3CCRF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccrF00
1H7MA 3NMUC 3N4ZA 3CCQF 3CCVF 3LWQC 3CCMF 2KG4A 2CZWA 3J7AR 3E20B 2FC3A 3HAXD 3IR9A 4BY9D 1VQ4F 3CPWF 1X7OA 2QEXF 1VQMF 1W40A 1VQ9F 1CN7A 2LBWA 3V7EA 2HVYD 3J81M 1ZWZA 3CCJF 1VQ8F 3VI6A 1M90H 1DT9A 1Q82H 2OZBA 4LCKA 2KTVA 1GZ0A 1XBIA 1W42A 3N4YA 1QVFF 1GO0A 1Q81H 1S72F 3G4SF 2QA4F 1M1KH 3PAFA 3LFOA 3JAMM 2I6DA 3G71F 3GYQA 1E7KA 3NK7A 1VQOF 1YJ9F 1KD1H 3CCEF 1K8AH 1IPAA 1Q7YH 5FJ4C 3CCSF 2BO1A 3CCUF 2QI2A 3VMFB 3OW2F 1T0KB 5GAPK 2ALEA 3NVKE 5IT9M 2OHWA 5DCVA 3SIUA 3PLAC 3CD6F 3RA6A 3LWPC 3AGKA 1JJ2F 3J80M 3G6EF 3CMEF 1NMUB 4BW0B 1X7PA 1QVGF 5GINC 5GIPC 2VGNA 3CPQA 1RA4A 2LBXA 1VQPF 1VQ7F 5GIOC 4TZZA 2KTUA 1YIJF 1VQLF 5A2QM 1NJIH 3OBYA 1Q86H 3ON1A 3LWRC 5GANK 4X3LA 4X3MA 5FLXM 3I55F 3CC2F 1YHQF 3CG6A 3CXCF 3LWOC 2JNBA 4C4WC 1K73H 3SIVA 2AIFA 3MCAB 3V7QA 1SDSA 2OTLF 2WALA 1CK2A 5EO3A 3LWVC 3CC7F 3CC4F 3OBWA 1VQNF 5G4VC 3JCMM 1X52A 4NUTA 5EWRA 1W3EX 1KC8H 3NVIB 3FFMA 1VQKF 1W41A 3O85A 3NK6A 1PXWA 3CCRF 1GO1A 1YJWF 1YI2F 3CMAF 1VQ5F 1YJNF 3RA5A 3CCLF 2OTJF 1RLGA 3HJWC 2VGMA 3WXMB 1W2BF 1KQSF 5G4UC 1K9MH 1YITF 3E1YA 1N8RH 3I56F 1VQ6F
chains in the Genus database with same CATH superfamily
1H7MA 2RHOA 4WBNB 3NMUC 4C81A 5AVMA 4O4IA 3RYIB 3CCMF 1FFXA 4ERHA 2HS3A 2CWJA 1YGYA 4O4JB 1VQ4F 1JFFB 2CSLA 3CPWF 1W57A 2QEXF 1VQ9F 4B46A 4G4YA 2LBWA 3IEWA 4U3JA 2BTQB 1VQ8F 2ZVYA 3JVHA 3VI6A 5HXUA 2OZBA 2UYPA 1GZ0A 3N4YA 1H47A 2LCAA 1GO0A 3RYCB 1Q81H 3G4SF 2B33A 2QA4F 4O4JA 3S0WA 5JVDB 5HY1A 1E7KA 3WPXA 1DBFA 2Z1UA 3CCEF 1TUBB 3S02A 4G4ZA 5EIBD 5HXZA 4X1KB 3M1XA 4ZK7A 2Z1EA 5BMVB 4BT3A 1VHAA 3CCUF 3VMFB 2GZLA 1T0KB 2HRYA 5IT9M 4RQOA 3WPWA 2HS0A 2OTMA 3JAWA 3AGKA 3V3TA 4ZHQA 4B45A 3LWPC 2UYKA 3QTYA 4O2BA 3J80M 3F6MA 4BVQA 5LYJA 4B5CA 3JATB 4BT7A 4BT2A 5EIBC 3K14A 3ZP7A 1TUBA 3FD5A 4RHAA 3CPQA 4O2AA 1RA4A 3WJQA 2BTUA 5CA0B 1YIJF 3M84A 1W59A 4X1IB 1U40A 3ON1A 3K0TA 4ZHQB 3IKEA 3I55F 3RYFB 3CXCF 1VQVA 2NMUA 2UYNA 3VYTC 3GHZA 3SIVA 2AIFA 1SDSA 3TD3A 2Z1TA 4BT5A 3VOBA 2HP0A 5EAZA 4HNAB 5IJ9B 