1VHAA

Crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vhaA00
1JY8A 3Q8HA 1KNKA 1W57A 1YQNA 3F0EA 4C82A 3T80A 3JVHA 1IV2A 3F0GA 3FBAA 3IEQA 1GX1A 4C8GA 1T0AA 2AMTA 3P10A 1H47A 1KNJA 2PMPA 3F0FA 3FPIA 3IEWA 3IKEA 1IV3A 3ELCA 4C8EA 4C81A 3K14A 3QHDA 4C8IA 3K2XA 3RE3A 2GZLA 3MBMA 3KE1A 1U43A 3ERNA 3F6MA 1U3LA 3GHZA 3ESJA 5B8FA 1W55A 3F0DA 3B6NA 1U40A 2UZHA 1JN1A 1VHAA 3IKFA 1U3PA 3P0ZA 3EORA 1H48A 1IV4A 1IV1A 1VH8A
chains in the Genus database with same CATH superfamily
3RYHA 3TD3A 4ZHQA 1UFYA 1W57A 5HY2A 3ON1A 3ZP4A 3M1XA 4I55A 3VOAA 2HVYD 2BTOA 2WALA 3VMFB 3CCMF 3ZOPA 2VAMA 1VQMF 1SA0B 2UYPA 2Z1EA 4I55B 3L7QA 3G4SF 5KMGA 3CMAF 3CYPB 4O4IB 5LOVA 1U43A 3TD5A 1VQLF 1H7MA 1VQ6F 2KGWA 5LXTB 4TV8B 2OTJF 3B6NA 3WPWA 2ZF8A 3P0ZA 1OFUA 3O85A 1X7OA 2UYJA 3JAKA 4BVSA 1YQNA 3NMUC 4X20A 3ZP7A 3WGKA 3WGNA 5FJ4C 3CMEF 4BT2A 5G4UC 4BVQA 2CVLA 4I50B 1XV2A 3RE3A 5JVDB 4KWEA 3C9TA 5LXTA 1VQ7F 1Q86H 1YITF 5CA1A 2CHTA 3V3TA 2BTUA 5ITZA 3LDTA 5LYJB 2YYEA 4ZHWA 2LBWA 4X1YB 3CG6A 1ZWZA 2JNBA 3CCVF 4LNUA 2YXZA 5CB4A 4I4TA 3D54A 4ZHQB 1VK3A 1FSZA 4BT6A 3NVIB 2PMPA 5JCOA 4C8EA 1M1KH 3QHDA 1RQ7A 1Q7YH 3K0TA 3SIUA 5EZYA 3E1YA 3LWVC 1X25A 2HX0A 5JCOC 3F0DA 4O4JB 5IYZB 4C4WC 1OAPA 2EWCA 3S02A 2Z01A 1CN7A 4ZI7B 2I6DA 3NK7A 5MN6A 3FFMA 3HKEA 5JVDA 4O2AA 1Q81H 3VYTC 2AIZP 4U3JB 1YJNF 3QUWA 1IV3A 4BY9D 4RHAA 3M84A 5BMVA 3RYCA 1XRGA 3GHZA 4IIJA 3S0WA 4F6RB 1W55A 3JATA 2Z1FA 3FD5A 3MCQA 3CD6F 3N2GB 4DRXB 3RYIB 3JARA 4I4TB 2V9YA 1W581 3WXMB 4G4WA 4BVRA 5JQGA 3CC2F 5DCVA 1VQVA 3FPIA 4O4HB 5KMGB 1FNKA 5LYJA 3JARB 1N8RH 3WGLA 1RA4A 5B8FA 5GONA 4G4YA 5HY1A 2Z1TA 5EO3A 3GTZA 3JASA 3EORA 2OZBA 1QVFF 2KG4A 2LBTA 1GO0A 2H8EA 3DDNA 1VQ5F 2GVIA 1W40A 1YJ9F 5J2TA 1VQNF 4NUTA 3HKBA 1W3EX 1GZ0A 4G4VA 4X20B 5FNVA 3CC7F 3HKEB 5EAZA 2MQEA 3I3FA 1DT9A 3N2KB 5EB1B 3CXCF 1KNJA 3R0PA 3WGJA 3K14A 4O2BB 4C8IA 3JCMM 3CCSF 2RHLA 2GZLA 2UYNA 3U0OA 5GONB 3C9RA 2RB9A 1X7PA 4X1IB 1YI2F 3NK6A 2R751 4O4IA 1IV4A 4EI8A 4LCKA 3HJWC 3JAWB 1VQKF 3TD4A 2Q1YA 4BT4A 3MDOA 3GYQA 3JVHA 2H8CA 3CCEF 1W2BF 3RYIA 2RHOA 3HKDA 