2VGMA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
381
structure length
354
Chain Sequence
MKVISLKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIETDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords DOM34
total genus 97
structure length 354
sequence length 381
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgmA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgmA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgmA03
1W41A 1CN7A 1ZWZA 1NJIH 1Q7YH 2OZBA 2BO1A 1W2BF 3E1YA 4AF1A 3CCSF 2OHWA 3V7EA 3CCVF 2QA4F 5G4VC 5GIOC 3MCAB 3LWRC 3J81M 1YJWF 3CCMF 3WXMB 2HSTA 2KTVA 5A2QM 4C4WC 1YI2F 3G71F 3RA6A 4X3LA 3JAMM 3NMUC 3CXCF 1DT9A 3LWQC 5GIPC 3CCUF 1VQOF 1VQ4F 3J7AR 3NK6A 1RA4A 3J80M 1K8AH 3OBWA 3PLAC 3PAFA 1NMUB 1VQKF 3N4YA 1SDSA 1RLGA 2ALEA 3CCEF 2QI2A 1X52A 3CMEF 5FJ4C 3CG6A 2VGNA 3LWVC 2OTJF 3RA5A 3G6EF 1X7PA 2JNBA 3HJWC 2CZWA 1VQPF 3LWPC 1K73H 1VQ8F 1KQSF 1JJ2F 1CK2A 4LCKA 5FLXM 1VQ9F 3E20B 1M90H 2AIFA 3GYQA 1VQMF 2HVYD 2I6DA 1VQLF 2QEXF 1YJ9F 1GO0A 3JCMM 1E7KA 5DCVA 1YITF 3I55F 5EO3A 3IR9A 1QVFF 1Q86H 3I56F 3NVKE 1PXWA 5EWRA 1QVGF 4TZZA 3VMFB 3CMAF 2KTUA 1GO1A 3V7QA 3SIVA 1YJNF 3AGKA 4BY9D 2LBXA 1VQ7F 5IT9M 1KC8H 3CPWF 3CCRF 3CD6F 3NK7A 3HAXD 3FFMA 3O85A 1VQ6F 3OBYA 3G4SF 2KG4A 1S72F 4BW0B 1Q82H 1YHQF 1GZ0A 1W3EX 2OTLF 1Q81H 1XBIA 3N4ZA 2WALA 1H7MA 3LWOC 3CC7F 3SIUA 1M1KH 4NUTA 4X3MA 1VQNF 1YIJF 3CC4F 5GINC 3ON1A 3CCJF 5GAPK 1T0KB 2FC3A 1W42A 3LFOA 5G4UC 5GANK 3CC2F 1N8RH 1KD1H 3CCLF 1W40A 1X7OA 1VQ5F 1IPAA 2LBWA 3CCQF 3VI6A 3OW2F 3NVIB 1K9MH 2VGMA 3CPQA
chains in the Genus database with same CATH superfamily
1BIBA 4G1QA 3V1QA 2OZBA 3D7EO 1YHQA 1BI1A 1ACMB 1A5VA 1LJOA 3KLHA 1YI2N 3CCRT 2HVIA 3JB9H 1GOCA 1VQKA 2QQSA 1X69A 2WBNA 1TL3A 3CHWA 4ANJA 4O4IB 3CC2A 5GJVB 3M1XA 2KVQG 4C8QE 4BC3A 4HVUA 4QKUA 3BUZB 4M7AC 2HNZA 4LNPA 1RT4A 3VGKA 4YJ2A 4ELZC 3S3OA 5CYQA 4B9LA 1BG3A 2G8HA 2HAXA 4JI6K 3UT5B 1U48A 1W4SA 2KQ2A 4BT3A 1TVKB 4N41A 4FK0A 3LDLA 2RD1A 3HPGA 4DKWA 5J26A 1YJ9A 2GUPA 3D45A 4KPYA 4MFBA 1D0YA 1NMUB 4LD0A 1PD1A 1M2OA 5C0YA 4D8DA 3OVNA 4ZTFA 3W3DA 1FJGK 3RR6A 1TVRA 4CGFA 4OPJA 1ZUYA 4IUVA 1A0NB 1RI9A 2F8TA 4O4IA 2J6FA 2QI2A 3OYKA 1L3UA 1TUBB 5J2NA 3F9MA 4FWOA 3VOAA 3R6OA 4DSFA 2WSCE 4M75G 3C7NA 4A61A 4CJTA 2DK3A 4FJIA 4KUIA 3VS6A 1TKTA 3RMAA 3K2PA 4M75D 2CZWA 3UT5A 4KHUA 2R751 4GV6A 4KHYA 1IH7A 4I9LA 1PC0A 1EQYA 1V4SA 2KKZA 1K1ZA 2QGFB 3KJKA 1P8ZA 3I3FA 1D09B 3FC3A 2QWLA 5LA6B 4O5VA 1SPKA 2QDYB 4PFPA 1OPLA 3HSBA 1YWPA 1VQPQ 3AO3A 3CFPA 2GWKA 2DNUA 3RRGA 4LFBK 1CKAA 4ESRA 3CCVA 1RL2A 2P9SB 2QEXN 3KD1E 4M41A 1OU8A 1OH8A 4N5SA 2PYJA 3CPWS 3OW2A 1TV6A 3DRSA 4CIEA 2ZE2A 2UUBK 4F4KA 1Q8RA 1RAGB 5CK9A 2KLAA 2EQMA 5C42A 1B07A 4GVMA 5GMKh 2H8EA 4PJMA 1OEBA 3TEEA 4TUYA 1ZBXA 5DM7L 3IMPA 2OI3A 4M42A 3N4QA 5GAOq 1FXXA 4C5GA 1QSYA 3SJJA 2VXYA 3O8VA 3CCVQ 1MHNA 4O2BA 1YJNF 4L59A 4B62A 3D00A 3CMAQ 2RQRA 5E41A 4N0AA 4XAXB 4C0FA 4R55A 3CMEA 4FYXB 1D3BB 4LN2A 2PNIA 2I6RA 1YHQQ 3VS7A 2YHWA 1YQNA 3CC7Q 2DL5A 4K8ZA 1OX9A 1ATNA 1GFDA 2LQNA 3IG1A 4Z89A 2DAQA 2PQWA 4K11A 2WONA 4HUEA 5J2PA 4FJHA 4IEEA 4X1IA 3OYAA 3O9RA 5CR2A 2HHUA 5CA1B 2RPIA 4CJWA 2DL4A 4A5BA 2QWNA 5KYXB 5HRSA 1GZ0A 1JQQA 4N4HA 2M16A 4FFBB 2HF3A 4R0KA 2UYNA 2ITGA 1X6OA 3EE8A 4ISGA 4KTWA 3ZSRA 4DCHA 3SCXA 1EWQA 4AM7A 3C0CA 1VA7A 4CJSA 2WTUA 4FLXA 2FZGB 4DB3A 3VQDA 4HUFA 4FT2A 2DBMA 1BIZA 3LAMA 1VRTA 4JRKA 4C8MA 4DV1K 2KK4A 1VYVA 3CF5L 4PKCC 4PWTA 3VI6A 3NTHA 1KD1C 1QP3A 1ATRA 2ZM6K 2VQEK 4BT5A 5I11A 5GAOn 3VF6A 4E7IA 2K79A 4LY7A 2BANA 3BP8A 1G5VA 1LPLA 2YXYA 4X1YA 4FOIA 1HYSA 2UZHA 4GLKA 1KNJA 1VQ9A 2BO1A 5GAGP 2KYMA 4ZHQA 3DLMA 1IBLK 3AVCA 4IOAL 4WFAL 1I39A 4BB7A 5DM7R 5KGWA 3TAFA 4M7XA 2PMPA 4PJNA 4RCHA 1XMQK 4C0DC 5GANe 3JCMX 3PO5A 3WXMB 3DMJA 3QEXA 4FYDA 2YJFA 1FMWA 2LVMA 1BA0A 3ZO8A 4R5PA 4BT6A 3DB4A 3KWGA 4NYFA 1NGHA 1YI2F 5F2RA 3OYNA 3CG6A 1J9AA 2RF0A 2QA4Q 2A6AA 4ME7A 1HPMA 3RR8A 1K0XA 3N5BB 4F7UF 4I9QA 1VSIA 3DOLA 4GY2B 1S72Q 2E6MA 5KYXA 3ZX2A 5FLXE 1WGSA 2A7YA 4KGZB 4GW6A 5ADXH 2NUTA 1XNRK 4G4ZA 4EZ6A 1VQKF 5FPDA 4B1ZA 2FB7A 5IHIA 2CSIA 