3CCRF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccrF00
1H7MA 1PXWA 2OZBA 3J7AR 1Q82H 3MCAB 3LFOA 3IR9A 2BO1A 4LCKA 1Q7YH 1W3EX 3CXCF 1VQLF 3I56F 2KTVA 3WXMB 3CMEF 1YI2F 1KQSF 1YJ9F 3CCEF 3LWQC 5A2QM 3E20B 1S72F 5FJ4C 1VQ5F 3FFMA 4X3MA 3RA5A 1KD1H 1GO1A 5FLXM 3NVIB 1K9MH 3CCRF 4BY9D 1W2BF 3SIUA 3I55F 3NMUC 1NMUB 3PLAC 3OBWA 3CCJF 1IPAA 1JJ2F 3LWRC 2QI2A 1QVFF 1M90H 2KTUA 3GYQA 1VQ6F 1VQ7F 2VGNA 1ZWZA 1VQ9F 3VMFB 1W42A 1RLGA 2VGMA 1VQ8F 3JCMM 1VQPF 1T0KB 3G71F 5GIPC 1CK2A 1X7OA 3ON1A 3CCQF 1RA4A 1YITF 3HJWC 1SDSA 5G4UC 3NVKE 3OW2F 1CN7A 4TZZA 3CCLF 2WALA 3G4SF 3V7EA 3OBYA 2QEXF 1VQMF 3CC7F 1DT9A 5EWRA 1VQKF 1X7PA 3V7QA 3RA6A 3NK6A 3G6EF 1W40A 5EO3A 3CG6A 1X52A 3NK7A 5G4VC 3JAMM 1XBIA 5GANK 2I6DA 3O85A 4C4WC 3CCSF 4BW0B 3E1YA 3N4ZA 5GINC 1YHQF 1QVGF 3J80M 2LBXA 3CPQA 2KG4A 5GIOC 2ALEA 1YJNF 1YIJF 3CMAF 5DCVA 3LWVC 3CCVF 3CD6F 3CPWF 1Q81H 1KC8H 3LWOC 2FC3A 1NJIH 3LWPC 3CC4F 3VI6A 3CC2F 1N8RH 2HVYD 2OTLF 3N4YA 1K8AH 1W41A 5IT9M 2JNBA 1YJWF 2CZWA 5GAPK 1M1KH 2LBWA 3J81M 3HAXD 2OHWA 1VQNF 3SIVA 1GZ0A 1Q86H 1E7KA 2AIFA 3CCMF 1VQOF 1VQ4F 4X3LA 3CCUF 1K73H 3AGKA 4NUTA 3PAFA 2OTJF 1GO0A 2QA4F
chains in the Genus database with same CATH superfamily
5EZYA 3RE3A 3MCAB 3WGNA 3K0TA 3S03A 1Q7YH 1W3EX 3FD6A 2RHLA 5KX5B 3JAKB 2ZVYA 1OFUA 5JCOA 4I4TB 2KTVA 3RYHB 1VQLF 5EIBC 2R6R1 3WXMB 2HQSC 3CCEF 5JCOC 3E20B 4O2AA 3ESJA 4X3MA 3JASA 3RA5A 2HX0A 3EORA 1KD1H 3RYCB 2HS0A 3KE1A 4M8IA 2I6RA 5KMGA 4BY9D 1QU9A 1W2BF 3JVHA 3PLAC 5IJ0A 3OBWA 3WJRA 5C8YB 1JJ2F 3T80A 3HKBA 3UT5B 3P10A 2R751 1U40A 2BTOA 2ZF8A 1UFYA 2KTUA 3GYQA 4B45A 3LMEA 4BT6A 1VQ7F 5IJ9B 4WBNB 3JCMM 3E22B 3VOAA 1TUBB 3G71F 1H48A 3RYIA 1X7OA 3S0YA 4IHJA 4BVSA 5HY2A 2Z1UA 4O4IB 5HXUA 1COMA 5G4UC 3C9SA 3CYQA 4TZZA 3K12A 2KGWA 3CCLF 5EZYB 3CC7F 1VQKF 3RA6A 3NK6A 1SZQA 4ZI7A 5HP7A 5LOVB 3G6EF 3GHZA 1YGYA 3NK7A 3D54A 5EIBD 4FFBB 3S06A 3P0ZA 2Z1FA 3TD4A 3MBMA 1Q8RA 4O2AB 3CCSF 2HRYA 3JASB 4X20A 4BW0B 5EAZA 3JATA 3VYTC 2RHJA 3VIUA 5GINC 5KMGB 1QVGF 3J80M 2LBXA 3MCQA 4TUYA 4EB6A 5B8FA 1YJNF 