3IKEA 5EB0A 3M4SA 3VIUA 2HP0A 3LWRC 5IJ0A 5LOVB 2DT4A 3AGKA 3CB2A 1SDSA 5LP6C 4PWTA 3ERNA 1U3LA 4O4HA 2ZVYA 1CK2A 5HXUA 3V7QA 1TVKB 5GIPC 1Z5VA 4X1IA 2Z1UA 5HY0A 1R1MA 2HS4A 3VYUC 3HAXD 1X52A 5FLXM 1YGYA 4C82A 3WJPA 5CA1B 5ITZB 5GANK 1FFXA 2HS3A 1IV2A 3J81M 3QTYA 2UYNB 5EIBC 3S03A 2KTUA 4U39A 3V7EA 1W41A 4I50A 1YJWF 3IEWA 2VGMA 2LBXA 1K8AH 3PAFA 5IYZA 3MBMA 5MN4A 3OONA 4IHJB 5G4VC 2HP3A 2FC3A 3S06A 5GINC 5J2TB 4B62A 2KTVA 4FFBA 2HQSC 2HRUA 3C8LA 1COMA 4YJ3A 3VCZA 3MQWA 3Q8HA 1KNKA 2BTQB 2LCAA 4G4ZA 2G9IA 2Q1XA 3I7TA 5EIBD 4B46A 4XCQA 1T0AA 3CYQA 1K9MH 3UT5A 3F0FA 1VQOF 5HY4A 4EB6A 3D01A 3KJKA 4DRXA 5IT9M 4BW0B 5J2UA 1T0KB 3N4YA 2I6RA 4WBNB 1NQ3A 3DC2A 5GAPK 2VAWA 3IKFA 4R40B 3LMEA 3SIVA 3RYCB 1JFFB 3LWOC 4RQOA 1W5FA 4ZOLA 4DXDA 2ALEA 4X1YA 3WPXA 3K12A 4X3MA 1RLUA 5MN5A 3D00A 4U3JA 3FBAA 5BMVB 2B33A 2VXYA 3N4ZA 4ZOLB 3KJJA 1E7KA 4ZHYB 1QU9A 5GIOC 2IAFA 3F6MA 2QEXF 2OHWA 3KHNA 4ZI7A 1FFXB 3WJQA 2CWJA 1SZQA 5HWEA 1U3PA 1H48A 1KD1H 2K1SA 2ZODA 3UT5B 3JAKB 3CCQF 3BYQA 3JASB 2VGNA 3P4EA 5EZYB 1KC8H 1DBFA 3J7AR 3I55F 4O4LA 4G88A 3CCLF 1NMUB 2N48A 4NWOB 4B5CA 5EWRA 2HP0B 4TZZA 1NJIH 4O4LB 1W5BA 2OTLF 2ZOVA 2QI2A 2F9ZC 4NQ3A 2CZWA 5AVMA 3JAWA 3OBYA 3LYBA 5C8YA 1VQ9F 3HWUA 1W59A 3F0EA 4O2AB 1W5EA 3FD6A 1VQ8F 2UYKA 5JH7A 3T80A 3ZO8A 1TUBB 2HS0A 2CW4A 5LP6A 3F0GA 1GO1A 1W5AA 2QTPA 2RHJA 4EI9A 3LWPC 3VYSC 4BVTA 2AMTA 3CPQA 2ZVZA 4O2BA 4IIJB 4F6RA 1Q82H 4B45A 2L26A 3RYFB 3E20B 1PXWA 5C8YB 1K73H 1Z5WA 3E22A 1M90H 2W8BC 3CPWF 1J7HA 1ODEA 5IJ9A 1TUBA 2DYYA 3JAMM 2H6LA 4ERHA 2AIFA 3HKDB 1JY8A 3IR9A 3HKCB 2ZAUA 4TV8A 2R6R1 1FNJA 5J2UB 5CA0B 4LNUB 3VOBA 1TVKA 3C9SA 5CA0A 4ZK7A 1H47A 3V4DA 2VAPA 3C9UA 5JQGB 1QAHA 3NVKE 3HKCA 4G4XA 1QVGF 3RYHB 3LFOA 5HXZA 1CLIA 5EYPA 1ONIA 1U40A 4HNAB 5CB4B 1IV1A 4IHJA 4FFBB 3RYFA 4E6EA 4TV9B 5KX5A 4C8GA 3WGMA 3E22B 2BO1A 3P10A 3S0HA 2NMUA 4C81A 4X1KB 4BT3A 3LWQC 3K2XA 3S0YA 3G71F 3I56F 3J80M 2GLZA 5JH7B 2CHSA 3VI6A 2P6YA 1VHAA 2PHNA 3PLAC 3MCAB 4EB6B 5KX5B 1XBIA 2FGYA 1VH8A 1W42A 4BT7A 3CCRF 5LA6B 3JALB 3VTIC 4M8IA 1GX1A 1Q8RA 2OTMA 4ZHVA 