3LWVC 3CC4F 1SZQA 3WGKA 1X52A 3JARB 3Q8HA 2PMPA 5EWRA 3ELCA 1KC8H 1RLUA 4DXDA 4O4IB 3HWUA 1QD9A 1W41A 5HP8A 3UT5A 1GO1A 4I50B 3P4EA 1FSZA 4U39A 5J2TA 5KX5A 3MBMA 3JARA 5EZYB 2IAFA 4I55A 2VXYA 4O4HA 1YITF 4EB6A 4NWOB 3TD5A 5JVDA 3UT5B 3LWQC 2KG4A 2CZWA 2DYYA 5CB4B 4I55B 3WJRA 1GX1A 2ZF8A 5FNVB 3JAWB 1U3LA 1M90H 3HKBA 2G9IA 2KTVA 3LMEA 4TV8A 4EI8A 2H8EA 1S72F 5HP7A 1M1KH 3PAFA 3RYHB 5LP6A 3JAKA 3LFOA 3MCQA 2VAMA 2RHLA 3V4DA 4O2AB 3NK7A 1VQOF 1NQ3A 1YJ9F 5HY0A 5ITZA 5GONA 1IPAA 1U43A 5KMGB 1Q7YH 1YQNA 2BO1A 3DDNA 3JALB 2P6YA 3KJJA 5B8FA 2ALEA 5HY2A 2UYNB 2DT4A 3SIUA 4DRXA 2HP3A 3KJKA 1Z5WA 4BW0B 3RYIA 1QAHA 4HNAA 4TUYA 2VAPA 3HKEA 2LBXA 4G4VA 2CW4A 3CB2A 1Q86H 2Z01A 2HX0A 5GANK 3ZO8A 4X3LA 3LWRC 2CVLA 4TV9A 3CG6A 5HY4A 3LWOC 3F0EA 3OONA 5MN5A 3C8LA 2CHTA 1T0AA 4IIJB 3D54A 2OTLF 1JN1A 1W55A 5LA6B 1CK2A 2K1SA 2RHJA 4O4HB 1IV2A 3N2KB 2ZODA 3HKCA 3ERNA 2R6R1 3FD6A 4I4TA 5G4VC 1JFFA 3K12A 3WGJA 4NUTA 1W3EX 4YJ2A 4U3JB 3FFMA 4LNUA 4O4LB 5CB4A 1J7HA 3QHDA 2LBTA 3O85A 3F0DA 5LA6A 3N2GA 5J2UA 3RYCA 4C8IA 1KNKA 3E22A 1YI2F 3K2XA 3VIUA 5FNVA 1XHOA 1VQ5F 4TV8B 2RB9A 2R751 2IQQA 3RA5A 3RYFA 2FGYA 2OTJF 1W581 3WXMB 5EYPB 5MN6A 1W2BF 3MQWA 3E1YA 4NQ3A 3VO8A 3I56F 1VQ6F 4X1KA 1Q8RA 5KMGA 3N4ZA 3B6NA 3CCQF 1ODEA 5ITZB 1IV3A 3KHNA 3ZP4A 2ZVZA 3HAXD 4BY9D 4G4XA 1X7OA 4DRXB 1W40A 1CN7A 4O2BB 3C9UA 3V7EA 4IHJA 3J81M 4ZHYB 1XBIA 1W42A 1QVFF 2YXZA 5JQGA 3C9SA 3HKDA 3JAMM 3HKEB 5LP6C 2HQSC 1KD1H 2F9ZC 4I50A 5IJ0A 1SA0B 4G4WA 5JCOC 4X20B 2PHNA 3C9TA 5GAPK 1RQ2A 3S06A 4FFBA 1X25A 2H6LA 4ZOLA 5EB1B 4EB6B 5DCVA 2I6RA 1RQ7A 2N48A 3CD6F 1KNJA 4YJ3A 3DC2A 3IEQA 3WGLA 1FNJA 3CMEF 1NMUB 3F0FA 5GINC 5GIPC 2VGNA 4X1YA 4ZI7B 1VQPF 1PF5A 5GIOC 4TZZA 2KTUA 1VQ7F 5A2QM 3OBYA 1CLIA 4EI9A 1QU9A 2BTOA 1IV4A 4LNUB 1U3PA 4BT6A 1UFYA 1YHQF 2MQEA 3RE3A 1W5EA 5LXTB 5BMVA 4C4WC 4G88A 5MN4A 3FBAA 1K73H 2Q1YA 3N2GB 1R1MA 5JCOA 5J2UB 3I3FA 1Z5VA 1ONIA 3TD4A 2H8CA 3LYBA 3R0PA 3I7TA 3ZOPA 1OFUA 5EO3A 3CC7F 2ZAUA 3OBWA 5IYZA 1VQNF 5LXTA 1IV1A 1W5FA 5CA0A 1W5AA 2AMTA 3EORA 4X1IA 