1VHAA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
b'SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vhaA00
1GX1A 3ESJA 2AMTA 1U43A 1U3PA 2UZHA 1VH8A 3MBMA 4C81A 3K2XA 3F0DA 3IKFA 3ELCA 3FBAA 3F0FA 3QHDA 3F0GA 3Q8HA 3IKEA 1W55A 4C82A 5B8FA 4C8EA 1W57A 1H48A 4C8IA 3B6NA 3P10A 3IEWA 3JVHA 3KE1A 1JN1A 1IV2A 4C8GA 3T80A 3RE3A 1KNKA 1YQNA 1KNJA 2PMPA 1H47A 3ERNA 1T0AA 3P0ZA 1VHAA 1JY8A 1IV3A 3F0EA 3GHZA 3EORA 1IV1A 1U40A 2GZLA 3F6MA 3K14A 1IV4A 1U3LA 3FPIA 3IEQA
chains in the Genus database with same CATH superfamily
3E20B 5C8YA 5JQGB 3JASB 2QA4F 3VI6A 1NJIH 5EB0A 3WGMA 3RA5A 2HRUA 5HY0A 4C82A 3SIVA 2UYNB 1M1KH 5IJ9A 2CW4A 1RQ7A 2NMUA 3JVHA 3ZO8A 4BVTA 2IAFA 4F6RA 1M90H 4G4VA 2OTMA 5JCOA 3WXMB 1IV3A 1XBIA 3WGNA 1ZWZA 2CSLA 3VIUA 3F0DA 4F6RB 2I6RA 1JJ2F 3HKCA 2ZOVA 3F0GA 4X1IA 5A2QM 1CLIA 4C8IA 3HKCB 5KX5A 3JATA 5CA0A 4X1IB 1JN1A 1Q8RA 1OFUA 3I55F 3AGKA 4O2BA 3RYCA 2LBXA 5KX5B 2CVLA 1TVKA 3JATB 5CA0B 3EORA 3F6MA 2OZBA 1U3LA 4G4ZA 1JD1A 4BY9D 4O4JA 1NMUB 3MBMA 2CWJA 2UYPA 2ZF8A 4O2BB 3IKFA 3K0TA 3RYCB 2HVYD 1W42A 4NUTA 1TVKB 3JAMM 2ZAUA 4O4JB 2YXZA 1VK3A 3NVKE 1H48A 5J2TA 5MN5A 3KIZA 1X52A 4EI8A 3VO8A 3KE1A 4I4TA 4EI9A 2BO1A 3QTYA 3T80A 1W581 3CCVF 3D00A 3L7QA 2KTUA 1YQNA 3OONA 1DT9A 1JY8A 3C9SA 4I4TB 2HS4A 4B62A 3N4ZA 4U3JA 1NQ3A 3P4EA 3V7EA 4O4IA 4X1KA 1FSZA 3Q8HA 5JCOC 3JCMM 3C9TA 4IIJA 2Q1YA 2MQEA 5EIBD 1QVGF 4O4IB 4X1KB 4DRXA 2OTLF 1XHOA 4IIJB 1YJ9F 2HX0A 4ZK7A 1VHAA 5ITZA 4DRXB 3IEQA 5GONA 1JFFB 3I3FA 5ITZB 1T0KB 2Z1UA 1RLGA 3IR9A 3GTZA 3N2KA 2B33A 4X1YA 4PWTA 2IG8A 3G4SF 3V7QA 3PLAC 1QU9A 3NK6A 2HP0A 5EYPA 2Z1TA 2QEXF 4X1YB 3RYIA 4RHAA 3S0YA 1Q86H 2EWCA 5HWEA 5CB4A 3CC2F 5HY4A 3GHZA 4BT5A 1IV1A 2HRYA 1CK2A 2VAPA 4TUYA 1TUBA 2H8EA 5CB4B 2RHJA 1Q82H 1UFYA 3RYFA 3IKEA 2HP3A 4U39A 3JALA 4TUYB 5FLXM 5C8YB 2KGWA 1TUBB 1UI9A 1XRGA 5FJ4C 3RYFB 2P6YA 1X7OA 4TZZA 5LXTA 2FGYA 1S72F 2Z1FA 3CC7F 3JALB 3ZOPA 2Q1XA 4ZHVA 5EO3A 1RQ2A 5IJ9B 2VAMA 1IV4A 2JNBA 3E22A 4FFBA 4BVRA 4G88A 5LXTB 2AMTA 4WBNA 4R40B 3WGKA 2YYEA 2FC3A 1KD1H 3IMPA 5GIOC 3E22B 2OTJF 3JARA 4BT7A 