3CCRF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccrF00
3PAFA 3CCQF 4BY9D 5G4VC 2QA4F 1YJ9F 4X3LA 3CD6F 1X52A 3WXMB 1Q7YH 3CCUF 3CPWF 1W42A 3CPQA 3N4YA 5GIPC 3CG6A 3CCEF 2OTLF 1JJ2F 3HJWC 3FFMA 3AGKA 3G6EF 1K73H 2KTUA 5DCVA 1S72F 3E1YA 1VQKF 1N8RH 1Q81H 1DT9A 3NK7A 3NMUC 3OBYA 1VQ9F 5FLXM 3SIVA 3J81M 3V7QA 3LWOC 1VQPF 5FJ4C 1RA4A 2VGMA 1PXWA 1KQSF 3G4SF 3N4ZA 3I56F 3J7AR 3RA6A 3CCSF 1W40A 3RA5A 5IT9M 1YHQF 2OHWA 3V7EA 1E7KA 3LWVC 3E20B 1YITF 1VQ7F 3CC7F 2ALEA 5EWRA 3VMFB 1VQ6F 1RLGA 2OTJF 2AIFA 3GYQA 1KD1H 1M1KH 1T0KB 3J80M 2LBXA 3SIUA 1GO0A 3O85A 1VQLF 3VI6A 1VQ8F 1Q82H 5GANK 1X7PA 1GO1A 3LWQC 2CZWA 2BO1A 1YIJF 4BW0B 2HVYD 1VQMF 1SDSA 3G71F 3PLAC 1W3EX 4C4WC 3CC4F 1GZ0A 4NUTA 5A2QM 5GINC 1VQ5F 1VQOF 1VQ4F 1H7MA 1M90H 5GIOC 3CCLF 3OW2F 3CXCF 3NK6A 3CCMF 3OBWA 3NVIB 1QVGF 1YJNF 1CK2A 3LWPC 4X3MA 2FC3A 2I6DA 2OZBA 3I55F 1NJIH 2QI2A 3CCJF 3IR9A 2JNBA 1CN7A 3LFOA 3ON1A 1KC8H 1NMUB 1XBIA 3HAXD 4LCKA 2KTVA 4TZZA 2VGNA 3CMEF 3CCRF 1VQNF 2WALA 1W41A 1IPAA 2KG4A 3CMAF 2LBWA 1YJWF 3CCVF 1X7OA 1K8AH 3JAMM 3JCMM 1W2BF 5EO3A 3MCAB 3CC2F 3NVKE 3LWRC 1Q86H 1K9MH 5GAPK 1YI2F 1QVFF 5G4UC 2QEXF 1ZWZA
chains in the Genus database with same CATH superfamily
4BY9D 1IV1A 5LYJA 1X52A 3CCUF 3CPWF 1PF5A 3QTYA 5GIPC 3VOAA 3CG6A 2N48A 1CLIA 3HJWC 4NWOB 5DCVA 1JFFA 3E1YA 2RHJA 2CHSA 3GTZA 4PWTA 3ELCA 5IJ9B 3MDOA 1Q8RA 2GVIA 3KJKA 3VYSC 5EB1B 3J81M 1TVKA 1TVKB 1H48A 5FJ4C 1RA4A 1PXWA 1KQSF 3G4SF 2NMUA 3RA6A 1W40A 1R1MA 1GX1A 1E7KA 3JAKA 1W59A 3C9UA 5CA0B 1YITF 3TD3A 2ALEA 2W8BC 2OTJF 2H8CA 3HTNA 1KD1H 5CA1B 3J80M 5JQGB 4EB6B 5LXTB 3VI6A 1VQ8F 5GANK 4RHAA 4U3JB 3LWQC 5GONB 3IMPA 4E6EA 2HS0A 2HRYA 2CVLA 4ERHA 1W3EX 2HP0B 3ESJA 5IJ9A 3CC4F 4O4LB 2RHOA 1COMA 2VAWA 5A2QM 4O4JA 3QUWA 2KGWA 5FNVA 3WGMA 3JASB 3JASA 3K14A 4BT3A 1FNJA 3CCLF 3OW2F 3CXCF 2CHTA 4DRXB 3S06A 3CB2A 4C82A 1W55A 5C8YA 4C8EA 4O4IA 3V4DA 4TV9B 3I55F 3KHNA 2HX0A 3HWUA 1W57A 5J2UB 3WGLA 3D01A 4IIJA 4ZK7A 5CB4B 3ON1A 5CB4A 3HAXD 4FFBA 4BT2A 4LCKA 3KJJA 4TZZA 3CMEF 3CCRF 3RYIB 4BT6A 5LA6B 