3HTNA 2AIZP 3WGNA 2ZOVA 3IKFA 5LOVA 1PXWA 5CA1B 3CCRF 1YJWF 4BVSA 4BVTA 4C8EA 3JAKB 3CMAF 2GVIA 2GLZA 4TV9B 3RYHA 5LP6B 3M4SA 3HJWC 3VYSC 1FNKA 2UZHA 1KQSF 1K9MH 5G4UC 2W8BC 1OAPA 5IJ9A 3QUWA 1W5BA 2HP0B 5IJ0B 4F6RB 4X20A 3JATA 3CCVF 5CA1A 5C8YB 1SA0A 3C9RA 3J7AR 3E20B 4R40B 2FC3A 5JH7B 3IR9A 2IG8A 3U0OA 1VQMF 1H48A 2KGWA 2HVYD 1ZWZA 3CCJF 1DT9A 3JASB 3VTIC 1Q82H 4LCKA 3MDOA 5JH7A 4F6RA 4ZI7A 4EI7A 2I6DA 3G71F 3GYQA 5J2TB 4X1YB 2YYEA 3KIZA 1K8AH 1FFXB 1VH8A 4WBNA 5EZYA 2CHSA 2V9YA 3IMPA 5FJ4C 3CCSF 2QI2A 3OW2F 5EYPA 3NVKE 5EB0A 2OHWA 3PLAC 3F0GA 3N2KA 3RA6A 3VOAA 1JJ2F 1TVKA 3P10A 4I4TB 3G6EF 2Q1XA 1X7PA 1QVGF 3FPIA 4YJ2B 1JD1A 4O4LA 3D01A 1VQLF 4C82A 5IYZB 3HKBB 1NJIH 3KE1A 1TVKB 4PWTA 4X3MA 5KX5B 5FLXM 3CC2F 3D00A 3S0YA 4B62A 2JNBA 1VK3A 2EWCA 3E22B 4BVRA 1UI9A 3VCZA 2HRUA 3JALA 3VYUC 1XV2A 4XCQA 1XRGA 3MCAB 3V7QA 5LYJB 3S03A 2VAWA 3BYQA 2QTPA 3WGMA 3GTZA 5LOVB 3L7QA 3T80A 2WALA 3P0ZA 2RHHA 4ZHVA 4C8GA 2HS4A 4FFBB 4ZOLB 5HWEA 3JCMM 4KWEA 4YJ3B 3WJPA 4M8IA 4TUYB 3NVIB 4IHJB 2Z1FA 1VQKF 2L26A 5C8YA 3NK6A 5JQGB 3LDTA 4ZHWA 4IIJA 5GONB 3HKDB 3CYQA 2UYJA 1YJNF 1JY8A 4BT4A 3CCLF 3JASA 4E6EA 1RLGA 3ESJA 2VGMA 3CYPB 3S0HA 1N8RH 1COMA 3HKCB
chains in the Genus database with same CATH topology
1H7MA 3NMUC 3N4ZA 3CCQF 3CCVF 3LWQC 3CCMF 2KG4A 2CZWA 3J7AR 3E20B 2FC3A 3HAXD 3IR9A 4BY9D 1VQ4F 3CPWF 1X7OA 2QEXF 1VQMF 1W40A 1VQ9F 1CN7A 2LBWA 3V7EA 2HVYD 3J81M 1ZWZA 3CCJF 1VQ8F 3VI6A 1M90H 1DT9A 5HXUA 1Q82H 2OZBA 4LCKA 3N4YA 1GZ0A 1XBIA 1W42A 2KTVA 1QVFF 1GO0A 4EI8A 1Q81H 1S72F 3G4SF 2QA4F 1M1KH 3PAFA 3LFOA 3JAMM 4EI7A 2I6DA 3G71F 3GYQA 5HY1A 1E7KA 3NK7A 1VQOF 1YJ9F 5HY0A 1KD1H 2F9ZC 3CCEF 1K8AH 1IPAA 5HXZA 1Q7YH 5FJ4C 3CCSF 2BO1A 3CCUF 2QI2A 3VMFB 3OW2F 1T0KB 5GAPK 2ALEA 3NVKE 5IT9M 2OHWA 5HY2A 5DCVA 3SIUA 3PLAC 3CD6F 3RA6A 3V3TA 3LWPC 3AGKA 1JJ2F 3J80M 3G6EF 4BVQA 3CMEF 1NMUB 4BW0B 1X7PA 1QVGF 5GINC 5GIPC 2VGNA 3CPQA 1RA4A 2LBXA 1VQPF 1VQ7F 5GIOC 4TZZA 2KTUA 1YIJF 1VQLF 5A2QM 1NJIH 3OBYA 1Q86H 3ON1A 4EI9A 3LWRC 5GANK 4X3LA 4X3MA 5FLXM 3I55F 