3CG6A 4XCQA 1ONIA 2N48A 4WBNB 1VQVA 1VQ4F 1VQMF 5EB1B 4X3MA 3K12A 1PF5A 3TD4A 3CMEF 2H8CA 1VQNF 3OBWA 4BT2A 1FFXA 3MQWA 3JARB 3ERNA 3CXCF 3O85A 1VQ7F 4B45A 5GAPK 3FD5A 3FPIA 1U43A 2UZHA 4C81A 1Q7YH 3E1YA 3ELCA 1FNJA 3U0OA 3G6EF 3RA6A 3CCUF 1W55A 3LMEA 5AVMA 1ODEA 5HY2A 3CD6F 1W5BA 4I55A 5J2UA 4G4YA 4BVSA 2BTUA 3PAFA 2ZODA 3FFMA 3VYTC 3J7AR 3C9RA 2CHSA 2HQSC 4O2AA 1W41A 4I55B 4G4WA 3D01A 5GANK 5J2UB 5J2TB 1W59A 3ZP7A 2RHOA 2UYKA 2AIZP 4O4LA 1U3PA 4ZI7A 4O2AB 3CCJF 4TV9A 1Q81H 4C4WC 4I50A 5B8FA 1SDSA 1W5EA 3KJKA 2V9YA 4ZI7B 1KQSF 4U3JB 4YJ2A 4TV9B 3CPWF 3GYQA 3G71F 3UT5A 4I50B 2QI2A 3S03A 1VQ5F 1H7MA 1VQLF 3J81M 3OW2F 3KHNA 4YJ2B 2BTQB 5IYZA 5JH7A 3UT5B 3N4YA 3J80M 3OBYA 5IYZB 5JH7B 2QTPA 3WJPA 5LP6A 1W5FA 3VCZA 4BW0B 4ZHQA 3V4DA 3C8LA 1X7PA 3DDNA 1PXWA 2DT4A 5GONB 2VGMA 2GVIA 5LP6B 3LWPC 3HKDA 4C8GA 3N2KB 3RE3A 3VMFB 3P0ZA 5LOVA 2HP0B 5EYPB 5HP8A 4RQOA 5LYJA 3CYQA 5DCVA 1N8RH 3WJQA 4B46A 1GZ0A 1COMA 3CPQA 3RYIB 5BMVA 3LDTA 5LOVB 4ZHWA 3I7TA 3VYSC 1QVFF 5LYJB 3HWUA 5JVDA 2VGNA 4LNUA 2BTOA 4C8EA 3NMUC 3S06A 2ZVZA 3LYBA 5BMVB 1VQOF 4NQ3A 2KTVA 4O4HA 3VTIC 4ZHYB 1YJWF 2RB9A 4KWEA 5JVDB 1IV2A 4LNUB 1SZQA 3WGJA 1YJNF 3TD3A 5HXZA 1CN7A 1H47A 2CZWA 3CB2A 1K9MH 4O4HB 2HS3A 2UYNA 1YI2F 1VQ6F 3HKEA 3LWOC 4X20A 4DXDA 3SIUA 3HAXD 3CCRF 4B5CA 2W8BC 5GIPC 4NWOB 5EAZA 4FFBB 3HKEB 2LCAA 2OHWA 4X20B 3LWVC 2I6DA 1VQ8F 4EI7A 2RHHA 3B6NA 2VAWA 3NVIB 3IEWA 2Z1EA 1GO1A 3CC4F 2F9ZC 5IT9M 5LP6C 5KMGA 4HNAA 5CA1A 2PMPA 3R0PA 3HJWC 1VQ9F 2GLZA 3D54A 4TV8A 2G9IA 3C9UA 1VQKF 1U40A 5KMGB 4HNAB 1FFXB 5CA1B 1VQPF 1QD9A 5FNVA 4TV8B 3WPXA 1DBFA 3LFOA 3CCLF 1YHQF 3JAWA 3TD5A 3CCEF 5HP7A 3JAKA 1RLUA 1Z5VA 5FNVB 1IPAA 3JAWB 2WALA 1X25A 5LA6A 1T0AA 3JAKB 3CMAF 1W2BF 2GZLA 2DYYA 2CHTA 3K14A 3S02A 3QHDA 3VOAA 2HS0A 1VH8A 5LA6B 3VYUC 4ZOLA 5GINC 2ZVYA 3NK7A 5EZYA 1YGYA 1QAHA 4G4XA 5MN6A 4M8IA 1GO0A 3DC2A 4BVQA 4YJ3A 1K8AH 4O4LB 3S0HA 4ZOLB 1W5AA 5EZYB 3BYQA 5EWRA 3P10A 2K1SA 2AIFA 4IHJA 1YITF 5IJ0A 4YJ3B 3CCMF 1KNKA 5HXUA 3HKBA 3MCAB 3CCSF 4LCKA 1RA4A 1Z5WA 4BT6A 3MCQA 1W3EX 4IHJB 3ESJA 5IJ0B 2ALEA 3V3TA 