1GLDG 4CJ5A 3HXMA 3QFUA 3RRHA 4HHTA 5C8YB 1WHMA 1M5Q1 1Z25A 1ZSZA 1SSFA 3JAME 4IFVA 3U4LA 1SL2A 4XCQA 5C0MA 1KC8U 3H1QA 1NJYA 3TR8A 1AVZC 1VQKT 3JSCA 2FF3B 3CJ1A 1UJYA 5LMNK 4J9EA 3ASMA 1YI2A 5IYZB 5IT9O 3P4EA 5LMUK 1WHKA 1VQKN 1CZAN 3RKWA 2GTDA 1TU0B 4LDWA 1WA7A 2L2PA 4GVEA 1KIKA 4H4MA 4LNUA 1MNEA 5GAMf 2JM9A 1HKBA 1SZ2A 1ABOA 3PE0A 4Z4IA 2YUPA 1E6GA 3Q1JA 3LH0A 1FKOA 4AHUA 3HK2A 2CP0A 2O8EA 1DEJA 4E19A 2P51A 3U9ZA 5IHNA 4DV7K 4C8QB 4EMKA 4C8KA 4AG1C 2UXBK 1ESVA 4TZZA 3NFAA 1I8FA 3BFMA 3CMAF 2KTUA 5LP6A 4IJAA 3LWLA 3VS3A 3JCMd 2LJ3A 3I5RA 5GMKl 4IZ9A 4O0JA 5M1KA 4DV6K 4FJ8A 2EPDA 3DXKA 4CZLA 4QS7A 2F4VK 4KI4A 1I0CA 2HP0A 3RE3A 4CJFA 3M0UA 1NOYA 2PVGB 3CMEN 4CRIA 1VQOQ 1OX8A 2OTLT 4WFNL 4BUGA 3UF4A 2X6SA 3WPXA 2BUPA 4DRXB 4CF1A 1OH6A 4JI2K 4DFKA 3R0PA 2HBLA 4H8KA 1PRLC 4ELTA 4BDZA 2QQRA 2O4GA 1I81A 3LPTA 1M1KR 2YHTA 1JJ2A 4DF8A 5GANh 4JKGB 5EAZA 2OTJQ 2D4WA 4L6V5 1C1BA 1UG1A 1RGIA 1KSPA 1ASWA 2DEQA 1H7MA 1BI3A 1M1KH 1WN7A 1VYTA 2QDLA 5HCKA 2DXTA 3D0PA 4BY6C 4DQIA 5KYNA 1LW0A 2KRNA 3R6MA 3BY7A 3LFOA 1S1XA 1WSFA 3CC7A 5G4UC 4RW6A 3V9WA 1PM3A 2M0OA 3A8OB 3CCLA 1LAWA 1ZA1B 4C0ZA 3WGKA 4KB1A 2IVNA 3ZP4A 4JJCA 1W7AA 5A2QE 5AQTA 2IG0A 1TUYA 1IV4A 1NLPC 3EKUA 3K9KA 2F2VA 4OMPA 4JJNK 4KREA 1YJNT 4PKIA 3PVQA 3TWHA 4CJUA 3FDRA 1KFSA 2C0TA 3JARA 5EB1B 1Q7YH 1Q86O 4OMQA 1RT3A 3OSVA 2PHNA 3C9RA 4M7DE 2YLBA 3VS1A 3SMPA 4FJLA 3A5LC 4BRCA 3S0YA 5C10A 1QVGS 2CH5A 3G4ST 3HPHA 5AQOA 5JLFA 2XY8A 4ZHRA 1W2BP 3SJHA 2EWSA 3MEAA 4JLGA 1K8KB 2GVIA 3G71F 4B46A 3SPYA 3MHXA 4HKEA 1KD1O 1YCYA 2VAWA 1Y71A 1OZ2A 3OYBA 1JCGA 1RAHB 4HVWA 4C8QD 1RT5A 3M0PA 1WSEA 3FLCO 2XO7A 5AJ3K 2GF7A 1UGQB 2GBZA 1G83A 3TAQA 1NJZA 2HRYA 4RTUA 5LYJB 4E1JA 2K5LA 2QXFA 3QWXX 1IXDA 2RQUA 2HW3A 4W5NA 3N4YA 4CFCA 2G8KA 3X25B 1X2QA 5AQQA 4Z88A 3T7ZA 3RWUA 1FNJA 2ALEA 5HBMA 4RKUE 1JRIA 3GBTA 2DPNA 2VG7A 2DA9A 2AKLA 3G71T 1Q82C 1ZSZC 3CYMA 3NH1A 4H5NA 1WBBA 3BDLA 1DTTA 4K0KK 3HKBB 4LH5A 1W2BS 3VQ6A 2JZ2A 3VQ5A 4CI0C 1H1VA 3U9DA 5JLHA 3QIIA 3THXB 1U40A 3C9SA 1VQ7A 4FJNA 1BWFO 5HK3A 3OYYA 2W40A 5FLXM 3P10A 2QM1A 3PFSA 2W41A 1OVQA 4YNQA 2LQKA 1PD0A 3QMLA 3DI6A 2RK2A 1GO0A 4RTXA 1YIJA 1GFCA 5LJ3g 4JNEA 1YJ9N 4ILGB 3JV3A 2E6LA 1E3MA 1FKPA 4F7UE 1JBMA 1R0BG 3RTVA 5LJ3d 2V52B 1QVGF 4B8CA 3B6PA 1Y64A 3RKXA 2RKIA 1JXEA 1Q8IA 4BRLA 4U7BA 4LF5K 1NEGA 3QDRB 3HI0A 1NBWA 4Z4CA 1VQ4A 2Z1TA 3FJ5A 2BZ8A 1KQSS 3LP3A 4J2DA 5GANf 3BY5A 1M1KU 3LP0A 5EZYA 4X1KB 1FSZA 5AQNA 4EI8A 4O4JA 1VHAA 5KGXA 2J6OA 4YDUC 1N6QA 1R8OB 2CP7A 4RG8A 4CZMA 4DTXA 1RDWX 1C1CA 4JJDA 1GLJO 4X34A 3KIOA 3QNNA 1YP5A 4ICLA 2IAJA 3VF4A 4YFUA 4GKJK 5GMKe 3LP1A 3FFMA 4I50B 1FWZA 5JVGL 1VQ5A 4JKDA 4CEEA 4PJOG 4XIUA 5EIBC 5HRPA 2E10A 5BR8K 1EZZB 3KJVA 3P8DA 1V4TA 3WGJA 1Q82H 5AQFA 4NWOB 1ZXOA 1VQ9T 4FZYA 2CGJA 5D3GA 3A1PA 4K8XA 3B8AX 4LH4A 4FLUA 1VQPN 2WALA 5AQSA 4DFPA 3LDPA 4X3MA 4AT1B 2Q2RA 1ZBJA 2EAYA 2MWOA 2E65A 4DV2K 2HHTA 2M51A 2RHKA 3KBGA 4C0GA 1NK5A 1M3CA 1WLPB 1Z9QA 5KYUB 3KK2A 3TSWA 2XDDA 5GANK 5EU7A 2HS4A 2D0NA 2OTLN 2RPNA 2EQIA 3DRPA 1EX4A 2VAMA 1X2KA 2ROLA 3HFNA 3NGIA 2YRVA 4FLVA 2OPQA 3RKYA 2LBWA 3HKSA 3CETA 1AWJA 3CQXA 4Y28E 3QPHA 2BE2A 1XI1A 5CKHA 4JYAK 3UKUA 1NG2A 1W41A 4AFSC 5GAMg 3X24B 3N2GB 4J9GA 4DQRA 4NXNK 2EYWA 4IBNA 5AQYA 3CCSF 1U1SA 4ZI7A 4IG3A 4F9OA 5G4VC 4J8FA 2Z1EA 4OB2B 4ZGDB 1E6HA 3VERA 2KTVA 3MWTA 4BROA 2CP2A 5BREA 1KLNA 2PVOB 2QG9B 2XDBA 2B5JA 1X01A 2AZSA 2DL8A 3VQQA 2D0OA 3QIOA 2AJQA 2OTJT 3ZSXA 5GIPC 2EJGA 1VQOF 1H641 4J6XA 3M0RA 2GNCA 1NGIA 3EAEA 5BPNA 2E70A 2A1SA 3PLAC 5BRFA 2RHHA 1AD5A 1VQMN 4RG2A 4Z4EA 4G4XA 5M1FA 5AQXA 1XOVA 5L23A 2W10A 4M4ZA 2FPDA 3R6NA 1RTHA 4NCGA 5FLXO 3SQ2A 1FW6A 1ZBIA 2OTMA 1TS9A 5AQUA 4ZHQB 2E2OA 1LOJA 3M8PA 2COWA 4LD6A 2IOCA 3IS9A 4KB0A 1WFWA 1ZX6A 2F5KA 2WACA 4BD3A 5A0GA 1XC3A 4DTUA 1D3BA 1NPPA 2OTJF 1HYZA 2Y90A 3P8BB 4JI4K 2K6DA 2FSJA 2DRMA 5FPNA 1OQKA 4CGJA 3VUZA 3DLBA 4M75B 2P1JA 3MK6A 1G3SA 3C9TA 1SQKA 1VQ5Q 3LZJA 1M3AA 3RESA 4H5WA 4X20A 1VSJA 4CHOA 1HNZK 3JASA 4DHYA 5AZJB 1WIEA 4HNAB 2ZQBA 1QHAA 5KPZA 2AIFA 3O1BA 5GAN7 4PY5A 1HQUA 1O75A 1PHTA 2EGAA 3EGXB 2RE2A 1QTMA 