3CC2F 1YHQF 3CG6A 3D00A 3CXCF 5HY4A 3LWOC 2JNBA 4BVRA 4C4WC 1K73H 3SIVA 4XCQA 2AIFA 3MCAB 3V7QA 1SDSA 2OTLF 2WALA 1CK2A 5EO3A 3LWVC 3CC7F 3CC4F 3OBWA 5HWEA 1VQNF 5G4VC 3JCMM 1X52A 4NUTA 5EWRA 1W3EX 1KC8H 3NVIB 3FFMA 1VQKF 1W41A 3O85A 3NK6A 1PXWA 3CCRF 1GO1A 1YJWF 4BVSA 4BVTA 1YI2F 3CMAF 1VQ5F 1YJNF 2GLZA 3RA5A 2FGYA 3CCLF 2OTJF 1RLGA 3HJWC 2VGMA 3WXMB 1W2BF 1KQSF 5G4UC 1K9MH 1YITF 3E1YA 4NQ3A 3I56F 1N8RH 1VQ6F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7M A;  3NMU C;  3N4Z A;  3CCQ F;  3CCV F;  3LWQ C;  3CCM F;  2KG4 A;  2CZW A;  3J7A R;  3E20 B;  2FC3 A;  3HAX D;  3IR9 A;  4BY9 D;  1VQ4 F;  3CPW F;  1X7O A;  2QEX F;  1VQM F;  1W40 A;  1VQ9 F;  1CN7 A;  2LBW A;  3V7E A;  2HVY D;  3J81 M;  1ZWZ A;  3CCJ F;  1VQ8 F;  3VI6 A;  1M90 H;  1DT9 A;  1Q82 H;  2OZB A;  4LCK A;  2KTV A;  1GZ0 A;  1XBI A;  1W42 A;  3N4Y A;  1QVF F;  1GO0 A;  1Q81 H;  1S72 F;  3G4S F;  2QA4 F;  1M1K H;  3PAF A;  3LFO A;  3JAM M;  2I6D A;  3G71 F;  3GYQ A;  1E7K A;  3NK7 A;  1VQO F;  1YJ9 F;  1KD1 H;  3CCE F;  1K8A H;  1IPA A;  1Q7Y H;  5FJ4 C;  3CCS F;  2BO1 A;  3CCU F;  2QI2 A;  3VMF B;  3OW2 F;  1T0K B;  5GAP K;  2ALE A;  3NVK E;  5IT9 M;  2OHW A;  5DCV A;  3SIU A;  3PLA C;  3CD6 F;  3RA6 A;  3LWP C;  3AGK A;  1JJ2 F;  3J80 M;  3G6E F;  3CME F;  1NMU B;  4BW0 B;  1X7P A;  1QVG F;  5GIN C;  5GIP C;  2VGN A;  3CPQ A;  1RA4 A;  2LBX A;  1VQP F;  1VQ7 F;  5GIO C;  4TZZ A;  2KTU A;  1YIJ F;  1VQL F;  5A2Q M;  1NJI H;  3OBY A;  1Q86 H;  3ON1 A;  3LWR C;  5GAN K;  4X3L A;  4X3M A;  5FLX M;  3I55 F;  3CC2 F;  1YHQ F;  3CG6 A;  3CXC F;  3LWO C;  2JNB A;  4C4W C;  1K73 H;  3SIV A;  2AIF A;  3MCA B;  3V7Q A;  1SDS A;  2OTL F;  2WAL A;  1CK2 A;  5EO3 A;  3LWV C;  3CC7 F;  3CC4 F;  3OBW A;  1VQN F;  5G4V C;  3JCM M;  1X52 A;  4NUT A;  5EWR A;  1W3E X;  1KC8 H;  3NVI B;  3FFM A;  1VQK F;  1W41 A;  3O85 A;  3NK6 A;  1PXW A;  3CCR F;  1GO1 A;  1YJW F;  1YI2 F;  3CMA F;  1VQ5 F;  1YJN F;  3RA5 A;  3CCL F;  2OTJ F;  1RLG A;  3HJW C;  2VGM A;  3WXM B;  1W2B F;  1KQS F;  5G4U C;  1K9M H;  1YIT F;  3E1Y A;  1N8R H;  3I56 F;  1VQ6 F; 