4X3LA 1QD9A 4YJ3B 1PF5A 5LA6A 1VQ4F 3JATB 3KE1A 1XHOA 2CSLA 3OW2F 1JJ2F 1SA0A 3JALA 1JN1A 3G6EF 3CCJF 3RA5A 3RA6A 3CCUF 2IG8A 5HP8A 1JD1A 3KIZA 4X1KA 3HTNA 3N2GA 4TUYA 4YJ2A 5LP6B 3WJRA 3IEQA 5IJ9B 1YIJF 3HKBB 4EI7A 4TV9A 3ELCA 5A2QM 4BT5A 1KQSF 3CC4F 3N2KA 3VO8A 2QA4F 4O4JA 5FNVB 3ESJA 1IPAA 4HNAA 2IQQA 3IMPA 2HRYA 1YHQF 2UZHA 3OBWA 1RQ2A 4WBNA 5EYPB 1RLGA 2RHHA 4TUYB 4YJ2B 5IJ0B 1VQPF 1JFFA 1S72F 5HP7A 1UI9A
chains in the Genus database with same CATH topology
1JY8A 3Q8HA 1KNKA 1W57A 1YQNA 3F0EA 4C82A 3T80A 3JVHA 1IV2A 3F0GA 3FBAA 3IEQA 1GX1A 4C8GA 1T0AA 2AMTA 3P10A 1H47A 1KNJA 2PMPA 3F0FA 3FPIA 3IEWA 3IKEA 1IV3A 3ELCA 4C8EA 4C81A 3K14A 3QHDA 4C8IA 3K2XA 3RE3A 2GZLA 3MBMA 3KE1A 1U43A 3ERNA 3F6MA 1U3LA 3GHZA 3ESJA 5B8FA 1W55A 3F0DA 3B6NA 1U40A 2UZHA 1JN1A 1VHAA 3IKFA 1U3PA 3P0ZA 3EORA 1H48A 1IV4A 1IV1A 1VH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY8 A;  3Q8H A;  1KNK A;  1W57 A;  1YQN A;  3F0E A;  4C82 A;  3T80 A;  3JVH A;  1IV2 A;  3F0G A;  3FBA A;  3IEQ A;  1GX1 A;  4C8G A;  1T0A A;  2AMT A;  3P10 A;  1H47 A;  1KNJ A;  2PMP A;  3F0F A;  3FPI A;  3IEW A;  3IKE A;  1IV3 A;  3ELC A;  4C8E A;  4C81 A;  3K14 A;  3QHD A;  4C8I A;  3K2X A;  3RE3 A;  2GZL A;  3MBM A;  3KE1 A;  1U43 A;  3ERN A;  3F6M A;  1U3L A;  3GHZ A;  3ESJ A;  5B8F A;  1W55 A;  3F0D A;  3B6N A;  1U40 A;  2UZH A;  1JN1 A;  1VHA A;  3IKF A;  1U3P A;  3P0Z A;  3EOR A;  1H48 A;  1IV4 A;  1IV1 A;  1VH8 A; 
#chains in the Genus database with same CATH topology
 3RYH A;  3TD3 A;  4ZHQ A;  1UFY A;  1W57 A;  5HY2 A;  3ON1 A;  3ZP4 A;  3M1X A;  4I55 A;  3VOA A;  2HVY D;  2BTO A;  2WAL A;  3VMF B;  3CCM F;  3ZOP A;  2VAM A;  1VQM F;  1SA0 B;  2UYP A;  2Z1E A;  4I55 B;  3L7Q A;  3G4S F;  5KMG A;  3CMA F;  3CYP B;  4O4I B;  5LOV A;  1U43 A;  3TD5 A;  1VQL F;  1H7M A;  1VQ6 F;  2KGW A;  5LXT B;  4TV8 B;  2OTJ F;  3B6N A;  3WPW A;  2ZF8 A;  3P0Z A;  1OFU A;  3O85 A;  1X7O A;  2UYJ A;  3JAK A;  4BVS A;  1YQN A;  3NMU C;  4X20 A;  3ZP7 A;  3WGK A;  3WGN A;  5FJ4 C;  3CME F;  4BT2 A;  5G4U C;  4BVQ A;  2CVL A;  4I50 B;  1XV2 A;  3RE3 A;  5JVD B;  4KWE A;  3C9T A;  5LXT A;  1VQ7 F;  1Q86 H;  1YIT F;  5CA1 A;  2CHT A;  3V3T A;  2BTU A;  5ITZ A;  3LDT A;  5LYJ B;  2YYE A;  4ZHW A;  2LBW A;  4X1Y B;  3CG6 A;  1ZWZ A;  2JNB A;  3CCV F;  4LNU A;  2YXZ A;  5CB4 A;  4I4T A;  3D54 A;  4ZHQ B;  1VK3 A;  1FSZ A;  4BT6 A;  3NVI B;  2PMP A;  5JCO A;  4C8E A;  1M1K H;  3QHD A;  1RQ7 A;  1Q7Y H;  3K0T A;  3SIU A;  5EZY A;  3E1Y A;  3LWV C;  1X25 A;  2HX0 A;  5JCO C;  3F0D A;  4O4J B;  5IYZ B;  4C4W C;  1OAP A;  2EWC A;  3S02 A;  2Z01 A;  1CN7 A;  4ZI7 B;  2I6D A;  3NK7 A;  5MN6 A;  3FFM A;  3HKE A;  5JVD A;  4O2A A;  1Q81 H;  3VYT C;  2AIZ P;  4U3J B;  1YJN F;  3QUW A;  1IV3 A;  4BY9 D;  4RHA A;  3M84 A;  5BMV A;  3RYC A;  1XRG A;  3GHZ A;  4IIJ A;  3S0W A;  4F6R B;  1W55 A;  3JAT A;  2Z1F A;  3FD5 A;  3MCQ A;  3CD6 F;  3N2G B;  4DRX B;  3RYI B;  3JAR A;  4I4T B;  2V9Y A;  1W58 1;  3WXM B;  4G4W A;  4BVR A;  5JQG A;  3CC2 F;  5DCV A;  1VQV A;  3FPI A;  4O4H B;  5KMG B;  1FNK A;  5LYJ A;  3JAR B;  1N8R H;  3WGL A;  1RA4 A;  5B8F A;  5GON A;  4G4Y A;  5HY1 A;  2Z1T A;  5EO3 A;  3GTZ A;  3JAS A;  3EOR A;  2OZB A;  1QVF F;  2KG4 A;  2LBT A;  1GO0 A;  2H8E A;  3DDN A;  1VQ5 F;  2GVI A;  1W40 A;  1YJ9 F;  5J2T A;  1VQN F;  4NUT A;  3HKB A;  1W3E X;  1GZ0 A;  4G4V A;  4X20 B;  5FNV A;  3CC7 F;  3HKE B;  5EAZ A;  2MQE A;  3I3F A;  1DT9 A;  3N2K B;  5EB1 B;  3CXC F;  1KNJ A;  3R0P A;  3WGJ A;  3K14 A;  4O2B B;  4C8I A;  3JCM M;  3CCS F;  2RHL A;  2GZL A;  2UYN A;  3U0O A;  5GON B;  3C9R A;  2RB9 A;  1X7P A;  4X1I B;  1YI2 F;  3NK6 A;  2R75 1;  4O4I A;  1IV4 A;  4EI8 A;  4LCK A;  3HJW C;  3JAW B;  1VQK F;  3TD4 A;  2Q1Y A;  4BT4 A;  3MDO A;  3GYQ A;  3JVH A;  2H8C A;  3CCE F;  1W2B F;  3RYI A;  2RHO A;  3HKD A;  3IKE A;  5EB0 A;  3M4S A;  3VIU A;  2HP0 A;  3LWR C;  5IJ0 A;  5LOV B;  2DT4 A;  3AGK A;  3CB2 A;  1SDS A;  5LP6 C;  4PWT A;  3ERN A;  1U3L A;  4O4H A;  2ZVY A;  1CK2 A;  5HXU A;  3V7Q A;  1TVK B;  5GIP C;  1Z5V A;  4X1I A;  2Z1U A;  5HY0 A;  1R1M A;  2HS4 A;  