3CCRF

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ccrF00
1XBIA 3CPQA 1Q86H 3G71F 3J81M 1VQ4F 4BY9D 1GO0A 1VQ8F 2OHWA 5G4UC 1DT9A 3LWQC 1VQMF 3VMFB 4X3MA 1K8AH 3N4YA 2AIFA 1QVFF 1PXWA 3O85A 3SIUA 1Q82H 5DCVA 2FC3A 1X52A 3PLAC 1W2BF 1VQNF 3NVKE 5GIOC 3CCJF 1X7OA 5FLXM 3LWPC 3E1YA 2HVYD 1IPAA 1W42A 1YJ9F 1KQSF 3CMEF 2OZBA 3LWOC 3OBWA 3V7QA 3SIVA 3G4SF 1QVGF 1VQ5F 3OBYA 2JNBA 4TZZA 3CCUF 1VQOF 1YHQF 1GO1A 1W40A 3AGKA 3CCMF 3N4ZA 1M1KH 3CPWF 1VQ7F 3JAMM 1NJIH 3IR9A 3ON1A 3CCLF 4LCKA 1YITF 3I55F 3CCSF 3LWVC 3E20B 5G4VC 1K9MH 3RA6A 1VQKF 1YJNF 1YJWF 3CCVF 1CN7A 2KG4A 2KTVA 1VQ6F 3CG6A 3PAFA 3CMAF 3CC2F 3CC7F 3HJWC 1YIJF 3GYQA 2WALA 2VGMA 1H7MA 1VQLF 2QEXF 1VQPF 2ALEA 2I6DA 1NMUB 1GZ0A 3NMUC 3JCMM 5A2QM 5GAPK 1SDSA 4C4WC 5EO3A 3G6EF 5GINC 2KTUA 2LBXA 1W3EX 1RA4A 3CCEF 3VI6A 3CCRF 3NK7A 1KD1H 1M90H 3CXCF 4NUTA 1Q7YH 3V7EA 3RA5A 1X7PA 2CZWA 3LWRC 1K73H 3CC4F 2OTJF 1KC8H 1N8RH 1S72F 1ZWZA 2QI2A 3FFMA 1T0KB 1W41A 5GANK 4X3LA 3MCAB 5GIPC 3WXMB 1JJ2F 4BW0B 1CK2A 1YI2F 3LFOA 2LBWA 2VGNA 2BO1A 5IT9M 2OTLF 3CCQF 3HAXD 3J7AR 1Q81H 3J80M 3CD6F 1E7KA 3NK6A 3I56F 1VQ9F 1RLGA 2QA4F 5FJ4C 5EWRA 3OW2F 3NVIB
chains in the Genus database with same CATH superfamily
2Z1EA 3CPQA 1Q86H 2HP0B 3VTIC 3J81M 3M4SA 2VAPA 4BY9D 4I55A 1VQ8F 3HKCB 3OONA 4O4LB 2OHWA 4ZHWA 4ZI7A 5G4UC 1DT9A 3LWQC 3RYIA 5KX5A 4G4VA 1FNKA 3VMFB 5ITZB 3N4YA 1QVFF 5FNVA 4X20B 3SIUA 3TD4A 3CYQA 2FC3A 4X1IA 4FFBB 2DT4A 4RQOA 1YGYA 3NVKE 1ONIA 5GIOC 3JARB 4TV8B 4G4WA 2HVYD 2HS4A 1IPAA 1W59A 4BT5A 2HRUA 3LWOC 3JASB 2JNBA 1JN1A 3CCUF 3D01A 3AGKA 3N4ZA 3CPWF 4EB6B 2QTPA 3CCLF 2VXYA 5ITZA 4YJ2B 4G88A 4RHAA 3V3TA 4FFBA 5CA1A 1CN7A 2Z1UA 4YJ3B 1TVKA 2HRYA 4R40B 4O2AB 1W55A 5EYPA 3GYQA 1UI9A 3JASA 1H7MA 1VQPF 2DYYA 2ALEA 3ERNA 3JAWB 1GZ0A 1H47A 4IIJB 3NMUC 2N48A 3JCMM 5GAPK 1SDSA 5EO3A 3F0EA 3FD6A 4B5CA 1QU9A 2W8BC 1RLUA 4C8GA 1X25A 3I7TA 3E22B 4YJ2A 2HX0A 5AVMA 1M90H 2IG8A 4ERHA 5KMGB 1Q7YH 2LBTA 3ZP7A 3LWRC 2RB9A 4ZHVA 4BVSA 1COMA 3K2XA 4YJ3A 5GANK 4NQ3A 4TUYB 5J2UB 3WXMB 4HNAB 1CK2A 