4U3JA 2LBWA 3HKDB 3CCVF 3JAMM 4BVSA 5HY2A 2OTMA 1W2BF 3CC2F 3WJPA 4G4YA 3HKCA 2UYNB 2HP0A 5MN6A 4BT7A 5GAPK 2B33A 1QVFF 1TUBA 1RQ2A 3MQWA 4M8IA 2I6RA 2ZOVA 3WXMB 1Q7YH 3HKBA 1DBFA 3CPQA 3MCQA 1JN1A 3ZOPA 4TV9A 2YYEA 4O2BB 2FGYA 5HY0A 1K73H 5EYPA 4BVRA 2F9ZC 1VQKF 5KMGA 3ZO8A 3NK7A 3OBYA 2AMTA 3JARA 1VQ9F 4EI9A 3SIVA 3LWOC 3IKFA 3B6NA 4O2AB 3N4ZA 5ITZB 2CSLA 3J7AR 4I55A 3FD6A 1IV2A 3LWVC 3E20B 3VIUA 3CC7F 5J2UA 4IHJB 4ZOLB 1XRGA 1VQ6F 2H8EA 3KIZA 5CA1A 3FPIA 3P4EA 4RQOA 5LP6C 3U0OA 1T0AA 4G88A 2RHHA 4BT4A 4I50B 2CZWA 3C9RA 3KE1A 4X1YB 1YIJF 2ZVZA 3D54A 1VQMF 1VH8A 1QU9A 3PLAC 5J2TB 4O4LA 4WBNB 3S02A 4G4WA 4NUTA 2BTQB 1VQ5F 3IKEA 1FFXA 3S0YA 3JAWA 3DDNA 4TV8B 1W5AA 4TV8A 3UT5B 2ZVYA 3ERNA 5GIOC 4LNUB 5EZYA 3C8LA 2UZHA 3WGNA 4ZHQA 1QVGF 3LWPC 4X3MA 1U3PA 2I6DA 2OZBA 2QI2A 3S0HA 3WGJA 1QD9A 3VYTC 2IAFA 5HXZA 3L7QA 5IYZA 5IYZB 2KTVA 5LP6A 1IV3A 3JARB 5MN4A 3IEQA 4X20A 4F6RB 4X1KB 1W41A 1YJWF 2UYPA 1X7OA 1K8AH 3RYCA 3ZP7A 3NVKE 4HNAB 3M84A 1RLUA 2ZAUA 1RQ7A 1U43A 3LWRC 4WBNA 1OFUA 3JAWB 4X1IB 1VQVA 1ZWZA 1VQPF 1W5BA 4C81A 3RYFA 3BYQA 3VOBA 3CCQF 5G4VC 3R0PA 5EIBC 3F6MA 2HRUA 3T80A 2RHLA 5MN5A 1YQNA 4I50A 4G4VA 4TUYA 3FD5A 3FFMA 3AGKA 3G6EF 1KNKA 1ODEA 1S72F 5EYPB 5KMGB 1DT9A 4ZI7A 4ZI7B 2ZF8A 1SA0A 2LCAA 2Z1UA 3V7QA 4R40B 1U3LA 3JVHA 4O4HA 4O4HB 4B45A 3CYPB 1VK3A 1FNKA 3K12A 4YJ2A 3RA5A 4I55B 3VCZA 3V7EA 4U39A 3JAKB 2R751 1VQ7F 3LMEA 3LDTA 1RLGA 1U40A 3GYQA 1T0KB 5LYJB 2LBXA 4C8GA 3SIUA 2BTUA 1GO0A 2Z1TA 3WJRA 1VQLF 4EB6A 5LXTA 1Q82H 3HKBB 1VHAA 1UFYA 5HP7A 1GO1A 3Q8HA 5KX5A 4BW0B 5HY4A 2HVYD 2VXYA 4BVQA 2Q1YA 3P10A 5JCOA 1SDSA 3JALB 1X25A 3JALA 2L26A 2P6YA 4I4TA 2Z1EA 3I3FA 4NQ3A 2PMPA 2UYKA 5GINC 4B5CA 5AVMA 1VQOF 1H7MA 5HXUA 5FNVB 2VAPA 3DC2A 4ZHVA 4LNUA 4DRXA 3N2GB 2HS4A 4ZHYB 3N2KB 3RE3A 1W5EA 3F0FA 1YJNF 2FC3A 1NJIH 3CCJF 3IR9A 4B62A 5IJ0B 2HP3A 4ZHWA 5IJ0A 1CN7A 2H6LA 3LFOA 1NMUB 2ZODA 1XBIA 5JCOC 4EI8A 3VO8A 3E22B 5JH7B 5HWEA 5JH7A 3HKEB 3RYIA 1SA0B 2GLZA 3WPXA 2WALA 5JVDB 3CMAF 2Q1XA 3FBAA 1YGYA 4O2AA 3JCMM 1XV2A 5EO3A 2DYYA 1NQ3A 3HKCB 4YJ2B 4B46A 4I4TB 1Q86H 2IQQA 1YI2F 1H47A 2IG8A 3UT5A 5CA0A 5EAZA 4BVTA 3PAFA 2UYJA 3GHZA 4EI7A 2QA4F 1YJ9F 2R6R1 4X3LA 3CD6F 3N2GA 3P0ZA 4KWEA 1W42A 3N4YA 4O4IB 1JD1A 3S0WA 3V3TA 3CCEF 4TUYB 4BT5A 5LOVA 3VYUC 5LOVB 1JJ2F 1SZQA 1Z5VA 2OTLF 2EWCA 2KTUA 3K2XA 2CWJA 2MQEA 1JFFB 3C9SA 4YJ3B 1N8RH 1Q81H 3IEWA 3NMUC 3JATA 3E22A 3JATB 2RB9A 3WJQA 3F0DA 5FLXM 4X20B 4DXDA 4G4ZA 3F0EA 1J7HA 2VGMA 3LYBA 3I56F 5ITZA 4HNAA 1FSZA 5C8YB 3CCSF 5IT9M 1YHQF 1JY8A 2OHWA 5HY1A 4X1IA 2Z1FA 4IHJA 2V9YA 4ZOLA 3RYFB 5EWRA 3VMFB 4IIJB 2AIFA 1M1KH 3ZP4A 3WPWA 5JQGA 1KNJA 3OONA 3RYHA 3O85A 5BMVB 5BMVA 3HKEA 4C8IA 1ONIA 5HP8A 1X7PA 5LA6A 3MBMA 4O2BA 2BO1A 2BTOA 2VAMA 4XCQA 5GONA 3G71F 2UYNA 4YJ3A 4C4WC 1IV4A 1GZ0A 4O4JB 2DT4A 1XHOA 1VQ4F 1TUBB 2AIZP 1M90H 3EORA 2K1SA 5EIBD 2LBTA 3CCMF 3NK6A 2GZLA 2PHNA 2QTPA 3OBWA 3WGKA 5EZYB 3NVIB 3N2KA 1W581 2G9IA 4ZHQB 1CK2A 1QAHA 3VTIC 2HS3A 2Z01A 2JNBA 5EB0A 2CW4A 1KC8H 4FFBB 1W5FA 3C9TA 3RYHB 2YXZA 5LP6B 2VGNA 1VQNF 4X1KA 4F6RA 3M1XA 1IPAA 2KG4A 3I7TA 5KX5B 3M4SA 5JVDA 3QHDA 1UI9A 3HKDA 3TD4A 4X1YA 2HQSC 3S03A 4G4XA 3F0GA 5B8FA 3MCAB 3RYCB 3K0TA 3CYQA 5J2TA 3D00A 1K9MH 1Z5WA 1FFXB 1OAPA 3TD5A 2QEXF 5G4UC
chains in the Genus database with same CATH topology
3PAFA 3CCQF 4BY9D 5G4VC 4EI7A 2QA4F 1YJ9F 4X3LA 3CD6F 1X52A 3WXMB 1Q7YH 3CCUF 3CPWF 1W42A 3CPQA 3N4YA 5GIPC 3CG6A 3V3TA 3CCEF 2FGYA 2OTLF 1JJ2F 3HJWC 3FFMA 3AGKA 5HY0A 3G6EF 1K73H 2KTUA 5DCVA 4BVRA 1S72F 3E1YA 2F9ZC 1VQKF 1N8RH 1Q81H 1DT9A 3NK7A 3NMUC 3OBYA 1VQ9F 5FLXM 4EI9A 3SIVA 3J81M 3V7QA 3LWOC 1VQPF 5FJ4C 1RA4A 2VGMA 1PXWA 1KQSF 3G4SF 3N4ZA 3I56F 3J7AR 3RA6A 3CCSF 1W40A 3RA5A 5IT9M 1YHQF 2OHWA 5HY1A 3V7EA 1E7KA 3LWVC 3E20B 1YITF 1VQ7F 3CC7F 2ALEA 5EWRA 3VMFB 1VQ6F 1RLGA 2OTJF 2AIFA 3GYQA 1KD1H 1M1KH 1T0KB 3J80M 2LBXA 3SIUA 1GO0A 3O85A 1VQLF 3VI6A 1VQ8F 1Q82H 5GANK 1X7PA 1GO1A 3LWQC 2CZWA 4XCQA 2BO1A 1YIJF 4BW0B 5HY4A 2HVYD 4BVQA 1VQMF 1SDSA 3G71F 3PLAC 1W3EX 4C4WC 3CC4F 1GZ0A 4NQ3A 4NUTA 5A2QM 5GINC 1VQ5F 1VQOF 1VQ4F 1H7MA 5HXUA 1M90H 5GIOC 