3CCRF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccrF00
1VQOF 3JAMM 1E7KA 1QVGF 1H7MA 5GIOC 2KG4A 5EWRA 2HVYD 3FFMA 3LWQC 2KTUA 1YI2F 3GYQA 5EO3A 2CZWA 3NK6A 1Q81H 1M1KH 3E20B 3ON1A 3WXMB 1JJ2F 1CN7A 1Q7YH 3CC4F 1M90H 2OTLF 3CCLF 3NMUC 3CMEF 1VQPF 1YIJF 3CMAF 3CC7F 3LWRC 4C4WC 1N8RH 2JNBA 3HJWC 1DT9A 3J81M 5GANK 1RLGA 3I56F 2FC3A 1VQ7F 3SIUA 2OHWA 3AGKA 1YJNF 1VQ6F 3CPWF 1NJIH 4BY9D 3NVKE 5A2QM 1Q86H 1YHQF 3CXCF 3J7AR 2QI2A 5DCVA 3NVIB 1VQKF 2OZBA 5GIPC 3CPQA 3CC2F 1IPAA 3CCUF 1T0KB 5G4VC 3N4ZA 3CCJF 3N4YA 1S72F 1NMUB 1VQ5F 2WALA 1VQLF 4BW0B 3PLAC 2LBWA 3I55F 3CCMF 1K9MH 1YJ9F 1X52A 1VQ4F 2OTJF 1W2BF 1VQ8F 1VQNF 2BO1A 3NK7A 3VMFB 4TZZA 5G4UC 1W40A 3O85A 3LWVC 5FLXM 2AIFA 2VGMA 3V7QA 3CD6F 3PAFA 1KD1H 4NUTA 3OBYA 1K8AH 1QVFF 5GAPK 1YITF 1K73H 2ALEA 3CCQF 1X7PA 2QEXF 3G4SF 4X3MA 3G6EF 4X3LA 1SDSA 5IT9M 3CCSF 3G71F 2QA4F 5GINC 3CCVF 1X7OA 1YJWF 2KTVA 3J80M 3E1YA 3CCRF 1RA4A 1ZWZA 1GO0A 1CK2A 1VQ9F 1W3EX 4LCKA 3JCMM 3LWPC 3LWOC 1W42A 2LBXA 1VQMF 1W41A 3RA5A 3SIVA 2I6DA 5FJ4C 1KC8H 1PXWA 3CCEF 2VGNA 3OBWA 1Q82H 3MCAB 1KQSF 1GO1A 3OW2F 1GZ0A 3RA6A 3V7EA 3HAXD 3LFOA 3VI6A 3CG6A 1XBIA 3IR9A
chains in the Genus database with same CATH superfamily
3JAMM 5FNVB 1E7KA 1FNKA 3JALB 1QVGF 1OAPA 3JATA 5GIOC 4YJ2B 2HS0A 4C8EA 1W5AA 2L26A 2DYYA 4I50A 4YJ3A 4U3JA 1Q81H 3ON1A 4E6EA 3CC4F 1M90H 2OTLF 1CLIA 4ZHWA 2HX0A 3CMEF 3FBAA 4G4VA 4BT3A 4TUYB 4C4WC 3KE1A 1ODEA 1TUBB 3CB2A 3J81M 1RLGA 2P6YA 3SIUA 1IV3A 2B33A 3AGKA 5HWEA 1VQ6F 1VHAA 3JARA 4BY9D 4I4TA 5MN5A 3VYSC 4ZHQA 3VOAA 3F0DA 1JY8A 1YHQF 3KHNA 3CXCF 1SA0B 1W581 5J2UB 3HKCA 4M8IA 4O4JA 4RHAA 3CPQA 3CC2F 2H8CA 3V3TA 1JN1A 5HXUA 5G4VC 4G4ZA 4FFBB 3N4YA 4O2BB 1S72F 5AVMA 4C8IA 1NMUB 1VQ5F 2WALA 4G4WA 4BW0B 3I55F 4TV9B 4O4LB 1K9MH 5IJ0A 2V9YA 2UYJA 1VQ8F 2VXYA 1KNKA 2BO1A 4LNUB 1H48A 4TZZA 5EYPA 1W40A 3O85A 4ZOLA 3N2GA 3S0HA 5BMVB 5LP6B 1W59A 3C9TA 3B6NA 2NMUA 3BYQA 1YITF 3VYUC 2Z1EA 3RYIA 3WJPA 1UFYA 3CG6A 4G4XA 2K1SA 4DRXB 3HKDA 3CCSF 4I55A 3JAKB 5HXZA 5CA1B 3HKEA 4C8GA 5LA6B 3K0TA 1ZWZA 