1VHAA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vhaA00
1W55A 3B6NA 1VHAA 1KNKA 1JY8A 1JN1A 3F0GA 3ESJA 1H47A 1IV3A 1YQNA 3ERNA 3QHDA 1U43A 3F0EA 2AMTA 3F0DA 4C81A 3FBAA 3F0FA 3EORA 2GZLA 1T0AA 3KE1A 1U3LA 3P0ZA 4C8IA 3ELCA 3F6MA 4C8GA 1IV1A 3FPIA 3T80A 3JVHA 3RE3A 3IEWA 5B8FA 1IV2A 1GX1A 1KNJA 4C8EA 2UZHA 3GHZA 2PMPA 1U40A 3IKEA 4C82A 1VH8A 3MBMA 1W57A 3IEQA 1U3PA 3IKFA 3Q8HA 3K2XA 3P10A 1H48A 1IV4A 3K14A
chains in the Genus database with same CATH superfamily
3CPQA 5G4UC 1RLUA 1W5EA 1NQ3A 4O2BB 1K73H 4IHJB 3TD3A 4EI9A 3F0DA 1K8AH 1VK3A 1UFYA 1KD1H 1ODEA 3WPWA 3KJKA 2QTPA 2IAFA 1TUBA 3AGKA 3HKEB 3S0HA 3E20B 1VQ8F 3HKDB 3I7TA 3IEWA 3N2GA 5GONA 3C8LA 3JAKA 5KX5B 4LNUA 3VYTC 2PHNA 2HVYD 1M1KH 2F9ZC 4NQ3A 2BTOA 1QD9A 3MCAB 5BMVB 2BTQB 1X52A 4O4HB 4U3JB 2FGYA 4DXDA 3M84A 3VI6A 2R6R1 4I55B 1VQNF 1W41A 3MQWA 4B62A 1VQ5F 2QI2A 1U3LA 3O85A 4FFBA 1VQ9F 1RQ2A 3C9SA 1W42A 1W581 4ZOLB 3V7EA 2BTUA 5GANK 1FFXA 3CCRF 1VQOF 2PMPA 1U40A 4TUYB 1W57A 2LCAA 5JVDB 3V3TA 3C9TA 2ZAUA 3VO8A 5EAZA 2ZF8A 5LXTB 4O4LB 3LYBA 1GO0A 3N2KA 5EYPB 2KGWA 3FBAA 3GTZA 3SIUA 5CA1B 4B5CA 3RYCA 2JNBA 3LWVC 4O4JA 1TUBB 2N48A 3D01A 1TVKA 4C8EA 4KWEA 4XCQA 2ZVYA 2HQSC 2B33A 2RHOA 5GONB 3VIUA 3JAKB 3HKBA 3MCQA 4BY9D 5FNVA 5HXUA 5GIPC 4F6RA 2AIZP 2LBXA 1W59A 4TV9A 3ERNA 2IG8A 4G4YA 3CCEF 1YJNF 5JQGB 3NK6A 2H8CA 3MDOA 3G6EF 3WGKA 2ZOVA 3CCJF 4RHAA 4FFBB 3ZOPA 1RQ7A 3GHZA 4BW0B 1FFXB 1UI9A 3S02A 5GINC 1XBIA 1COMA 2RHLA 3JATA 3J7AR 1JY8A 5HY1A 2I6DA 1R1MA 5JCOA 1VQVA 1W5AA 3WGMA 3WGLA 3LWQC 4C81A 1CK2A 3VOAA 1M90H 1W5FA 2HP0A 3N2KB 3D00A 4X20A 2WALA 3V4DA 4BVRA 1S72F 2OTLF 3T80A 3JVHA 4EI7A 1PF5A 2LBWA 3RYCB 1VQ4F 1QU9A 4I50A 1H7MA 5CB4A 3CD6F 3IKFA 1TVKB 1W40A 1IV4A 2OTJF 1W55A 3B6NA 1VHAA 4O4LA 1SDSA 4C4WC 1YJ9F 3F0GA 5EYPA 3HKBB 5AVMA 2Q1YA 1YQNA 3LDTA 1VQ6F 3JAWA 1OAPA 1FSZA 1W3EX 5FNVB 3HTNA 4F6RB 5C8YA 3RYHA 3ZO8A 5CA1A 2G9IA 4TV9B 2Z1TA 3N4YA 4C8IA 5EO3A 3OBWA 5EB1B 4C8GA 4PWTA 5J2UB 1IV2A 2OZBA 3C9RA 3NVIB 3WJPA 1KC8H 4TZZA 1U3PA 4G4VA 5JH7A 3PAFA 5GIOC 2HS3A 5EIBC 5JCOC 2YYEA 1NMUB 