4LNUA 5IJ0B 5DCVA 1KC8H 1GX1A 3HKDA 3CC4F 3CC2F 1OAPA 3KHNA 3KJKA 3ERNA 3F6MA 5J2UB 5GAPK 1RLUA 5EB1B 1VQVA 3IEQA 3RYIB 2HP0B 4IHJB 4O2BA 1GZ0A 4O4LB 4KWEA 4YJ3A 1SA0A 3ELCA 5JQGA 1JD1A 3PAFA 4BT3A 1W59A 3C9UA 4HNAA 3HTNA 4ZI7B 2ZVZA 3QHDA 3ZP7A 2K1SA 4I50B 4TV9A 3VOBA 2Q1XA 3I56F 4DRXB 2CVLA 2CSLA 4X20B 3FPIA 2VAPA 3JATB 5CA0B 1S72F 1FSZA 3FFMA 3C9TA 4TUYB 2F9ZC 1JN1A 3SIUA 3HKDB 4YJ2B 1JFFA 1NMUB 2H8EA 3WPXA 1IPAA 2PHNA 2QI2A 2UYJA 1DBFA 1QVFF 5LP6A 4E6EA 2CHTA 4ZOLA 2UYNA 5LYJA 2VGNA 1CLIA 2ZOVA 3VMFB 3FD5A 5LP6C 3K2XA 1RLGA 3WPWA 3WGMA 1T0KB 5GIPC 1CK2A 2CW4A 4O4JB 3ZO8A 4C8IA 2RB9A 3ON1A 3CCQF 5FNVB 1SA0B 1SDSA 2AMTA 3V4DA 2FGYA 2DYYA 5AVMA 3V7EA 3OBYA 3GTZA 2QEXF 1VQMF 5CA1A 4G4VA 4BVTA 1FFXA 3JARA 3F0GA 5HY4A 1H47A 3JAWA 3HKEA 5LXTA 3KIZA 3DC2A 3MDOA 3TD5A 5MN5A 5G4VC 5JVDA 1W5FA 1XBIA 4G4YA 4C4WC 3O85A 4PWTA 4ZHQA 5BMVA 4BT4A 1TVKA 4BVRA 1W5AA 5IYZA 2GVIA 2V9YA 3N4ZA 2QTPA 4TV8A 3CPQA 5GIOC 5HWEA 3KJJA 3CMAF 3LYBA 3CD6F 3CYPB 1Q81H 2FC3A 4BT5A 3LWPC 5LP6B 4I55A 4ZOLB 3WGKA 2HVYD 5LYJB 3VYUC 3K14A 1M1KH 2RHOA 4ERHA 2LBWA 5MN6A 1R1MA 2VXYA 4U39A 1QD9A 2AIFA 2YYEA 5J2TA 3IKEA 4O4HA 4X3LA 1XHOA 1KNJA 2HS3A 3AGKA 1XRGA 2OTJF 3I3FA 2QA4F 1H7MA 2DT4A 1PXWA 2PMPA 4C81A 1T0AA 3VCZA 1FFXB 3JARB 5HY0A 1Q82H 3HKBB 3N2GA 2OZBA 3LFOA 3HKEB 1IV3A 5LXTB 4NQ3A 4ZHWA 3S02A 1XV2A 4LCKA 2GLZA 3D01A 3CXCF 5JVDB 1RQ7A 1IV1A 3ZOPA 3CMEF 4RQOA 3HKCA 5EB0A 1YJ9F 1TVKB 4F6RA 5IYZB 3WGLA 1U43A 4TV8B 3OONA 5FJ4C 1VQ5F 4BVQA 3HWUA 5GONA 1GO1A 5FLXM 5HP8A 1U3LA 3IMPA 5MN4A 2L26A 4X1KA 3I55F 3NMUC 3WJQA 1PF5A 4I55B 1NQ3A 3CCJF 2HP3A 3N2KA 2MQEA 5EYPA 1VQ6F 1RQ2A 2EWCA 3JAKA 1VQ9F 3RYHA 1W42A 3VTIC 2VGMA 5J2TB 3I7TA 2IQQA 2P6YA 5HY1A 1YITF 3HJWC 4G88A 3P4EA 3NVKE 4EB6B 2Z01A 3QUWA 3RYCA 4LNUB 1FNKA 3LDTA 2WALA 3G4SF 3U0OA 1JY8A 3L7QA 1W5BA 5EWRA 1X7PA 2BTQB 3V7QA 2IG8A 1W40A 4G4XA 3R0PA 5EO3A 3CG6A 1X52A 3IKFA 5CB4A 3JAMM 5JH7A 4F6RB 3C9RA 1Z5VA 5GANK 4O2BB 1YQNA 2IAFA 3F0EA 3Q8HA 4NWOB 2H6LA 4C82A 2HRUA 3WGJA 4YJ3B 1W5EA 4X1KB 1VH8A 5JQGB 2ALEA 