4O4HB 1W3EX 1OFUA 4ZI7B 4LCKA 2R6R1 1X25A 3DDNA 4TV8A 5JH7B 1U3LA 4EI7A 5KX5B 5HP8A 2PHNA 2QTPA 2HP0B 3HTNA 1TVKA 5GONA 5MN4A 2I6DA 1XRGA 3VTIC 1KC8H 5FJ4C 2GLZA 3CCEF 1W57A 1R1MA 2VGNA 3OBWA 5GONB 3VO8A 4PWTA 3MCAB 1KQSF 4B62A 3KJKA 2DT4A 2R751 5JVDA 3HAXD 5JCOA 3WGLA 3N2KB 5HY0A 4EB6B 2F9ZC 1H7MA 5EWRA 2HVYD 3FFMA 3LWQC 2Z1FA 4O2AA 3GYQA 5JQGB 3RYCA 2CZWA 2VAWA 3WXMB 1VH8A 3S06A 1VQPF 3L7QA 3LWRC 1DT9A 2FC3A 5B8FA 1W5EA 3VIUA 5J2TB 2UZHA 5CB4A 1YJNF 3I3FA 5FNVA 1NJIH 4F6RB 2VAMA 4RQOA 3JALA 5CB4B 3VOBA 4YJ2A 5EB0A 1Q8RA 1RQ2A 2EWCA 2QI2A 3TD4A 5EZYB 1KNJA 3IMPA 3QTYA 1T0KB 4KWEA 4X1YB 3UT5B 4TUYA 1TUBA 3HKBB 5HY4A 1H47A 3GTZA 3WGNA 4NQ3A 3HWUA 3RE3A 2LBWA 4G88A 2Q1YA 1SA0A 5J2UA 1QU9A 2IQQA 2BTQB 2HRYA 3D01A 4X1KB 3LWVC 3WPWA 2AIFA 2VGMA 1W5BA 3V7QA 3CD6F 2ZVYA 3OBYA 1K8AH 2IG8A 4BT4A 3IKFA 4FFBA 1T0AA 1XV2A 4O2BA 2QEXF 2HS4A 4X3LA 3F0GA 3RYHB 4TV9A 4O4LA 3C9RA 5CA0B 2QA4F 3CCVF 1X7OA 1YJWF 3WJQA 3F0EA 3MBMA 3E1YA 1Z5VA 2ZAUA 4IIJB 4LNUA 4O4IB 4C81A 5JCOC 2CWJA 4X20B 5BMVA 3LWPC 5ITZA 3MDOA 5LP6A 2LBXA 5ITZB 1Z5WA 3FD5A 1XHOA 3ZOPA 4B45A 3SIVA 3JAWB 2YXZA 4DRXA 3F6MA 4IHJB 4BT2A 4X1IB 3CYQA 3LYBA 4ERHA 2CHTA 4HNAB 3JAKA 2UYNB 5CA1A 1VQVA 3IR9A 2H8EA 5LA6A 4O4HA 4ZI7A 5JH7A 2HRUA 4WBNB 5KX5A 1YI2F 1JD1A 5EAZA 5EO3A 3WJRA 2HP0A 3NK6A 3WGKA 1M1KH 3TD5A 3E20B 1JJ2F 1CN7A 3E22A 5IYZB 3CCLF 3NMUC 2ZF8A 3ERNA 3M4SA 3MCQA 1YIJF 3E22B 3RYFB 3CMAF 5G4UC 1N8RH 3HJWC 5GANK 2Q1XA 2OHWA 5MN6A 3LDTA 3WGMA 1NQ3A 3CPWF 3N2KA 1ONIA 3NVKE 4EB6A 5A2QM 2BTUA 5EB1B 2Z1UA 5JQGA 2CVLA 3V4DA 3JVHA 3NVIB 1VQKF 2OZBA 3WGJA 5C8YB 5GIPC 2G9IA 4XCQA 1IPAA 4BT5A 5KMGA 2VAPA 3CCJF 4BVQA 5KMGB 2UYKA 1PF5A 3DC2A 5J2TA 1VQLF 3ZP7A 1DBFA 4EI8A 3PLAC 3CCMF 2ZVZA 4F6RA 1X52A 1SZQA 1VQ4F 1W2BF 2OTJF 3C9SA 1VQNF 5LYJB 5IJ9B 3NK7A 3VMFB 3ZP4A 5FLXM 5EZYA 3K14A 2HP3A 3QHDA 1GX1A 4NUTA 1U3PA 1YQNA 1YGYA 4X1YA 3UT5A 2ALEA 4B46A 1X7PA 5LXTB 3HKBA 5LP6C 3JASB 2HS3A 1FFXB 4X3MA 3C9UA 1IV2A 2CSLA 3G71F 1FNJA 3LMEA 1JFFB 5LOVB 4G4YA 3VYTC 4U39A 1RA4A 2ZOVA 3Q8HA 3S03A 