3CCLF 3OW2F 3CXCF 3NK6A 3CCMF 3OBWA 3NVIB 1QVGF 1YJNF 1CK2A 3LWPC 4X3MA 2FC3A 2I6DA 2OZBA 3I55F 1NJIH 2QI2A 3CCJF 3IR9A 2JNBA 1CN7A 3LFOA 3ON1A 1KC8H 1NMUB 1XBIA 3HAXD 5HXZA 4EI8A 4LCKA 2KTVA 5HWEA 4TZZA 2VGNA 3CMEF 3CCRF 1VQNF 2GLZA 2WALA 1W41A 1IPAA 2KG4A 3CMAF 2LBWA 1YJWF 3CCVF 1X7OA 1K8AH 3JAMM 3JCMM 4BVSA 5HY2A 1W2BF 5EO3A 3MCAB 3CC2F 3NVKE 3LWRC 1Q86H 3D00A 1K9MH 5GAPK 1YI2F 1QVFF 5G4UC 2QEXF 1ZWZA 4BVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAF A;  3CCQ F;  4BY9 D;  5G4V C;  2QA4 F;  1YJ9 F;  4X3L A;  3CD6 F;  1X52 A;  3WXM B;  1Q7Y H;  3CCU F;  3CPW F;  1W42 A;  3CPQ A;  3N4Y A;  5GIP C;  3CG6 A;  3CCE F;  2OTL F;  1JJ2 F;  3HJW C;  3FFM A;  3AGK A;  3G6E F;  1K73 H;  2KTU A;  5DCV A;  1S72 F;  3E1Y A;  1VQK F;  1N8R H;  1Q81 H;  1DT9 A;  3NK7 A;  3NMU C;  3OBY A;  1VQ9 F;  5FLX M;  3SIV A;  3J81 M;  3V7Q A;  3LWO C;  1VQP F;  5FJ4 C;  1RA4 A;  2VGM A;  1PXW A;  1KQS F;  3G4S F;  3N4Z A;  3I56 F;  3J7A R;  3RA6 A;  3CCS F;  1W40 A;  3RA5 A;  5IT9 M;  1YHQ F;  2OHW A;  3V7E A;  1E7K A;  3LWV C;  3E20 B;  1YIT F;  1VQ7 F;  3CC7 F;  2ALE A;  5EWR A;  3VMF B;  1VQ6 F;  1RLG A;  2OTJ F;  2AIF A;  3GYQ A;  1KD1 H;  1M1K H;  1T0K B;  3J80 M;  2LBX A;  3SIU A;  1GO0 A;  3O85 A;  1VQL F;  3VI6 A;  1VQ8 F;  1Q82 H;  5GAN K;  1X7P A;  1GO1 A;  3LWQ C;  2CZW A;  2BO1 A;  1YIJ F;  4BW0 B;  2HVY D;  1VQM F;  1SDS A;  3G71 F;  3PLA C;  1W3E X;  4C4W C;  3CC4 F;  1GZ0 A;  4NUT A;  5A2Q M;  5GIN C;  1VQ5 F;  1VQO F;  1VQ4 F;  1H7M A;  1M90 H;  5GIO C;  3CCL F;  3OW2 F;  3CXC F;  3NK6 A;  3CCM F;  3OBW A;  3NVI B;  1QVG F;  1YJN F;  1CK2 A;  3LWP C;  4X3M A;  2FC3 A;  2I6D A;  2OZB A;  3I55 F;  1NJI H;  2QI2 A;  3CCJ F;  3IR9 A;  2JNB A;  1CN7 A;  3LFO A;  3ON1 A;  1KC8 H;  1NMU B;  1XBI A;  3HAX D;  4LCK A;  2KTV A;  4TZZ A;  2VGN A;  3CME F;  3CCR F;  1VQN F;  2WAL A;  1W41 A;  1IPA A;  2KG4 A;  3CMA F;  2LBW A;  1YJW F;  3CCV F;  1X7O A;  1K8A H;  3JAM M;  3JCM M;  1W2B F;  5EO3 A;  3MCA B;  3CC2 F;  3NVK E;  3LWR C;  1Q86 H;  1K9M H;  5GAP K;  1YI2 F;  1QVF F;  5G4U C;  2QEX F;  1ZWZ A; 