1FNJA 3CB2A 3WJPA 2Z1TA 3LWVC 4HNAB 3LWOC 3N2KB 2VAWA 2YXZA 3VI6A 4IIJA 4RHAA 2LCAA 1N8RH 3M84A 5EYPB 3N4YA 4EI9A 3TD3A 4TV9B 1K8AH 5LOVA 1W41A 1YJWF 3IEWA 3S0HA 4BT7A 1IV4A 3J81M 3HAXD 2OHWA 1VQNF 1UI9A 4FFBA 2B33A 3JALA 5ITZA 3BYQA 1E7KA 2ZODA 1VQOF 3D00A 2G9IA 2AIZP 1K73H 1JFFB 3J7AR 1W57A 1U3PA 2RHHA 3IR9A 2BO1A 3M1XA 2UYNB 1ONIA 1W581 5CB4B 4X1IA 5JH7B 5J2UA 4BT2A 3RYFA 1YI2F 1KQSF 2Z1EA 2Q1YA 4DXDA 4EI7A 2BTUA 3QTYA 2HP0A 3LWQC 1ODEA 3VYSC 5A2QM 2CHSA 3F0FA 4O4LA 4C8EA 2ZAUA 4ZHVA 3NVIB 3VO8A 1K9MH 3CCRF 1J7HA 2HS4A 5CA1B 4IIJB 2N48A 4X1YA 5HXZA 3LWRC 1VHAA 3JAWB 5LA6A 2OTMA 1M90H 1Z5WA 2VAMA 2CWJA 4I50A 1ZWZA 3JALB 1IV2A 4R40B 4DRXA 2GZLA 4ZHQB 5ITZB 1VQ8F 1QAHA 1VQPF 4U3JA 5BMVB 1VK3A 5CA0A 1RA4A 4C8GA 1CN7A 4ZK7A 3OW2F 4EI8A 3DDNA 1W55A 4B46A 4YJ2A 1KNKA 1DT9A 3B6NA 4X1IB 3RYFB 5KX5A 3V3TA 4G4WA 4I4TA 2I6DA 2UYPA 4O4JA 3M4SA 3E1YA 4O4HB 3ZP4A 5FNVA 1YHQF 2KG4A 3S0WA 1YIJF 2LBTA 3MQWA 2UZHA 4G4ZA 3CCVF 4X1YB 3N2GB 3CPWF 4XCQA 5LA6B 1NJIH 3FBAA 2W8BC 5C8YA 4ZHYB 2OTLF 3UT5A 5IT9M 2JNBA 2CZWA 2UYKA 1X25A 3F0DA 3HKCB 4U3JB 3SIVA 5IJ9A 3C8LA 4B62A 4WBNA 3E22A 1TUBA 1Q86H 2NMUA 3CCMF 2H8CA 1VQ4F 5GONB 4B5CA 4O4IA 3CCUF 4NUTA 1GO0A
chains in the Genus database with same CATH topology
1H7MA 1PXWA 2OZBA 3J7AR 5HY0A 1Q82H 3MCAB 3LFOA 4NQ3A 3IR9A 2BO1A 4LCKA 1Q7YH 1W3EX 2GLZA 3CXCF 1VQLF 3I56F 2KTVA 3WXMB 3CMEF 1YI2F 1KQSF 1YJ9F 4EI7A 3CCEF 3LWQC 5A2QM 3E20B 1S72F 5FJ4C 1VQ5F 3FFMA 4X3MA 3RA5A 4BVQA 1KD1H 2F9ZC 1GO1A 5FLXM 3NVIB 1K9MH 3CCRF 4BY9D 1W2BF 3SIUA 3I55F 3NMUC 1NMUB 3PLAC 3OBWA 3CCJF 1IPAA 1JJ2F 5HXZA 3LWRC 2QI2A 1QVFF 1M90H 2KTUA 3GYQA 1VQ6F 1VQ7F 2VGNA 1ZWZA 1VQ9F 3VMFB 1W42A 1RLGA 2VGMA 1VQ8F 3JCMM 1VQPF 1T0KB 3G71F 5GIPC 1CK2A 1X7OA 4BVSA 3ON1A 5HY2A 3CCQF 1RA4A 5HY1A 1YITF 5HXUA 3HJWC 1SDSA 5G4UC 3NVKE 3OW2F 1CN7A 4TZZA 4EI8A 2FGYA 3CCLF 2WALA 3G4SF 3V7EA 3OBYA 2QEXF 1VQMF 3CC7F 1DT9A 5EWRA 1VQKF 1X7PA 3V7QA 3RA6A 4BVTA 3NK6A 5HY4A 3G6EF 1W40A 5EO3A 3CG6A 1X52A 3NK7A 5G4VC 3V3TA 3JAMM 1XBIA 5GANK 2I6DA 3O85A 4C4WC 