#chains in the Genus database with same CATH topology
 1H7M A;  2RHO A;  4WBN B;  3NMU C;  4C81 A;  5AVM A;  4O4I A;  3RYI B;  3CCM F;  1FFX A;  4ERH A;  2HS3 A;  2CWJ A;  1YGY A;  4O4J B;  1VQ4 F;  1JFF B;  2CSL A;  3CPW F;  1W57 A;  2QEX F;  1VQ9 F;  4B46 A;  4G4Y A;  2LBW A;  3IEW A;  4U3J A;  2BTQ B;  1VQ8 F;  2ZVY A;  3JVH A;  3VI6 A;  5HXU A;  2OZB A;  2UYP A;  1GZ0 A;  3N4Y A;  1H47 A;  2LCA A;  1GO0 A;  3RYC B;  1Q81 H;  3G4S F;  2B33 A;  2QA4 F;  4O4J A;  3S0W A;  5JVD B;  5HY1 A;  1E7K A;  3WPX A;  1DBF A;  2Z1U A;  3CCE F;  1TUB B;  3S02 A;  4G4Z A;  5EIB D;  5HXZ A;  4X1K B;  3M1X A;  4ZK7 A;  2Z1E A;  5BMV B;  4BT3 A;  1VHA A;  3CCU F;  3VMF B;  2GZL A;  1T0K B;  2HRY A;  5IT9 M;  4RQO A;  3WPW A;  2HS0 A;  2OTM A;  3JAW A;  3AGK A;  3V3T A;  4ZHQ A;  4B45 A;  3LWP C;  2UYK A;  3QTY A;  4O2B A;  3J80 M;  3F6M A;  4BVQ A;  5LYJ A;  4B5C A;  3JAT B;  4BT7 A;  4BT2 A;  5EIB C;  3K14 A;  3ZP7 A;  1TUB A;  3FD5 A;  4RHA A;  3CPQ A;  4O2A A;  1RA4 A;  3WJQ A;  2BTU A;  5CA0 B;  1YIJ F;  3M84 A;  1W59 A;  4X1I B;  1U40 A;  3ON1 A;  3K0T A;  4ZHQ B;  3IKE A;  3I55 F;  3RYF B;  3CXC F;  1VQV A;  2NMU A;  2UYN A;  3VYT C;  3GHZ A;  3SIV A;  2AIF A;  1SDS A;  3TD3 A;  2Z1T A;  4BT5 A;  3VOB A;  2HP0 A;  5EAZ A;  4HNA B;  5IJ9 B;  3LWV C;  3CC4 F;  1SZQ A;  3WGK A;  1X52 A;  3JAR B;  3Q8H A;  2PMP A;  5EWR A;  3ELC A;  1KC8 H;  1RLU A;  4DXD A;  4O4I B;  3HWU A;  1QD9 A;  1W41 A;  5HP8 A;  3UT5 A;  1GO1 A;  4I50 B;  3P4E A;  1FSZ A;  4U39 A;  5J2T A;  5KX5 A;  3MBM A;  3JAR A;  5EZY B;  2IAF A;  4I55 A;  2VXY A;  4O4H A;  1YIT F;  4EB6 A;  4NWO B;  3TD5 A;  5JVD A;  3UT5 B;  3LWQ C;  2KG4 A;  2CZW A;  2DYY A;  5CB4 B;  4I55 B;  3WJR A;  1GX1 A;  2ZF8 A;  5FNV B;  3JAW B;  1U3L A;  1M90 H;  3HKB A;  2G9I A;  2KTV A;  3LME A;  4TV8 A;  4EI8 A;  2H8E A;  1S72 F;  5HP7 A;  1M1K H;  3PAF A;  3RYH B;  5LP6 A;  3JAK A;  3LFO A;  3MCQ A;  2VAM A;  2RHL A;  3V4D A;  4O2A