2AIZP 1GO0A 1VQ9F 4X1KA 4BVTA 1QD9A 3JCMM 2W8BC 3JATB 3S0WA 3ESJA 3MQWA 5EIBC 3P10A 4I50B 3D00A 4YJ3B 3T80A 4U3JB 1RQ7A 1W55A 4EI9A 3RA5A 3CYPB 2RHHA 1PXWA 3M1XA 1Q82H 3RYHA 5CA0A 1GO1A 3OW2F 1W5FA 1GZ0A 3RA6A 3V7EA 3M84A 2Z1TA 3LFOA 2H6LA 1XBIA 4BVRA 4IIJA 1J7HA 5HY2A 4O4IA 1VQOF 3JARB 2FGYA 4I4TB 4ZHQB 3C8LA 4X20A 3FPIA 3IEQA 2KG4A 2KTUA 2CW4A 3HKCB 3I7TA 4O4JB 2OTMA 3P4EA 3OONA 5EIBD 1Q7YH 3JAWA 3FD6A 3D54A 4C82A 4IHJA 4X1IA 3CC7F 3ZO8A 2GVIA 2JNBA 3WPXA 4HNAA 3I56F 1VQ7F 2UYNA 2IAFA 3KJJA 2BTOA 2MQEA 5IJ0B 4WBNA 1FSZA 1Q86H 2RHOA 5HY1A 3VCZA 3J7AR 5DCVA 5EYPB 4ZOLB 2RHLA 3N2GB 2N48A 5IYZA 1VK3A 4R40B 4BT6A 3P0ZA 3CCUF 4DXDA 3RYFA 3N4ZA 2LBTA 3RYIB 3IEWA 2ZODA 3HKDB 3ELCA 3R0PA 4BVSA 1YJ9F 4I55B 2LCAA 3QUWA 4ZHYB 3HKEB 2RB9A 1UI9A 5C8YA 4TV8B 3PAFA 1KD1H 1COMA 1QVFF 5GAPK 1IV1A 1K73H 3CCQF 1TVKB 3GHZA 3G4SF 3G6EF 2UYPA 2CHSA 1SDSA 2KGWA 5IT9M 5GINC 5HP7A 2KTVA 3J80M 5JVDB 3CCRF 2AMTA 5LYJA 3S02A 5IJ9A 2HQSC 1CK2A 2GZLA 2Z01A 3EORA 4ZK7A 4NWOB 3LWOC 3F0FA 1W42A 3IKEA 4O2AB 4B5CA 3RYCB 1VQMF 1U40A 1W41A 4BT7A 2PMPA 5LXTA 3JASA 1FFXA 3KIZA 1U43A 1RLUA 1IV4A 2YYEA 1QAHA 3TD3A 3U0OA 3S0YA 2RHJA 1JFFA 5LOVA 3K2XA 4ZHVA 3VI6A 3K12A 2I6RA
chains in the Genus database with same CATH topology
5HY2A 3JAMM 1VQOF 5HY0A 1E7KA 2FGYA 2F9ZC 1QVGF 1H7MA 5GIOC 2KG4A 5EWRA 2HVYD 3FFMA 3LWQC 2KTUA 1YI2F 3GYQA 5EO3A 2CZWA 3NK6A 1Q81H 1M1KH 3E20B 3ON1A 3WXMB 1JJ2F 1CN7A 1Q7YH 3CC4F 1M90H 2OTLF 3CCLF 3NMUC 3CMEF 1VQPF 1YIJF 3CMAF 3CC7F 3LWRC 4C4WC 1N8RH 2JNBA 3HJWC 1DT9A 3J81M 5GANK 1RLGA 3I56F 2FC3A 1VQ7F 3SIUA 2OHWA 3AGKA 5HWEA 1YJNF 3CPWF 1VQ6F 1NJIH 4BY9D 3NVKE 5A2QM 1Q86H 5HY1A 1YHQF 3CXCF 3J7AR 2QI2A 5DCVA 3NVIB 1VQKF 2OZBA 5GIPC 3CPQA 3CC2F 4XCQA 3V3TA 1IPAA 3CCUF 5HXUA 1T0KB 5G4VC 3N4ZA 3CCJF 3N4YA 1S72F 5HY4A 4BVQA 1NMUB 1VQ5F 4NQ3A 2WALA 1VQLF 4BVSA 4BW0B 4EI8A 2LBWA 3I55F 3CCMF 3PLAC 1K9MH 1YJ9F 1X52A 1VQ4F 2OTJF 1W2BF 1VQ8F 1VQNF 2BO1A 3NK7A 3VMFB 4TZZA 5G4UC 1W40A 3O85A 3LWVC 5FLXM 2AIFA 2VGMA 3V7QA 3CD6F 3PAFA 1KD1H 4NUTA 3OBYA 1K8AH 