3CYPB 1W2BF 3CC4F 4NUTA 4ZI7A 3QHDA 3JATB 3VYSC 5JQGA 1N8RH 4IIJB 2ALEA 3ZP7A 2I6RA 2GZLA 3M4SA 3JASB 1X7PA 3CYQA 2HP0B 4X20B 4R40B 1YHQF 5IJ9A 1XHOA 1XV2A 2Z1UA 1GO1A 3QUWA 3CMAF 1Q7YH 1VQMF 1JFFA 3S0WA 3N4ZA 4I4TA 4I50B 3CC7F 5CB4B 3NMUC 3I3FA 3I55F 5HY4A 4YJ3A 1NJIH 1Z5VA 2HS4A 2UYNB 3GYQA 2QEXF 4RQOA 2KTUA 3HKCA 3JAWB 1YJWF 2ZVZA 2YXZA 2EWCA 4BVTA 3LWRC 5C8YB 3J80M 3RYHB 3DDNA 4BVQA 2CWJA 1QAHA 3CCLF 3VYUC 3IEQA 3K12A 5JH7B 1JN1A 4LCKA 2Z01A 3SIVA 3ESJA 1H47A 3RYIA 5CA0A 4ERHA 2IQQA 3F0EA 3VCZA 4EI8A 3KIZA 1Z5WA 3F0FA 4ZI7B 3WXMB 2RHJA 2VGNA 3DC2A 3EORA 5J2UA 3WJQA 3F6MA 3V7QA 2RB9A 3RE3A 1DT9A 2K1SA 4X3LA 3IKEA 2UYJA 3FFMA 3VMFB 1VH8A 3J81M 5LP6C 3CPWF 5IJ9B 2HS0A 3HJWC 2QA4F 4DRXA 1JFFB 4TV8A 1X25A 1RA4A 4IIJA 1X7OA 4I4TB 4G4ZA 5HP8A 3S03A 3IR9A 5HXZA 3JALB 3CCSF 2RHHA 3JCMM 1YITF 2GLZA 3JASA 2HRUA 4YJ3B 1QVFF 3G4SF 1T0AA 4G88A 3WJRA 4X1YA 4X1KA 4EB6A 5HY0A 1VQ7F 3ELCA 4YJ2A 3HKCB 2CHSA 4X1IA 5EWRA 2KTVA 3TD5A 2UYPA 2DT4A 2H8EA 2VAPA 1YIJF 5HY2A 2UYNA 2W8BC 5FLXM 5EZYA 3LWOC 3KHNA 3RYIB 4G4WA 1ONIA 1Q8RA 5CA0B 2UYKA 2FC3A 3KE1A 3P4EA 3FD5A 2MQEA 3KJJA 1GX1A 4ZHQA 4BVSA 1KQSF 5LA6A 3UT5A 2R751 3Q8HA 1Q86H 3P10A 1H48A 5DCVA 3JARA 1Q82H 4O2AA 4O4IA 3CCUF 1CLIA 3S06A 2Z1EA 2KG4A 5EIBD 3L7QA 1GZ0A 1IV3A 5J2TA 4DRXB 4TV8B 2HP3A 5LYJA 5IJ0A 3E22A 2VXYA 1VQPF 2CSLA 3RA6A 4G4XA 5HWEA 4X1KB 4X1YB 4EB6B 1J7HA 3RYFA 4YJ2B 3RA5A 3U0OA 4X1IB 2DYYA 3CCMF 3LFOA 3CC2F 5ITZA 3HAXD 3R0PA 3K0TA 5HP7A 3ZP4A 3K14A 3CG6A 5IYZA 4ZHVA 5G4VC 2HRYA 3JALA 5LOVA 5LP6A 3IMPA 3WGNA 4M8IA 4BT4A 2AMTA 1PXWA 2HX0A 1SZQA 3C9UA 5EZYB 4HNAB 3NVKE 3VOBA 5A2QM 2LBTA 4ZK7A 1W5BA 4C82A 2VAMA 3S0YA 3MBMA 4ZHQB 4E6EA 5LA6B 3UT5B 1E7KA 1FNKA 2Z1FA 1JJ2F 3NK7A 3I56F 3JARB 5MN5A 4BT2A 4O2AB 4WBNA 4O4IB 2VGMA 3QTYA 1SA0A 3VTIC 2CVLA 2V9YA 5J2TB 5KMGA 5IJ0B 5LYJB 3E22B 1K9MH 1IV1A 3FPIA 1VQLF 3CB2A 1YI2F 1KNJA 3N2GB 2NMUA 3HWUA 4B46A 3M1XA 3OW2F 3RYFB 3K2XA 3WPXA 2CW4A 4LNUB 4O2BA 4BT3A 1JD1A 1ZWZA 4IHJA 4BT7A 5ITZB 1XRGA 5IYZB 3LMEA 1CN7A 1U43A 5EB0A 5LOVB 5LP6B 3HKEA 4X3MA 4NWOB 2CHTA 1T0KB 