#chains in the Genus database with same CATH topology
 4BY9 D;  1IV1 A;  5LYJ A;  1X52 A;  3CCU F;  3CPW F;  1PF5 A;  3QTY A;  5GIP C;  3VOA A;  3CG6 A;  2N48 A;  1CLI A;  3HJW C;  4NWO B;  5DCV A;  1JFF A;  3E1Y A;  2RHJ A;  2CHS A;  3GTZ A;  4PWT A;  3ELC A;  5IJ9 B;  3MDO A;  1Q8R A;  2GVI A;  3KJK A;  3VYS C;  5EB1 B;  3J81 M;  1TVK A;  1TVK B;  1H48 A;  5FJ4 C;  1RA4 A;  1PXW A;  1KQS F;  3G4S F;  2NMU A;  3RA6 A;  1W40 A;  1R1M A;  1GX1 A;  1E7K A;  3JAK A;  1W59 A;  3C9U A;  5CA0 B;  1YIT F;  3TD3 A;  2ALE A;  2W8B C;  2OTJ F;  2H8C A;  3HTN A;  1KD1 H;  5CA1 B;  3J80 M;  5JQG B;  4EB6 B;  5LXT B;  3VI6 A;  1VQ8 F;  5GAN K;  4RHA A;  4U3J B;  3LWQ C;  5GON B;  3IMP A;  4E6E A;  2HS0 A;  2HRY A;  2CVL A;  4ERH A;  1W3E X;  2HP0 B;  3ESJ A;  5IJ9 A;  3CC4 F;  4O4L B;  2RHO A;  1COM A;  2VAW A;  5A2Q M;  4O4J A;  3QUW A;  2KGW A;  5FNV A;  3WGM A;  3JAS B;  3JAS A;  3K14 A;  4BT3 A;  1FNJ A;  3CCL F;  3OW2 F;  3CXC F;  2CHT A;  4DRX B;  3S06 A;  3CB2 A;  4C82 A;  1W55 A;  5C8Y A;  4C8E A;  4O4I A;  3V4D A;  4TV9 B;  3I55 F;  3KHN A;  2HX0 A;  3HWU A;  1W57 A;  5J2U B;  3WGL A;  3D01 A;  4IIJ A;  4ZK7 A;  5CB4 B;  3ON1 A;  5CB4 A;  3HAX D;  4FFB A;  4BT2 A;  4LCK A;  3KJJ A;  4TZZ A;  3CME F;  3CCR F;  3RYI B;  4BT6 A;  5LA6 B;  4U3J A;  2LBW A;  3HKD B;  3CCV F;  3JAM M;  4BVS A;  5HY2 A;  2OTM A;  1W2B F;  3CC2 F;  3WJP A;  4G4Y A;  3HKC A;  2UYN B;  2HP0 A;  5MN6 A;  4BT7 A;  5GAP K;  2B33 A;  1QVF F;  1TUB A;  1RQ2 A;  3MQW A;  4M8I A;  2I6R A;  2ZOV A;  3WXM B;  1Q7Y H;  3HKB A;  1DBF A;  3CPQ A;  3MCQ A;  1JN1 A;  3ZOP A;  4TV9 A;  2YYE A;  4O2B B;  2FGY A;  5HY0 A;  1K73 H;  5EYP A;  4BVR A;  2F9Z C;  1VQK F;  5KMG A;  3ZO8 A;  3NK7 A;  3OBY A;  2AMT A;  3JAR A;  1VQ9 F;  4EI9 A;  3SIV A;  3LWO C;  3IKF A;  3B6N A;  4O2A B;  3N4Z A;  5ITZ B;  2CSL A;  3J7A R;  4I55 A;  3FD6 A;  1IV2 A;  3LWV C;  3E20 B;  3VIU A;  3CC7 F;  5J2U A;  4IHJ B;  4ZOL B;  