2KG4A 3K2XA 3HKBB 4E6EA 3F0FA 3MDOA 3M4SA 1KC8H 2R751 5EIBC 4BT3A 1W57A 4BT4A 3HTNA 5G4UC 1SA0A 3M84A 1XV2A 2RHLA 1J7HA 3WJRA 2PHNA 2UYJA 2R6R1 3N2GA 5HY1A 2LBTA 1JFFA 4ZHQB 4EB6A 1SA0B 1W40A 3WGLA 3F0EA 4X3LA 2IQQA 2LBWA 3VOBA 2Z01A 3N2GB 1GX1A 3HKDB 4EB6B 3FD6A 1E7KA 1K73H 3I56F 3CCQF 3FBAA 3LWRC 3CYPB 2L26A 3RYHA 3WPWA 3ON1A 3M1XA 5MN4A 3S0WA 3ZP4A 1FNKA 3QUWA 3KJJA 2H6LA 3RYHB 1YIJF 5G4VC 5JQGA 1KNJA 3JASA 4ERHA 2VXYA 1R1MA 1OAPA 3LWQC
chains in the Genus database with same CATH topology
1GX1A 3ESJA 2AMTA 1U43A 1U3PA 2UZHA 1VH8A 3MBMA 4C81A 3K2XA 3F0DA 3IKFA 3ELCA 3FBAA 3F0FA 3QHDA 3F0GA 3Q8HA 3IKEA 1W55A 4C82A 5B8FA 4C8EA 1W57A 1H48A 4C8IA 3B6NA 3P10A 3IEWA 3JVHA 3KE1A 1JN1A 1IV2A 4C8GA 3T80A 3RE3A 1KNKA 1YQNA 1KNJA 2PMPA 1H47A 3ERNA 1T0AA 3P0ZA 1VHAA 1JY8A 1IV3A 3F0EA 3GHZA 3EORA 1IV1A 1U40A 2GZLA 3F6MA 3K14A 1IV4A 1U3LA 3FPIA 3IEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX1 A;  3ESJ A;  2AMT A;  1U43 A;  1U3P A;  2UZH A;  1VH8 A;  3MBM A;  4C81 A;  3K2X A;  3F0D A;  3IKF A;  3ELC A;  3FBA A;  3F0F A;  3QHD A;  3F0G A;  3Q8H A;  3IKE A;  1W55 A;  4C82 A;  5B8F A;  4C8E A;  1W57 A;  1H48 A;  4C8I A;  3B6N A;  3P10 A;  3IEW A;  3JVH A;  3KE1 A;  1JN1 A;  1IV2 A;  4C8G A;  3T80 A;  3RE3 A;  1KNK A;  1YQN A;  1KNJ A;  2PMP A;  1H47 A;  3ERN A;  1T0A A;  3P0Z A;  1VHA A;  1JY8 A;  1IV3 A;  3F0E A;  3GHZ A;  3EOR A;  1IV1 A;  1U40 A;  2GZL A;  3F6M A;  3K14 A;  1IV4 A;  1U3L A;  3FPI A;  3IEQ A; 
#chains in the Genus database with same CATH topology
 3E20 B;  5C8Y A;  5JQG B;  3JAS B;  2QA4 F;  3VI6 A;  1NJI H;  5EB0 A;  3WGM A;  3RA5 A;  2HRU A;  5HY0 A;  4C82 A;  3SIV A;  2UYN B;  1M1K H;  5IJ9 A;  2CW4 A;  1RQ7 A;  2NMU A;  3JVH A;  3ZO8 A;  4BVT A;  2IAF A;  4F6R A;  1M90 H;  4G4V A;  2OTM A;  5JCO A;  3WXM B;  1IV3 A;  1XBI A;  3WGN A;  1ZWZ A;  2CSL A;  3VIU A;  3F0D A;  4F6R B;  2I6R A;  1JJ2 F;  3HKC A;  2ZOV A;  3F0G A;  4X1I A;  5A2Q M;  1CLI A;  4C8I A;  3HKC B;  5KX5 A;  3JAT A;  5CA0 A;  4X1I B;  1JN1 A;  1Q8R A;  1OFU A;  3I55 F;  3AGK