1VHAA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vhaA00
1YQNA 3F6MA 3KE1A 1IV4A 1VHAA 3ESJA 3GHZA 1GX1A 1H47A 1VH8A 3F0EA 3P10A 2UZHA 2PMPA 1JN1A 3F0FA 3MBMA 5B8FA 1U3LA 3EORA 1U40A 3QHDA 3ELCA 3FBAA 3B6NA 3IEQA 3Q8HA 4C8GA 1IV2A 1IV3A 3T80A 3RE3A 1T0AA 1U3PA 2GZLA 1W55A 3F0DA 3IKFA 1IV1A 4C8IA 3FPIA 1W57A 1KNJA 3K14A 3IEWA 4C81A 1U43A 1KNKA 3IKEA 1H48A 4C8EA 3K2XA 4C82A 3F0GA 3P0ZA 2AMTA 3JVHA 3ERNA 1JY8A
chains in the Genus database with same CATH superfamily
3TD4A 3RYFB 2NMUA 4X1IB 5G4UC 5IJ0A 1K9MH 3ZP7A 1SDSA 3JARB 3RA5A 3CCQF 1FNKA 3RE3A 1X7PA 2ZAUA 4B62A 1N8RH 3HKCB 2GLZA 3GYQA 2HX0A 1YJWF 2BTOA 2UYKA 5HP8A 1W5BA 2YXZA 1M90H 3P0ZA 2AMTA 2ZVYA 4X1KB 3G4SF 3NK7A 1IV4A 3HKDA 4WBNA 1YGYA 4RHAA 2UYPA 4ZHQA 2UZHA 1ODEA 2UYNA 1VQVA 2VAMA 5KMGB 4BVTA 1VQLF 3IEQA 2CVLA 5GINC 2KG4A 3N4YA 5IJ9A 2WALA 5EB1B 4X1KA 4EI9A 5HP7A 2N48A 1RLUA 1H48A 5EZYA 3JALA 4ZHQB 4IIJA 4BT6A 1COMA 3WXMB 5IJ0B 3OBYA 5FLXM 1UI9A 2VGMA 1W3EX 3PLAC 3JARA 4KWEA 3OBWA 1RQ2A 3JAKB 3CYQA 3FD6A 3JAWB 1GO1A 3KIZA 1IV2A 1W40A 2VGNA 4C8GA 5LXTA 5CA1B 3I3FA 3NVIB 4ERHA 3OW2F 4ZI7B 4O4HB 4BY9D 3HAXD 1Z5WA 3CCEF 3SIVA 5HY4A 3UT5A 3I56F 5MN4A 1VQ4F 4YJ2B 2HRYA 2GVIA 1QAHA 3RYIB 2FC3A 2UYNB 4F6RA 3WGKA 3JAMM 2L26A 3CC4F 5LYJB 3LYBA 2PMPA 3F0FA 1Q86H 1U3LA 5LOVA 2RB9A 2Z1TA 3CD6F 2KTUA 3UT5B 4X1YB 1X7OA 4PWTA 2GZLA 2ZOVA 3CG6A 2IQQA 3IR9A 3NMUC 3HKBA 4BT7A 3C9RA 4IIJB 2CW4A 3K0TA 3S0HA 4F6RB 3GTZA 3N2KA 5J2TA 3CCRF 4ZOLA 4DXDA 3JAKA 4G88A 1NMUB 4LNUB 1K73H 3BYQA 4O2BA 3RYCA 4FFBA 3CMAF 3P10A 3JATB 5HY0A 5LXTB 5IYZA 1W41A 1RQ7A 4YJ3B 3HJWC 4DRXB 3FBAA 3U0OA 1R1MA 1QVGF 3RYHB 3CXCF 1VQ5F 1K8AH 4X3MA 4ZOLB 4LCKA 1XV2A 4YJ2A 1OAPA 3WJPA 1UFYA 3RYIA 2RHOA 4LNUA 1VK3A 1VQ7F 3WPXA 3VI6A 3V7EA 4U3JB 1CN7A 5IYZB 3VOAA 4X3LA 1VQPF 1TUBA 5JVDA 4NQ3A 1JJ2F 4O4LB 5DCVA 2CZWA 2LBWA 3WJRA 2H8EA 4G4YA 5HY1A 2QEXF 3C8LA 2QTPA 2R6R1 3QTYA 2DYYA 4C8IA 5HWEA 1XRGA 2UYJA 5EIBD 5J2TB 3LDTA 3E20B 1JFFB 1W57A 3S06A 5EYPB 3IEWA 1CK2A 1X25A 1XBIA 1W59A 1YJ9F 3F0GA 3JATA 4O4LA 3C9UA 3CCLF 3JVHA 3CYPB 3ERNA 2HS0A 