1XRG A;  1VQ6 F;  2H8E A;  3KIZ A;  5CA1 A;  3FPI A;  3P4E A;  4RQO A;  5LP6 C;  3U0O A;  1T0A A;  4G88 A;  2RHH A;  4BT4 A;  4I50 B;  2CZW A;  3C9R A;  3KE1 A;  4X1Y B;  1YIJ F;  2ZVZ A;  3D54 A;  1VQM F;  1VH8 A;  1QU9 A;  3PLA C;  5J2T B;  4O4L A;  4WBN B;  3S02 A;  4G4W A;  4NUT A;  2BTQ B;  1VQ5 F;  3IKE A;  1FFX A;  3S0Y A;  3JAW A;  3DDN A;  4TV8 B;  1W5A A;  4TV8 A;  3UT5 B;  2ZVY A;  3ERN A;  5GIO C;  4LNU B;  5EZY A;  3C8L A;  2UZH A;  3WGN A;  4ZHQ A;  1QVG F;  3LWP C;  4X3M A;  1U3P A;  2I6D A;  2OZB A;  2QI2 A;  3S0H A;  3WGJ A;  1QD9 A;  3VYT C;  2IAF A;  5HXZ A;  3L7Q A;  5IYZ A;  5IYZ B;  2KTV A;  5LP6 A;  1IV3 A;  3JAR B;  5MN4 A;  3IEQ A;  4X20 A;  4F6R B;  4X1K B;  1W41 A;  1YJW F;  2UYP A;  1X7O A;  1K8A H;  3RYC A;  3ZP7 A;  3NVK E;  4HNA B;  3M84 A;  1RLU A;  2ZAU A;  1RQ7 A;  1U43 A;  3LWR C;  4WBN A;  1OFU A;  3JAW B;  4X1I B;  1VQV A;  1ZWZ A;  1VQP F;  1W5B A;  4C81 A;  3RYF A;  3BYQ A;  3VOB A;  3CCQ F;  5G4V C;  3R0P A;  5EIB C;  3F6M A;  2HRU A;  3T80 A;  2RHL A;  5MN5 A;  1YQN A;  4I50 A;  4G4V A;  4TUY A;  3FD5 A;  3FFM A;  3AGK A;  3G6E F;  1KNK A;  1ODE A;  1S72 F;  5EYP B;  5KMG B;  1DT9 A;  4ZI7 A;  4ZI7 B;  2ZF8 A;  1SA0 A;  2LCA A;  2Z1U A;  3V7Q A;  4R40 B;  1U3L A;  3JVH A;  4O4H A;  4O4H B;  4B45 A;  3CYP B;  1VK3 A;  1FNK A;  3K12 A;  4YJ2 A;  3RA5 A;  4I55 B;  3VCZ A;  3V7E A;  4U39 A;  3JAK B;  2R75 1;  1VQ7 F;  3LME A;  3LDT A;  1RLG A;  1U40 A;  3GYQ A;  1T0K B;  5LYJ B;  2LBX A;  4C8G A;  3SIU A;  2BTU A;  1GO0 A;  2Z1T A;  3WJR A;  1VQL F;  4EB6 A;  5LXT A;  1Q82 H;  3HKB B;  1VHA A;  1UFY A;  5HP7 A;  1GO1 A;  3Q8H A;  5KX5 A;  4BW0 B;  5HY4 A;  2HVY D;  2VXY A;  4BVQ A;  2Q1Y A;  3P10 A;  5JCO A;  1SDS A;  3JAL B;  1X25 A;  3JAL A;  2L26 A;  2P6Y A;  4I4T A;  2Z1E A;  3I3F A;  4NQ3 A;  2PMP A;  2UYK A;  5GIN C;  4B5C A;  5AVM A;  1VQO F;  1H7M A;  5HXU A;  5FNV B;  2VAP A;  3DC2 A;  4ZHV A;  4LNU A;  4DRX A;  3N2G B;  2HS4 A;  4ZHY B;  3N2K B;  3RE3 A;  1W5E A;  3F0F A;  1YJN F;  