2Q1YA 3LFOA 3JATB 5LA6B 3DC2A 3WGNA 2OTLF 3RYHA 5B8FA 2G9IA 3JAWA 3HAXD 3VOBA 2UYNB 5JVDA 3NK6A 5IJ9A 4WBNB 1FNJA 1FSZA 3LMEA 1RLGA 2V9YA 5EWRA 3ZP4A 5MN4A 1QD9A 3JALA 3G71F 5KMGA 3HKEA 2ZOVA 3BYQA 3HKBB 3I3FA 3S03A 5JH7A 1GX1A 3R0PA 4ZOLB 5HWEA 5JQGB 3S02A 4TUYA 5J2UA 3MCQA 4O2BA 4HNAA 1PF5A 3O85A 3ELCA 3JATA 5LA6A 2FGYA 1Q82H 5DCVA 2P6YA 5LOVB 4LNUB 3PLAC 1CLIA 2HQSC 4WBNA 2BTUA 5IYZB 3LWPC 1UFYA 3E1YA 4X1YB 3S0YA 1Z5WA 3CMEF 4G4YA 3SIVA 3P4EA 4I4TA 1VQ5F 1H48A 2CSLA 1GO1A 1KNJA 3HKBA 1M1KH 3Q8HA 2ZAUA 2BTOA 3JAMM 5LXTB 4ZOLA 4C8IA 5JQGA 4LCKA 3JAKB 2HP3A 2Z01A 4DRXB 3I55F 1W5FA 4BVQA 3LWVC 2LCAA 3CCSF 4B45A 2RHLA 5HXUA 1IV1A 1VQKF 2H8EA 3M84A 5LOVA 1VHAA 1YJNF 2NMUA 4B62A 5LP6B 1RQ2A 1VQ6F 2UZHA 3CC2F 3HJWC 4X1YA 2HP0A 4I50B 3VO8A 3D00A 4C8EA 1VQLF 1W581 2K1SA 3HKCA 3N2KB 4G4ZA 5GONB 4O4LA 2PHNA 3ZO8A 3K0TA 3MBMA 1T0AA 3MDOA 1JFFB 2BTQB 2RHJA 5GINC 5LP6C 3JAKA 4X20A 3CCEF 4C82A 3CCRF 1KD1H 2ZVYA 3KE1A 4NUTA 2KGWA 3C8LA 4EI7A 3QUWA 1X7PA 2OTJF 1VQVA 1N8RH 3JARA 4TV8A 2B33A 2QI2A 5C8YB 3RYFB 4X3LA 2Z1FA 2GZLA 5EAZA 5MN6A 2VGNA 4B46A 1XRGA 3CCQF 2I6RA 1R1MA 3N2GB 4BT3A 3J7AR 4EB6A 3I56F 3LDTA 1W5AA 3GHZA 2QA4F 2HS0A 3RYCB 1XBIA 2CWJA 2YXZA 5EIBC 1VQ4F 1GO0A 3IKEA 3TD3A 5LYJB 4E6EA 2R6R1 5J2TB 3U0OA 1TUBB 1VQMF 2GLZA 5C8YA 1SA0B 4O2AA 3VIUA 3RYFA 4F6RB 4X3MA 1K8AH 2PMPA 2CHTA 1PXWA 4BVRA 4O4IB 4U39A 3WGKA 4ZHQB 3UT5B 5EB0A 4C81A 4IIJA 1X52A 1U43A 2CW4A 4NWOB 4XCQA 2ZF8A 3EORA 1QAHA 3CCJF 3E22A 4IHJB 3D54A 3TD5A 1W42A 3CYPB 3V4DA 1KQSF 3OBWA 3C9SA 3V7QA 3G4SF 2GVIA 1VQOF 3VOAA 1YHQF 1OAPA 2HS3A 3CCMF 3WGJA 3WGLA 1TUBA 1VQ7F 3WJQA 5CB4B 5BMVB 3IR9A 5CA0B 2AIZP 5HP8A 3K14A 1IV3A 4ZHYB 4O4IA 5G4VC 3GTZA 4KWEA 3RA6A 4ZHQA 3UT5A 3C9UA 1IV4A 2UYNA 1YJWF 3CCVF 2CHSA 2KG4A 3WGMA 1OFUA 3CG6A 2EWCA 3RYIB 3CMAF 4IHJA 3VYTC 3ESJA 2ZVZA 2WALA 1W5EA 5FNVB 1U3PA 3S06A 4BT2A 2UYJA 2I6DA 1DBFA 3K12A 4O4JB 5EIBD 4X1IB 5IJ0B 5A2QM 4C4WC 2F9ZC 3KIZA 4G4XA 3G6EF 4BT4A 5BMVA 1W3EX 2H6LA 3C9RA 3VI6A 5HP7A 3CXCF 4LNUA 5HY2A 3FBAA 3V7EA 3RA5A 4ZK7A 1K73H 