 3CMEF 3F0DA 1VQOF 4YJ3B 1YHQF 2LBTA 1K8AH 5GIPC 4G4VA 3IKEA 3KE1A 5HY0A 3I55F 3P4EA 1Q8RA 1CLIA 3TD4A 3IKFA 4B46A 3HAXD 1CK2A 4EI9A 1S72F 1W2BF 3FBAA 3LYBA 5JVDA 5EZYA 1X7OA 3F0GA 5LOVA 4O4JA 3JAKA 4NWOB 1M1KH 3RE3A 2QTPA 3ERNA 3RYFB 4IHJB 3G4SF 3GHZA 5EWRA 3NVKE 1XBIA 5AVMA 2RHHA 1RQ7A 1QAHA 4ZOLB 5B8FA 3JAKB 1KD1H 4O4JB 3CMAF 1IV3A 2Z1TA 3NVIB 3VYSC 1VQKF 1K9MH 1JFFA 4HNAB 4B45A 3E20B 4I4TA 3NK7A 3LWQC 3WXMB 3JATA 1FNJA 3K12A 4X3MA 1W41A 2AIZP 1NMUB 4YJ3A 2MQEA 3M84A 3V3TA 5HP7A 2VAPA 3LWOC 1GO0A 4O2AB 4BVQA 1VQ5F 1E7KA 2HX0A 3CCEF 2H8EA 3DC2A 1U40A 1VQ6F 3ZO8A 2VAWA 2VXYA 4O2AA 3RYIA 3OBYA 3WGLA 2BTUA 3MBMA 4BT7A 5CA1B 3UT5A 4X3LA 5KX5A 3T80A 5JQGA 2UYJA 3U0OA 1OFUA 1DBFA 4I4TB 2Z1EA 4YJ2B 3LFOA 4O2BA 1VQ7F 1IV2A 5JCOC 3HJWC 3S0HA 1OAPA 1UFYA 3LWVC 1W581 1H48A 4LNUB 4ZHQA 5J2UA 3WJPA 4ZOLA 2HS3A 1Z5WA 4PWTA 1W5EA 4BT4A 3CXCF 2IAFA 1N8RH 3ZP4A 4C4WC 4ZHWA 3D01A 2ZAUA 5LP6C 1QVFF 4ZI7B 5GINC 5G4UC 2UYKA 3N4YA 1VQVA 3LWRC 4X20B 2H6LA 4RQOA 3I56F 3CC4F 1QVGF 3JAWA 1W55A 2I6RA 3KJJA 3GTZA 1YGYA 3HKCA 3P0ZA 3LMEA 3WPWA 4U39A 3E1YA 3CCMF 3HKEB 3RYCB 3MQWA 5CB4A 2FGYA 1XV2A 5LYJB 3C8LA 2N48A 1Q86H 5HY4A 2GZLA 3N2GA 5EYPB 5KMGA 1RQ2A 1FNKA 1SA0B 2CHSA 4NUTA 5ITZA 3RYHA 3HKDA 4F6RB 1VQPF 4TV9A 4F6RA 3S03A 2VGMA 3ESJA 5ITZB 1W5AA 3S06A 2CHTA 3QTYA 4TUYB 5LYJA 3CC2F 5C8YA 3KJKA 1JY8A 3HKEA 2EWCA 1U3LA 4BVTA 4U3JA 3SIUA 3L7QA 2PHNA 1COMA 5IJ9B 5A2QM 1XHOA 2ZVZA 4FFBA 3N4ZA 5EAZA 5LA6B 3JAWB 2HP0A 2ZODA 4LCKA 3J80M 2CVLA 2UYNA 2YXZA 4X1KA 5LP6B 4IIJA 5J2TB 4BT3A 4X20A 2Q1YA 5GONA 4ZHVA 1JD1A 1H47A 3VO8A 3CCLF 3G6EF 5J2TA 5HP8A 2I6DA 4ZI7A 3CYPB 4TZZA 2HP3A 5JCOA 2WALA 3CD6F 4O4IB 5LXTB 5G4VC 3WGNA 5LA6A 3D00A 3F0FA 4DRXA 4DXDA 5BMVA 5IJ9A 2QA4F 1VQNF 1J7HA 4C8GA 1X25A 4XCQA 4U3JB 3VOAA 3J7AR 1VHAA 3ZOPA 2JNBA 3WJQA 1GX1A 2L26A 1IV4A 3C9UA 3CPQA 5HY1A 4EI7A 2V9YA 3VYTC 3CPWF 3AGKA 1Z5VA 3JALB 4TUYA 5JH7A 3V7EA 