1QVFF 5GAPK 1YITF 1K73H 2ALEA 3CCQF 1X7PA 2QEXF 3G4SF 4X3MA 3G6EF 4X3LA 1SDSA 5IT9M 3CCSF 3G71F 2QA4F 5GINC 3CCVF 1X7OA 1YJWF 2KTVA 3J80M 3E1YA 5HXZA 3CCRF 1RA4A 1ZWZA 1GO0A 1CK2A 1VQ9F 1W3EX 4BVTA 4LCKA 3JCMM 3LWPC 3LWOC 4EI7A 1W42A 2LBXA 1VQMF 1W41A 3D00A 4EI9A 3RA5A 3SIVA 2I6DA 5FJ4C 1KC8H 1PXWA 2GLZA 3CCEF 2VGNA 3OBWA 1Q82H 3MCAB 1KQSF 1GO1A 3OW2F 1GZ0A 3RA6A 3V7EA 3HAXD 3LFOA 3VI6A 3CG6A 1XBIA 3IR9A 4BVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO F;  3JAM M;  1E7K A;  1QVG F;  1H7M A;  5GIO C;  2KG4 A;  5EWR A;  2HVY D;  3FFM A;  3LWQ C;  2KTU A;  1YI2 F;  3GYQ A;  5EO3 A;  2CZW A;  3NK6 A;  1Q81 H;  1M1K H;  3E20 B;  3ON1 A;  3WXM B;  1JJ2 F;  1CN7 A;  1Q7Y H;  3CC4 F;  1M90 H;  2OTL F;  3CCL F;  3NMU C;  3CME F;  1VQP F;  1YIJ F;  3CMA F;  3CC7 F;  3LWR C;  4C4W C;  1N8R H;  2JNB A;  3HJW C;  1DT9 A;  3J81 M;  5GAN K;  1RLG A;  3I56 F;  2FC3 A;  1VQ7 F;  3SIU A;  2OHW A;  3AGK A;  1YJN F;  1VQ6 F;  3CPW F;  1NJI H;  4BY9 D;  3NVK E;  5A2Q M;  1Q86 H;  1YHQ F;  3CXC F;  3J7A R;  2QI2 A;  5DCV A;  3NVI B;  1VQK F;  2OZB A;  5GIP C;  3CPQ A;  3CC2 F;  1IPA A;  3CCU F;  1T0K B;  5G4V C;  3N4Z A;  3CCJ F;  3N4Y A;  1S72 F;  1NMU B;  1VQ5 F;  2WAL A;  1VQL F;  4BW0 B;  3PLA C;  2LBW A;  3I55 F;  3CCM F;  1K9M H;  1YJ9 F;  1X52 A;  1VQ4 F;  2OTJ F;  1W2B F;  1VQ8 F;  1VQN F;  2BO1 A;  3NK7 A;  3VMF B;  4TZZ A;  5G4U C;  1W40 A;  3O85 A;  3LWV C;  5FLX M;  2AIF A;  2VGM A;  3V7Q A;  3CD6 F;  3PAF A;  1KD1 H;  4NUT A;  3OBY A;  1K8A H;  1QVF F;  5GAP K;  1YIT F;  1K73 H;  2ALE A;  3CCQ F;  1X7P A;  2QEX F;  3G4S F;  4X3M A;  3G6E F;  4X3L A;  1SDS A;  5IT9 M;  3CCS F;  3G71 F;  2QA4 F;  5GIN C;  3CCV F;  1X7O A;  1YJW F;  2KTV A;  3J80 M;  3E1Y A;  3CCR F;  1RA4 A;  1ZWZ A;  1GO0 A;  1CK2 A;  1VQ9 F;  1W3E X;  4LCK A;  3JCM M;  3LWP C;  3LWO C;  1W42 A;  2LBX A;  1VQM F;  1W41 A;  3RA5 A;  3SIV A;  2I6D A;  5FJ4 C;  1KC8 H;  1PXW A;  3CCE F;  2VGN A;  3OBW A;  1Q82 H;  3MCA B;  1KQS F;  1GO1 A;  3OW2 F;  1GZ0 A;  3RA6 A;  3V7E A;  3HAX D;  3LFO A;  3VI6 A;  3CG6 A;  1XBI A;  3IR9 A; 