B;  3NK7 A;  1VQO F;  1NQ3 A;  1YJ9 F;  5HY0 A;  5ITZ A;  5GON A;  1IPA A;  1U43 A;  5KMG B;  1Q7Y H;  1YQN A;  2BO1 A;  3DDN A;  3JAL B;  2P6Y A;  3KJJ A;  5B8F A;  2ALE A;  5HY2 A;  2UYN B;  2DT4 A;  3SIU A;  4DRX A;  2HP3 A;  3KJK A;  1Z5W A;  4BW0 B;  3RYI A;  1QAH A;  4HNA A;  4TUY A;  2VAP A;  3HKE A;  2LBX A;  4G4V A;  2CW4 A;  3CB2 A;  1Q86 H;  2Z01 A;  2HX0 A;  5GAN K;  3ZO8 A;  4X3L A;  3LWR C;  2CVL A;  4TV9 A;  3CG6 A;  5HY4 A;  3LWO C;  3F0E A;  3OON A;  5MN5 A;  3C8L A;  2CHT A;  1T0A A;  4IIJ B;  3D54 A;  2OTL F;  1JN1 A;  1W55 A;  5LA6 B;  1CK2 A;  2K1S A;  2RHJ A;  4O4H B;  1IV2 A;  3N2K B;  2ZOD A;  3HKC A;  3ERN A;  2R6R 1;  3FD6 A;  4I4T A;  5G4V C;  1JFF A;  3K12 A;  3WGJ A;  4NUT A;  1W3E X;  4YJ2 A;  4U3J B;  3FFM A;  4LNU A;  4O4L B;  5CB4 A;  1J7H A;  3QHD A;  2LBT A;  3O85 A;  3F0D A;  5LA6 A;  3N2G A;  5J2U A;  3RYC A;  4C8I A;  1KNK A;  3E22 A;  1YI2 F;  3K2X A;  3VIU A;  5FNV A;  1XHO A;  1VQ5 F;  4TV8 B;  2RB9 A;  2R75 1;  2IQQ A;  3RA5 A;  3RYF A;  2FGY A;  2OTJ F;  1W58 1;  3WXM B;  5EYP B;  5MN6 A;  1W2B F;  3MQW A;  3E1Y A;  4NQ3 A;  3VO8 A;  3I56 F;  1VQ6 F;  4X1K A;  1Q8R A;  5KMG A;  3N4Z A;  3B6N A;  3CCQ F;  1ODE A;  5ITZ B;  1IV3 A;  3KHN A;  3ZP4 A;  2ZVZ A;  3HAX D;  4BY9 D;  4G4X A;  1X7O A;  4DRX B;  1W40 A;  1CN7 A;  4O2B B;  3C9U A;  3V7E A;  4IHJ A;  3J81 M;  4ZHY B;  1XBI A;  1W42 A;  1QVF F;  2YXZ A;  5JQG A;  3C9S A;  3HKD A;  3JAM M;  3HKE B;  5LP6 C;  2HQS C;  1KD1 H;  2F9Z C;  4I50 A;  5IJ0 A;  1SA0 B;  4G4W A;  5JCO C;  4X20 B;  2PHN A;  3C9T A;  5GAP K;  1RQ2 A;  3S06 A;  4FFB A;  1X25 A;  2H6L A;  4ZOL A;  5EB1 B;  4EB6 B;  5DCV A;  2I6R A;  1RQ7 A;  2N48 A;  3CD6 F;  1KNJ A;  4YJ3 A;  3DC2 A;  3IEQ A;  3WGL A;  1FNJ A;  3CME F;  1NMU B;  3F0F A;  5GIN C;  5GIP C;  2VGN A;  4X1Y A;  4ZI7 B;  1VQP F;  1PF5 A;  5GIO C;  4TZZ A;  2KTU A;  1VQ7 F;  5A2Q M;  3OBY A;  1CLI A;  4EI9 A;  1QU9 A;  2BTO A;  1IV4 A;  4LNU B;  1U3P A;  4BT6 A;  1UFY A;  1YHQ F;  2MQE A;  3RE3 A;  