3CCSF 4BW0B 4BVRA 3E1YA 3N4ZA 5GINC 1YHQF 1QVGF 3J80M 2LBXA 3CPQA 2KG4A 5GIOC 2ALEA 5HWEA 1YJNF 1YIJF 3CMAF 5DCVA 3LWVC 3CCVF 3CD6F 3CPWF 1Q81H 1KC8H 3LWOC 2FC3A 4XCQA 3LWPC 1NJIH 3CC4F 3VI6A 3CC2F 1N8RH 2HVYD 2OTLF 3N4YA 4EI9A 1K8AH 1W41A 5IT9M 2JNBA 1YJWF 2CZWA 5GAPK 1M1KH 2LBWA 3J81M 3HAXD 2OHWA 1VQNF 3SIVA 1GZ0A 1Q86H 1E7KA 2AIFA 3CCMF 1VQOF 3D00A 1VQ4F 4X3LA 3CCUF 1K73H 3AGKA 4NUTA 3PAFA 2OTJF 1GO0A 2QA4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7M A;  1PXW A;  2OZB A;  3J7A R;  1Q82 H;  3MCA B;  3LFO A;  3IR9 A;  2BO1 A;  4LCK A;  1Q7Y H;  1W3E X;  3CXC F;  1VQL F;  3I56 F;  2KTV A;  3WXM B;  3CME F;  1YI2 F;  1KQS F;  1YJ9 F;  3CCE F;  3LWQ C;  5A2Q M;  3E20 B;  1S72 F;  5FJ4 C;  1VQ5 F;  3FFM A;  4X3M A;  3RA5 A;  1KD1 H;  1GO1 A;  5FLX M;  3NVI B;  1K9M H;  3CCR F;  4BY9 D;  1W2B F;  3SIU A;  3I55 F;  3NMU C;  1NMU B;  3PLA C;  3OBW A;  3CCJ F;  1IPA A;  1JJ2 F;  3LWR C;  2QI2 A;  1QVF F;  1M90 H;  2KTU A;  3GYQ A;  1VQ6 F;  1VQ7 F;  2VGN A;  1ZWZ A;  1VQ9 F;  3VMF B;  1W42 A;  1RLG A;  2VGM A;  1VQ8 F;  3JCM M;  1VQP F;  1T0K B;  3G71 F;  5GIP C;  1CK2 A;  1X7O A;  3ON1 A;  3CCQ F;  1RA4 A;  1YIT F;  3HJW C;  1SDS A;  5G4U C;  3NVK E;  3OW2 F;  1CN7 A;  4TZZ A;  3CCL F;  2WAL A;  3G4S F;  3V7E A;  3OBY A;  2QEX F;  1VQM F;  3CC7 F;  1DT9 A;  5EWR A;  1VQK F;  1X7P A;  3V7Q A;  3RA6 A;  3NK6 A;  3G6E F;  1W40 A;  5EO3 A;  3CG6 A;  1X52 A;  3NK7 A;  5G4V C;  3JAM M;  1XBI A;  5GAN K;  2I6D A;  3O85 A;  4C4W C;  3CCS F;  4BW0 B;  3E1Y A;  3N4Z A;  5GIN C;  1YHQ F;  1QVG F;  3J80 M;  2LBX A;  3CPQ A;  2KG4 A;  5GIO C;  2ALE A;  1YJN F;  1YIJ F;  3CMA F;  5DCV A;  3LWV C;  3CCV F;  3CD6 F;  3CPW F;  1Q81 H;  1KC8 H;  3LWO C;  2FC3 A;  1NJI H;  3LWP C;  3CC4 F;  3VI6 A;  3CC2 F;  1N8R H;  2HVY D;  2OTL F;  3N4Y A;  1K8A H;  1W41 A;  5IT9 M;  2JNB A;  1YJW F;  2CZW A;  5GAP K;  1M1K H;  2LBW A;  3J81 M;  3HAX D;  2OHW A;  1VQN F;  3SIV A;  1GZ0 A;  1Q86 H;  1E7K A;  2AIF A;  3CCM F;  1VQO F;  1VQ4 F;  4X3L A;  3CCU F;  1K73 H;  3AGK A;  4NUT A;  3PAF A;  2OTJ F;  1GO0 A;  2QA4 F; 