3F0FA 1JD1A 4X1KB 1KC8H 1S72F 1Q8RA 5IYZA 3IEWA 4DXDA 1W41A 1SZQA 3P10A 5JCOC 2UYKA 4U3JB 3MCAB 3HKDB 1YQNA 4BVTA 5GIPC 4BW0B 4TV9B 2L26A 2LBWA 2BO1A 5IT9M 1ODEA 4O4JA 3CD6F 5JCOA 1Z5VA 5IJ0A 5LXTA 1E7KA 3IKFA 1FFXB 3DDNA 5CA1B 1VQ9F 3IEQA 3S0WA 2H8CA 5EZYB 1TVKB 4DRXA 3WPXA 3MQWA 1KNKA 3KHNA 5HXZA 3WJRA 3JVHA 5EYPB 2IQQA 4BT6A 1U3LA 5HY0A 3QTYA 5LP6A 1J7HA 4X1KA 3F6MA 3T80A 3IMPA 4I50A 4U3JA 3F0DA 2AIFA 3HKDA 4TV9A 3N2KA 5GONA 3M1XA 2VAWA 1JFFA 1W2BF 1VQNF 1IV2A 1FFXA 4PWTA 1X7OA 5FLXM 5EZYA 1YJ9F 3F0GA 2OZBA 1QVGF 3LYBA 2R751 3OBYA 4TZZA 1W40A 3RYHB 5JVDB 5IJ9B 1NJIH 1VH8A 3ON1A 3WJPA 1YITF 2UYPA 1VK3A 3E20B 3HTNA 1K9MH 2RHOA 3JALB 3FD5A 3N2GA 3HKEB 2OTMA 3P0ZA 2KTVA 2Z1TA 5EB1B 4EI8A 3PAFA 4O4HB 5JH7B 3S0HA 2YYEA 3KJJA 2RHHA 3RYCA 3CC7F 2CVLA 5HY4A 3HWUA 1YIJF 5MN5A 3VYSC 4M8IA 2VGMA 4O2BB 4EI9A 2QEXF 5LYJA 3C9TA 1NMUB 5J2TA 1W57A 3RE3A 3KJKA 3FPIA 1SA0A 2IAFA 3B6NA 4F6RA 2KTUA 2LBXA 3L7QA 2ZODA 1RA4A 2Q1XA 3NK7A 2AMTA 3VYUC 4I4TB 4I55B 3VCZA 2CZWA 1RQ7A 3CC4F 2VAMA 4ZI7B 1ZWZA 3FFMA 1T0KB 4O4HA 5KX5B 3CB2A 1XV2A 1JY8A 1YI2F 1JJ2F 2MQEA 1XHOA 3ZOPA 5HY1A 1Q81H 3J80M 3QHDA 5CB4A 5CA0A 1NQ3A 1W5BA 4BT7A 1U40A 3WPWA 5FJ4C 3OW2F 3NVIB
chains in the Genus database with same CATH topology
1XBIA 3CPQA 5HXZA 1Q86H 3G71F 3J81M 1VQ4F 4BY9D 1GO0A 1VQ8F 5HY0A 2OHWA 5G4UC 1DT9A 3LWQC 1VQMF 2GLZA 5HWEA 3VMFB 4X3MA 1K8AH 3N4YA 2AIFA 1QVFF 1PXWA 4BVRA 3O85A 3SIUA 2FGYA 1Q82H 5DCVA 2FC3A 1X52A 3PLAC 4XCQA 1W2BF 1VQNF 3NVKE 5GIOC 3CCJF 1X7OA 5FLXM 3LWPC 3E1YA 2HVYD 1IPAA 1W42A 1YJ9F 1KQSF 3CMEF 2OZBA 3LWOC 3OBWA 3V7QA 3SIVA 3G4SF 1QVGF 1VQ5F 3OBYA 2JNBA 4TZZA 3CCUF 1VQOF 1YHQF 1GO1A 1W40A 3AGKA 3CCMF 3N4ZA 1M1KH 3CPWF 1VQ7F 3JAMM 1NJIH 3IR9A 3ON1A 3CCLF 4LCKA 1YITF 3I55F 3CCSF 4BVQA 3LWVC 3E20B 5G4VC 5HXUA 1K9MH 3RA6A 1VQKF 3V3TA 1YJNF 1YJWF 3CCVF 1CN7A 2KG4A 2KTVA 1VQ6F 4EI8A 3CG6A 3PAFA 3CMAF 3CC2F 3CC7F 3HJWC 5HY4A 1YIJF 3GYQA 2WALA 3D00A 4EI9A 2VGMA 1H7MA 1VQLF 2QEXF 1VQPF 2ALEA 2I6DA 1NMUB 1GZ0A 3NMUC 3JCMM 5A2QM 5GAPK 2F9ZC 1SDSA 4C4WC 