2V51B 3CCEA 2QQAA 2YKMA 4M7YA 2DJQA 5KRSA 3L42A 3FR0A 2NRHA 4RTYA 5IAYA 4XTVA 3H9NA 1KAZA 4PLIA 1A5XA 4JKAA 1FYNA 3C0BA 1IHWA 2D0PA 3MP8A 3UKRB 3HPOA 4PWDA 1YTAA 1H3ZA 3MWPA 3VU3C 4NCAA 4H5TA 1F1BB 2NWMA 5HK0A 3WQUA 1Q82U 2LT1A 3IAYA 2FGYA 1WJSA 4A63B 1Z26A 1TK0A 2OPPA 2OPSA 3SYZA 3VEWA 1ATSA 3QSUA 3NPFA 3V1OA 5CHIA 4BRKA 1KFZA 2KZZA 2KDSA 5AQPA 1QZ5A 4P5NA 2VXFA 4FLZA 2Q1YA 3FZFA 2ROTA 3CCMA 5IT9M 1W5FA 4AM6A 4ERHA 1UEBA 3ME9A 3ALYA 3AVNA 4XU3A 4AH9A 4WF9L 4LUDA 3I7TA 1TUBA 4M75F 1ILYA 1JLQA 1K8KA 3BGRA 3ZCMA 4CF8A 1OYXA 3M4GA 3O08A 2JM8A 1GLAG 1HK9A 2H3EB 2K57A 1D1BA 2RQVA 4CFBA 4U3JB 5M1QA 5J2TB 1K8AR 5AVMA 1QLYA 3HVTA 3QLHA 2Z01A 3SIUA 2KW4A 1Q7YC 4OX9K 1KXPA 4W5TA 3ZEHA 4JKHA 3M8SA 3PIOA 3JB9G 2VWBA 2HHHK 3CCJF 3KFVA 3U23A 3AA2A 3MCPA 4QOZB 3UIQA 3PX6A 4OMLA 3JALA 1G3YA 4BVRA 2ZPIB 3FZLA 3HVRA 3I56N 2LDMA 2GEMA 4AMCA 2EYXA 2JMAA 2C0OA 3SDZA 3CEYA 1NLOC 2P9NB 4TSXA 2FSNA 2CZ7B 1UA0A 1KNKA 1X7OA 2HBWA 1GLCG 3CM6A 4RW8A 2HHWA 1K9MH 3CCQN 3NBPA 4MO5A 3CCJT 1JLAA 1AT1B 4OB0B 1VQMQ 2P4RA 2E4HA 3DLLA 5K14A 2DFUA 1M8VA 3TU5A 4RMOA 2AIZP 3FRNA 1VQ8A 3TAPA 5BN8A 5HKCA 1RILA 2BZYA 2IDOA 4BRFA 3SWNC 3IKMA 4DQ2A 1S9GA 2KGTA 5AZIA 2JWKA 1VYUA 2E3IA 5FU6C 2XI9A 4CZJA 4F3OA 2NRXA 1RDAA 1L3VA 4JI0K 3JS6A 2EGCA 4KT0E 3I55T 3CBPA 1JLCA 1K9AA 5FPEA 4H03B 2DIGA 2H6LA 3MEUA 3MQWA 4PL6A 1MA9B 5LXTB 2FPEA 1JL2A 1SUQA 1HLUA 3REAB 1DT9A 1IV3A 4L8RB 4FJJA 5AFUH 3CCMQ 4JJBA 3QDKA 1UJ0A 1VQNA 4MDBA 2UU9K 4PQUA 5I2MA 3JB9F 1RQ2A 4C8GA 3QETA 3CCSA 3QNOA 3MXMA 2XD0A 2KROA 3PX4A 4CECA 4WCEL 3OYDA 3JXUA 1KRPA 3C6TA 3J7ZO 1SL1A 1X52A 2G3RA 3AO1A 4PJOB 1M4ZA 3ZT4A 3JCMJ 5AQZA 4CGIA 4DS5A 5TKYA 4E3SA 2VGNA 2DXUA 2JT4A 3J8AA 1LVKA 2GFAA 3WNFA 1BA1A 4M3XA 1MMGA 5LL6S 5KYUA 1U6ZA 4Y1CA 1VQNQ 3PV8A 4R79A 3K0SA 3DC2A 2KMTA 4EIKA 3KXTA 4LDYA 2XDPA 4OMOA 3CCQQ 1NM1A 4OKJA 3ZSZA 1Z5WA 4LCKA 2OAWA 2HDAA 3L3VA 1WDXA 1NWKA 3MN5A 3PMIA 2G8WA 1OU9A 4FJ9A 4Z4FA 5FWBA 3CG7A 2O8DA 1IB8A 2DFFA 1YJ9F 3QJYA 5BPMA 1G99A 2PBDA 2FBYA 2K2VA 3E9PA 3KVGA 1HKGA 2HMIA 1HSQA 3TTCA 3SUPA 5EO3A 4U39A 3H0IA 3HRUA 4HVVA 3VQ4A 1LWCA 1PCXA 2P9SA 2JMCA 4MDAA 3T19A 1PXWA 4EI9A 3SK3A 3LAKA 3O3FA 4DU1A 1QKWA 2NUZA 3ER0A 3RUXA 2AP1A 3QBYA 1QVFA 2D0BA 3FZHA 3MDQA 3TTFA 1UFFA 4DR3K 3CCQT 3LP2A 2M9UA 4N4GA 3AO4A 3NGPA 1JO8A 2E3HA 2V1RA 1K0SA 4AHCA 2EYYA 3THXA 4XTXA 5IXFA 3AGKA 1N5ZA 2C06A 1RBSA 3CCUQ 2FVUA 1KK7A 2CGKA 3VOBA 5I22A 5KYYB 5FRNA 4RCBA 1E7OA 3VTHA 3N2KB 1AZGB 2ECZA 3ZYYX 3VS4A 2RI5A 1KAYA 4WE1A 3CM5A 3C4SA 1Q86U 4K41A 4CJLA 1ZLMA 2K4YA 4KH0B 1QQCA 3FE1A 3V9ZA 3ZT0A 4BW0B 4ZHYB 2ZZDA 3OS5A 5MN4A 2HHXA 4J7FA 3NH2A 5LJ3f 4IO9L 2CDTA 5LL6Z 4K42A 1QVFP 1NGFA 2QTDA 4IIJA 1Z9ZA 1KD1R 4HCKA 1RBVA 2ZGYA 5BRHA 4F6RB 5GINC 2RHYA 4J9IA 2P0PA 1EXQA 4M78C 2RN2A 1ABQA 3IUCA 2CP3A 4OP0A 3JCMh 3NVMA 1PKSA 4RHAA 1QE1A 4NOYA 1GXIE 3IMXA 5LJVA 1JLBA 3OW2M 1X7PA 1GLEG 1K8AU 2VYTA 2DTIA 3CCQF 4RTFD 1VQ5F 3AHUA 3HZ6A 4AHSA 3CCQA 5T7BA 2GTJA 2C0IA 2E5KA 4JLHA 5FU6B 3HJFA 4C82A 2HF4A 3H0FA 3CD6N 1VQPT 4FWLA 1DLOA 3S3NA 5LYJA 3H1VX 5E84A 1Y96B 1TYQB 2MAMA 1ZWZA 1RABB 4CIFA 4H0XB 3AVFA 2XHCA 2HVHA 2AMTA 4A54A 2KEAA 3CC2N 5KQDA 4A2BA 1YXQA 5GIOC 4QQDA 1VQLT 1WPYA 3U8XA 1ZBLA 3CCMF 4CEBA 4BWMA 2I0NA 3EG1A 4KWEA 3T1AA 3GOXA 1IZ6A 3M5AA 3SLCA 2A40A 3G71A 1QW1A 5LJ5j 5EXWA 4FLYA 4TUYB 1YJNQ 1BQNA 1NGJA 4QAGA 4BR9A 1BB9A 5EC7A 2P5OA 4CJ4A 3RDVA 4DR2K 3NK6A 1WBDA 2ASMA 3A5ZB 1D5AA 3GG4A 5J1EA 3W0LA 5HXUA 2MWPA 4A57A 5F0XA 3E22A 3RYHB 3TPQA 2EYQA 4TV9B 5CE3A 4HT8A 3JYTA 3TD3A 1QMCA 1EIFA 2RNAA 5KX5B 4Z0UA 3CCEF 3PMTA 1PSEA 4HT9A 4J7IA 4B9MA 1I1JA 5HP8A 2XY7A 3JRZA 3TAMA 3JARB 2QA4N 1OV3A 2O8BB 1AWWA 2JNBA 1VQNN 1CLIA 3KIZA 4EB6B 2RA2A 1S1WA 1KC8O 1RFQA 4QQ6A 1WQWA 5GINA 3RYCA 3OS1A 2K5FA 2ZODA 3CCET 3G6EQ 5GAN4 3HRTA 4X20B 3CCVT 2IVOA 4FU6A 1JJ2M 2RJDA 5KPTA 4B9NA 1D1CA 1GCQC 1RI0A 1J7HA 3AVLA 3L1AA 3M57A 3VEOA 3EH2A 4V2SA 5LP6C 2G8FA 4B9TA 2DERA 4FJMA 4FWKA 3P4IA 4BR0A 1QVGA 1LOTB 3NVKE 3AY9A 3JCMg 2XK0A 4QT7A 3P38A 4KTQA 1SA0A 1AWXA 5JCOA 2JJ9A 1JLGA 3AO2A 2X74A 4XU2A 1KC8R 3QEVA 3P8HA 3VEYA 3EN9A 3QXEB 4BY9D 