#chains in the Genus database with same CATH topology
 5EZY A;  3RE3 A;  3MCA B;  3WGN A;  3K0T A;  3S03 A;  1Q7Y H;  1W3E X;  3FD6 A;  2RHL A;  5KX5 B;  3JAK B;  2ZVY A;  1OFU A;  5JCO A;  4I4T B;  2KTV A;  3RYH B;  1VQL F;  5EIB C;  2R6R 1;  3WXM B;  2HQS C;  3CCE F;  5JCO C;  3E20 B;  4O2A A;  3ESJ A;  4X3M A;  3JAS A;  3RA5 A;  2HX0 A;  3EOR A;  1KD1 H;  3RYC B;  2HS0 A;  3KE1 A;  4M8I A;  2I6R A;  5KMG A;  4BY9 D;  1QU9 A;  1W2B F;  3JVH A;  3PLA C;  5IJ0 A;  3OBW A;  3WJR A;  5C8Y B;  1JJ2 F;  3T80 A;  3HKB A;  3UT5 B;  3P10 A;  2R75 1;  1U40 A;  2BTO A;  2ZF8 A;  1UFY A;  2KTU A;  3GYQ A;  4B45 A;  3LME A;  4BT6 A;  1VQ7 F;  5IJ9 B;  4WBN B;  3JCM M;  3E22 B;  3VOA A;  1TUB B;  3G71 F;  1H48 A;  3RYI A;  1X7O A;  3S0Y A;  4IHJ A;  4BVS A;  5HY2 A;  2Z1U A;  4O4I B;  5HXU A;  1COM A;  5G4U C;  3C9S A;  3CYQ A;  4TZZ A;  3K12 A;  2KGW A;  3CCL F;  5EZY B;  3CC7 F;  1VQK F;  3RA6 A;  3NK6 A;  1SZQ A;  4ZI7 A;  5HP7 A;  5LOV B;  3G6E F;  3GHZ A;  1YGY A;  3NK7 A;  3D54 A;  5EIB D;  4FFB B;  3S06 A;  3P0Z A;  2Z1F A;  3TD4 A;  3MBM A;  1Q8R A;  4O2A B;  3CCS F;  2HRY A;  3JAS B;  4X20 A;  4BW0 B;  5EAZ A;  3JAT A;  3VYT C;  2RHJ A;  3VIU A;  5GIN C;  5KMG B;  1QVG F;  3J80 M;  2LBX A;  3MCQ A;  4TUY A;  4EB6 A;  5B8F A;  1YJN F;  4LNU A;  5IJ0 B;  5DCV A;  1KC8 H;  1GX1 A;  3HKD A;  3CC4 F;  3CC2 F;  1OAP A;  3KHN A;  3KJK A;  3ERN A;  3F6M A;  5J2U B;  5GAP K;  1RLU A;  5EB1 B;  1VQV A;  3IEQ A;  3RYI B;  2HP0 B;  4IHJ B;  4O2B A;  1GZ0 A;  4O4L B;  4KWE A;  4YJ3 A;  1SA0 A;  3ELC A;  5JQG A;  1JD1 A;  3PAF A;  4BT3 A;  1W59 A;  3C9U A;  4HNA A;  3HTN A;  4ZI7 B;  2ZVZ A;  3QHD A;  3ZP7 A;  2K1S A;  4I50 B;  4TV9 A;  3VOB A;  2Q1X A;  3I56 F;  4DRX B;  2CVL A;  2CSL A;  4X20 B;  3FPI A;  2VAP A;  3JAT B;  5CA0 B;  1S72 F;  1FSZ A;  3FFM A;  3C9T A;  4TUY B;  2F9Z C;  1JN1 A;  3SIU A;  3HKD B;  4YJ2 B;  1JFF A;  1NMU B;  2H8E A;  3WPX A;  1IPA A;  2PHN A;  