3VO8A 3KE1A 1VQ6F 1TVKB 3HKCA 1W581 1GX1A 2HVYD 3KHNA 2VAPA 1J7HA 5BMVA 5HY2A 2V9YA 1JFFA 2ZODA 3CCSF 1Q82H 4HNAA 3V7QA 1YITF 4I50B 2CWJA 5JQGA 4C4WC 3M84A 2P6YA 3F0DA 3HKDB 1FNJA 3C9SA 3TD5A 1H7MA 1QD9A 1DBFA 4O4JB 1ZWZA 3LWVC 5CB4A 3MQWA 3S0WA 5JVDB 4R40B 4O4IB 4B45A 5LP6C 1QVFF 5CA0B 1YIJF 1VH8A 3LFOA 3VYUC 5J2UA 4TUYA 5EWRA 5GIOC 3JALB 3G6EF 4E6EA 1CLIA 5MN6A 3Q8HA 3DC2A 5EYPA 3CPWF 3IKFA 3LWOC 3TD3A 3HWUA 2LBXA 2ZVZA 2HP3A 1ONIA 3VOBA 3WGJA 1KNKA 3MDOA 3O85A 2AIFA 2H6LA 1S72F 5J2UB 5ITZB 3RYFA 3ZP4A 1W5AA 4X1IA 2KGWA 2AIZP 4I50A 5JQGB 3K12A 5B8FA 1RLGA 4NUTA 3FFMA 3RA6A 3WPWA 3V3TA 2BTQB 2OHWA 5GANK 3V4DA 2B33A 3HKEA 5LYJA 3ON1A 3FPIA 4IHJB 5KX5B 4O4IA 5GONB 4C81A 4TV9A 2Z1UA 2RHHA 4I55B 4C82A 5LP6A 3WJQA 1W42A 2HP0B 3F6MA 4WBNB 2EWCA 1KD1H 5IT9M 3ZO8A 3WGMA 3DDNA 1SA0A 3CMEF 4BVRA 1W5FA 2HS3A 2H8CA 2IAFA 3MCQA 4I4TA 3CB2A 2VAWA 5GONA 5GAPK 3PAFA 1W55A 1X52A 3RYCB 1IV1A 5IJ9B 2LBTA 5A2QM 3CC2F 1KNJA 3OONA 5ITZA 5EZYB 4EB6B 1PXWA 3E22A 3K2XA 4BVQA 1FSZA 1VQNF 1GZ0A 2HQSC 4X20A 4EI7A 4ZHWA 4O2AB 5JH7A 4TZZA 1JD1A 1FFXB 4RQOA 2FGYA 2Z01A 1U40A 1DT9A 3JAWA 3N4ZA 1IPAA 5KX5A 4EB6A 1IV3A 5G4VC 3CCUF 4G4XA 4ZK7A 3LMEA 1M1KH 4O4HA 3ZOPA 1VQ8F 1Q81H 2HP0A 1U43A 2HS4A 5JCOA 2OTJF 1PF5A 2Q1XA 2K1SA 3LWRC 5EAZA 1SA0B 3MBMA 4BT2A 1VHAA 4ZHYB 2BTUA 3AGKA 1W5EA 2YYEA 5LOVB 3QHDA 1XHOA 3ELCA 4BT5A 3S03A 3VYTC 1NQ3A 3HKBB 4X1YA 1E7KA 4X20B 4G4VA 3N2GB 5EIBC 3M4SA 3N2KB 5EB0A 5BMVB 5KMGA 2JNBA 3QUWA 5GIPC 1VQKF 1FFXA 5LA6B 4TV8B 3I7TA 2ALEA 1Z5VA 4M8IA 3SIUA 2CHTA 2Q1YA 3ESJA 3F0EA 3KJKA 4FFBB 2CSLA 1RA4A 2Z1EA 4YJ3A 5FNVB 2CHSA 3D54A 3VCZA 4G4WA 3N2GA 2DT4A 1NJIH 2RHLA 3LWQC 3RYHA 5JCOC 4TV8A 2LCAA 3K14A 2KTVA 4XCQA 3IKEA 4BT3A 4C8EA 3CCVF 3J81M 4U3JA 2RHJA 3KJJA 5CA1A 1TUBB 2I6DA 4ZI7A 3CCJF 3S0YA 4G4ZA 3P4EA 3D00A 3B6NA 1VQMF 3NVKE 5AVMA 3E1YA 3CPQA 1VQ9F 3JASB 3T80A 4U39A 5HXUA 1KQSF 3L7QA 5LA6A 2Z1FA 2HRUA 3IMPA 1GO0A 2QI2A 2BO1A 3S02A 3VMFB 3JCMM 3J7AR 4BT4A 5FNVA 3WGNA 5FJ4C 3HKEB 3GHZA 1OFUA 1TVKA 2W8BC 4IHJA 1H47A 3FD5A 3JASA 1JN1A 4TV9B 1KC8H 3EORA 5EO3A 