3ZP7A 1UGPB 4MZPA 1E4FT 4DRXA 4MLEA 3VQ7A 2O8BA 5C12A 1QVFS 5CR4A 1YI2Q 3CXCM 4GMJB 1LNXA 2HHVA 3CC4T 4YJ3B 2M0YA 2XG8D 4DQSA 3LL3A 2G8IA 3J7YP 1U45A 1OPKA 1S72F 4ZTJA 4O4HB 4IWVA 1VH8A 4A53A 4DR5K 4O0IA 1KQSA 4PHTX 2EQUA 1N33K 4I7FA 4CEZA 3H6ZA 4BRGA 2PZ1A 1NMNA 3JVHA 2X4XA 1XQHA 4IIOA 3GP8A 4DR4K 2Z1GA 4XH4A 1S1NA 5A0LA 4NXMK 3V4IA 3CC2F 4LD9K 2F9TA 3FGUA 2L26A 4M45A 1ZBHA 1Z6RA 3FZKA 1MGQA 1KVBA 3HM8A 4CK2A 3K0TA 1W40A 2A3LA 2AZVA 4DUZK 3ZT1A 2QEXQ 1BDGA 1QHTA 1S1VA 3L6QA 2QK9A 3V81A 1WHLA 1JJ2S 1R77A 3H8ZA 1QS4A 3QDFA 3V7SA 1T44A 2WSEE 3DLKA 4MLHA 1GX1A 1YT3A 2D8JA 3HKEA 1TYQA 4WBNB 1VIEA 3HPWA 3X20B 4PA1A 2YWWA 4JZ4A 5GONB 4Q5WA 4I4TB 2NUPA 1RBRA 1YCSB 1T03A 2CREA 4FWMA 1NK6A 2UYKA 3QYGB 3S41A 1NK9A 4G9ZA 4FYVB 4MQ3A 2P4TA 4J83A 3L2VA 2QWPA 4F7UG 2FC0A 2XU8A 5KRTA 4M77D 1UUEA 4KUDK 2ASPA 3ID6A 4CGGA 2J05A 3IFRA 3LYBA 2DBKA 4XEIA 4JDSA 4F7UB 3EE9A 1YHQN 4FPAA 3JATB 4ZHWA 5B8HA 5FW9A 4Y1DA 2P9LA 4PUOA 3GF5A 3RERA 5C24A 1T7PA 4X3LA 2PY5A 2KXCA 1M30A 3UDCA 3M8QA 2X35A 5LXTA 3CCUF 4X1VA 2GZLA 5LA6A 1VQ4F 1T3VA 1MMAA 3UKRA 3MO8A 4AHRA 1ITGA 1UGRB 1IO6A 2L5QA 3PAFA 4CFDA 2R57A 5JS1A 1YJWT 1SDSA 3OYHA 2DYIA 1RDUA 2MCNA 1X3MA 3VGLA 1TAUA 2F2XA 2FZKB 1RAEB 3V7RA 1VQ8Q 4OKEA 4CEQA 3K58A 3KE1A 4IIJB 4TV8A 3RYFB 1A5WA 4CGHA 4DU3A 4FJKA 5CKDA 4FL6A 4G88A 3G6EF 2IG8A 2DJZA 4YHHK 1O1WA 5E26A 2AT1B 5GAMe 3CCVN 1SEMA 1VQ6T 2Q97A 5GAOl 2ZPEB 5GAMj 2Q3SA 2QKKA 3IKEA 4I55A 2KFZA 4EP4A 4O2BB 3LPUA 1W59A 1C0UA 4DV3K 3O1WA 1Q9XA 5LJ5g 3VENA 1N8RC 3LWHA 2O88A 2M02A 2QW9A 4OJRA 4B3OA 3ID8A 3TSQA 4M7AE 3GYQA 3CI5A 4NQ3A 5GJWB 3DJCA 3G4SN 4BY9C 1VQLF 3JSMA 1WHHA 4AG2C 1M1KC 3MCQA 1T3SA 1AOJA 1G3WA 4M77A 5CCAA 2QK0A 4PJLA 4LFCK 4BVQA 3ZT2A 4BVTA 3VS2A 1QVFF 3NE6A 3M3ZA 3I56F 4GLMA 3O9SA 5EWRA 4W5QA 2DVJA 1LWFA 1Q18A 1IKVA 1XUPO 1BCMA 1U1TA 4CHNA 1W70A 2XIDA 3O8MA 2BIVA 3I8DA 2PYLA 1Q7YR 1K8AO 3VOVA 2CWJA 1Q81U 1CZBA 3EHRA 4YORA 2VWFA 4IHJA 4FW2A 2LCCA 1M27C 5JH7B 4DF4A 1K73U 2V7ZA 3S9HA 4E6EA 3LGLA 2EWCA 3CCRF 2Y4YA 2QA4A 3EZ5A 1YITN 3E9OA 4B3MK 4PL8A 2OZMA 4MZMA 4TVRA 3VYHB 1M90U 4JK9A 3O85A 4B6MA 2UXCK 1ZC6A 4JHDB 4KHQA 3M8RA 1LCKA 2HBKA 3CPEA 2LCSA 4WQ4A 3VQCA 4QS9A 2MMPA 3M58A 3LWOC 3I9QA 4H4OA 1DBFA 2LQWA 1T0HA 4N4IA 1VQLA 3CCEQ 1D0XA 1YJNA 2JLEA 3DLEA 4CD1A 4LF8K 4NUTA 1KVCA 3DM2A 5GAPK 2LT4A 3BYQA 2XHBA 1X6GA 2HSPA 2YNIA 2BE9B 4KH4A 1JCFA 1VSFA 3EGXA 3FIFA 1I4K1 1IRXA 2X4WA 3WVDB 4C23A 3NHGA 4D6WA 1J3TA 1QQMA 1WSJA 1O9SA 4M63C 4K43A 1K6YA 4KTZA 4CEFA 1RT7A 2E8AA 4JKEA 4CJKA 1UA1A 1IPAA 3N2KA 5CB4B 1BU6O 1MWMA 5IJ9B 5CYMA 1YIJT 3AA4A 4FO0A 2D0AA 3AAQA 3C6AA 4CJ7A 3URGA 2YHYA 4X62K 1TKDA 1XHOA 2CS7A 3WXIA 3K57A 1KAXA 2K1SA 2CGLA 2X3XD 3WQTA 4BR5A 1MMNA 1Q82O 1W2BF 4X65K 3FD5A 3PIPL 3M56A 1NOZA 4DEYA 2GTOA 5JMVA 3F0FA 2X6NA 1TKZA 3WNHA 2E2PA 1V76A 3ZLJA 4J9DA 3GBQA 4C8OA 4QVCA 1JJ2P 2I5JA 2RF2A 2DE0X 1NPRA 1TOVA 4C8LA 3OW2P 2P9KA 4CEDA 4C92D 3EG2A 1P90A 5JVDB 5IWAK 3J7AR 3G4SQ 1VSMA 1BI0A 1SF9A 4YOXA 3MBMA 3TD5A 1BU1A 3LYIA 4PKHA 2VC8A 3RR7A 5MN5A 2BDPA 4YJ2B 1Y7XA 1NK8A 2DD4A 3UWNA 5FRMA 3NF9A 3LM2A 2Q1XA 4JRIA 1MNDA 1TK5A 1VQMT 1UHFA 1NNEA 3EFOA 3MEDA 1S6QA 1CXUA 1GL5A 2B6AA 3OTOK 5LJ5d 2HL5C 3DAWA 3M54A 1U8RA 4ILHA 5I42A 5CAIA 2XMFA 1NKEA 4KGXB 3WJPA 3RYHA 3QO9A 4Z8AA 3PIOL 1JB0E 2YX6A 2RQWA 3SHWA 3AA3A 3WXLA 5KYWB 3CC2Q 3CQYA 1S6PA 1U49A 4MMKA 1KQSP 1XTDA 1U2VA 4FZXC 4ZOLB 3TAGA 3TD4A 2QWMA 2I6DA 2YV0X 4G4YA 3LWVC 3BE3A 1OFUA 2D1XA 2KXDA 3LLRA 3QYHB 4IG0A 2ZAUA 1N6AA 5ADXA 4M78E 5HP1A 5LJWA 4OMMA 4IUQA 5A2QO 4JS5A 2R5MA 3SAHA 3VMFB 4C92A 5LJ5e 2NZTA 4B1XB 3J7AF 2RO0A 2PZSA 5D6YA 4DG1A 1D1AA 4E7SA 3M9QA 2MK5A 4IHJB 4M7DG 1HX1A 3EY1A 4ZNXA 4M3ZA 1EETA 4FPBA 2JVVA 2ESWA 2A41A 2YUNA 3H45C 2E1HA 3LX7A 3CFRA 2VUBA 4CZEA 2CSQA 1BKBA 2D9TA 4PNOA 1L5UA 2JTEA 1REVA 3OA6A 1VQNT 3SBGA 2K9GA 3MXJA 5KMGB 3V6DA 1VQ6F 1Q7YU 3PO4A 1VQ4Q 3V8LA 2EJFA 3NFCA 5HOOA 4A4GA 1I07A 4E7KA 2Q0UA 4O8UA 1WJRA 5CB4A 5DLQE 3A98A 1W1FA 4XK8E 9ATCB 5LJ3j 3FFIA 2Y4XA 2H3GX 5DMRA 5AQIA 2DTHA 2RN8A 2J4RA 3TI0A 3THVA 1NKBA 1N34K 3LDNA 4DSIA 3F5TA 5TKWA 2O01E 2XKOC 5DY9A 4E47A 