2QI2 A;  2UYJ A;  1DBF A;  1QVF F;  5LP6 A;  4E6E A;  2CHT A;  4ZOL A;  2UYN A;  5LYJ A;  2VGN A;  1CLI A;  2ZOV A;  3VMF B;  3FD5 A;  5LP6 C;  3K2X A;  1RLG A;  3WPW A;  3WGM A;  1T0K B;  5GIP C;  1CK2 A;  2CW4 A;  4O4J B;  3ZO8 A;  4C8I A;  2RB9 A;  3ON1 A;  3CCQ F;  5FNV B;  1SA0 B;  1SDS A;  2AMT A;  3V4D A;  2FGY A;  2DYY A;  5AVM A;  3V7E A;  3OBY A;  3GTZ A;  2QEX F;  1VQM F;  5CA1 A;  4G4V A;  4BVT A;  1FFX A;  3JAR A;  3F0G A;  5HY4 A;  1H47 A;  3JAW A;  3HKE A;  5LXT A;  3KIZ A;  3DC2 A;  3MDO A;  3TD5 A;  5MN5 A;  5G4V C;  5JVD A;  1W5F A;  1XBI A;  4G4Y A;  4C4W C;  3O85 A;  4PWT A;  4ZHQ A;  5BMV A;  4BT4 A;  1TVK A;  4BVR A;  1W5A A;  5IYZ A;  2GVI A;  2V9Y A;  3N4Z A;  2QTP A;  4TV8 A;  3CPQ A;  5GIO C;  5HWE A;  3KJJ A;  3CMA F;  3LYB A;  3CD6 F;  3CYP B;  1Q81 H;  2FC3 A;  4BT5 A;  3LWP C;  5LP6 B;  4I55 A;  4ZOL B;  3WGK A;  2HVY D;  5LYJ B;  3VYU C;  3K14 A;  1M1K H;  2RHO A;  4ERH A;  2LBW A;  5MN6 A;  1R1M A;  2VXY A;  4U39 A;  1QD9 A;  2AIF A;  2YYE A;  5J2T A;  3IKE A;  4O4H A;  4X3L A;  1XHO A;  1KNJ A;  2HS3 A;  3AGK A;  1XRG A;  2OTJ F;  3I3F A;  2QA4 F;  1H7M A;  2DT4 A;  1PXW A;  2PMP A;  4C81 A;  1T0A A;  3VCZ A;  1FFX B;  3JAR B;  5HY0 A;  1Q82 H;  3HKB B;  3N2G A;  2OZB A;  3LFO A;  3HKE B;  1IV3 A;  5LXT B;  4NQ3 A;  4ZHW A;  3S02 A;  1XV2 A;  4LCK A;  2GLZ A;  3D01 A;  3CXC F;  5JVD B;  1RQ7 A;  1IV1 A;  3ZOP A;  3CME F;  4RQO A;  3HKC A;  5EB0 A;  1YJ9 F;  1TVK B;  4F6R A;  5IYZ B;  3WGL A;  1U43 A;  4TV8 B;  3OON A;  5FJ4 C;  1VQ5 F;  4BVQ A;  3HWU A;  5GON A;  1GO1 A;  5FLX M;  5HP8 A;  1U3L A;  3IMP A;  5MN4 A;  2L26 A;  4X1K A;  3I55 F;  3NMU C;  3WJQ A;  1PF5 A;  4I55 B;  1NQ3 A;  3CCJ F;  2HP3 A;  3N2K A;  2MQE A;  5EYP A;  1VQ6 F;  1RQ2 A;  2EWC A;  3JAK A;  1VQ9 F;  3RYH A;  1W42 A;  3VTI C;  2VGM A;  5J2T B;  3I7T A;  2IQQ A;  2P6Y A;  5HY1 A;  1YIT F;  3HJW C;  4G88 A;  3P4E A;  3NVK E;  4EB6 B;  2Z01 A;  3QUW A;  3RYC A;  4LNU B;  1FNK A;  3LDT A;  2WAL A;  3G4S F;  3U0O A;  1JY8 A;  