3HKDA 2AIFA 3CCQF 2P6YA 2GVIA 1FNJA 3CCVF 5B8FA 5KX5A 3WGJA 4B45A 3CXCF 5MN4A 5IT9M 5BMVA 2BO1A 3E1YA 1YGYA 3TD4A 4O4HA 5FJ4C 4U3JA 4U39A 1DBFA 1KNKA 1OFUA 4I55A 4BT6A 2ZODA 3D54A 1QVGF 1RLGA 3OONA 5GAPK 3G71F 4WBNB 3JAMM 4HNAA 4ZOLA 3P0ZA 1SA0B 2OTMA 3BYQA 1IPAA 1Q81H 3PLAC 2OHWA 3LWPC 5KMGB 3FD6A 4TUYA 4ZHWA 2CZWA 4BT5A 2H6LA 2VAWA 2UZHA 2Q1XA 4ZHYB 3OBYA 4O4JB 5JVDA 3CMEF 1VQKF 5LXTA 3ON1A 2L26A 5MN6A
chains in the Genus database with same CATH topology
1W55A 3B6NA 1VHAA 1KNKA 1JY8A 1JN1A 3F0GA 3ESJA 1H47A 1IV3A 1YQNA 3ERNA 3QHDA 1U43A 3F0EA 2AMTA 3F0DA 4C81A 3FBAA 3F0FA 3EORA 2GZLA 1T0AA 3KE1A 1U3LA 3P0ZA 4C8IA 3ELCA 3F6MA 4C8GA 1IV1A 3FPIA 3T80A 3JVHA 3RE3A 3IEWA 5B8FA 1IV2A 1GX1A 1KNJA 4C8EA 2UZHA 3GHZA 2PMPA 1U40A 3IKEA 4C82A 1VH8A 3MBMA 1W57A 3IEQA 1U3PA 3IKFA 3Q8HA 3K2XA 3P10A 1H48A 1IV4A 3K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W55 A;  3B6N A;  1VHA A;  1KNK A;  1JY8 A;  1JN1 A;  3F0G A;  3ESJ A;  1H47 A;  1IV3 A;  1YQN A;  3ERN A;  3QHD A;  1U43 A;  3F0E A;  2AMT A;  3F0D A;  4C81 A;  3FBA A;  3F0F A;  3EOR A;  2GZL A;  1T0A A;  3KE1 A;  1U3L A;  3P0Z A;  4C8I A;  3ELC A;  3F6M A;  4C8G A;  1IV1 A;  3FPI A;  3T80 A;  3JVH A;  3RE3 A;  3IEW A;  5B8F A;  1IV2 A;  1GX1 A;  1KNJ A;  4C8E A;  2UZH A;  3GHZ A;  2PMP A;  1U40 A;  3IKE A;  4C82 A;  1VH8 A;  3MBM A;  1W57 A;  3IEQ A;  1U3P A;  3IKF A;  3Q8H A;  3K2X A;  3P10 A;  1H48 A;  1IV4 A;  3K14 A; 
#chains in the Genus database with same CATH topology
 3CPQ A;  5G4U C;  1RLU A;  1W5E A;  1NQ3 A;  4O2B B;  1K73 H;  4IHJ B;  3TD3 A;  4EI9 A;  3F0D A;  1K8A H;  1VK3 A;  1UFY A;  1KD1 H;  1ODE A;  3WPW A;  3KJK A;  2QTP A;  2IAF A;  1TUB A;  3AGK A;  3HKE B;  3S0H A;  3E20 B;  1VQ8 F;  3HKD B;  3I7T A;  3IEW A;  3N2G A;  5GON A;  3C8L A;  3JAK A;  5KX5 B;  4LNU A;  3VYT C;  2PHN A;  2HVY D;  1M1K H;  2F9Z C;  4NQ3 A;  2BTO A;  1QD9 A;  3MCA B;  5BMV B;  2BTQ B;  1X52 A;  4O4H B;  4U3J B;  2FGY A;  4DXD A;  3M84 A;  3VI6 A;  2R6R 1;  4I55 B;  1VQN F;  1W41 A;  3MQW A;  4B62 A;  1VQ5 