4M7AF 1KG1A 5HY0A 1M90O 2DEUA 1N8RH 4H0YB 4BQZA 3D2EB 3LM9A 3J81E 4R40B 1X25A 1TK8A 5AQJA 1N8RR 5KX5A 1SL0A 3NHNA 4C0DB 4E1NA 3TARA 2DFEA 4CJEA 2Z1HA 3WJQA 3KLGA 2YLCA 2E6ZA 4UY8O 3MEVA 4J2AA 4DEXA 4CF2A 1NMDA 4QVDA 4E7LA 1JY8A 4QVZA 3CYPB 1YGYA 2Z1UA 3O80A 3HKBA 1MUZA 4ID1A 4NCBA 1PWTA 3VTIC 5C6SA 3O4QA 3OYJA 3V7EA 3QBXA 5IH2A 4RTZA 2VCPA 5M1NA 3QICA 4JZ3A 4J2BA 3AAPA 2Y1JA 2CVLA 2HP0B 3SEMA 3HO1A 3V4DA 1KTQA 1BI4B 3HRGA 1JEGA 4II1A 3VUBA 3CMET 1BYMA 4HUGA 1ASVA 1OZ3A 4LXCA 3AVKA 3RVCA 1RDDA 4M7AB 1VQ6N 1S1UA 4IUTA 3HFOA 3K5OA 2COYA 3GNGA 3ZFJA 3JCMe 2MF2A 1RDBA 2KYBA 4CHYA 4WQ5A 4C5IA 3K9JA 1TUGB 2DXCA 1S5JA 3VQBA 1WOQA 3HKDA 2OTLQ 4PJOF 1MU2A 1JFFB 2BTOA 2CGHA 2JW4A 1L3TA 2BKDN 3ZL7C 5GAN8 4LC9B 1VQ7N 4XQ3A 2EYZA 2Z1JA 3CB2A 4CJPA 1H47A 4JD2A 2VYPA 3CMEF 4DS4A 4HCCA 1RACB 1NJIU 4F14A 1GLFO 1H48A 1Y96A 2ATQA 3QB0A 3D2EA 4FLTA 2M1HA 1IV1A 2DX1A 1B34B 5A0DA 5GAOm 4R56A 1S9EA 2E2NA 3QFPA 1XRGA 1NE8A 3H3OB 2X51A 3CCJQ 4LSNA 4X1KA 3A8HB 5GAN3 3I8BA 1YITF 1VQ8F 3PGGA 5AQGA 3F0EA 3QBWA 1M2VB 3I55N 3JB9J 3WT0A 2E12A 2KRSA 1LWEA 3RSEA 5C2DA 1NG9A 4J5YA 2RH2A 1WSGA 3ZSYA 4CJQA 2QWQA 4U67L 4M3UA 2HVYD 3AV9A 1QSLA 3JCMM 1VQ4N 3FPIA 1QWEA 5KCOA 3LWIA 1BO5O 3ZEUB 3BF1A 4E1MA 1Q81C 3VYTC 4XTYA 3IR9A 1VQ9Q 3TREA 1WZOA 4LDVA 1VQ8T 1VSEA 4M78D 3M1FA 4CBWA 1WNSA 3SAGA 2G8VA 3VO8A 3T69A 1VQLQ 4M78F 3AVHA 4RTVA 2ZGWA 1NEBA 1YN8A 1XWLA 3JCMP 1C0GA 3P0ZA 2LBTA 3ZOPA 2GELA 1NK7A 4IIMA 1RADB 4C8QA 1YIJN 1W5AA 2LX9A 4J9BA 1C6VX 1GO1A 4O2AA 2AHJB 5GANj 1AEYA 3ZBDA 4EHTA 1VQ6Q 1OULA 4PKGA 2E2QA 4WTOB 4IDHA 2CH4W 4JKBA 1CSKA 2HHQA 3F0GA 4EMKB 3UA6A 3I0SA 1U06A 1BBZA 5HP7A 3G4SF 3H3NO 2XICA 3CPFA 1NGEA 2HBMA 1RT2A 4LDUA 5ELZA 1BUPA 4PJOC 3CCRQ 4BACA 1B9FA 2F9WA 2YUQA 1WQ7A 2LJ1A 2NUBA 4FWRA 3L4IA 2NRVA 3RIRA 3PSFA 3HOTA 1N9SA 2CZ6B 1MDUB 1RT1A 4BRDA 4Y0WA 5H1SQ 1V1CA 1W0HA 4CZFA 4EIAA 4KHNA 3HKEB 4WBNA 2V8IA 3CQ8A 3VPZA 4MZTA 5BMVB 4Y91A 4HTLA 2P9PB 4M78A 4M75C 1VQPA 4DR7K 3M0SA 2SRCA 3OMCA 1WJQA 4BRPA 4CC7A 1J5EK 5CKBA 1YITQ 3A5NC 3RYIA 1YAGA 2AIRB 4I2QA 1PRMC 2BE7D 3P1GA 4CZIA 3EG9B 3CPQA 4IDKA 3CXCS 1H92A 2RI3A 4DTOA 2IVWA 2UXDK 3E9GA 4ISEA 1CKBA 5KTQA 2IQQA 1XQSC 4FT4A 2HKQB 1UB4A 4DA4A 2DXBA 4M7AA 1JLEA 3KJJA 2HD0A 1ZQ1A 2KY9A 4RTWA 2X78A 4O8KA 5AQVA 1K8AC 1ZUKA 1HMVA 4CE9A 3M84A 3MEEA 1I5OB 4PFOA 3VN5A 5AYFA 3L4QA 1QCNA 1BI4A 1KQSM 4RW4A 3M5RA 1YF5L 4BREA 1ODEA 1T0AA 4I50A 5A2QM 2HNIA 3NTKA 1FMVA 2RM4A 4YOTA 2X3WD 1NGBA 3KHYA 4BRNA 3CJAA 4DQQA 3ZETA 1VQ6A 2HQEA 2RK1A 2JGUA 3C7NB 4C8NA 1XHZA 4HNAA 1IO2A 3G25A 4CFAA 1RA4A 2OA8A 3GTZA 3J80M 3OBWA 1NK4A 4G4WA 4CC2A 3MECA 2JXBA 4IUUA 5CKEA 1KFDA 3VQPA 1RBTA 3KKSA 2OTJA 4I55B 4KFBA 1RLPC 3QESA 1KJWA 1RUWA 3CBOA 3OS0A 3CC4Q 3P83D 4EAHD 4AFQC 3JAMO 3GL1A 3GHZA 4KRFA 4M75E 4JKGA 2PUOB 1TGOA 1BHLA 2FXUA 5LJ5h 4OPHA 1XNQK 3ZT3A 5F1XA 1KHCA 2VG6A 3DXMB 4FK2A 1PKTA 1QVGP 1WXTA 3CMAN 3CCEN 4ZN1A 4GY5A 1NKCA 4OVAA 1QCFA 2HEQA 4C5EA 4ELUA 4BI8B 4EI7A 3CMAT 2FPFA 3META 2QTVA 3RMDA 4M7AD 2LQ8A 4BWJA 3E20B 1VQ9F 1H8KA 3EL2A 3VA0A 5AQMA 3RYCB 3OHRA 1NJIR 3QUWA 1GRIA 2YNGA 3C6UA 1L3SA 3OA9A 2L3QA 3WGLA 4C5HA 2IC3A 3OYCA 1VQMA 4FWPA 2OX7A 1TUUA 2EFIA 1SRLA 4QQGA 4C8QC 2HB5A 2KZMA 4M8IA 4KULA 1RDCA 5FPMA 2IVPA 4OPAA 3CCMN 1IKXA 1N32K 4IXCA 4DLEA 1U2VB 1TH7A 2HQXA 3A5MC 3G10A 3V9UA 3HWUA 2LJ0A 1OKJA 5HROA 1X43A 4DLGA 3F70A 3NF6A 5CA0B 2W6KA 3PSIA 4BI4A 1VAZA 5C8YA 1K9MU 2YSQA 5J2MA 2QAZA 2OAUA 1FK9A 1WLJA 5J2UB 4ZOLA 4JRPA 2ZJQL 1NGCA 4C8EA 1VHXA 4YDUA 3M4YA 3HL8A 1F21A 5IYZA 5J3BA 2B8AA 2E88A 4F04B 3WJRA 1HJRA 1JFFA 2GCXA 5HXZA 2QGGA 4OGEA 2CT4A 3C95A 2A37A 4AHVA 2OTLF 2WSFE 4BGAA 3L2ZA 1ONIA 5EOYA 2FYKA 3PY8A 5LJ3e 4BDYA 3FBAA 2CYZB 5FU7C 2D5RA 2P9KB 2CP5A 3EG9A 1ZBFA 4FJGA 4FVUA 5M1OA 2FBXA 1VSLA 4FM2A 1W42A 4NL2A 5AQKA 5FNVB 2EHGA 2JOYA 4B3RK 1P92A 3D6RA 3L2UA 3VRZA 4FJ5A 4PJJA 3JASB 5GMKi 3O9TA 2Z1IA 3LGFA 3VYGA 3ASKA 1S72N 3WVEB 1HNXK 2CW4A 3OW2F 3NVIB 2K3XA 1QCOA 3JB9I 4E0DA 4CESA 1WYXA 2VG5A 3JCMc 2GX9A 1Q86C 2DETA 3E9LA 4W5OA 5LOVB 2KRMA 2P5GA 4XU0A 1CLQA 5EX5A 2E6NA 2FEIA 2KE9A 1M3BA 2RHJA 3IEWA 3I33A 3LWMA 