1W5E A;  5LXT B;  5BMV A;  4C4W C;  4G88 A;  5MN4 A;  3FBA A;  1K73 H;  2Q1Y A;  3N2G B;  1R1M A;  5JCO A;  5J2U B;  3I3F A;  1Z5V A;  1ONI A;  3TD4 A;  2H8C A;  3LYB A;  3R0P A;  3I7T A;  3ZOP A;  1OFU A;  5EO3 A;  3CC7 F;  2ZAU A;  3OBW A;  5IYZ A;  1VQN F;  5LXT A;  1IV1 A;  1W5F A;  5CA0 A;  1W5A A;  2AMT A;  3EOR A;  4X1I A;  3HTN A;  2AIZ P;  3WGN A;  2ZOV A;  3IKF A;  5LOV A;  1PXW A;  5CA1 B;  3CCR F;  1YJW F;  4BVS A;  4BVT A;  4C8E A;  3JAK B;  3CMA F;  2GVI A;  2GLZ A;  4TV9 B;  3RYH A;  5LP6 B;  3M4S A;  3HJW C;  3VYS C;  1FNK A;  2UZH A;  1KQS F;  1K9M H;  5G4U C;  2W8B C;  1OAP A;  5IJ9 A;  3QUW A;  1W5B A;  2HP0 B;  5IJ0 B;  4F6R B;  4X20 A;  3JAT A;  3CCV F;  5CA1 A;  5C8Y B;  1SA0 A;  3C9R A;  3J7A R;  3E20 B;  4R40 B;  2FC3 A;  5JH7 B;  3IR9 A;  2IG8 A;  3U0O A;  1VQM F;  1H48 A;  2KGW A;  2HVY D;  1ZWZ A;  3CCJ F;  1DT9 A;  3JAS B;  3VTI C;  1Q82 H;  4LCK A;  3MDO A;  5JH7 A;  4F6R A;  4ZI7 A;  4EI7 A;  2I6D A;  3G71 F;  3GYQ A;  5J2T B;  4X1Y B;  2YYE A;  3KIZ A;  1K8A H;  1FFX B;  1VH8 A;  4WBN A;  5EZY A;  2CHS A;  2V9Y A;  3IMP A;  5FJ4 C;  3CCS F;  2QI2 A;  3OW2 F;  5EYP A;  3NVK E;  5EB0 A;  2OHW A;  3PLA C;  3F0G A;  3N2K A;  3RA6 A;  3VOA A;  1JJ2 F;  1TVK A;  3P10 A;  4I4T B;  3G6E F;  2Q1X A;  1X7P A;  1QVG F;  3FPI A;  4YJ2 B;  1JD1 A;  4O4L A;  3D01 A;  1VQL F;  4C82 A;  5IYZ B;  3HKB B;  1NJI H;  3KE1 A;  1TVK B;  4PWT A;  4X3M A;  5KX5 B;  5FLX M;  3CC2 F;  3D00 A;  3S0Y A;  4B62 A;  2JNB A;  1VK3 A;  2EWC A;  3E22 B;  4BVR A;  1UI9 A;  3VCZ A;  2HRU A;  3JAL A;  3VYU C;  1XV2 A;  4XCQ A;  1XRG A;  3MCA B;  3V7Q A;  5LYJ B;  3S03 A;  2VAW A;  3BYQ A;  2QTP A;  3WGM A;  3GTZ A;  5LOV B;  3L7Q A;  3T80 A;  2WAL A;  3P0Z A;  2RHH A;  4ZHV A;  4C8G A;  2HS4 A;  4FFB B;  4ZOL B;  5HWE A;  3JCM M;  4KWE A;  4YJ3 B;  3WJP A;  4M8I A;  4TUY B;  3NVI B;  4IHJ B;  2Z1F A;  1VQK F;  2L26 A;  5C8Y A;  3NK6 A;  5JQG B;  3LDT A;  4ZHW A;  4IIJ A;  5GON B;  3HKD B;  3CYQ A;  2UYJ A;  1YJN F;  1JY8 A;  4BT4 A;  3CCL F;  3JAS A;  4E6E A;  1RLG A;  3ESJ A;  2VGM A;  3CYP B;  3S0H A;  1N8R H;  1COM A;  3HKC B; 