A;  4O2B A;  3RYC A;  2LBX A;  5KX5 B;  2CVL A;  1TVK A;  3JAT B;  5CA0 B;  3EOR A;  3F6M A;  2OZB A;  1U3L A;  4G4Z A;  1JD1 A;  4BY9 D;  4O4J A;  1NMU B;  3MBM A;  2CWJ A;  2UYP A;  2ZF8 A;  4O2B B;  3IKF A;  3K0T A;  3RYC B;  2HVY D;  1W42 A;  4NUT A;  1TVK B;  3JAM M;  2ZAU A;  4O4J B;  2YXZ A;  1VK3 A;  3NVK E;  1H48 A;  5J2T A;  5MN5 A;  3KIZ A;  1X52 A;  4EI8 A;  3VO8 A;  3KE1 A;  4I4T A;  4EI9 A;  2BO1 A;  3QTY A;  3T80 A;  1W58 1;  3CCV F;  3D00 A;  3L7Q A;  2KTU A;  1YQN A;  3OON A;  1DT9 A;  1JY8 A;  3C9S A;  4I4T B;  2HS4 A;  4B62 A;  3N4Z A;  4U3J A;  1NQ3 A;  3P4E A;  3V7E A;  4O4I A;  4X1K A;  1FSZ A;  3Q8H A;  5JCO C;  3JCM M;  3C9T A;  4IIJ A;  2Q1Y A;  2MQE A;  5EIB D;  1QVG F;  4O4I B;  4X1K B;  4DRX A;  2OTL F;  1XHO A;  4IIJ B;  1YJ9 F;  2HX0 A;  4ZK7 A;  1VHA A;  5ITZ A;  4DRX B;  3IEQ A;  5GON A;  1JFF B;  3I3F A;  5ITZ B;  1T0K B;  2Z1U A;  1RLG A;  3IR9 A;  3GTZ A;  3N2K A;  2B33 A;  4X1Y A;  4PWT A;  2IG8 A;  3G4S F;  3V7Q A;  3PLA C;  1QU9 A;  3NK6 A;  2HP0 A;  5EYP A;  2Z1T A;  2QEX F;  4X1Y B;  3RYI A;  4RHA A;  3S0Y A;  1Q86 H;  2EWC A;  5HWE A;  5CB4 A;  3CC2 F;  5HY4 A;  3GHZ A;  4BT5 A;  1IV1 A;  2HRY A;  1CK2 A;  2VAP A;  4TUY A;  1TUB A;  2H8E A;  5CB4 B;  2RHJ A;  1Q82 H;  1UFY A;  3RYF A;  3IKE A;  2HP3 A;  4U39 A;  3JAL A;  4TUY B;  5FLX M;  5C8Y B;  2KGW A;  1TUB B;  1UI9 A;  1XRG A;  5FJ4 C;  3RYF B;  2P6Y A;  1X7O A;  4TZZ A;  5LXT A;  2FGY A;  1S72 F;  2Z1F A;  3CC7 F;  3JAL B;  3ZOP A;  2Q1X A;  4ZHV A;  5EO3 A;  1RQ2 A;  5IJ9 B;  2VAM A;  1IV4 A;  2JNB A;  3E22 A;  4FFB A;  4BVR A;  4G88 A;  5LXT B;  2AMT A;  4WBN A;  4R40 B;  3WGK A;  2YYE A;  2FC3 A;  1KD1 H;  3IMP A;  5GIO C;  3E22 B;  2OTJ F;  3JAR A;  4BT7 A;  3CG6 A;  4XCQ A;  1ONI A;  2N48 A;  4WBN B;  1VQV A;  1VQ4 F;  1VQM F;  5EB1 B;  4X3M A;  3K12 A;  1PF5 A;  3TD4 A;  3CME F;  2H8C A;  1VQN F;  3OBW A;  4BT2 A;  1FFX A;  3MQW A;  3JAR B;  3ERN A;  3CXC F;  3O85 A;  1VQ7 F;  4B45 A;  5GAP K;  3FD5 A;  3FPI A;  1U43 A;  2UZH A;  4C81 A;  1Q7Y H;  3E1Y A;  