3VCZA 5LJ5f 2OHWA 3J80O 2A36A 1PG5B 2LX7A 2HQHA 1SRMA 4E6RA 4JK8A 5BR9A 2F8SA 3MCAB 4F3TA 3LWRC 4IO8A 3C12A 1YVUA 2EW3A 4C92F 2COZA 1SHFA 2KNBB 3L2QA 2FO0A 3MP1A 1SS6A 2UYPA 2W8BC 3ULEA 3HRSA 3KK1A 2FHDA 3LDSA 3CERA 4N76A 3I56A 4IOXA 5GAHP 1SA0B 3I5SA 3RA6A 3JAMM 3SUQA 2IS3A 3LWQC 3AO5A 2O9VA 4KO0A 3AVJA 1JN1A 1OVYA 3E9FA 2QEXA 3IEQA 1XJWB 5I9EB 1QKXA 2JS2A 4FWQA 2Q0RA 4IURA 3SWNB 1ASUA 2IPOB 4BI3A 2HNYA 4H0VB 4C8IA 4DSKA 5I2SA 2B4JA 2G8UA 3KKRA 3C9UA 3EFRA 4A4HA 1RTDA 3PLAA 1NJIO 2YHAA 3AARA 2RB9A 2ED0A 2RHLA 2RI2A 4IJNA 3THWB 4ZGEB 4O44A 1YJWN 3CJCA 2EWNA 2QEXT 1K9MC 3KLEA 1H3HA 3UPUA 1PF5A 1Q9YA 2F69A 3RA5A 3U3GA 2A42A 3BDUA 2VASA 5GMKm 2LTOA 3CCSN 3L7QA 1BI2A 3NF8A 1IV2A 4TV9A 3JALB 1GCPA 4B8AB 3CMEQ 4DFMA 4ZN3A 1PSFA 1ARKA 3HT3A 4JKFA 4BR4A 3ZSOA 3MKDA 1CK2A 4EMGA 1KQ1A 4N47A 1RCHA 5GAOr 1M2VA 3MXIA 3MN7A 4C92B 3U3YA 2R5AA 5FU7B 2QEXF 1G3TA 2DFHA 4BT7A 1UGSB 5CA0A 1IKYA 4Z94A 5HY4A 3CPWA 3OW2S 1S1TA 2ZAEA 2V7YA 3F2KA 3VEXA 2H3JA 1HKCA 1YI2T 2MQEA 3ZSWA 2ZF8A 4AFZC 4OVLA 3SQ0A 4M77B 4M77C 2EKOA 4XTUA 3QIPA 4JV5K 3EEQA 2DM1A 2YCHA 2LCLA 2RHXA 1CZ9A 4M77G 3G7ZA 4DR1K 2BH1A 3ENOA 3C65A 4OPKA 3LANA 2QXLA 2HMAA 3VGMA 4CHPA 5GAOp 4M7DF 3ULDA 2OTJN 1YNZA 4E7JA 1M90C 1WAJA 5GIOA 1UGVA 4ORZA 4DTNA 3EFSA 3WUHA 2UYJA 2DKGA 2HZYA 2B86A 4M7DB 3ZSVA 3INZA 2P9IB 2DL7A 1IG8A 3HSTB 3V8JA 3QEWA 3OMGA 1RAAB 2HKNA 4BE0A 2ZPBB 3NK7A 1HPZA 2V26A 3CPWP 3A8YA 4IOCL 1YBYA 4O2AB 1XNIA 1IGUA 4YOUA 1RTJA 1WXUA 2DTOA 5GAMd 2K3BA 1JU5C 2RJFA 1VQ9N 5ECAA 3AVIA 4J6WA 4DFJA 2V8KA 2L3RA 2W0ZA 2K5IA 3TVTA 1W55A 3CPWM 3GNFB 2P9UA 3SQ1A 3U6FA 2E1YA 5IT9E 3M53A 1T0JA 3TTDA 3SUNA 3K5NA 1SKWA 2F9ZC 1KD1H 3MN6A 4Z02A 2YUOA 3EH1A 1TKXA 2NYSA 2NRZA 2WC9A 3V9XA 2D1KA 3CJBA 1BGXT 3NTIA 4BVPA 1OH7A 2ZCFB 2BTUA 4CF0A 2D8HA 2BUDA 1LAVA 1J54A 4ZHVA 4BQLA 3ULEB 3NMZC 2HMPA 2L0AA 2O8EB 1QD9A 5BPLA 3FZMA 2VXEA 1CN7A 4DOWA 3OYGA 2P9UB 3L0QA 4BRQA 1B9DA 3O5ZA 3MMVA 1Z5VA 4X1YB 3V9SA 4LNUB 4AF1A 3I56Q 2Y1IA 5HLFA 4KGVB 3G6EN 1W97L 2O9SA 4ZGJB 4DR6K 3CFOA 4WFBL 3HKCB 3JAKA 2H8HA 4FM4B 5DK5A 3OJSA 3E22B 3HKDB 3MEWA 4PL7A 2HSEB 5GONA 4NB4A 5C15A 4WF2A 4KH1B 3WXKA 3V7CA 4A2AA 1QAHA 3M6GA 1FFXA 4UC4A 2PAVA 4BRMA 3CCST 3WEEB 1NGAA 2JTFA 2KG4A 2OZSA 1GLBG 1HRHA 1ZBUA 4BY6B 2NRRA 1W57A 1RAFB 4HCBA 4M7AG 4JUVA 2DZCA 4B9XA 3GE1A 3G71N 4BT2A 4DQPA 4Z4GA 3T1YK 5CQXA 2J7IA 2X4JA 3PX0A 5IN1A 1YJWA 5FJ4C 3QWYA 1YUWA 1C6VA 1MWKA 3RBBB 3HTRA 4OB3B 2EBPA 1QQJA 4KRTA 4O5FA 2PTKA 2K7AA 2A0FB 1ZBSA 2Q1NA 4V19S 1WXBA 2XY5A 1YFNA 4H5RA 3CBMA 1I94K 3KK7A 3JAWA 5AR0A 1NQ3A 3HKCA 4FIBA 3JAKB 5EIBD 3T80A 3WPWA 1S22A 4DTRA 3M55A 1RNHA 3UA7A 2BZXA 1VOMA 3VJPA 5BRDA 4O4LA 2RHUA 2JS0A 2HOEA 3I35A 5LOVA 5CIUA 1IBKK 3BW1A 2RQTA 3OY9A 3EGDB 4CK1A 1W5EA 4DOVA 4IUPA 1UE9A 4HTUA 3LDOA 5EB0A 4L5GA 4JLIA 2P9NA 4O4JB 1HYVA 5LJ3h 2ZF5O 4DV0K 1FNKA 3V7QA 3SIVA 5GANd 2LBXA 3T1HK 3VIUA 1KLMA 2GGRA 4RW7A 3RNJA 5KMGA 1HJDA 1GLLO 4JKCA 1B34A 5IJ9A 1KC8H 1KD1U 3B6NA 1SKSA 4FW1A 1YITA 3SUOA 5CZ2A 4J6YA 3V3TA 4AFUC 4JAXA 4FFBA 3CPWF 2CUDA 1QZ6A 1T6DA 4FK4A 1SHGA 3FB9A 2KGWA 1X9JA 3OONA 2FL7A 3CIPA 1J6ZA 3DXKB 5GIPA 4CD3A 3EO3A 4FSVA 2A08A 3NGZA 1R59O 3IDHA 4BC5A 4EB6A 2EQKA 1NZ9A 3CCLN 4YTLA 3VV0A 4A5AA 2VKNA 1JKHA 5CKFA 4OMNA 4HWIA 4DTPA 2DILA 4O55A 4MMLA 4CVNE 1XBIA 2P0KA 3U0OA 1NLVA 2KSSA 1X3NA 5KQ8A 4N56A 4JI7K 3VRYA 4NLBA 8ATCB 3ZETB 4M3WA 4QCLA 1VQVA 4D8KA 1K4US 1KC8C 3R9PA 3UKUB 1VRUA 3CC4N 1YITT 1G2BA 2JUFA 3CCRA 1ZYQA 3VYUC 4CBXA 4CCHA 1SSHA 2GV9A 2WOMA 1OH5A 1U3PA 2ZWHA 3VYSC 1CXQA 1TWBA 2L89A 2EIFA 1IV0A 4LE9A 4OB1B 2KFNA 3QZ9B 3JCMQ 2DO3A 3KUFA 1ZA2B 4NS5A 1UWBA 3F73A 5HY2A 4KI6A 4RCCA 4CC3A 3HOSA 3RMQA 4CJ3A 2VGMA 1IG9A 3BDPA 4JI5K 4U3JA 2QYZA 1X6BA 3K2XA 3M0TA 1QSSA 3P5JA 2F96A 4CZGA 2E64A 1VQON 5AQLA 3ERNA 2Z1FA 3JAWB 3DYAA 3X26B 2XY6A 4B45A 2FF6A 4DWIA 3MX2A 2HS0A 2DIQA 4B1VA 1XHXA 4FM1A 3CCVF 1W5BA 3PT9A 3HBTA 5J2TA 2O4XA 2VWJA 3EYZA 4DQ8A 1C0MA 3VEZA 3BZCA 3J81M 4JK7A 5EZYB 1LW2A 3EORA 2X9HA 3K5MA 3A0IX 1NU0A 1HYOA 1WHGA 2BTTA 5GAMh 1NGDA 3OS2A 3A2FA 3ENBA 3VQ9A 4M78G 3CD6Q 2O8FA 1FMKA 3M59A 1BIAA 1OI1A 