5EO3A 3G6EF 5GINC 2KTUA 2LBXA 1W3EX 1RA4A 3CCEF 3VI6A 3CCRF 3NK7A 1KD1H 1M90H 3CXCF 4NUTA 5HY2A 1Q7YH 3V7EA 3RA5A 4EI7A 1X7PA 2CZWA 3LWRC 1K73H 3CC4F 2OTJF 4BVSA 1N8RH 1S72F 1KC8H 1ZWZA 2QI2A 3FFMA 1T0KB 1W41A 5GANK 4X3LA 4NQ3A 3MCAB 5GIPC 3WXMB 4BVTA 1JJ2F 4BW0B 1CK2A 1YI2F 3LFOA 2LBWA 2VGNA 2BO1A 5IT9M 2OTLF 3CCQF 3HAXD 3J7AR 5HY1A 1Q81H 3J80M 3CD6F 1E7KA 3NK6A 3I56F 1VQ9F 1RLGA 2QA4F 5FJ4C 5EWRA 3OW2F 3NVIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBI A;  3CPQ A;  1Q86 H;  3G71 F;  3J81 M;  1VQ4 F;  4BY9 D;  1GO0 A;  1VQ8 F;  2OHW A;  5G4U C;  1DT9 A;  3LWQ C;  1VQM F;  3VMF B;  4X3M A;  1K8A H;  3N4Y A;  2AIF A;  1QVF F;  1PXW A;  3O85 A;  3SIU A;  1Q82 H;  5DCV A;  2FC3 A;  1X52 A;  3PLA C;  1W2B F;  1VQN F;  3NVK E;  5GIO C;  3CCJ F;  1X7O A;  5FLX M;  3LWP C;  3E1Y A;  2HVY D;  1IPA A;  1W42 A;  1YJ9 F;  1KQS F;  3CME F;  2OZB A;  3LWO C;  3OBW A;  3V7Q A;  3SIV A;  3G4S F;  1QVG F;  1VQ5 F;  3OBY A;  2JNB A;  4TZZ A;  3CCU F;  1VQO F;  1YHQ F;  1GO1 A;  1W40 A;  3AGK A;  3CCM F;  3N4Z A;  1M1K H;  3CPW F;  1VQ7 F;  3JAM M;  1NJI H;  3IR9 A;  3ON1 A;  3CCL F;  4LCK A;  1YIT F;  3I55 F;  3CCS F;  3LWV C;  3E20 B;  5G4V C;  1K9M H;  3RA6 A;  1VQK F;  1YJN F;  1YJW F;  3CCV F;  1CN7 A;  2KG4 A;  2KTV A;  1VQ6 F;  3CG6 A;  3PAF A;  3CMA F;  3CC2 F;  3CC7 F;  3HJW C;  1YIJ F;  3GYQ A;  2WAL A;  2VGM A;  1H7M A;  1VQL F;  2QEX F;  1VQP F;  2ALE A;  2I6D A;  1NMU B;  1GZ0 A;  3NMU C;  3JCM M;  5A2Q M;  5GAP K;  1SDS A;  4C4W C;  5EO3 A;  3G6E F;  5GIN C;  2KTU A;  2LBX A;  1W3E X;  1RA4 A;  3CCE F;  3VI6 A;  3CCR F;  3NK7 A;  1KD1 H;  1M90 H;  3CXC F;  4NUT A;  1Q7Y H;  3V7E A;  3RA5 A;  1X7P A;  2CZW A;  3LWR C;  1K73 H;  3CC4 F;  2OTJ F;  1KC8 H;  1N8R H;  1S72 F;  1ZWZ A;  2QI2 A;  3FFM A;  1T0K B;  1W41 A;  5GAN K;  4X3L A;  3MCA B;  5GIP C;  3WXM B;  1JJ2 F;  4BW0 B;  1CK2 A;  1YI2 F;  3LFO A;  2LBW A;  2VGN A;  2BO1 A;  5IT9 M;  2OTL F;  3CCQ F;  3HAX D;  3J7A R;  1Q81 H;  3J80 M;  3CD6 F;  1E7K A;  3NK6 A;  3I56 F;  1VQ9 F;  1RLG A;  2QA4 F;  5FJ4 C;  5EWR A;  3OW2 F;  3NVI B; 