F;  2QI2 A;  1U3L A;  3O85 A;  4FFB A;  1VQ9 F;  1RQ2 A;  3C9S A;  1W42 A;  1W58 1;  4ZOL B;  3V7E A;  2BTU A;  5GAN K;  1FFX A;  3CCR F;  1VQO F;  2PMP A;  1U40 A;  4TUY B;  1W57 A;  2LCA A;  5JVD B;  3V3T A;  3C9T A;  2ZAU A;  3VO8 A;  5EAZ A;  2ZF8 A;  5LXT B;  4O4L B;  3LYB A;  1GO0 A;  3N2K A;  5EYP B;  2KGW A;  3FBA A;  3GTZ A;  3SIU A;  5CA1 B;  4B5C A;  3RYC A;  2JNB A;  3LWV C;  4O4J A;  1TUB B;  2N48 A;  3D01 A;  1TVK A;  4C8E A;  4KWE A;  4XCQ A;  2ZVY A;  2HQS C;  2B33 A;  2RHO A;  5GON B;  3VIU A;  3JAK B;  3HKB A;  3MCQ A;  4BY9 D;  5FNV A;  5HXU A;  5GIP C;  4F6R A;  2AIZ P;  2LBX A;  1W59 A;  4TV9 A;  3ERN A;  2IG8 A;  4G4Y A;  3CCE F;  1YJN F;  5JQG B;  3NK6 A;  2H8C A;  3MDO A;  3G6E F;  3WGK A;  2ZOV A;  3CCJ F;  4RHA A;  4FFB B;  3ZOP A;  1RQ7 A;  3GHZ A;  4BW0 B;  1FFX B;  1UI9 A;  3S02 A;  5GIN C;  1XBI A;  1COM A;  2RHL A;  3JAT A;  3J7A R;  1JY8 A;  5HY1 A;  2I6D A;  1R1M A;  5JCO A;  1VQV A;  1W5A A;  3WGM A;  3WGL A;  3LWQ C;  4C81 A;  1CK2 A;  3VOA A;  1M90 H;  1W5F A;  2HP0 A;  3N2K B;  3D00 A;  4X20 A;  2WAL A;  3V4D A;  4BVR A;  1S72 F;  2OTL F;  3T80 A;  3JVH A;  4EI7 A;  1PF5 A;  2LBW A;  3RYC B;  1VQ4 F;  1QU9 A;  4I50 A;  1H7M A;  5CB4 A;  3CD6 F;  3IKF A;  1TVK B;  1W40 A;  1IV4 A;  2OTJ F;  1W55 A;  3B6N A;  1VHA A;  4O4L A;  1SDS A;  4C4W C;  1YJ9 F;  3F0G A;  5EYP A;  3HKB B;  5AVM A;  2Q1Y A;  1YQN A;  3LDT A;  1VQ6 F;  3JAW A;  1OAP A;  1FSZ A;  1W3E X;  5FNV B;  3HTN A;  4F6R B;  5C8Y A;  3RYH A;  3ZO8 A;  5CA1 A;  2G9I A;  4TV9 B;  2Z1T A;  3N4Y A;  4C8I A;  5EO3 A;  3OBW A;  5EB1 B;  4C8G A;  4PWT A;  5J2U B;  1IV2 A;  2OZB A;  3C9R A;  3NVI B;  3WJP A;  1KC8 H;  4TZZ A;  1U3P A;  4G4V A;  5JH7 A;  3PAF A;  5GIO C;  2HS3 A;  5EIB C;  5JCO C;  2YYE A;  1NMU B;  3CYP B;  1W2B F;  3CC4 F;  4NUT A;  4ZI7 A;  3QHD A;  3JAT B;  3VYS C;  5JQG A;  1N8R H;  4IIJ B;  2ALE A;  3ZP7 A;  2I6R A;  2GZL A;  3M4S A;  3JAS B;  1X7P A;  3CYQ A;  2HP0 B;  4X20 B;  4R40 B;  1YHQ F;  5IJ9 A;  1XHO A;  1XV2 A;  2Z1U A;  1GO1 A;  