2GFUA 1XV2A 2I7NA 3UB5A 4TV8B 2CZ0B 2X4YA 4M77E 4KKOA 2K2MA 4M78B 2L8DA 5J2QA 2KHOA 5AQWA 2CHTA 3L3UA 4KHSA 2DL3A 3DXMA 2HS3A 3I0RA 3Q8HA 4O4HA 2ZOVA 5GANg 5AFUA 4DU4A 2PUKB 3QHSA 1SZQA 3AVBA 1QQOA 5D7UA 4DBQA 4O4GA 2NRWA 3HTNA 5EG2A 2D0CA 3RYFA 1WI7A 2R58A 1MV3A 1D9FA 2F5TX 3DLRA 1YJ9T 3MEGA 3O4WA 1JL1A 3NDKA 1EFNA 5D6XA 1LCUA 1RTIA 5KYYA 3G4SA 4BGBA 5SZTA 4DTMA 1Q81R 3HSCA 4DMNA 2W42A 1T05A 2YJEA 3LDTA 4W5RA 1K73H 3C8LA 2GQIA 1J5OA 4O5BA 4F6RA 2DY4A 2F1LA 4BRHA 1N8RO 1M90H 5HY6A 2J06A 4GV9A 4C1NI 3DOKA 3BZKA 4M3TA 2ABLA 2YNHA 3SNNA 1OAPA 3DLLL 3CJ9A 4B08A 3MDOA 1WSHA 5KH6A 2CH6A 3KD5E 2O8FB 3S6WA 4JRQA 1B7TA 5DLOA 4FVMA 4CGDA 4LF6K 1EP4A 2KQWA 3QO3A 4EFHA 2EX3A 1WX6A 3SAFA 2O4XB 2O8CB 5JQGB 4EHUA 2DVEA 1V29B 2VAPA 1VQOT 2F2WA 1NYGA 4FCYA 1N9RA 1YJWQ 3O3HA 1RQ7A 2H8CA 1BIUA 1R0CB 3KTQA 3TCJA 4OGCA 4BG9A 4JHDA 4MO4A 3N2GA 4Q5VA 3A8LB 4ILJA 3ITHA 5J2UA 2IIMA 1NJXA 1SKUB 2CP6A 2MI6A 3JCMb 1BQMA 1QU9A 1UAXA 2JNGA 3EKSA 4LFAK 1RT6A 4ZI7B 3EFOB 3HM9A 3ISNC 4M7DA 2HBJA 3S03A 4CF9A 2RHIA 5MLCQ 1VQLN 2ZPHB 1Q82R 2RB6A 4X9DA 1JLFA 2NNWA 4QS8A 4FM0A 3HAXD 1T6CA 3FJPA 4YOVA 1YIJQ 1D9DA 4LUEA 2CT3A 3OYIA 5ITZB 3AVAA 1ZSZB 4A62A 4BR2A 4LF4K 2CKKA 2QKBA 2OTLA 4RUGA 3VQAA 1J53A 1TSFA 1VQ5T 4IFYA 3DLGA 3WEEA 3P31A 1QP2A 4PK4A 1KVAA 3CC4A 2VQFK 3JB9D 3CCJA 4RQOA 2FC3A 1Z05A 4BC4A 5EYPA 1Y07A 2YRDA 3VKIA 4A4FA 2E41A 4B3TK 3S02A 2EGEA 3CC7N 2HBPA 1MMDA 2YI1A 4HVJA 3CCLF 3D54A 3C94A 3S3MA 5AZJA 1GCQA 3OYEA 3O6WA 4F2SA 2EJ9A 3A8GB 1X9SA 5JVDA 4O6JA 3H41A 2HP3A 1VSDA 1N36K 3NF7A 3PNWC 3J81O 4C8QF 4HA8A 4B9UA 5ITZA 3QG1A 3THKA 5JQGA 3LMEA 1VQOA 3OJUA 3TANA 2YT6A 4KHWA 1C0FA 3KZBA 1VIFA 3CCLT 1T8EA 3F9KA 5AZIB 1HJOA 2KI7A 3WGMA 1NJWA 2KAFA 2BTQB 1U47A 1BL3A 4M7DD 1M8MA 4I2PA 4Y92A 4FXDA 2IAFA 1K9MO 4FYWB 3FEOA 2Q31A 3MN9A 4DV4K 4CI6A 4EDUA 1DJ7B 2VWKA 3B6OA 4KH6A 4CJVA 4B9WA 3KHNA 5M9OA 1K73C 3H46O 4OKKA 2WUSA 3OYMA 4B3SK 3DWLA 3QUIA 3CXCF 4F17A 3D2FA 2WFBA 3E2UA 2P9LB 4F8RA 1RLQC 2QASA 5CQYA 4BVOA 3KLFA 5KCHA 4JPBW 1N27A 4XTWA 4DSLA 3RMSA 4JN4A 3JCMV 3CCMT 1QVPA 2DZ9A 1RLGA 1HD3A 1YVNA 2Q36A 2ITMA 4JI8K 2L3PA 4X66K 2I7PA 4BR7A 3UE5A 5EY4A 5JS2A 2P9IA 3G6EA 3QTYA 1W581 1SKRA 3PTAA 4CJRA 3HJWC 4RWTA 1JCEA 3WNGA 1COMA 3T9NA 3OB9A 4FSSA 4J2EA 2HQSC 2UUCK 1KQSF 3SV4A 4ID5A 2DD5A 1JJ2F 5GAN6 2MOXA 2ENMA 2QTXA 2V8JA 4XTZA 4CHQA 1R0AA 1JXBA 3RMBA 3NAEA 4XH1A 5KE3A 4OLAA 5AQRA 2ZGZA 2GUIA 3MPUB 2BGGA 1E7KA 4AQYK 2P6YA 5DCVA 1U3LA 3BEXA 3I55F 4C92G 3TSUA 4KHPK 2YHBA 2UYNB 1Q86H 1KCFA 3SV3A 1UECA 3VA3A 2DT4A 2FRYA 1WNLA 2QQ9A 3CD6T 3TU4K 4NO7A 3KK3A 1Q86R 3A5OC 2LC4A 1G8XA 1U43A 2LSNA 3E1SA 1X75C 3EGUA 4EMKC 2P9PA 2YRCA 2HCKA 1S72T 2CH4A 3G71Q 1G15A 2UYTA 3E66A 4J9CA 3KWIA 4JI1K 4M7DC 3VS0A 5I21A 2HNDA 4DSJA 5HRNA 2G6FX 3RYIB 2P0QA 2A28A 2PU9B 6AT1B 4NYNA 5C25A 3QERA 3LALA 3QJ6A 1HUXA 4BRIA 3CD6F 1RLUA 2ZJPL 1UI9A 5GAN2 3WNEA 3IQLA 4FYYB 4NL3A 1M1GA 1TTHB 1I3AA 1Q95G 2D6FA 2IIRA 4FL9A 1VQ7Q 1GOBA 3CC2T 1RBUA 2E20A 4IKFA 1VQ5N 5FROA 2ZVYA 2RHOA 2AKKA 5CZ1A 1W3EX 4E7ZA 3R1XA 4B1WB 1WB9A 1Q81H 1JXOA 4E2FB 3VF2A 2FZCB 1K73R 4LSLA 3L8BA 3A8MB 3CCJN 2DYBA 3CXCP 2N48A 3CC4F 1T0KB 5J39A 1UTIA 4KBOA 4C81A 3J7AP 1TG0A 3LW5E 1M90R 2NLXA 3NGYA 3SMSA 1X9WA 4F16A 3T3FA 4JEPA 2DRKA 3X28B 2R6R1 3O5BA 1TUCA 1K9MR 4ELVA 3LH5A 2ED1A 1T3LA 3K14A 4IFEA 3Q7BA 3TSZA 3ZX3A 4PJOD 2GQVA 4B1YB 4B9QA 5CY4A 3DB3A 2OPRA 4YOWA 1NBEB 3THYA 4GBQA 3K12A 1VSKA 2MYSA 1E4GT 4VUBA 1YTUA 3QKJA 1U04A 3V1RA 1WHJA 1NJIH 3VQEA 5CVIA 3MX5A 3QEPA 4QW2A 1HNIA 2O8DB 1SG5A 3E19A 2R7YA 2UUAK 1UHCA 4BE2A 4YOYA 5I3UA 1DGKN 3RMCA 2HL3A 4X1IB 5CA1A 3GLXA 5KE2A 1YJWF 3ULRB 1M9SA 2KT1A 5D6WA 4CZHA 3M4SA 2HSTA 3CJ7A 3S06A 4KH5A 2I2LA 4B9VA 4EMHA 5JCOC 2JWLA 1GOAA 2CSLA 1K76A 3EHQA 3NMUC 2FBTA 3WXJA 1FX7A 4C92E 2V1QA 2ASOA 1IREB 5BN9A 3RSEB 4CK3A 3EGDA 3HP6A 1D8YA 4N0AC 3N4PA 1DTQA 2W6LA 4HCZA 5MN6A 2NUPB 5KI6A 2GBQA 2VB6A 2RJCA 4AILC 1R1MA 3WGNA 3FD6A 3G1JA 5BMVA 4O4LB 2YYEA 4MDXA 4RW9A 4FLWA 1C1AA 1MV0B 2KBTA 2GWJA 1XC9A 4DV5K 1N5YA 3IKFA 4ELYC 2BTFA 4H0TB 3O9QA 3ENHA 1DKGD 4PJOA 4X9CA 1NYFA 3M0QA 1VQ4T 2OANA 