2B33A 2HS0A 3B6NA 3ZP7A 4ZK7A 5JQGB 4X1YA 5KX5B 3UT5B 2BTQB 2HS4A 3HKDB 2ALEA 4BT5A 2Z01A 5KMGB 5EO3A 2YYEA 5EB1B 1W59A 2R751 5FNVB 3SIVA 3EORA 2VGNA 4BVSA 1JN1A 3NK6A 3WGKA 2DYYA 3CCUF 3PAFA 3BYQA 5MN6A 2OHWA 4BY9D 2OZBA 3C9RA 3VOBA 3QHDA 1YJWF 2G9IA 2ZVYA 3JASA 4C8EA 3JAMM 3K14A 1VQLF 3LDTA 3LWPC 1U3PA 2CW4A 5GIOC 3QUWA 2OTJF 2GVIA 3JVHA 4O4HB 1GZ0A 4I55B 3C9SA 1FFXA 1YQNA 2RHJA 3J81M 5GANK 2RHLA 3NMUC 3ELCA 4WBNB 2Q1XA 1FFXB 1RLUA 1RLGA 4IHJA 1TUBB 5FLXM 5J2UB 3KHNA 1M90H 5EZYB 3FD5A 3IMPA 4TV8B 2OTLF 1YI2F 4O2BB 1YJNF 3I7TA 3V4DA 5DCVA 2HRYA 3CCVF 2Z1UA 3I3FA 4BT2A 3WJRA 2BO1A 2HQSC 2ZF8A 3OONA 1ONIA 1W40A 3O85A 5CA0A 3P10A 1NJIH 5IJ0B 1YITF 3CC7F 3IR9A 3WPXA 4C8IA 2Z1FA 5MN5A 2R6R1 4BW0B 4BVRA 3DDNA 3WGJA 1KQSF 3JATB 5JH7B 2VAMA 3CCRF 3CCSF 1JFFB 1NQ3A 3FD6A 4HNAA 3RA6A 4RHAA 4TV8A 3VYUC 3N2KA 1W5FA 2ZOVA 3M1XA 2CSLA 1TUBA 1CN7A 1W5BA 2AIFA 3CG6A 5BMVB 4DRXB 3KIZA 4EB6B 4WBNA 2W8BC 4G4YA 5LXTA 2DT4A 3GYQA 4X1IB 3TD5A 4I55A 4O4HA 1H7MA 3CCQF 4G4WA 3RYFA 5HXZA 2GLZA 3MCAB 5EIBC 2KGWA 1QU9A 5GONB 5LOVB 1T0KB 1XRGA 1GO1A 5JVDB 1W3EX 3E22B 1JJ2F 1KNKA 3JARB 1Q82H 2PMPA 4X1KB 4EI8A 5LP6A 4ERHA 3JASB 2H8CA 5GAPK 4E6EA 1T0AA 2KTUA 4FFBB 3S0YA 3RA5A 1W42A 2LBXA 4M8IA 3C9TA 5IYZB 1Q81H 3CB2A 3M4SA 2OTMA 5HWEA 5FJ4C 2BTOA 5C8YB 5FNVA 3JCMM 4I50B 1IV1A 3HKBB 1FSZA 3VI6A 3V7QA 3Q8HA 3VMFB 3D54A 3RYHB 1KNJA 1SZQA 2F9ZC 2P6YA 5HY2A 1ODEA 2KTVA 4X1YB 3HTNA 3TD3A 1W57A 2HVYD 1IPAA 1VK3A 3WGMA 2LBWA 3JALA 3G71F 3OBWA 1VQ4F 3RYCA 1VQMF 3F0EA 1YIJF 2LCAA 3VCZA 3HKCB 1KC8H 2QI2A 5IYZA 4O4LA 4NQ3A 2HRUA 3OW2F 2K1SA 3ON1A 2NMUA 3VTIC 4G4ZA 3MDOA 3CYQA 3IEQA 4O4IA 1R1MA 3JARA 3E22A 1TVKB 3R0PA 1TVKA
chains in the Genus database with same CATH topology