#chains in the Genus database with same CATH topology
 3JAM M;  5FNV B;  1E7K A;  1FNK A;  3JAL B;  1QVG F;  1OAP A;  3JAT A;  5GIO C;  4YJ2 B;  2HS0 A;  4C8E A;  1W5A A;  2L26 A;  2DYY A;  4I50 A;  4YJ3 A;  4U3J A;  1Q81 H;  3ON1 A;  4E6E A;  3CC4 F;  1M90 H;  2OTL F;  1CLI A;  4ZHW A;  2HX0 A;  3CME F;  3FBA A;  4G4V A;  4BT3 A;  4TUY B;  4C4W C;  3KE1 A;  1ODE A;  1TUB B;  3CB2 A;  3J81 M;  1RLG A;  2P6Y A;  3SIU A;  1IV3 A;  2B33 A;  3AGK A;  5HWE A;  1VQ6 F;  1VHA A;  3JAR A;  4BY9 D;  4I4T A;  5MN5 A;  3VYS C;  4ZHQ A;  3VOA A;  3F0D A;  1JY8 A;  1YHQ F;  3KHN A;  3CXC F;  1SA0 B;  1W58 1;  5J2U B;  3HKC A;  4M8I A;  4O4J A;  4RHA A;  3CPQ A;  3CC2 F;  2H8C A;  3V3T A;  1JN1 A;  5HXU A;  5G4V C;  4G4Z A;  4FFB B;  3N4Y A;  4O2B B;  1S72 F;  5AVM A;  4C8I A;  1NMU B;  1VQ5 F;  2WAL A;  4G4W A;  4BW0 B;  3I55 F;  4TV9 B;  4O4L B;  1K9M H;  5IJ0 A;  2V9Y A;  2UYJ A;  1VQ8 F;  2VXY A;  1KNK A;  2BO1 A;  4LNU B;  1H48 A;  4TZZ A;  5EYP A;  1W40 A;  3O85 A;  4ZOL A;  3N2G A;  3S0H A;  5BMV B;  5LP6 B;  1W59 A;  3C9T A;  3B6N A;  2NMU A;  3BYQ A;  1YIT F;  3VYU C;  2Z1E A;  3RYI A;  3WJP A;  1UFY A;  3CG6 A;  4G4X A;  2K1S A;  4DRX B;  3HKD A;  3CCS F;  4I55 A;  3JAK B;  5HXZ A;  5CA1 B;  3HKE A;  4C8G A;  5LA6 B;  3K0T A;  1ZWZ A;  4O4H B;  1W3E X;  1OFU A;  4ZI7 B;  4LCK A;  2R6R 1;  1X25 A;  3DDN A;  4TV8 A;  5JH7 B;  1U3L A;  4EI7 A;  5KX5 B;  5HP8 A;  2PHN A;  2QTP A;  2HP0 B;  3HTN A;  1TVK A;  5GON A;  5MN4 A;  2I6D A;  1XRG A;  3VTI C;  1KC8 H;  5FJ4 C;  2GLZ A;  3CCE F;  1W57 A;  1R1M A;  2VGN A;  3OBW A;  5GON B;  3VO8 A;  4PWT A;  3MCA B;  1KQS F;  4B62 A;  3KJK A;  2DT4 A;  2R75 1;  5JVD A;  3HAX D;  5JCO A;  3WGL A;  3N2K B;  5HY0 A;  4EB6 B;  2F9Z C;  1H7M A;  5EWR A;  2HVY D;  3FFM A;  3LWQ C;  2Z1F A;  4O2A A;  3GYQ A;  5JQG B;  3RYC A;  2CZW A;  2VAW A;  3WXM B;  1VH8 A;  3S06 A;  1VQP F;  3L7Q A;  3LWR C;  1DT9 A;  2FC3 A;  5B8F A;  1W5E A;  3VIU