4I55A 5LP6B 4HNAB 5HXZA 2F9ZC 4BW0B 1T0AA 1W2BF 4O2BB 3LWPC 4NWOB 3NK6A 3I55F 1QU9A 2OZBA 1YHQF 3R0PA 3C9TA 1VQOF 4O4JA 2OTMA 4DRXA 5CB4B 4B5CA 4I4TB 4EI8A 1YJNF 4B46A 5C8YA 2OTLF 3CC7F 1YQNA 3VIUA 5CA0A 3G71F 5MN5A 1YI2F 1T0KB 2I6RA 4ZHVA 3MCAB 3VTIC 3E22B 4BVSA 3D01A 4TUYB 2R751 2VXYA 3WGLA 1U3PA 3VYSC 4O2AA 5JH7B 2QA4F 2PHNA 3M1XA 2ZF8A 5C8YB 1SZQA 1Q8RA 2IG8A 3HTNA 3CCMF 1Q7YH 2MQEA 2G9IA 3J80M 1JY8A
chains in the Genus database with same CATH topology
1YQNA 3F6MA 3KE1A 1IV4A 1VHAA 3ESJA 3GHZA 1GX1A 1H47A 1VH8A 3F0EA 3P10A 2UZHA 2PMPA 1JN1A 3F0FA 3MBMA 5B8FA 1U3LA 3EORA 1U40A 3QHDA 3ELCA 3FBAA 3B6NA 3IEQA 3Q8HA 4C8GA 1IV2A 1IV3A 3T80A 3RE3A 1T0AA 1U3PA 2GZLA 1W55A 3F0DA 3IKFA 1IV1A 4C8IA 3FPIA 1W57A 1KNJA 3K14A 3IEWA 4C81A 1U43A 1KNKA 3IKEA 1H48A 4C8EA 3K2XA 4C82A 3F0GA 3P0ZA 2AMTA 3JVHA 3ERNA 1JY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQN A;  3F6M A;  3KE1 A;  1IV4 A;  1VHA A;  3ESJ A;  3GHZ A;  1GX1 A;  1H47 A;  1VH8 A;  3F0E A;  3P10 A;  2UZH A;  2PMP A;  1JN1 A;  3F0F A;  3MBM A;  5B8F A;  1U3L A;  3EOR A;  1U40 A;  3QHD A;  3ELC A;  3FBA A;  3B6N A;  3IEQ A;  3Q8H A;  4C8G A;  1IV2 A;  1IV3 A;  3T80 A;  3RE3 A;  1T0A A;  1U3P A;  2GZL A;  1W55 A;  3F0D A;  3IKF A;  1IV1 A;  4C8I A;  3FPI A;  1W57 A;  1KNJ A;  3K14 A;  3IEW A;  4C81 A;  1U43 A;  1KNK A;  3IKE A;  1H48 A;  4C8E A;  3K2X A;  4C82 A;  3F0G A;  3P0Z A;  2AMT A;  3JVH A;  3ERN A;  1JY8 A; 
#chains in the Genus database with same CATH topology
 3TD4 A;  3RYF B;  2NMU A;  4X1I B;  5G4U C;  5IJ0 A;  1K9M H;  3ZP7 A;  1SDS A;  3JAR B;  3RA5 A;  3CCQ F;  1FNK A;  3RE3 A;  1X7P A;  2ZAU A;  4B62 A;  1N8R H;  3HKC B;  2GLZ A;  3GYQ A;  2HX0 A;  1YJW F;  2BTO A;  2UYK A;  5HP8 A;  1W5B A;  2YXZ A;  1M90 H;  3P0Z A;  2AMT A;  2ZVY A;  4X1K B;  3G4S F;  3NK7 A;  1IV4 A;  3HKD A;  4WBN A;  1YGY A;  4RHA A;  2UYP A;  4ZHQ A;  2UZH A;  1ODE A;  2UYN A;  1VQV A;  2VAM A;  5KMG B;  4BVT A;  1VQL F;  3IEQ A;  2CVL A;  5GIN C;  2KG4 A;  3N4Y A;  5IJ9 A;  2WAL A;  5EB1 B;  4X1K A;  4EI9 