#chains in the Genus database with same CATH topology
 2Z1E A;  3CPQ A;  1Q86 H;  2HP0 B;  3VTI C;  3J81 M;  3M4S A;  2VAP A;  4BY9 D;  4I55 A;  1VQ8 F;  3HKC B;  3OON A;  4O4L B;  2OHW A;  4ZHW A;  4ZI7 A;  5G4U C;  1DT9 A;  3LWQ C;  3RYI A;  5KX5 A;  4G4V A;  1FNK A;  3VMF B;  5ITZ B;  3N4Y A;  1QVF F;  5FNV A;  4X20 B;  3SIU A;  3TD4 A;  3CYQ A;  2FC3 A;  4X1I A;  4FFB B;  2DT4 A;  4RQO A;  1YGY A;  3NVK E;  1ONI A;  5GIO C;  3JAR B;  4TV8 B;  4G4W A;  2HVY D;  2HS4 A;  1IPA A;  1W59 A;  4BT5 A;  2HRU A;  3LWO C;  3JAS B;  2JNB A;  1JN1 A;  3CCU F;  3D01 A;  3AGK A;  3N4Z A;  3CPW F;  4EB6 B;  2QTP A;  3CCL F;  2VXY A;  5ITZ A;  4YJ2 B;  4G88 A;  4RHA A;  3V3T A;  4FFB A;  5CA1 A;  1CN7 A;  2Z1U A;  4YJ3 B;  1TVK A;  2HRY A;  4R40 B;  4O2A B;  1W55 A;  5EYP A;  3GYQ A;  1UI9 A;  3JAS A;  1H7M A;  1VQP F;  2DYY A;  2ALE A;  3ERN A;  3JAW B;  1GZ0 A;  1H47 A;  4IIJ B;  3NMU C;  2N48 A;  3JCM M;  5GAP K;  1SDS A;  5EO3 A;  3F0E A;  3FD6 A;  4B5C A;  1QU9 A;  2W8B C;  1RLU A;  4C8G A;  1X25 A;  3I7T A;  3E22 B;  4YJ2 A;  2HX0 A;  5AVM A;  1M90 H;  2IG8 A;  4ERH A;  5KMG B;  1Q7Y H;  2LBT A;  3ZP7 A;  3LWR C;  2RB9 A;  4ZHV A;  4BVS A;  1COM A;  3K2X A;  4YJ3 A;  5GAN K;  4NQ3 A;  4TUY B;  5J2U B;  3WXM B;  4HNA B;  1CK2 A;  2Q1Y A;  3LFO A;  3JAT B;  5LA6 B;  3DC2 A;  3WGN A;  2OTL F;  3RYH A;  5B8F A;  2G9I A;  3JAW A;  3HAX D;  3VOB A;  2UYN B;  5JVD A;  3NK6 A;  5IJ9 A;  4WBN B;  1FNJ A;  1FSZ A;  3LME A;  1RLG A;  2V9Y A;  5EWR A;  3ZP4 A;  5MN4 A;  1QD9 A;  3JAL A;  3G71 F;  5KMG A;  3HKE A;  2ZOV A;  3BYQ A;  3HKB B;  3I3F A;  3S03 A;  5JH7 A;  1GX1 A;  3R0P A;  4ZOL B;  5HWE A;  5JQG B;  3S02 A;  4TUY A;  5J2U A;  3MCQ A;  4O2B A;  4HNA A;  1PF5 A;  3O85 A;  3ELC A;  3JAT A;  5LA6 A;  2FGY A;  1Q82 H;  5DCV A;  2P6Y A;  5LOV B;  4LNU B;  3PLA C;  1CLI A;  2HQS C;  4WBN A;  2BTU A;  5IYZ B;  3LWP C;  1UFY A;  3E1Y A;  4X1Y B;  3S0Y A;  1Z5W A;  3CME F;  