3VYU C;  3HAX D;  1X52 A;  5FLX M;  1YGY A;  4C82 A;  3WJP A;  5CA1 B;  5ITZ B;  5GAN K;  1FFX A;  2HS3 A;  1IV2 A;  3J81 M;  3QTY A;  2UYN B;  5EIB C;  3S03 A;  2KTU A;  4U39 A;  3V7E A;  1W41 A;  4I50 A;  1YJW F;  3IEW A;  2VGM A;  2LBX A;  1K8A H;  3PAF A;  5IYZ A;  3MBM A;  5MN4 A;  3OON A;  4IHJ B;  5G4V C;  2HP3 A;  2FC3 A;  3S06 A;  5GIN C;  5J2T B;  4B62 A;  2KTV A;  4FFB A;  2HQS C;  2HRU A;  3C8L A;  1COM A;  4YJ3 A;  3VCZ A;  3MQW A;  3Q8H A;  1KNK A;  2BTQ B;  2LCA A;  4G4Z A;  2G9I A;  2Q1X A;  3I7T A;  5EIB D;  4B46 A;  4XCQ A;  1T0A A;  3CYQ A;  1K9M H;  3UT5 A;  3F0F A;  1VQO F;  5HY4 A;  4EB6 A;  3D01 A;  3KJK A;  4DRX A;  5IT9 M;  4BW0 B;  5J2U A;  1T0K B;  3N4Y A;  2I6R A;  4WBN B;  1NQ3 A;  3DC2 A;  5GAP K;  2VAW A;  3IKF A;  4R40 B;  3LME A;  3SIV A;  3RYC B;  1JFF B;  3LWO C;  4RQO A;  1W5F A;  4ZOL A;  4DXD A;  2ALE A;  4X1Y A;  3WPX A;  3K12 A;  4X3M A;  1RLU A;  5MN5 A;  3D00 A;  4U3J A;  3FBA A;  5BMV B;  2B33 A;  2VXY A;  3N4Z A;  4ZOL B;  3KJJ A;  1E7K A;  4ZHY B;  1QU9 A;  5GIO C;  2IAF A;  3F6M A;  2QEX F;  2OHW A;  3KHN A;  4ZI7 A;  1FFX B;  3WJQ A;  2CWJ A;  1SZQ A;  5HWE A;  1U3P A;  1H48 A;  1KD1 H;  2K1S A;  2ZOD A;  3UT5 B;  3JAK B;  3CCQ F;  3BYQ A;  3JAS B;  2VGN A;  3P4E A;  5EZY B;  1KC8 H;  1DBF A;  3J7A R;  3I55 F;  4O4L A;  4G88 A;  3CCL F;  1NMU B;  2N48 A;  4NWO B;  4B5C A;  5EWR A;  2HP0 B;  4TZZ A;  1NJI H;  4O4L B;  1W5B A;  2OTL F;  2ZOV A;  2QI2 A;  2F9Z C;  4NQ3 A;  2CZW A;  5AVM A;  3JAW A;  3OBY A;  3LYB A;  5C8Y A;  1VQ9 F;  3HWU A;  1W59 A;  3F0E A;  4O2A B;  1W5E A;  3FD6 A;  1VQ8 F;  2UYK A;  5JH7 A;  3T80 A;  3ZO8 A;  1TUB B;  2HS0 A;  2CW4 A;  5LP6 A;  3F0G A;  1GO1 A;  1W5A A;  2QTP A;  2RHJ A;  4EI9 A;  3LWP C;  3VYS C;  4BVT A;  2AMT A;  3CPQ A;  2ZVZ A;  4O2B A;  4IIJ B;  4F6R A;  1Q82 H;  4B45 A;  2L26 A;  3RYF B;  3E20 B;  1PXW A;  5C8Y B;  1K73 H;  1Z5W A;  3E22 A;  1M90 H;  2W8B C;  3CPW F;  1J7H A;  1ODE A;  5IJ9 A;  1TUB A;  2DYY A;  3JAM M;  2H6L A;  4ERH A;  2AIF A;  3HKD B;  1JY8 A;  