3QUW A;  3CMA F;  1Q7Y H;  1VQM F;  1JFF A;  3S0W A;  3N4Z A;  4I4T A;  4I50 B;  3CC7 F;  5CB4 B;  3NMU C;  3I3F A;  3I55 F;  5HY4 A;  4YJ3 A;  1NJI H;  1Z5V A;  2HS4 A;  2UYN B;  3GYQ A;  2QEX F;  4RQO A;  2KTU A;  3HKC A;  3JAW B;  1YJW F;  2ZVZ A;  2YXZ A;  2EWC A;  4BVT A;  3LWR C;  5C8Y B;  3J80 M;  3RYH B;  3DDN A;  4BVQ A;  2CWJ A;  1QAH A;  3CCL F;  3VYU C;  3IEQ A;  3K12 A;  5JH7 B;  1JN1 A;  4LCK A;  2Z01 A;  3SIV A;  3ESJ A;  1H47 A;  3RYI A;  5CA0 A;  4ERH A;  2IQQ A;  3F0E A;  3VCZ A;  4EI8 A;  3KIZ A;  1Z5W A;  3F0F A;  4ZI7 B;  3WXM B;  2RHJ A;  2VGN A;  3DC2 A;  3EOR A;  5J2U A;  3WJQ A;  3F6M A;  3V7Q A;  2RB9 A;  3RE3 A;  1DT9 A;  2K1S A;  4X3L A;  3IKE A;  2UYJ A;  3FFM A;  3VMF B;  1VH8 A;  3J81 M;  5LP6 C;  3CPW F;  5IJ9 B;  2HS0 A;  3HJW C;  2QA4 F;  4DRX A;  1JFF B;  4TV8 A;  1X25 A;  1RA4 A;  4IIJ A;  1X7O A;  4I4T B;  4G4Z A;  5HP8 A;  3S03 A;  3IR9 A;  5HXZ A;  3JAL B;  3CCS F;  2RHH A;  3JCM M;  1YIT F;  2GLZ A;  3JAS A;  2HRU A;  4YJ3 B;  1QVF F;  3G4S F;  1T0A A;  4G88 A;  3WJR A;  4X1Y A;  4X1K A;  4EB6 A;  5HY0 A;  1VQ7 F;  3ELC A;  4YJ2 A;  3HKC B;  2CHS A;  4X1I A;  5EWR A;  2KTV A;  3TD5 A;  2UYP A;  2DT4 A;  2H8E A;  2VAP A;  1YIJ F;  5HY2 A;  2UYN A;  2W8B C;  5FLX M;  5EZY A;  3LWO C;  3KHN A;  3RYI B;  4G4W A;  1ONI A;  1Q8R A;  5CA0 B;  2UYK A;  2FC3 A;  3KE1 A;  3P4E A;  3FD5 A;  2MQE A;  3KJJ A;  1GX1 A;  4ZHQ A;  4BVS A;  1KQS F;  5LA6 A;  3UT5 A;  2R75 1;  3Q8H A;  1Q86 H;  3P10 A;  1H48 A;  5DCV A;  3JAR A;  1Q82 H;  4O2A A;  4O4I A;  3CCU F;  1CLI A;  3S06 A;  2Z1E A;  2KG4 A;  5EIB D;  3L7Q A;  1GZ0 A;  1IV3 A;  5J2T A;  4DRX B;  4TV8 B;  2HP3 A;  5LYJ A;  5IJ0 A;  3E22 A;  2VXY A;  1VQP F;  2CSL A;  3RA6 A;  4G4X A;  5HWE A;  4X1K B;  4X1Y B;  4EB6 B;  1J7H A;  3RYF A;  4YJ2 B;  3RA5 A;  3U0O A;  4X1I B;  2DYY A;  3CCM F;  3LFO A;  3CC2 F;  5ITZ A;  3HAX D;  3R0P A;  3K0T A;  5HP7 A;  3ZP4 A;  3K14 A;  3CG6 A;  5IYZ A;  4ZHV A;  5G4V C;  2HRY A;  3JAL A;  5LOV A;  5LP6 A;  3IMP A;  3WGN A;  4M8I A;  4BT4 A;  