4G4Y A;  3SIV A;  3P4E A;  4I4T A;  1VQ5 F;  1H48 A;  2CSL A;  1GO1 A;  1KNJ A;  3HKB A;  1M1K H;  3Q8H A;  2ZAU A;  2BTO A;  3JAM M;  5LXT B;  4ZOL A;  4C8I A;  5JQG A;  4LCK A;  3JAK B;  2HP3 A;  2Z01 A;  4DRX B;  3I55 F;  1W5F A;  4BVQ A;  3LWV C;  2LCA A;  3CCS F;  4B45 A;  2RHL A;  5HXU A;  1IV1 A;  1VQK F;  2H8E A;  3M84 A;  5LOV A;  1VHA A;  1YJN F;  2NMU A;  4B62 A;  5LP6 B;  1RQ2 A;  1VQ6 F;  2UZH A;  3CC2 F;  3HJW C;  4X1Y A;  2HP0 A;  4I50 B;  3VO8 A;  3D00 A;  4C8E A;  1VQL F;  1W58 1;  2K1S A;  3HKC A;  3N2K B;  4G4Z A;  5GON B;  4O4L A;  2PHN A;  3ZO8 A;  3K0T A;  3MBM A;  1T0A A;  3MDO A;  1JFF B;  2BTQ B;  2RHJ A;  5GIN C;  5LP6 C;  3JAK A;  4X20 A;  3CCE F;  4C82 A;  3CCR F;  1KD1 H;  2ZVY A;  3KE1 A;  4NUT A;  2KGW A;  3C8L A;  4EI7 A;  3QUW A;  1X7P A;  2OTJ F;  1VQV A;  1N8R H;  3JAR A;  4TV8 A;  2B33 A;  2QI2 A;  5C8Y B;  3RYF B;  4X3L A;  2Z1F A;  2GZL A;  5EAZ A;  5MN6 A;  2VGN A;  4B46 A;  1XRG A;  3CCQ F;  2I6R A;  1R1M A;  3N2G B;  4BT3 A;  3J7A R;  4EB6 A;  3I56 F;  3LDT A;  1W5A A;  3GHZ A;  2QA4 F;  2HS0 A;  3RYC B;  1XBI A;  2CWJ A;  2YXZ A;  5EIB C;  1VQ4 F;  1GO0 A;  3IKE A;  3TD3 A;  5LYJ B;  4E6E A;  2R6R 1;  5J2T B;  3U0O A;  1TUB B;  1VQM F;  2GLZ A;  5C8Y A;  1SA0 B;  4O2A A;  3VIU A;  3RYF A;  4F6R B;  4X3M A;  1K8A H;  2PMP A;  2CHT A;  1PXW A;  4BVR A;  4O4I B;  4U39 A;  3WGK A;  4ZHQ B;  3UT5 B;  5EB0 A;  4C81 A;  4IIJ A;  1X52 A;  1U43 A;  2CW4 A;  4NWO B;  4XCQ A;  2ZF8 A;  3EOR A;  1QAH A;  3CCJ F;  3E22 A;  4IHJ B;  3D54 A;  3TD5 A;  1W42 A;  3CYP B;  3V4D A;  1KQS F;  3OBW A;  3C9S A;  3V7Q A;  3G4S F;  2GVI A;  1VQO F;  3VOA A;  1YHQ F;  1OAP A;  2HS3 A;  3CCM F;  3WGJ A;  3WGL A;  1TUB A;  1VQ7 F;  3WJQ A;  5CB4 B;  5BMV B;  3IR9 A;  5CA0 B;  2AIZ P;  5HP8 A;  3K14 A;  1IV3 A;  4ZHY B;  4O4I A;  5G4V C;  3GTZ A;  4KWE A;  3RA6 A;  4ZHQ A;  3UT5 A;  3C9U A;  1IV4 A;  2UYN A;  1YJW F;  3CCV F;  2CHS A;  2KG4 A;  3WGM A;  1OFU A;  3CG6 A;  2EWC A;  3RYI B;  3CMA F;  4IHJ A;  3VYT C;  