3ELC A;  1FNJ A;  3U0O A;  3G6E F;  3RA6 A;  3CCU F;  1W55 A;  3LME A;  5AVM A;  1ODE A;  5HY2 A;  3CD6 F;  1W5B A;  4I55 A;  5J2U A;  4G4Y A;  4BVS A;  2BTU A;  3PAF A;  2ZOD A;  3FFM A;  3VYT C;  3J7A R;  3C9R A;  2CHS A;  2HQS C;  4O2A A;  1W41 A;  4I55 B;  4G4W A;  3D01 A;  5GAN K;  5J2U B;  5J2T B;  1W59 A;  3ZP7 A;  2RHO A;  2UYK A;  2AIZ P;  4O4L A;  1U3P A;  4ZI7 A;  4O2A B;  3CCJ F;  4TV9 A;  1Q81 H;  4C4W C;  4I50 A;  5B8F A;  1SDS A;  1W5E A;  3KJK A;  2V9Y A;  4ZI7 B;  1KQS F;  4U3J B;  4YJ2 A;  4TV9 B;  3CPW F;  3GYQ A;  3G71 F;  3UT5 A;  4I50 B;  2QI2 A;  3S03 A;  1VQ5 F;  1H7M A;  1VQL F;  3J81 M;  3OW2 F;  3KHN A;  4YJ2 B;  2BTQ B;  5IYZ A;  5JH7 A;  3UT5 B;  3N4Y A;  3J80 M;  3OBY A;  5IYZ B;  5JH7 B;  2QTP A;  3WJP A;  5LP6 A;  1W5F A;  3VCZ A;  4BW0 B;  4ZHQ A;  3V4D A;  3C8L A;  1X7P A;  3DDN A;  1PXW A;  2DT4 A;  5GON B;  2VGM A;  2GVI A;  5LP6 B;  3LWP C;  3HKD A;  4C8G A;  3N2K B;  3RE3 A;  3VMF B;  3P0Z A;  5LOV A;  2HP0 B;  5EYP B;  5HP8 A;  4RQO A;  5LYJ A;  3CYQ A;  5DCV A;  1N8R H;  3WJQ A;  4B46 A;  1GZ0 A;  1COM A;  3CPQ A;  3RYI B;  5BMV A;  3LDT A;  5LOV B;  4ZHW A;  3I7T A;  3VYS C;  1QVF F;  5LYJ B;  3HWU A;  5JVD A;  2VGN A;  4LNU A;  2BTO A;  4C8E A;  3NMU C;  3S06 A;  2ZVZ A;  3LYB A;  5BMV B;  1VQO F;  4NQ3 A;  2KTV A;  4O4H A;  3VTI C;  4ZHY B;  1YJW F;  2RB9 A;  4KWE A;  5JVD B;  1IV2 A;  4LNU B;  1SZQ A;  3WGJ A;  1YJN F;  3TD3 A;  5HXZ A;  1CN7 A;  1H47 A;  2CZW A;  3CB2 A;  1K9M H;  4O4H B;  2HS3 A;  2UYN A;  1YI2 F;  1VQ6 F;  3HKE A;  3LWO C;  4X20 A;  4DXD A;  3SIU A;  3HAX D;  3CCR F;  4B5C A;  2W8B C;  5GIP C;  4NWO B;  5EAZ A;  4FFB B;  3HKE B;  2LCA A;  2OHW A;  4X20 B;  3LWV C;  2I6D A;  1VQ8 F;  4EI7 A;  2RHH A;  3B6N A;  2VAW A;  3NVI B;  3IEW A;  2Z1E A;  1GO1 A;  3CC4 F;  2F9Z C;  5IT9 M;  5LP6 C;  5KMG A;  4HNA A;  5CA1 A;  2PMP A;  3R0P A;  3HJW C;  1VQ9 F;  2GLZ A;  3D54 A;  4TV8 A;  2G9I A;  3C9U A;  1VQK F;  1U40 A;  5KMG B;  4HNA B;  1FFX B;  5CA1 B;  1VQP F;  1QD9 A;  5FNV A;  4TV8 B;  3WPX A;  1DBF A;  