A;  5HP7 A;  2N48 A;  1RLU A;  1H48 A;  5EZY A;  3JAL A;  4ZHQ B;  4IIJ A;  4BT6 A;  1COM A;  3WXM B;  5IJ0 B;  3OBY A;  5FLX M;  1UI9 A;  2VGM A;  1W3E X;  3PLA C;  3JAR A;  4KWE A;  3OBW A;  1RQ2 A;  3JAK B;  3CYQ A;  3FD6 A;  3JAW B;  1GO1 A;  3KIZ A;  1IV2 A;  1W40 A;  2VGN A;  4C8G A;  5LXT A;  5CA1 B;  3I3F A;  3NVI B;  4ERH A;  3OW2 F;  4ZI7 B;  4O4H B;  4BY9 D;  3HAX D;  1Z5W A;  3CCE F;  3SIV A;  5HY4 A;  3UT5 A;  3I56 F;  5MN4 A;  1VQ4 F;  4YJ2 B;  2HRY A;  2GVI A;  1QAH A;  3RYI B;  2FC3 A;  2UYN B;  4F6R A;  3WGK A;  3JAM M;  2L26 A;  3CC4 F;  5LYJ B;  3LYB A;  2PMP A;  3F0F A;  1Q86 H;  1U3L A;  5LOV A;  2RB9 A;  2Z1T A;  3CD6 F;  2KTU A;  3UT5 B;  4X1Y B;  1X7O A;  4PWT A;  2GZL A;  2ZOV A;  3CG6 A;  2IQQ A;  3IR9 A;  3NMU C;  3HKB A;  4BT7 A;  3C9R A;  4IIJ B;  2CW4 A;  3K0T A;  3S0H A;  4F6R B;  3GTZ A;  3N2K A;  5J2T A;  3CCR F;  4ZOL A;  4DXD A;  3JAK A;  4G88 A;  1NMU B;  4LNU B;  1K73 H;  3BYQ A;  4O2B A;  3RYC A;  4FFB A;  3CMA F;  3P10 A;  3JAT B;  5HY0 A;  5LXT B;  5IYZ A;  1W41 A;  1RQ7 A;  4YJ3 B;  3HJW C;  4DRX B;  3FBA A;  3U0O A;  1R1M A;  1QVG F;  3RYH B;  3CXC F;  1VQ5 F;  1K8A H;  4X3M A;  4ZOL B;  4LCK A;  1XV2 A;  4YJ2 A;  1OAP A;  3WJP A;  1UFY A;  3RYI A;  2RHO A;  4LNU A;  1VK3 A;  1VQ7 F;  3WPX A;  3VI6 A;  3V7E A;  4U3J B;  1CN7 A;  5IYZ B;  3VOA A;  4X3L A;  1VQP F;  1TUB A;  5JVD A;  4NQ3 A;  1JJ2 F;  4O4L B;  5DCV A;  2CZW A;  2LBW A;  3WJR A;  2H8E A;  4G4Y A;  5HY1 A;  2QEX F;  3C8L A;  2QTP A;  2R6R 1;  3QTY A;  2DYY A;  4C8I A;  5HWE A;  1XRG A;  2UYJ A;  5EIB D;  5J2T B;  3LDT A;  3E20 B;  1JFF B;  1W57 A;  3S06 A;  5EYP B;  3IEW A;  1CK2 A;  1X25 A;  1XBI A;  1W59 A;  1YJ9 F;  3F0G A;  3JAT A;  4O4L A;  3C9U A;  3CCL F;  3JVH A;  3CYP B;  3ERN A;  2HS0 A;  3VO8 A;  3KE1 A;  1VQ6 F;  1TVK B;  3HKC A;  1W58 1;  1GX1 A;  2HVY D;  3KHN A;  2VAP A;  1J7H A;  5BMV A;  5HY2 A;  2V9Y A;  1JFF A;  2ZOD A;  3CCS F;  1Q82 H;  4HNA A;  3V7Q A;  1YIT F;  4I50 B;  2CWJ A;  5JQG A;  4C4W C;  3M84 A;  2P6Y A;  3F0D A;  3HKD