3ESJ A;  2ZVZ A;  2WAL A;  1W5E A;  5FNV B;  1U3P A;  3S06 A;  4BT2 A;  2UYJ A;  2I6D A;  1DBF A;  3K12 A;  4O4J B;  5EIB D;  4X1I B;  5IJ0 B;  5A2Q M;  4C4W C;  2F9Z C;  3KIZ A;  4G4X A;  3G6E F;  4BT4 A;  5BMV A;  1W3E X;  2H6L A;  3C9R A;  3VI6 A;  5HP7 A;  3CXC F;  4LNU A;  5HY2 A;  3FBA A;  3V7E A;  3RA5 A;  4ZK7 A;  1K73 H;  3F0F A;  1JD1 A;  4X1K B;  1KC8 H;  1S72 F;  1Q8R A;  5IYZ A;  3IEW A;  4DXD A;  1W41 A;  1SZQ A;  3P10 A;  5JCO C;  2UYK A;  4U3J B;  3MCA B;  3HKD B;  1YQN A;  4BVT A;  5GIP C;  4BW0 B;  4TV9 B;  2L26 A;  2LBW A;  2BO1 A;  5IT9 M;  1ODE A;  4O4J A;  3CD6 F;  5JCO A;  1Z5V A;  5IJ0 A;  5LXT A;  1E7K A;  3IKF A;  1FFX B;  3DDN A;  5CA1 B;  1VQ9 F;  3IEQ A;  3S0W A;  2H8C A;  5EZY B;  1TVK B;  4DRX A;  3WPX A;  3MQW A;  1KNK A;  3KHN A;  5HXZ A;  3WJR A;  3JVH A;  5EYP B;  2IQQ A;  4BT6 A;  1U3L A;  5HY0 A;  3QTY A;  5LP6 A;  1J7H A;  4X1K A;  3F6M A;  3T80 A;  3IMP A;  4I50 A;  4U3J A;  3F0D A;  2AIF A;  3HKD A;  4TV9 A;  3N2K A;  5GON A;  3M1X A;  2VAW A;  1JFF A;  1W2B F;  1VQN F;  1IV2 A;  1FFX A;  4PWT A;  1X7O A;  5FLX M;  5EZY A;  1YJ9 F;  3F0G A;  2OZB A;  1QVG F;  3LYB A;  2R75 1;  3OBY A;  4TZZ A;  1W40 A;  3RYH B;  5JVD B;  5IJ9 B;  1NJI H;  1VH8 A;  3ON1 A;  3WJP A;  1YIT F;  2UYP A;  1VK3 A;  3E20 B;  3HTN A;  1K9M H;  2RHO A;  3JAL B;  3FD5 A;  3N2G A;  3HKE B;  2OTM A;  3P0Z A;  2KTV A;  2Z1T A;  5EB1 B;  4EI8 A;  3PAF A;  4O4H B;  5JH7 B;  3S0H A;  2YYE A;  3KJJ A;  2RHH A;  3RYC A;  3CC7 F;  2CVL A;  5HY4 A;  3HWU A;  1YIJ F;  5MN5 A;  3VYS C;  4M8I A;  2VGM A;  4O2B B;  4EI9 A;  2QEX F;  5LYJ A;  3C9T A;  1NMU B;  5J2T A;  1W57 A;  3RE3 A;  3KJK A;  3FPI A;  1SA0 A;  2IAF A;  3B6N A;  4F6R A;  2KTU A;  2LBX A;  3L7Q A;  2ZOD A;  1RA4 A;  2Q1X A;  3NK7 A;  2AMT A;  3VYU C;  4I4T B;  4I55 B;  3VCZ A;  2CZW A;  1RQ7 A;  3CC4 F;  2VAM A;  4ZI7 B;  1ZWZ A;  3FFM A;  1T0K B;  4O4H A;  5KX5 B;  3CB2 A;  1XV2 A;  1JY8 A;  1YI2 F;  1JJ2 F;  2MQE A;  1XHO A;  3ZOP A;  5HY1 A;  1Q81 H;  3J80 M;  3QHD A;  5CB4 A;  5CA0 A;  1NQ3 A;  1W5B A;  4BT7 A;  1U40 A;  3WPW A;  5FJ4 C;  3OW2 F;  3NVI B; 