A;  5J2T B;  2UZH A;  5CB4 A;  1YJN F;  3I3F A;  5FNV A;  1NJI H;  4F6R B;  2VAM A;  4RQO A;  3JAL A;  5CB4 B;  3VOB A;  4YJ2 A;  5EB0 A;  1Q8R A;  1RQ2 A;  2EWC A;  2QI2 A;  3TD4 A;  5EZY B;  1KNJ A;  3IMP A;  3QTY A;  1T0K B;  4KWE A;  4X1Y B;  3UT5 B;  4TUY A;  1TUB A;  3HKB B;  5HY4 A;  1H47 A;  3GTZ A;  3WGN A;  4NQ3 A;  3HWU A;  3RE3 A;  2LBW A;  4G88 A;  2Q1Y A;  1SA0 A;  5J2U A;  1QU9 A;  2IQQ A;  2BTQ B;  2HRY A;  3D01 A;  4X1K B;  3LWV C;  3WPW A;  2AIF A;  2VGM A;  1W5B A;  3V7Q A;  3CD6 F;  2ZVY A;  3OBY A;  1K8A H;  2IG8 A;  4BT4 A;  3IKF A;  4FFB A;  1T0A A;  1XV2 A;  4O2B A;  2QEX F;  2HS4 A;  4X3L A;  3F0G A;  3RYH B;  4TV9 A;  4O4L A;  3C9R A;  5CA0 B;  2QA4 F;  3CCV F;  1X7O A;  1YJW F;  3WJQ A;  3F0E A;  3MBM A;  3E1Y A;  1Z5V A;  2ZAU A;  4IIJ B;  4LNU A;  4O4I B;  4C81 A;  5JCO C;  2CWJ A;  4X20 B;  5BMV A;  3LWP C;  5ITZ A;  3MDO A;  5LP6 A;  2LBX A;  5ITZ B;  1Z5W A;  3FD5 A;  1XHO A;  3ZOP A;  4B45 A;  3SIV A;  3JAW B;  2YXZ A;  4DRX A;  3F6M A;  4IHJ B;  4BT2 A;  4X1I B;  3CYQ A;  3LYB A;  4ERH A;  2CHT A;  4HNA B;  3JAK A;  2UYN B;  5CA1 A;  1VQV A;  3IR9 A;  2H8E A;  5LA6 A;  4O4H A;  4ZI7 A;  5JH7 A;  2HRU A;  4WBN B;  5KX5 A;  1YI2 F;  1JD1 A;  5EAZ A;  5EO3 A;  3WJR A;  2HP0 A;  3NK6 A;  3WGK A;  1M1K H;  3TD5 A;  3E20 B;  1JJ2 F;  1CN7 A;  3E22 A;  5IYZ B;  3CCL F;  3NMU C;  2ZF8 A;  3ERN A;  3M4S A;  3MCQ A;  1YIJ F;  3E22 B;  3RYF B;  3CMA F;  5G4U C;  1N8R H;  3HJW C;  5GAN K;  2Q1X A;  2OHW A;  5MN6 A;  3LDT A;  3WGM A;  1NQ3 A;  3CPW F;  3N2K A;  1ONI A;  3NVK E;  4EB6 A;  5A2Q M;  2BTU A;  5EB1 B;  2Z1U A;  5JQG A;  2CVL A;  3V4D A;  3JVH A;  3NVI B;  1VQK F;  2OZB A;  3WGJ A;  5C8Y B;  5GIP C;  2G9I A;  4XCQ A;  1IPA A;  4BT5 A;  5KMG A;  2VAP A;  3CCJ F;  4BVQ A;  5KMG B;  2UYK A;  1PF5 A;  3DC2 A;  5J2T A;  1VQL F;  3ZP7 A;  1DBF A;  4EI8 A;  3PLA C;  3CCM F;  2ZVZ A;  4F6R A;  1X52 A;  1SZQ A;  1VQ4 F;  1W2B F;  2OTJ F;  3C9S A;  1VQN F;  5LYJ B;  5IJ9 B;  3NK7 A;  3VMF B;  3ZP4 A;  