1JD1A 3ZP7A 4ZK7A 3KJJA 3ZO8A 5HP8A 3GTZA 3KJKA 3LMEA 2UYPA 2EWCA 3M4SA 3ZP4A 2OTMA 2UYNB 3LYBA 3I7TA 3D01A 3VCZA 1UI9A 3V4DA 2IG8A 3MQWA 3L7QA 1COMA 2UYJA 2UYKA 4NWOB 3K0TA 2CW4A 1QU9A 1DBFA 2CWJA 1XHOA 1FNJA 3QUWA 1J7HA 1XRGA 3K12A 1X25A 3I3FA 1QD9A 3ZOPA 1FNKA 2CHSA 1NQ3A 1PF5A 2CVLA 2UYNA 2DYYA 1UFYA 5HP7A 1ODEA 1ONIA 3M1XA 2B33A 3R0PA 1QAHA 2CHTA 2CSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JD1 A;  3ZP7 A;  4ZK7 A;  3KJJ A;  3ZO8 A;  5HP8 A;  3GTZ A;  3KJK A;  3LME A;  2UYP A;  2EWC A;  3M4S A;  3ZP4 A;  2OTM A;  2UYN B;  3LYB A;  3I7T A;  3D01 A;  3VCZ A;  1UI9 A;  3V4D A;  2IG8 A;  3MQW A;  3L7Q A;  1COM A;  2UYJ A;  2UYK A;  4NWO B;  3K0T A;  2CW4 A;  1QU9 A;  1DBF A;  2CWJ A;  1XHO A;  1FNJ A;  3QUW A;  1J7H A;  1XRG A;  3K12 A;  1X25 A;  3I3F A;  1QD9 A;  3ZOP A;  1FNK A;  2CHS A;  1NQ3 A;  1PF5 A;  2CVL A;  2UYN A;  2DYY A;  1UFY A;  5HP7 A;  1ODE A;  1ONI A;  3M1X A;  2B33 A;  3R0P A;  1QAH A;  2CHT A;  2CSL A; 
#chains in the Genus database with same CATH topology
 5EIB D;  1RA4 A;  3HWU A;  4IIJ B;  2UYP A;  1DT9 A;  1X7P A;  2FC3 A;  2UYN B;  4X1I A;  4B62 A;  2HP0 B;  4EB6 A;  2IG8 A;  4R40 B;  5EB0 A;  2CWJ A;  4ZHY B;  4O4L B;  1U43 A;  2RB9 A;  3PLA C;  2AMT A;  1K73 H;  4LNU A;  4ZHQ B;  2IQQ A;  1VQ9 F;  3N2K B;  2KG4 A;  5HXU A;  2CZW A;  3F6M A;  2QEX F;  3CCJ F;  4C82 A;  1YJ9 F;  4YJ2 A;  4G88 A;  5MN4 A;  4B5C A;  1SDS A;  4G4X A;  4KWE A;  4TV9 B;  5CA1 A;  1SA0 A;  3FFM A;  1Q7Y H;  1UI9 A;  3HKB A;  1ZWZ A;  3RYI B;  5EYP A;  4C81 A;  3N2G B;  1PXW A;  3S02 A;  4I50 A;  2UZH A;  3K0T A;  3K2X A;  3FPI A;  5IJ0 A;  4BT6 A;  5CB4 B;  1VH8 A;  3IEW A;  1X52 A;  3MCQ A;  1QD9 A;  5CA0 B;  2RHO A;  1VQ8 F;  5IT9 M;  3S0W A;  1PF5 A;  3VIU A;  3CME F;  3F0D A;  1VQO F;  4YJ3 B;  1YHQ F;  2LBT A;  1K8A H;  5GIP C;  4G4V A;  3IKE A;  3KE1 A;  5HY0 A;  3I55 F;  3P4E A;  1Q8R A;  1CLI A;  3TD4 A;  3IKF A;  4B46 A;  3HAX D;  1CK2 A;  4EI9 A;  1S72 F;  1W2B F;  3FBA A;  3LYB A;  5JVD A;  5EZY A;  1X7O A;  3F0G A;  5LOV A;  4O4J A;  3JAK A;  4NWO