#chains in the Genus database with same CATH homology
 1H7M A;  3NMU C;  3N4Z A;  3CCQ F;  3CCV F;  3LWQ C;  3CCM F;  2KG4 A;  2CZW A;  3J7A R;  3E20 B;  2FC3 A;  3HAX D;  3IR9 A;  4BY9 D;  1VQ4 F;  3CPW F;  1X7O A;  2QEX F;  1VQM F;  1W40 A;  1VQ9 F;  1CN7 A;  2LBW A;  3V7E A;  2HVY D;  3J81 M;  1ZWZ A;  3CCJ F;  1VQ8 F;  3VI6 A;  1M90 H;  1DT9 A;  5HXU A;  1Q82 H;  2OZB A;  4LCK A;  3N4Y A;  1GZ0 A;  1XBI A;  1W42 A;  2KTV A;  1QVF F;  1GO0 A;  4EI8 A;  1Q81 H;  1S72 F;  3G4S F;  2QA4 F;  1M1K H;  3PAF A;  3LFO A;  3JAM M;  4EI7 A;  2I6D A;  3G71 F;  3GYQ A;  5HY1 A;  1E7K A;  3NK7 A;  1VQO F;  1YJ9 F;  5HY0 A;  1KD1 H;  2F9Z C;  3CCE F;  1K8A H;  1IPA A;  5HXZ A;  1Q7Y H;  5FJ4 C;  3CCS F;  2BO1 A;  3CCU F;  2QI2 A;  3VMF B;  3OW2 F;  1T0K B;  5GAP K;  2ALE A;  3NVK E;  5IT9 M;  2OHW A;  5HY2 A;  5DCV A;  3SIU A;  3PLA C;  3CD6 F;  3RA6 A;  3V3T A;  3LWP C;  3AGK A;  1JJ2 F;  3J80 M;  3G6E F;  4BVQ A;  3CME F;  1NMU B;  4BW0 B;  1X7P A;  1QVG F;  5GIN C;  5GIP C;  2VGN A;  3CPQ A;  1RA4 A;  2LBX A;  1VQP F;  1VQ7 F;  5GIO C;  4TZZ A;  2KTU A;  1YIJ F;  1VQL F;  5A2Q M;  1NJI H;  3OBY A;  1Q86 H;  3ON1 A;  4EI9 A;  3LWR C;  5GAN K;  4X3L A;  4X3M A;  5FLX M;  3I55 F;  3CC2 F;  1YHQ F;  3CG6 A;  3D00 A;  3CXC F;  5HY4 A;  3LWO C;  2JNB A;  4BVR A;  4C4W C;  1K73 H;  3SIV A;  4XCQ A;  2AIF A;  3MCA B;  3V7Q A;  1SDS A;  2OTL F;  2WAL A;  1CK2 A;  5EO3 A;  3LWV C;  3CC7 F;  3CC4 F;  3OBW A;  5HWE A;  1VQN F;  5G4V C;  3JCM M;  1X52 A;  4NUT A;  5EWR A;  1W3E X;  1KC8 H;  3NVI B;  3FFM A;  1VQK F;  1W41 A;  3O85 A;  3NK6 A;  1PXW A;  3CCR F;  1GO1 A;  1YJW F;  4BVS A;  4BVT A;  1YI2 F;  3CMA F;  1VQ5 F;  1YJN F;  2GLZ A;  3RA5 A;  2FGY A;  3CCL F;  2OTJ F;  1RLG A;  3HJW C;  2VGM A;  3WXM B;  1W2B F;  1KQS F;  5G4U C;  1K9M H;  1YIT F;  3E1Y A;  4NQ3 A;  3I56 F;  1N8R H;  1VQ6 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...