2FC3 A;  1NJI H;  3CCJ F;  3IR9 A;  4B62 A;  5IJ0 B;  2HP3 A;  4ZHW A;  5IJ0 A;  1CN7 A;  2H6L A;  3LFO A;  1NMU B;  2ZOD A;  1XBI A;  5JCO C;  4EI8 A;  3VO8 A;  3E22 B;  5JH7 B;  5HWE A;  5JH7 A;  3HKE B;  3RYI A;  1SA0 B;  2GLZ A;  3WPX A;  2WAL A;  5JVD B;  3CMA F;  2Q1X A;  3FBA A;  1YGY A;  4O2A A;  3JCM M;  1XV2 A;  5EO3 A;  2DYY A;  1NQ3 A;  3HKC B;  4YJ2 B;  4B46 A;  4I4T B;  1Q86 H;  2IQQ A;  1YI2 F;  1H47 A;  2IG8 A;  3UT5 A;  5CA0 A;  5EAZ A;  4BVT A;  3PAF A;  2UYJ A;  3GHZ A;  4EI7 A;  2QA4 F;  1YJ9 F;  2R6R 1;  4X3L A;  3CD6 F;  3N2G A;  3P0Z A;  4KWE A;  1W42 A;  3N4Y A;  4O4I B;  1JD1 A;  3S0W A;  3V3T A;  3CCE F;  4TUY B;  4BT5 A;  5LOV A;  3VYU C;  5LOV B;  1JJ2 F;  1SZQ A;  1Z5V A;  2OTL F;  2EWC A;  2KTU A;  3K2X A;  2CWJ A;  2MQE A;  1JFF B;  3C9S A;  4YJ3 B;  1N8R H;  1Q81 H;  3IEW A;  3NMU C;  3JAT A;  3E22 A;  3JAT B;  2RB9 A;  3WJQ A;  3F0D A;  5FLX M;  4X20 B;  4DXD A;  4G4Z A;  3F0E A;  1J7H A;  2VGM A;  3LYB A;  3I56 F;  5ITZ A;  4HNA A;  1FSZ A;  5C8Y B;  3CCS F;  5IT9 M;  1YHQ F;  1JY8 A;  2OHW A;  5HY1 A;  4X1I A;  2Z1F A;  4IHJ A;  2V9Y A;  4ZOL A;  3RYF B;  5EWR A;  3VMF B;  4IIJ B;  2AIF A;  1M1K H;  3ZP4 A;  3WPW A;  5JQG A;  1KNJ A;  3OON A;  3RYH A;  3O85 A;  5BMV B;  5BMV A;  3HKE A;  4C8I A;  1ONI A;  5HP8 A;  1X7P A;  5LA6 A;  3MBM A;  4O2B A;  2BO1 A;  2BTO A;  2VAM A;  4XCQ A;  5GON A;  3G71 F;  2UYN A;  4YJ3 A;  4C4W C;  1IV4 A;  1GZ0 A;  4O4J B;  2DT4 A;  1XHO A;  1VQ4 F;  1TUB B;  2AIZ P;  1M90 H;  3EOR A;  2K1S A;  5EIB D;  2LBT A;  3CCM F;  3NK6 A;  2GZL A;  2PHN A;  2QTP A;  3OBW A;  3WGK A;  5EZY B;  3NVI B;  3N2K A;  1W58 1;  2G9I A;  4ZHQ B;  1CK2 A;  1QAH A;  3VTI C;  2HS3 A;  2Z01 A;  2JNB A;  5EB0 A;  2CW4 A;  1KC8 H;  4FFB B;  1W5F A;  3C9T A;  3RYH B;  2YXZ A;  5LP6 B;  2VGN A;  1VQN F;  4X1K A;  4F6R A;  3M1X A;  1IPA A;  2KG4 A;  3I7T A;  5KX5 B;  3M4S A;  5JVD A;  3QHD A;  1UI9 A;  3HKD A;  3TD4 A;  4X1Y A;  2HQS C;  3S03 A;  4G4X A;  3F0G A;  5B8F A;  3MCA B;  3RYC B;  3K0T A;  3CYQ A;  5J2T A;  3D00 A;  1K9M H;  1Z5W A;  1FFX B;  1OAP A;  3TD5 A;  2QEX F;  5G4U C; 