B;  1FNJ A;  3C9S A;  3TD5 A;  1H7M A;  1QD9 A;  1DBF A;  4O4J B;  1ZWZ A;  3LWV C;  5CB4 A;  3MQW A;  3S0W A;  5JVD B;  4R40 B;  4O4I B;  4B45 A;  5LP6 C;  1QVF F;  5CA0 B;  1YIJ F;  1VH8 A;  3LFO A;  3VYU C;  5J2U A;  4TUY A;  5EWR A;  5GIO C;  3JAL B;  3G6E F;  4E6E A;  1CLI A;  5MN6 A;  3Q8H A;  3DC2 A;  5EYP A;  3CPW F;  3IKF A;  3LWO C;  3TD3 A;  3HWU A;  2LBX A;  2ZVZ A;  2HP3 A;  1ONI A;  3VOB A;  3WGJ A;  1KNK A;  3MDO A;  3O85 A;  2AIF A;  2H6L A;  1S72 F;  5J2U B;  5ITZ B;  3RYF A;  3ZP4 A;  1W5A A;  4X1I A;  2KGW A;  2AIZ P;  4I50 A;  5JQG B;  3K12 A;  5B8F A;  1RLG A;  4NUT A;  3FFM A;  3RA6 A;  3WPW A;  3V3T A;  2BTQ B;  2OHW A;  5GAN K;  3V4D A;  2B33 A;  3HKE A;  5LYJ A;  3ON1 A;  3FPI A;  4IHJ B;  5KX5 B;  4O4I A;  5GON B;  4C81 A;  4TV9 A;  2Z1U A;  2RHH A;  4I55 B;  4C82 A;  5LP6 A;  3WJQ A;  1W42 A;  2HP0 B;  3F6M A;  4WBN B;  2EWC A;  1KD1 H;  5IT9 M;  3ZO8 A;  3WGM A;  3DDN A;  1SA0 A;  3CME F;  4BVR A;  1W5F A;  2HS3 A;  2H8C A;  2IAF A;  3MCQ A;  4I4T A;  3CB2 A;  2VAW A;  5GON A;  5GAP K;  3PAF A;  1W55 A;  1X52 A;  3RYC B;  1IV1 A;  5IJ9 B;  2LBT A;  5A2Q M;  3CC2 F;  1KNJ A;  3OON A;  5ITZ A;  5EZY B;  4EB6 B;  1PXW A;  3E22 A;  3K2X A;  4BVQ A;  1FSZ A;  1VQN F;  1GZ0 A;  2HQS C;  4X20 A;  4EI7 A;  4ZHW A;  4O2A B;  5JH7 A;  4TZZ A;  1JD1 A;  1FFX B;  4RQO A;  2FGY A;  2Z01 A;  1U40 A;  1DT9 A;  3JAW A;  3N4Z A;  1IPA A;  5KX5 A;  4EB6 A;  1IV3 A;  5G4V C;  3CCU F;  4G4X A;  4ZK7 A;  3LME A;  1M1K H;  4O4H A;  3ZOP A;  1VQ8 F;  1Q81 H;  2HP0 A;  1U43 A;  2HS4 A;  5JCO A;  2OTJ F;  1PF5 A;  2Q1X A;  2K1S A;  3LWR C;  5EAZ A;  1SA0 B;  3MBM A;  4BT2 A;  1VHA A;  4ZHY B;  2BTU A;  3AGK A;  1W5E A;  2YYE A;  5LOV B;  3QHD A;  1XHO A;  3ELC A;  4BT5 A;  3S03 A;  3VYT C;  1NQ3 A;  3HKB B;  4X1Y A;  1E7K A;  4X20 B;  4G4V A;  3N2G B;  5EIB C;  3M4S A;  3N2K B;  5EB0 A;  5BMV B;  5KMG A;  2JNB A;  3QUW A;  5GIP C;  1VQK F;  1FFX A;  5LA6 B;  4TV8 B;  3I7T A;  2ALE A;  1Z5V A;  4M8I A;  3SIU A;  2CHT A;  2Q1Y A;  3ESJ A;  3F0E A;  