B;  1M1K H;  3RE3 A;  2QTP A;  3ERN A;  3RYF B;  4IHJ B;  3G4S F;  3GHZ A;  5EWR A;  3NVK E;  1XBI A;  5AVM A;  2RHH A;  1RQ7 A;  1QAH A;  4ZOL B;  5B8F A;  3JAK B;  1KD1 H;  4O4J B;  3CMA F;  1IV3 A;  2Z1T A;  3NVI B;  3VYS C;  1VQK F;  1K9M H;  1JFF A;  4HNA B;  4B45 A;  3E20 B;  4I4T A;  3NK7 A;  3LWQ C;  3WXM B;  3JAT A;  1FNJ A;  3K12 A;  4X3M A;  1W41 A;  2AIZ P;  1NMU B;  4YJ3 A;  2MQE A;  3M84 A;  3V3T A;  5HP7 A;  2VAP A;  3LWO C;  1GO0 A;  4O2A B;  4BVQ A;  1VQ5 F;  1E7K A;  2HX0 A;  3CCE F;  2H8E A;  3DC2 A;  1U40 A;  1VQ6 F;  3ZO8 A;  2VAW A;  2VXY A;  4O2A A;  3RYI A;  3OBY A;  3WGL A;  2BTU A;  3MBM A;  4BT7 A;  5CA1 B;  3UT5 A;  4X3L A;  5KX5 A;  3T80 A;  5JQG A;  2UYJ A;  3U0O A;  1OFU A;  1DBF A;  4I4T B;  2Z1E A;  4YJ2 B;  3LFO A;  4O2B A;  1VQ7 F;  1IV2 A;  5JCO C;  3HJW C;  3S0H A;  1OAP A;  1UFY A;  3LWV C;  1W58 1;  1H48 A;  4LNU B;  4ZHQ A;  5J2U A;  3WJP A;  4ZOL A;  2HS3 A;  1Z5W A;  4PWT A;  1W5E A;  4BT4 A;  3CXC F;  2IAF A;  1N8R H;  3ZP4 A;  4C4W C;  4ZHW A;  3D01 A;  2ZAU A;  5LP6 C;  1QVF F;  4ZI7 B;  5GIN C;  5G4U C;  2UYK A;  3N4Y A;  1VQV A;  3LWR C;  4X20 B;  2H6L A;  4RQO A;  3I56 F;  3CC4 F;  1QVG F;  3JAW A;  1W55 A;  2I6R A;  3KJJ A;  3GTZ A;  1YGY A;  3HKC A;  3P0Z A;  3LME A;  3WPW A;  4U39 A;  3E1Y A;  3CCM F;  3HKE B;  3RYC B;  3MQW A;  5CB4 A;  2FGY A;  1XV2 A;  5LYJ B;  3C8L A;  2N48 A;  1Q86 H;  5HY4 A;  2GZL A;  3N2G A;  5EYP B;  5KMG A;  1RQ2 A;  1FNK A;  1SA0 B;  2CHS A;  4NUT A;  5ITZ A;  3RYH A;  3HKD A;  4F6R B;  1VQP F;  4TV9 A;  4F6R A;  3S03 A;  2VGM A;  3ESJ A;  5ITZ B;  1W5A A;  3S06 A;  2CHT A;  3QTY A;  4TUY B;  5LYJ A;  3CC2 F;  5C8Y A;  3KJK A;  1JY8 A;  3HKE A;  2EWC A;  1U3L A;  4BVT A;  4U3J A;  3SIU A;  3L7Q A;  2PHN A;  1COM A;  5IJ9 B;  5A2Q M;  1XHO A;  2ZVZ A;  4FFB A;  3N4Z A;  5EAZ A;  5LA6 B;  3JAW B;  2HP0 A;  2ZOD A;  4LCK A;  