3LFO A;  3CCL F;  1YHQ F;  3JAW A;  3TD5 A;  3CCE F;  5HP7 A;  3JAK A;  1RLU A;  1Z5V A;  5FNV B;  1IPA A;  3JAW B;  2WAL A;  1X25 A;  5LA6 A;  1T0A A;  3JAK B;  3CMA F;  1W2B F;  2GZL A;  2DYY A;  2CHT A;  3K14 A;  3S02 A;  3QHD A;  3VOA A;  2HS0 A;  1VH8 A;  5LA6 B;  3VYU C;  4ZOL A;  5GIN C;  2ZVY A;  3NK7 A;  5EZY A;  1YGY A;  1QAH A;  4G4X A;  5MN6 A;  4M8I A;  1GO0 A;  3DC2 A;  4BVQ A;  4YJ3 A;  1K8A H;  4O4L B;  3S0H A;  4ZOL B;  1W5A A;  5EZY B;  3BYQ A;  5EWR A;  3P10 A;  2K1S A;  2AIF A;  4IHJ A;  1YIT F;  5IJ0 A;  4YJ3 B;  3CCM F;  1KNK A;  5HXU A;  3HKB A;  3MCA B;  3CCS F;  4LCK A;  1RA4 A;  1Z5W A;  4BT6 A;  3MCQ A;  1W3E X;  4IHJ B;  3ESJ A;  5IJ0 B;  2ALE A;  3V3T A;  2KG4 A;  3K2X A;  3HKB B;  4E6E A;  3F0F A;  3MDO A;  3M4S A;  1KC8 H;  2R75 1;  5EIB C;  4BT3 A;  1W57 A;  4BT4 A;  3HTN A;  5G4U C;  1SA0 A;  3M84 A;  1XV2 A;  2RHL A;  1J7H A;  3WJR A;  2PHN A;  2UYJ A;  2R6R 1;  3N2G A;  5HY1 A;  2LBT A;  1JFF A;  4ZHQ B;  4EB6 A;  1SA0 B;  1W40 A;  3WGL A;  3F0E A;  4X3L A;  2IQQ A;  2LBW A;  3VOB A;  2Z01 A;  3N2G B;  1GX1 A;  3HKD B;  4EB6 B;  3FD6 A;  1E7K A;  1K73 H;  3I56 F;  3CCQ F;  3FBA A;  3LWR C;  3CYP B;  2L26 A;  3RYH A;  3WPW A;  3ON1 A;  3M1X A;  5MN4 A;  3S0W A;  3ZP4 A;  1FNK A;  3QUW A;  3KJJ A;  2H6L A;  3RYH B;  1YIJ F;  5G4V C;  5JQG A;  1KNJ A;  3JAS A;  4ERH A;  2VXY A;  1R1M A;  1OAP A;  3LWQ C; 
#chains in the Genus database with same CATH homology
 1GX1 A;  3ESJ A;  2AMT A;  1U43 A;  1U3P A;  2UZH A;  1VH8 A;  3MBM A;  4C81 A;  3K2X A;  3F0D A;  3IKF A;  3ELC A;  3FBA A;  3F0F A;  3QHD A;  3F0G A;  3Q8H A;  3IKE A;  1W55 A;  4C82 A;  5B8F A;  4C8E A;  1W57 A;  1H48 A;  4C8I A;  3B6N A;  3P10 A;  3IEW A;  3JVH A;  3KE1 A;  1JN1 A;  1IV2 A;  4C8G A;  3T80 A;  3RE3 A;  1KNK A;  1YQN A;  1KNJ A;  2PMP A;  1H47 A;  3ERN A;  1T0A A;  3P0Z A;  1VHA A;  1JY8 A;  1IV3 A;  3F0E A;  3GHZ A;  3EOR A;  1IV1 A;  1U40 A;  2GZL A;  3F6M A;  3K14 A;  1IV4 A;  1U3L A;  3FPI A;  3IEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...