3KJK A;  4FFB B;  2CSL A;  1RA4 A;  2Z1E A;  4YJ3 A;  5FNV B;  2CHS A;  3D54 A;  3VCZ A;  4G4W A;  3N2G A;  2DT4 A;  1NJI H;  2RHL A;  3LWQ C;  3RYH A;  5JCO C;  4TV8 A;  2LCA A;  3K14 A;  2KTV A;  4XCQ A;  3IKE A;  4BT3 A;  4C8E A;  3CCV F;  3J81 M;  4U3J A;  2RHJ A;  3KJJ A;  5CA1 A;  1TUB B;  2I6D A;  4ZI7 A;  3CCJ F;  3S0Y A;  4G4Z A;  3P4E A;  3D00 A;  3B6N A;  1VQM F;  3NVK E;  5AVM A;  3E1Y A;  3CPQ A;  1VQ9 F;  3JAS B;  3T80 A;  4U39 A;  5HXU A;  1KQS F;  3L7Q A;  5LA6 A;  2Z1F A;  2HRU A;  3IMP A;  1GO0 A;  2QI2 A;  2BO1 A;  3S02 A;  3VMF B;  3JCM M;  3J7A R;  4BT4 A;  5FNV A;  3WGN A;  5FJ4 C;  3HKE B;  3GHZ A;  1OFU A;  1TVK A;  2W8B C;  4IHJ A;  1H47 A;  3FD5 A;  3JAS A;  1JN1 A;  4TV9 B;  1KC8 H;  3EOR A;  5EO3 A;  4I55 A;  5LP6 B;  4HNA B;  5HXZ A;  2F9Z C;  4BW0 B;  1T0A A;  1W2B F;  4O2B B;  3LWP C;  4NWO B;  3NK6 A;  3I55 F;  1QU9 A;  2OZB A;  1YHQ F;  3R0P A;  3C9T A;  1VQO F;  4O4J A;  2OTM A;  4DRX A;  5CB4 B;  4B5C A;  4I4T B;  4EI8 A;  1YJN F;  4B46 A;  5C8Y A;  2OTL F;  3CC7 F;  1YQN A;  3VIU A;  5CA0 A;  3G71 F;  5MN5 A;  1YI2 F;  1T0K B;  2I6R A;  4ZHV A;  3MCA B;  3VTI C;  3E22 B;  4BVS A;  3D01 A;  4TUY B;  2R75 1;  2VXY A;  3WGL A;  1U3P A;  3VYS C;  4O2A A;  5JH7 B;  2QA4 F;  2PHN A;  3M1X A;  2ZF8 A;  5C8Y B;  1SZQ A;  1Q8R A;  2IG8 A;  3HTN A;  3CCM F;  1Q7Y H;  2MQE A;  2G9I A;  3J80 M;  1JY8 A; 
#chains in the Genus database with same CATH homology
 1YQN A;  3F6M A;  3KE1 A;  1IV4 A;  1VHA A;  3ESJ A;  3GHZ A;  1GX1 A;  1H47 A;  1VH8 A;  3F0E A;  3P10 A;  2UZH A;  2PMP A;  1JN1 A;  3F0F A;  3MBM A;  5B8F A;  1U3L A;  3EOR A;  1U40 A;  3QHD A;  3ELC A;  3FBA A;  3B6N A;  3IEQ A;  3Q8H A;  4C8G A;  1IV2 A;  1IV3 A;  3T80 A;  3RE3 A;  1T0A A;  1U3P A;  2GZL A;  1W55 A;  3F0D A;  3IKF A;  1IV1 A;  4C8I A;  3FPI A;  1W57 A;  1KNJ A;  3K14 A;  3IEW A;  4C81 A;  1U43 A;  1KNK A;  3IKE A;  1H48 A;  4C8E A;  3K2X A;  4C82 A;  3F0G A;  3P0Z A;  2AMT A;  3JVH A;  3ERN A;  1JY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...