3L7Q A;  1W5B A;  5EWR A;  1X7P A;  2BTQ B;  3V7Q A;  2IG8 A;  1W40 A;  4G4X A;  3R0P A;  5EO3 A;  3CG6 A;  1X52 A;  3IKF A;  5CB4 A;  3JAM M;  5JH7 A;  4F6R B;  3C9R A;  1Z5V A;  5GAN K;  4O2B B;  1YQN A;  2IAF A;  3F0E A;  3Q8H A;  4NWO B;  2H6L A;  4C82 A;  2HRU A;  3WGJ A;  4YJ3 B;  1W5E A;  4X1K B;  1VH8 A;  5JQG B;  2ALE A;  1FNJ A;  3CB2 A;  3WJP A;  2Z1T A;  3LWV C;  4HNA B;  3LWO C;  3N2K B;  2VAW A;  2YXZ A;  3VI6 A;  4IIJ A;  4RHA A;  2LCA A;  1N8R H;  3M84 A;  5EYP B;  3N4Y A;  4EI9 A;  3TD3 A;  4TV9 B;  1K8A H;  5LOV A;  1W41 A;  1YJW F;  3IEW A;  3S0H A;  4BT7 A;  1IV4 A;  3J81 M;  3HAX D;  2OHW A;  1VQN F;  1UI9 A;  4FFB A;  2B33 A;  3JAL A;  5ITZ A;  3BYQ A;  1E7K A;  2ZOD A;  1VQO F;  3D00 A;  2G9I A;  2AIZ P;  1K73 H;  1JFF B;  3J7A R;  1W57 A;  1U3P A;  2RHH A;  3IR9 A;  2BO1 A;  3M1X A;  2UYN B;  1ONI A;  1W58 1;  5CB4 B;  4X1I A;  5JH7 B;  5J2U A;  4BT2 A;  3RYF A;  1YI2 F;  1KQS F;  2Z1E A;  2Q1Y A;  4DXD A;  4EI7 A;  2BTU A;  3QTY A;  2HP0 A;  3LWQ C;  1ODE A;  3VYS C;  5A2Q M;  2CHS A;  3F0F A;  4O4L A;  4C8E A;  2ZAU A;  4ZHV A;  3NVI B;  3VO8 A;  1K9M H;  3CCR F;  1J7H A;  2HS4 A;  5CA1 B;  4IIJ B;  2N48 A;  4X1Y A;  5HXZ A;  3LWR C;  1VHA A;  3JAW B;  5LA6 A;  2OTM A;  1M90 H;  1Z5W A;  2VAM A;  2CWJ A;  4I50 A;  1ZWZ A;  3JAL B;  1IV2 A;  4R40 B;  4DRX A;  2GZL A;  4ZHQ B;  5ITZ B;  1VQ8 F;  1QAH A;  1VQP F;  4U3J A;  5BMV B;  1VK3 A;  5CA0 A;  1RA4 A;  4C8G A;  1CN7 A;  4ZK7 A;  3OW2 F;  4EI8 A;  3DDN A;  1W55 A;  4B46 A;  4YJ2 A;  1KNK A;  1DT9 A;  3B6N A;  4X1I B;  3RYF B;  5KX5 A;  3V3T A;  4G4W A;  4I4T A;  2I6D A;  2UYP A;  4O4J A;  3M4S A;  3E1Y A;  4O4H B;  3ZP4 A;  5FNV A;  1YHQ F;  2KG4 A;  3S0W A;  1YIJ F;  2LBT A;  3MQW A;  2UZH A;  4G4Z A;  3CCV F;  4X1Y B;  3N2G B;  3CPW F;  4XCQ A;  5LA6 B;  1NJI H;  3FBA A;  2W8B C;  5C8Y A;  4ZHY B;  2OTL F;  3UT5 A;  5IT9 M;  2JNB A;  2CZW A;  2UYK A;  1X25 A;  3F0D A;  3HKC B;  4U3J B;  3SIV A;  5IJ9 A;  3C8L A;  4B62 A;  4WBN A;  3E22 A;  1TUB A;  1Q86 H;  2NMU A;  3CCM F;  2H8C A;  1VQ4 F;  5GON B;  4B5C A;  4O4I A;  3CCU F;  4NUT A;  1GO0 A; 