3IR9 A;  3HKC B;  2ZAU A;  4TV8 A;  2R6R 1;  1FNJ A;  5J2U B;  5CA0 B;  4LNU B;  3VOB A;  1TVK A;  3C9S A;  5CA0 A;  4ZK7 A;  1H47 A;  3V4D A;  2VAP A;  3C9U A;  5JQG B;  1QAH A;  3NVK E;  3HKC A;  4G4X A;  1QVG F;  3RYH B;  3LFO A;  5HXZ A;  1CLI A;  5EYP A;  1ONI A;  1U40 A;  4HNA B;  5CB4 B;  1IV1 A;  4IHJ A;  4FFB B;  3RYF A;  4E6E A;  4TV9 B;  5KX5 A;  4C8G A;  3WGM A;  3E22 B;  2BO1 A;  3P10 A;  3S0H A;  2NMU A;  4C81 A;  4X1K B;  4BT3 A;  3LWQ C;  3K2X A;  3S0Y A;  3G71 F;  3I56 F;  3J80 M;  2GLZ A;  5JH7 B;  2CHS A;  3VI6 A;  2P6Y A;  1VHA A;  2PHN A;  3PLA C;  3MCA B;  4EB6 B;  5KX5 B;  1XBI A;  2FGY A;  1VH8 A;  1W42 A;  4BT7 A;  3CCR F;  5LA6 B;  3JAL B;  3VTI C;  4M8I A;  1GX1 A;  1Q8R A;  2OTM A;  4ZHV A;  4X3L A;  1QD9 A;  4YJ3 B;  1PF5 A;  5LA6 A;  1VQ4 F;  3JAT B;  3KE1 A;  1XHO A;  2CSL A;  3OW2 F;  1JJ2 F;  1SA0 A;  3JAL A;  1JN1 A;  3G6E F;  3CCJ F;  3RA5 A;  3RA6 A;  3CCU F;  2IG8 A;  5HP8 A;  1JD1 A;  3KIZ A;  4X1K A;  3HTN A;  3N2G A;  4TUY A;  4YJ2 A;  5LP6 B;  3WJR A;  3IEQ A;  5IJ9 B;  1YIJ F;  3HKB B;  4EI7 A;  4TV9 A;  3ELC A;  5A2Q M;  4BT5 A;  1KQS F;  3CC4 F;  3N2K A;  3VO8 A;  2QA4 F;  4O4J A;  5FNV B;  3ESJ A;  1IPA A;  4HNA A;  2IQQ A;  3IMP A;  2HRY A;  1YHQ F;  2UZH A;  3OBW A;  1RQ2 A;  4WBN A;  5EYP B;  1RLG A;  2RHH A;  4TUY B;  4YJ2 B;  5IJ0 B;  1VQP F;  1JFF A;  1S72 F;  5HP7 A;  1UI9 A; 
#chains in the Genus database with same CATH homology
 1JY8 A;  3Q8H A;  1KNK A;  1W57 A;  1YQN A;  3F0E A;  4C82 A;  3T80 A;  3JVH A;  1IV2 A;  3F0G A;  3FBA A;  3IEQ A;  1GX1 A;  4C8G A;  1T0A A;  2AMT A;  3P10 A;  1H47 A;  1KNJ A;  2PMP A;  3F0F A;  3FPI A;  3IEW A;  3IKE A;  1IV3 A;  3ELC A;  4C8E A;  4C81 A;  3K14 A;  3QHD A;  4C8I A;  3K2X A;  3RE3 A;  2GZL A;  3MBM A;  3KE1 A;  1U43 A;  3ERN A;  3F6M A;  1U3L A;  3GHZ A;  3ESJ A;  5B8F A;  1W55 A;  3F0D A;  3B6N A;  1U40 A;  2UZH A;  1JN1 A;  1VHA A;  3IKF A;  1U3P A;  3P0Z A;  3EOR A;  1H48 A;  1IV4 A;  1IV1 A;  1VH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...