3J80 M;  2CVL A;  2UYN A;  2YXZ A;  4X1K A;  5LP6 B;  4IIJ A;  5J2T B;  4BT3 A;  4X20 A;  2Q1Y A;  5GON A;  4ZHV A;  1JD1 A;  1H47 A;  3VO8 A;  3CCL F;  3G6E F;  5J2T A;  5HP8 A;  2I6D A;  4ZI7 A;  3CYP B;  4TZZ A;  2HP3 A;  5JCO A;  2WAL A;  3CD6 F;  4O4I B;  5LXT B;  5G4V C;  3WGN A;  5LA6 A;  3D00 A;  3F0F A;  4DRX A;  4DXD A;  5BMV A;  5IJ9 A;  2QA4 F;  1VQN F;  1J7H A;  4C8G A;  1X25 A;  4XCQ A;  4U3J B;  3VOA A;  3J7A R;  1VHA A;  3ZOP A;  2JNB A;  3WJQ A;  1GX1 A;  2L26 A;  1IV4 A;  3C9U A;  3CPQ A;  5HY1 A;  4EI7 A;  2V9Y A;  3VYT C;  3CPW F;  3AGK A;  1Z5V A;  3JAL B;  4TUY A;  5JH7 A;  3V7E A;  2B33 A;  2HS0 A;  3B6N A;  3ZP7 A;  4ZK7 A;  5JQG B;  4X1Y A;  5KX5 B;  3UT5 B;  2BTQ B;  2HS4 A;  3HKD B;  2ALE A;  4BT5 A;  2Z01 A;  5KMG B;  5EO3 A;  2YYE A;  5EB1 B;  1W59 A;  2R75 1;  5FNV B;  3SIV A;  3EOR A;  2VGN A;  4BVS A;  1JN1 A;  3NK6 A;  3WGK A;  2DYY A;  3CCU F;  3PAF A;  3BYQ A;  5MN6 A;  2OHW A;  4BY9 D;  2OZB A;  3C9R A;  3VOB A;  3QHD A;  1YJW F;  2G9I A;  2ZVY A;  3JAS A;  4C8E A;  3JAM M;  3K14 A;  1VQL F;  3LDT A;  3LWP C;  1U3P A;  2CW4 A;  5GIO C;  3QUW A;  2OTJ F;  2GVI A;  3JVH A;  4O4H B;  1GZ0 A;  4I55 B;  3C9S A;  1FFX A;  1YQN A;  2RHJ A;  3J81 M;  5GAN K;  2RHL A;  3NMU C;  3ELC A;  4WBN B;  2Q1X A;  1FFX B;  1RLU A;  1RLG A;  4IHJ A;  1TUB B;  5FLX M;  5J2U B;  3KHN A;  1M90 H;  5EZY B;  3FD5 A;  3IMP A;  4TV8 B;  2OTL F;  1YI2 F;  4O2B B;  1YJN F;  3I7T A;  3V4D A;  5DCV A;  2HRY A;  3CCV F;  2Z1U A;  3I3F A;  4BT2 A;  3WJR A;  2BO1 A;  2HQS C;  2ZF8 A;  3OON A;  1ONI A;  1W40 A;  3O85 A;  5CA0 A;  3P10 A;  1NJI H;  5IJ0 B;  1YIT F;  3CC7 F;  3IR9 A;  3WPX A;  4C8I A;  2Z1F A;  5MN5 A;  2R6R 1;  4BW0 B;  4BVR A;  3DDN A;  3WGJ A;  1KQS F;  3JAT B;  5JH7 B;  2VAM A;  3CCR F;  3CCS F;  1JFF B;  1NQ3 A;  3FD6 A;  4HNA A;  3RA6 A;  4RHA A;  4TV8 A;  3VYU C;  3N2K A;  1W5F A;  