2AMT A;  1PXW A;  2HX0 A;  1SZQ A;  3C9U A;  5EZY B;  4HNA B;  3NVK E;  3VOB A;  5A2Q M;  2LBT A;  4ZK7 A;  1W5B A;  4C82 A;  2VAM A;  3S0Y A;  3MBM A;  4ZHQ B;  4E6E A;  5LA6 B;  3UT5 B;  1E7K A;  1FNK A;  2Z1F A;  1JJ2 F;  3NK7 A;  3I56 F;  3JAR B;  5MN5 A;  4BT2 A;  4O2A B;  4WBN A;  4O4I B;  2VGM A;  3QTY A;  1SA0 A;  3VTI C;  2CVL A;  2V9Y A;  5J2T B;  5KMG A;  5IJ0 B;  5LYJ B;  3E22 B;  1K9M H;  1IV1 A;  3FPI A;  1VQL F;  3CB2 A;  1YI2 F;  1KNJ A;  3N2G B;  2NMU A;  3HWU A;  4B46 A;  3M1X A;  3OW2 F;  3RYF B;  3K2X A;  3WPX A;  2CW4 A;  4LNU B;  4O2B A;  4BT3 A;  1JD1 A;  1ZWZ A;  4IHJ A;  4BT7 A;  5ITZ B;  1XRG A;  5IYZ B;  3LME A;  1CN7 A;  1U43 A;  5EB0 A;  5LOV B;  5LP6 B;  3HKE A;  4X3M A;  4NWO B;  2CHT A;  1T0K B;  3HKD A;  2AIF A;  3CCQ F;  2P6Y A;  2GVI A;  1FNJ A;  3CCV F;  5B8F A;  5KX5 A;  3WGJ A;  4B45 A;  3CXC F;  5MN4 A;  5IT9 M;  5BMV A;  2BO1 A;  3E1Y A;  1YGY A;  3TD4 A;  4O4H A;  5FJ4 C;  4U3J A;  4U39 A;  1DBF A;  1KNK A;  1OFU A;  4I55 A;  4BT6 A;  2ZOD A;  3D54 A;  1QVG F;  1RLG A;  3OON A;  5GAP K;  3G71 F;  4WBN B;  3JAM M;  4HNA A;  4ZOL A;  3P0Z A;  1SA0 B;  2OTM A;  3BYQ A;  1IPA A;  1Q81 H;  3PLA C;  2OHW A;  3LWP C;  5KMG B;  3FD6 A;  4TUY A;  4ZHW A;  2CZW A;  4BT5 A;  2H6L A;  2VAW A;  2UZH A;  2Q1X A;  4ZHY B;  3OBY A;  4O4J B;  5JVD A;  3CME F;  1VQK F;  5LXT A;  3ON1 A;  2L26 A;  5MN6 A; 
#chains in the Genus database with same CATH homology
 1W55 A;  3B6N A;  1VHA A;  1KNK A;  1JY8 A;  1JN1 A;  3F0G A;  3ESJ A;  1H47 A;  1IV3 A;  1YQN A;  3ERN A;  3QHD A;  1U43 A;  3F0E A;  2AMT A;  3F0D A;  4C81 A;  3FBA A;  3F0F A;  3EOR A;  2GZL A;  1T0A A;  3KE1 A;  1U3L A;  3P0Z A;  4C8I A;  3ELC A;  3F6M A;  4C8G A;  1IV1 A;  3FPI A;  3T80 A;  3JVH A;  3RE3 A;  3IEW A;  5B8F A;  1IV2 A;  1GX1 A;  1KNJ A;  4C8E A;  2UZH A;  3GHZ A;  2PMP A;  1U40 A;  3IKE A;  4C82 A;  1VH8 A;  3MBM A;  1W57 A;  3IEQ A;  1U3P A;  3IKF A;  3Q8H A;  3K2X A;  3P10 A;  1H48 A;  1IV4 A;  3K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...