#chains in the Genus database with same CATH homology
 3PAF A;  3CCQ F;  4BY9 D;  5G4V C;  4EI7 A;  2QA4 F;  1YJ9 F;  4X3L A;  3CD6 F;  1X52 A;  3WXM B;  1Q7Y H;  3CCU F;  3CPW F;  1W42 A;  3CPQ A;  3N4Y A;  5GIP C;  3CG6 A;  3V3T A;  3CCE F;  2FGY A;  2OTL F;  1JJ2 F;  3HJW C;  3FFM A;  3AGK A;  5HY0 A;  3G6E F;  1K73 H;  2KTU A;  5DCV A;  4BVR A;  1S72 F;  3E1Y A;  2F9Z C;  1VQK F;  1N8R H;  1Q81 H;  1DT9 A;  3NK7 A;  3NMU C;  3OBY A;  1VQ9 F;  5FLX M;  4EI9 A;  3SIV A;  3J81 M;  3V7Q A;  3LWO C;  1VQP F;  5FJ4 C;  1RA4 A;  2VGM A;  1PXW A;  1KQS F;  3G4S F;  3N4Z A;  3I56 F;  3J7A R;  3RA6 A;  3CCS F;  1W40 A;  3RA5 A;  5IT9 M;  1YHQ F;  2OHW A;  5HY1 A;  3V7E A;  1E7K A;  3LWV C;  3E20 B;  1YIT F;  1VQ7 F;  3CC7 F;  2ALE A;  5EWR A;  3VMF B;  1VQ6 F;  1RLG A;  2OTJ F;  2AIF A;  3GYQ A;  1KD1 H;  1M1K H;  1T0K B;  3J80 M;  2LBX A;  3SIU A;  1GO0 A;  3O85 A;  1VQL F;  3VI6 A;  1VQ8 F;  1Q82 H;  5GAN K;  1X7P A;  1GO1 A;  3LWQ C;  2CZW A;  4XCQ A;  2BO1 A;  1YIJ F;  4BW0 B;  5HY4 A;  2HVY D;  4BVQ A;  1VQM F;  1SDS A;  3G71 F;  3PLA C;  1W3E X;  4C4W C;  3CC4 F;  1GZ0 A;  4NQ3 A;  4NUT A;  5A2Q M;  5GIN C;  1VQ5 F;  1VQO F;  1VQ4 F;  1H7M A;  5HXU A;  1M90 H;  5GIO C;  3CCL F;  3OW2 F;  3CXC F;  3NK6 A;  3CCM F;  3OBW A;  3NVI B;  1QVG F;  1YJN F;  1CK2 A;  3LWP C;  4X3M A;  2FC3 A;  2I6D A;  2OZB A;  3I55 F;  1NJI H;  2QI2 A;  3CCJ F;  3IR9 A;  2JNB A;  1CN7 A;  3LFO A;  3ON1 A;  1KC8 H;  1NMU B;  1XBI A;  3HAX D;  5HXZ A;  4EI8 A;  4LCK A;  2KTV A;  5HWE A;  4TZZ A;  2VGN A;  3CME F;  3CCR F;  1VQN F;  2GLZ A;  2WAL A;  1W41 A;  1IPA A;  2KG4 A;  3CMA F;  2LBW A;  1YJW F;  3CCV F;  1X7O A;  1K8A H;  3JAM M;  3JCM M;  4BVS A;  5HY2 A;  1W2B F;  5EO3 A;  3MCA B;  3CC2 F;  3NVK E;  3LWR C;  1Q86 H;  3D00 A;  1K9M H;  5GAP K;  1YI2 F;  1QVF F;  5G4U C;  2QEX F;  1ZWZ A;  4BVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...