2ZOV A;  3M1X A;  2CSL A;  1TUB A;  1CN7 A;  1W5B A;  2AIF A;  3CG6 A;  5BMV B;  4DRX B;  3KIZ A;  4EB6 B;  4WBN A;  2W8B C;  4G4Y A;  5LXT A;  2DT4 A;  3GYQ A;  4X1I B;  3TD5 A;  4I55 A;  4O4H A;  1H7M A;  3CCQ F;  4G4W A;  3RYF A;  5HXZ A;  2GLZ A;  3MCA B;  5EIB C;  2KGW A;  1QU9 A;  5GON B;  5LOV B;  1T0K B;  1XRG A;  1GO1 A;  5JVD B;  1W3E X;  3E22 B;  1JJ2 F;  1KNK A;  3JAR B;  1Q82 H;  2PMP A;  4X1K B;  4EI8 A;  5LP6 A;  4ERH A;  3JAS B;  2H8C A;  5GAP K;  4E6E A;  1T0A A;  2KTU A;  4FFB B;  3S0Y A;  3RA5 A;  1W42 A;  2LBX A;  4M8I A;  3C9T A;  5IYZ B;  1Q81 H;  3CB2 A;  3M4S A;  2OTM A;  5HWE A;  5FJ4 C;  2BTO A;  5C8Y B;  5FNV A;  3JCM M;  4I50 B;  1IV1 A;  3HKB B;  1FSZ A;  3VI6 A;  3V7Q A;  3Q8H A;  3VMF B;  3D54 A;  3RYH B;  1KNJ A;  1SZQ A;  2F9Z C;  2P6Y A;  5HY2 A;  1ODE A;  2KTV A;  4X1Y B;  3HTN A;  3TD3 A;  1W57 A;  2HVY D;  1IPA A;  1VK3 A;  3WGM A;  2LBW A;  3JAL A;  3G71 F;  3OBW A;  1VQ4 F;  3RYC A;  1VQM F;  3F0E A;  1YIJ F;  2LCA A;  3VCZ A;  3HKC B;  1KC8 H;  2QI2 A;  5IYZ A;  4O4L A;  4NQ3 A;  2HRU A;  3OW2 F;  2K1S A;  3ON1 A;  2NMU A;  3VTI C;  4G4Z A;  3MDO A;  3CYQ A;  3IEQ A;  4O4I A;  1R1M A;  3JAR A;  3E22 A;  1TVK B;  3R0P A;  1TVK A; 
#chains in the Genus database with same CATH homology
 1JD1 A;  3ZP7 A;  4ZK7 A;  3KJJ A;  3ZO8 A;  5HP8 A;  3GTZ A;  3KJK A;  3LME A;  2UYP A;  2EWC A;  3M4S A;  3ZP4 A;  2OTM A;  2UYN B;  3LYB A;  3I7T A;  3D01 A;  3VCZ A;  1UI9 A;  3V4D A;  2IG8 A;  3MQW A;  3L7Q A;  1COM A;  2UYJ A;  2UYK A;  4NWO B;  3K0T A;  2CW4 A;  1QU9 A;  1DBF A;  2CWJ A;  1XHO A;  1FNJ A;  3QUW A;  1J7H A;  1XRG A;  3K12 A;  1X25 A;  3I3F A;  1QD9 A;  3ZOP A;  1FNK A;  2CHS A;  1NQ3 A;  1PF5 A;  2CVL A;  2UYN A;  2DYY A;  1UFY A;  5HP7 A;  1ODE A;  1ONI A;  3M1X A;  2B33 A;  3R0P A;  1QAH A;  2CHT A;  2CSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...