5FLX M;  5EZY A;  3K14 A;  2HP3 A;  3QHD A;  1GX1 A;  4NUT A;  1U3P A;  1YQN A;  1YGY A;  4X1Y A;  3UT5 A;  2ALE A;  4B46 A;  1X7P A;  5LXT B;  3HKB A;  5LP6 C;  3JAS B;  2HS3 A;  1FFX B;  4X3M A;  3C9U A;  1IV2 A;  2CSL A;  3G71 F;  1FNJ A;  3LME A;  1JFF B;  5LOV B;  4G4Y A;  3VYT C;  4U39 A;  1RA4 A;  2ZOV A;  3Q8H A;  3S03 A;  2AIZ P;  1GO0 A;  1VQ9 F;  4X1K A;  4BVT A;  1QD9 A;  3JCM M;  2W8B C;  3JAT B;  3S0W A;  3ESJ A;  3MQW A;  5EIB C;  3P10 A;  4I50 B;  3D00 A;  4YJ3 B;  3T80 A;  4U3J B;  1RQ7 A;  1W55 A;  4EI9 A;  3RA5 A;  3CYP B;  2RHH A;  1PXW A;  3M1X A;  1Q82 H;  3RYH A;  5CA0 A;  1GO1 A;  3OW2 F;  1W5F A;  1GZ0 A;  3RA6 A;  3V7E A;  3M84 A;  2Z1T A;  3LFO A;  2H6L A;  1XBI A;  4BVR A;  4IIJ A;  1J7H A;  5HY2 A;  4O4I A;  1VQO F;  3JAR B;  2FGY A;  4I4T B;  4ZHQ B;  3C8L A;  4X20 A;  3FPI A;  3IEQ A;  2KG4 A;  2KTU A;  2CW4 A;  3HKC B;  3I7T A;  4O4J B;  2OTM A;  3P4E A;  3OON A;  5EIB D;  1Q7Y H;  3JAW A;  3FD6 A;  3D54 A;  4C82 A;  4IHJ A;  4X1I A;  3CC7 F;  3ZO8 A;  2GVI A;  2JNB A;  3WPX A;  4HNA A;  3I56 F;  1VQ7 F;  2UYN A;  2IAF A;  3KJJ A;  2BTO A;  2MQE A;  5IJ0 B;  4WBN A;  1FSZ A;  1Q86 H;  2RHO A;  5HY1 A;  3VCZ A;  3J7A R;  5DCV A;  5EYP B;  4ZOL B;  2RHL A;  3N2G B;  2N48 A;  5IYZ A;  1VK3 A;  4R40 B;  4BT6 A;  3P0Z A;  3CCU F;  4DXD A;  3RYF A;  3N4Z A;  2LBT A;  3RYI B;  3IEW A;  2ZOD A;  3HKD B;  3ELC A;  3R0P A;  4BVS A;  1YJ9 F;  4I55 B;  2LCA A;  3QUW A;  4ZHY B;  3HKE B;  2RB9 A;  1UI9 A;  5C8Y A;  4TV8 B;  3PAF A;  1KD1 H;  1COM A;  1QVF F;  5GAP K;  1IV1 A;  1K73 H;  3CCQ F;  1TVK B;  3GHZ A;  3G4S F;  3G6E F;  2UYP A;  2CHS A;  1SDS A;  2KGW A;  5IT9 M;  5GIN C;  5HP7 A;  2KTV A;  3J80 M;  5JVD B;  3CCR F;  2AMT A;  5LYJ A;  3S02 A;  5IJ9 A;  2HQS C;  1CK2 A;  2GZL A;  2Z01 A;  3EOR A;  4ZK7 A;  4NWO B;  3LWO C;  3F0F A;  1W42 A;  3IKE A;  4O2A B;  4B5C A;  3RYC B;  1VQM F;  1U40 A;  1W41 A;  4BT7 A;  2PMP A;  5LXT A;  3JAS A;  1FFX A;  3KIZ A;  1U43 A;  1RLU A;  1IV4 A;  2YYE A;  1QAH A;  3TD3 A;  3U0O A;  3S0Y A;  2RHJ A;  1JFF A;  5LOV A;  3K2X A;  4ZHV A;  3VI6 A;  3K12 A;  2I6R A; 