#chains in the Genus database with same CATH homology
 1XBI A;  3CPQ A;  5HXZ A;  1Q86 H;  3G71 F;  3J81 M;  1VQ4 F;  4BY9 D;  1GO0 A;  1VQ8 F;  5HY0 A;  2OHW A;  5G4U C;  1DT9 A;  3LWQ C;  1VQM F;  2GLZ A;  5HWE A;  3VMF B;  4X3M A;  1K8A H;  3N4Y A;  2AIF A;  1QVF F;  1PXW A;  4BVR A;  3O85 A;  3SIU A;  2FGY A;  1Q82 H;  5DCV A;  2FC3 A;  1X52 A;  3PLA C;  4XCQ A;  1W2B F;  1VQN F;  3NVK E;  5GIO C;  3CCJ F;  1X7O A;  5FLX M;  3LWP C;  3E1Y A;  2HVY D;  1IPA A;  1W42 A;  1YJ9 F;  1KQS F;  3CME F;  2OZB A;  3LWO C;  3OBW A;  3V7Q A;  3SIV A;  3G4S F;  1QVG F;  1VQ5 F;  3OBY A;  2JNB A;  4TZZ A;  3CCU F;  1VQO F;  1YHQ F;  1GO1 A;  1W40 A;  3AGK A;  3CCM F;  3N4Z A;  1M1K H;  3CPW F;  1VQ7 F;  3JAM M;  1NJI H;  3IR9 A;  3ON1 A;  3CCL F;  4LCK A;  1YIT F;  3I55 F;  3CCS F;  4BVQ A;  3LWV C;  3E20 B;  5G4V C;  5HXU A;  1K9M H;  3RA6 A;  1VQK F;  3V3T A;  1YJN F;  1YJW F;  3CCV F;  1CN7 A;  2KG4 A;  2KTV A;  1VQ6 F;  4EI8 A;  3CG6 A;  3PAF A;  3CMA F;  3CC2 F;  3CC7 F;  3HJW C;  5HY4 A;  1YIJ F;  3GYQ A;  2WAL A;  3D00 A;  4EI9 A;  2VGM A;  1H7M A;  1VQL F;  2QEX F;  1VQP F;  2ALE A;  2I6D A;  1NMU B;  1GZ0 A;  3NMU C;  3JCM M;  5A2Q M;  5GAP K;  2F9Z C;  1SDS A;  4C4W C;  5EO3 A;  3G6E F;  5GIN C;  2KTU A;  2LBX A;  1W3E X;  1RA4 A;  3CCE F;  3VI6 A;  3CCR F;  3NK7 A;  1KD1 H;  1M90 H;  3CXC F;  4NUT A;  5HY2 A;  1Q7Y H;  3V7E A;  3RA5 A;  4EI7 A;  1X7P A;  2CZW A;  3LWR C;  1K73 H;  3CC4 F;  2OTJ F;  4BVS A;  1N8R H;  1S72 F;  1KC8 H;  1ZWZ A;  2QI2 A;  3FFM A;  1T0K B;  1W41 A;  5GAN K;  4X3L A;  4NQ3 A;  3MCA B;  5GIP C;  3WXM B;  4BVT A;  1JJ2 F;  4BW0 B;  1CK2 A;  1YI2 F;  3LFO A;  2LBW A;  2VGN A;  2BO1 A;  5IT9 M;  2OTL F;  3CCQ F;  3HAX D;  3J7A R;  5HY1 A;  1Q81 H;  3J80 M;  3CD6 F;  1E7K A;  3NK6 A;  3I56 F;  1VQ9 F;  1RLG A;  2QA4 F;  5FJ4 C;  5EWR A;  3OW2 F;  3NVI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...