#chains in the Genus database with same CATH homology
 1H7M A;  1PXW A;  2OZB A;  3J7A R;  5HY0 A;  1Q82 H;  3MCA B;  3LFO A;  4NQ3 A;  3IR9 A;  2BO1 A;  4LCK A;  1Q7Y H;  1W3E X;  2GLZ A;  3CXC F;  1VQL F;  3I56 F;  2KTV A;  3WXM B;  3CME F;  1YI2 F;  1KQS F;  1YJ9 F;  4EI7 A;  3CCE F;  3LWQ C;  5A2Q M;  3E20 B;  1S72 F;  5FJ4 C;  1VQ5 F;  3FFM A;  4X3M A;  3RA5 A;  4BVQ A;  1KD1 H;  2F9Z C;  1GO1 A;  5FLX M;  3NVI B;  1K9M H;  3CCR F;  4BY9 D;  1W2B F;  3SIU A;  3I55 F;  3NMU C;  1NMU B;  3PLA C;  3OBW A;  3CCJ F;  1IPA A;  1JJ2 F;  5HXZ A;  3LWR C;  2QI2 A;  1QVF F;  1M90 H;  2KTU A;  3GYQ A;  1VQ6 F;  1VQ7 F;  2VGN A;  1ZWZ A;  1VQ9 F;  3VMF B;  1W42 A;  1RLG A;  2VGM A;  1VQ8 F;  3JCM M;  1VQP F;  1T0K B;  3G71 F;  5GIP C;  1CK2 A;  1X7O A;  4BVS A;  3ON1 A;  5HY2 A;  3CCQ F;  1RA4 A;  5HY1 A;  1YIT F;  5HXU A;  3HJW C;  1SDS A;  5G4U C;  3NVK E;  3OW2 F;  1CN7 A;  4TZZ A;  4EI8 A;  2FGY A;  3CCL F;  2WAL A;  3G4S F;  3V7E A;  3OBY A;  2QEX F;  1VQM F;  3CC7 F;  1DT9 A;  5EWR A;  1VQK F;  1X7P A;  3V7Q A;  3RA6 A;  4BVT A;  3NK6 A;  5HY4 A;  3G6E F;  1W40 A;  5EO3 A;  3CG6 A;  1X52 A;  3NK7 A;  5G4V C;  3V3T A;  3JAM M;  1XBI A;  5GAN K;  2I6D A;  3O85 A;  4C4W C;  3CCS F;  4BW0 B;  4BVR A;  3E1Y A;  3N4Z A;  5GIN C;  1YHQ F;  1QVG F;  3J80 M;  2LBX A;  3CPQ A;  2KG4 A;  5GIO C;  2ALE A;  5HWE A;  1YJN F;  1YIJ F;  3CMA F;  5DCV A;  3LWV C;  3CCV F;  3CD6 F;  3CPW F;  1Q81 H;  1KC8 H;  3LWO C;  2FC3 A;  4XCQ A;  3LWP C;  1NJI H;  3CC4 F;  3VI6 A;  3CC2 F;  1N8R H;  2HVY D;  2OTL F;  3N4Y A;  4EI9 A;  1K8A H;  1W41 A;  5IT9 M;  2JNB A;  1YJW F;  2CZW A;  5GAP K;  1M1K H;  2LBW A;  3J81 M;  3HAX D;  2OHW A;  1VQN F;  3SIV A;  1GZ0 A;  1Q86 H;  1E7K A;  2AIF A;  3CCM F;  1VQO F;  3D00 A;  1VQ4 F;  4X3L A;  3CCU F;  1K73 H;  3AGK A;  4NUT A;  3PAF A;  2OTJ F;  1GO0 A;  2QA4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...