#chains in the Genus database with same CATH homology
 5HY2 A;  3JAM M;  1VQO F;  5HY0 A;  1E7K A;  2FGY A;  2F9Z C;  1QVG F;  1H7M A;  5GIO C;  2KG4 A;  5EWR A;  2HVY D;  3FFM A;  3LWQ C;  2KTU A;  1YI2 F;  3GYQ A;  5EO3 A;  2CZW A;  3NK6 A;  1Q81 H;  1M1K H;  3E20 B;  3ON1 A;  3WXM B;  1JJ2 F;  1CN7 A;  1Q7Y H;  3CC4 F;  1M90 H;  2OTL F;  3CCL F;  3NMU C;  3CME F;  1VQP F;  1YIJ F;  3CMA F;  3CC7 F;  3LWR C;  4C4W C;  1N8R H;  2JNB A;  3HJW C;  1DT9 A;  3J81 M;  5GAN K;  1RLG A;  3I56 F;  2FC3 A;  1VQ7 F;  3SIU A;  2OHW A;  3AGK A;  5HWE A;  1YJN F;  3CPW F;  1VQ6 F;  1NJI H;  4BY9 D;  3NVK E;  5A2Q M;  1Q86 H;  5HY1 A;  1YHQ F;  3CXC F;  3J7A R;  2QI2 A;  5DCV A;  3NVI B;  1VQK F;  2OZB A;  5GIP C;  3CPQ A;  3CC2 F;  4XCQ A;  3V3T A;  1IPA A;  3CCU F;  5HXU A;  1T0K B;  5G4V C;  3N4Z A;  3CCJ F;  3N4Y A;  1S72 F;  5HY4 A;  4BVQ A;  1NMU B;  1VQ5 F;  4NQ3 A;  2WAL A;  1VQL F;  4BVS A;  4BW0 B;  4EI8 A;  2LBW A;  3I55 F;  3CCM F;  3PLA C;  1K9M H;  1YJ9 F;  1X52 A;  1VQ4 F;  2OTJ F;  1W2B F;  1VQ8 F;  1VQN F;  2BO1 A;  3NK7 A;  3VMF B;  4TZZ A;  5G4U C;  1W40 A;  3O85 A;  3LWV C;  5FLX M;  2AIF A;  2VGM A;  3V7Q A;  3CD6 F;  3PAF A;  1KD1 H;  4NUT A;  3OBY A;  1K8A H;  1QVF F;  5GAP K;  1YIT F;  1K73 H;  2ALE A;  3CCQ F;  1X7P A;  2QEX F;  3G4S F;  4X3M A;  3G6E F;  4X3L A;  1SDS A;  5IT9 M;  3CCS F;  3G71 F;  2QA4 F;  5GIN C;  3CCV F;  1X7O A;  1YJW F;  2KTV A;  3J80 M;  3E1Y A;  5HXZ A;  3CCR F;  1RA4 A;  1ZWZ A;  1GO0 A;  1CK2 A;  1VQ9 F;  1W3E X;  4BVT A;  4LCK A;  3JCM M;  3LWP C;  3LWO C;  4EI7 A;  1W42 A;  2LBX A;  1VQM F;  1W41 A;  3D00 A;  4EI9 A;  3RA5 A;  3SIV A;  2I6D A;  5FJ4 C;  1KC8 H;  1PXW A;  2GLZ A;  3CCE F;  2VGN A;  3OBW A;  1Q82 H;  3MCA B;  1KQS F;  1GO1 A;  3OW2 F;  1GZ0 A;  3RA6 A;  3V7E A;  3HAX D;  3LFO A;  3VI6 A;  3CG6 A;  1XBI A;  3IR9 A;  4BVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...