4IEIA 1IHVA 4Q0BA 4EPCA 3UT1A 1VQPF 3TSPA 2PVDB 3LWPC 3R3LA 3K59A 1YWOA 1ZHIA 3D01A 2LNVA 3SFMA 1YHQT 1LV5A 3SD4A 1HNVA 3CCLQ 3VEVA 2QQBA 2E5LK 3S0HA 1W6XA 3F6MA 1VK0A 5DM6L 2VV5A 2MIOA 2FBVA 4DXDA 1VUBA 3G6ET 2CUBA 2O4IA 4C8QG 4G4VA 1NGGA 4J9HA 2ZD1A 2P84A 3JCMW 5AQHA 3CCRN 1VQ7T 3PUFA 2Z0WA 3CCSQ 2VVKA 4A59A 4DTJA 2LCAA 4CBUA 2AK5A 3JCMf 2DF6A 3DRRA 4OLBA 4GV3A 1TVKA 5JVHL 2K3YA 2F7TA 2OCEA 1JXMA 1NM7A 5L8RE 3ATUA 3PIPA 3BF3A 4C92C 3MP6A 4XH5A 2OJ2A 4BDPA 1KHIA 4MDWA 4I6MA 2NLUA 1IBMK 2V9YA 1KQ2A 1O13A 4ATOA 1VQ7F 1UDLA 3I56T 2ETJA 3D2FB 3ATVA 2RMOA 2EVRA 3I55A 4CERA 4X64K 2E4LA 4L3QA 4JD2B 3L2RA 1HXDA 3H6EA 4BVSA 3O4NA 5FDLA 1IGQA 3OBYA 1SAZA 2O31A 2LP5A 8AT1B 1TL1A 4JS4A 4GKKK 4A4KA 1Y57A 1W2BA 3UATA 3R8EA 3OYFA 1OOTA 1AZEA 3THYB 1HQEA 5EVZA 2B33A 2JN0A 3QINA 2JTMA 3DDNA 4A4EA 1X27A 1YIJF 2E1ZA 5CO7A 4LF7K 4PFZA 2DMOA 3AT1B 2KR3A 4C1NK 3CD6A 2SEMA 4BG8A 1Y97A 4BE1A 5GMKj 5GAEP 1AWOA 5IXBA 1S72A 4BRAA 3QEIA 3HHTB 4WCIA 5IJ0B 4BT4A 3VS5A 3GPLA 3E01A 1TUDA 1TAQA 3HYFA 4CZKA 4DUYK 3DKMA 4F7UA 3JATA 4NLCA 3ZSQA 5EYPB 2HHSA 3AVMA 4OO1J 3AVGA 3O3GA 2LRQA 1W9HA 3CCUN 4F2RA 2RJEA 3J80E 3VETA 3C6HA 3CQTA 3EG0A 4E89A 3THWA 1Q7YO 3OQ5A 1VQ8N 2HRUA 3E1YA 1NJIC 2FRWA 5JICA 3H0HA 1S3XA 1WUAA 3HTVA 3LZIA 1JD1A 4OF1A 1N8RU 1EWRA 5JH7A 2QA4F 1BOTO 2IGIA 5IHKA 5C2FA 4CW7B 2NUTB 3NMUA 3IRXA 3QHDA 1U3OA 2O2OA 4FWSA 2DTUA 2LNHB 4ZK7A 4C4WC 3D7SB 4M3RA 2QTPA 4DBHA 1VQKQ 3K5LA 2AA4A 1EKEA 1K73O 1HR0K 2YXZA 3EZWA 3CYQA 3EG3A 3SQ4A 3L2WA 1ZUUA 1D0ZA 2QA4T 1BCOA 2YDLA 1I5LA 3O9UA 1K8AH 1M1KO 4KAZA 3GIBA 1SV5A 2QWOA 4J8OA 4H0OA 4JI3K 3AA5X 3FFKB 1Q81O 2DPPB 4OMFB 4B1UB 2YHXA 4BC2A 3REBB 3QZ5B 5AT1B 2DLPA 5FWCA 4CC4B 3VQ8A 4EP5A 3MAQA 1YJNN 4YY3K 4YJ3A 2O8CA 4DBFA 1BK2A 2CZ1B 1IKWA 4HXJA 3KLIA 5HL7L 4AHTA 4CEAA 4DSEA 4FOEA 5HY1A 3PVLA 4FJ7A 1ZSGA 4PLLA 3CXCA 1C0TA 5KPRA 1Y0MA 1GBRA 3ZX0A 2QWRA 3ESJA 1HNWK 1D4XA 4KBMB 3DLHA 1FFXB 1RAIB 3OSSC 4PJOE 1UOCA 1QQNA 3SZ2A 2D0QB 3MJXA 3FLGA 3TQ7P 2A5XA 5GADP 2OYQA 1VQMF 3SI6A 1W2BM 2YKNA 4RTTA 2NMUA 4E7HA 4M77F 3H08A 3CMAA 4I4TA 2RHZA 4H5VA 4K25A 2FSKA 3VESA 4M3YA 3NVKA 2KTQA 3ZEUA 3TAEA 2FG0A 2J6KA 3VTIA 2HX0A 1BISA 3GOIA 3CCUT 3SB2A 2A3ZA 1WAFA 4FJXA 1UFYA 5LP6B 3F0DA 4FWNA 5SWMA 1KSWA 3I55Q 4CIGA 3S0WA 1U5SA 2PFUA 4I6MB 1GBQA 4DBRA 2MPXC 2XRIA 2L3SA 2A1RA 5HRRA 5FNVA 1EO1A 5M1PA 3TABA 2LMJA 3Q7CA 4H0PA 4UQGA 1VK3A 3CC7T 1TXQA 4WQ5C 2KT8A 2YNFA 1B92A 1X1PA 4Z4HA 1VSHA 1QWFA 2LZ6B 3SBTA 1M1FA 3P39A 4WQ4C 3G0ZA 5B8FA 1X9MA 4FZZA 7AT1B 4EZ9A 4LDXA 1U4BA 3HP9A 1XMOK 4KV8A 4WYBA 4ISFA 1YHQF 1IJJA 3NCIA 1AHJB 4B5CA 4B9SA 3NH0A 2ZJRL 3V8KA 2DYYA 2ATCB 2E5QA 3OYLA 3N4ZA 3CC7F 2CHSA 2GLZA 2EKHA 1VQNF 5KYWA 5LY3A 4CHZA 3ON1A 2FLOA 4LF9K 2ZPGB 4GNIA 3AGRA 2NRTA 4FSXA 2ZVZA 2EQJA 5GAN5 4DTSA 3LDQA 5IJ0A 2G9IA 4XU1A 4J9FA 1YJ9Q 3ELCA 5HWEA 3GDQA 2ZPFB 4CEOA 1WSIA 3SPZA 1NK0A 1QVGM 1PNJA 4M75A 1B3QA 1QVFM 3CCUA 3SWNA
chains in the Genus database with same CATH topology
1BIBA 2OZBA 3D7EO 1YHQA 1BI1A 1LJOA 1YI2N 3CCRT 3JB9H 1VQKA 2QQSA 2WBNA 3CHWA 3CC2A 2KVQG 4C8QE 4BC3A 3BUZB 4M7AC 3VGKA 4ELZC 3S3OA 1BG3A 2HAXA 1W4SA 3LDLA 2RD1A 4DKWA 5J26A 1YJ9A 2GUPA 1NMUB 5C0YA 4ZTFA 3W3DA 4IUVA 2QI2A 3OYKA 3F9MA 4FWOA 3R6OA 2WSCE 4M75G 3C7NA 4A61A 2DK3A 4KUIA 4M75D 2CZWA 4GV6A 1EQYA 1V4SA 2KKZA 1P8ZA 3FC3A 2QWLA 4O5VA 2QDYB 3HSBA 2GWKA 3CCVA 1RL2A 2P9SB 2QEXN 3CPWS 3OW2A 5CK9A 2KLAA 2EQMA 5GMKh 3TEEA 1ZBXA 5DM7L 3N4QA 5GAOq 1FXXA 4C5GA 3O8VA 1MHNA 1YJNF 4L59A 3D00A 4N0AA 4XAXB 4C0FA 4R55A 3CMEA 1D3BB 2YHWA 1ATNA 2KG4A 2DAQA 2PQWA 4IEEA 3OYAA 3O9RA 5CR2A 1GZ0A 4A5BA 2QWNA 4N4HA 2M16A 2HF3A 1X6OA 3EE8A 4ISGA 4DCHA 4AM7A 4DB3A 4FT2A 4JRKA 2KK4A 3CF5L 4PKCC 3VI6A 3NTHA 1KD1C 1QP3A 1ATRA 5GAOn 3VF6A 4E7IA 3BP8A 1G5VA 4FOIA 4GLKA 2BO1A 1VQ9A 5GAGP 3DLMA 4IOAL 4WFAL 4BB7A 5DM7R 4M7XA 4RCHA 4C0DC 5GANe 3JCMX 3WXMB 2YJFA 2LVMA 1BA0A 3DB4A 3KWGA 1YI2F 1NGHA 5F2RA 3OYNA 2A6AA 4ME7A 1HPMA 3N5BB 4F7UF 4GY2B 3ZX2A 5FLXE 1WGSA 2A7YA 5ADXH 1VQKF 5FPDA 4B1ZA 2FB7A 1GLDG 3QFUA 1M5Q1 1SSFA 3JAME 3U4LA 4XCQA 5C0MA 1KC8U 3H1QA 1VQKT 3JSCA 2FF3B 3CJ1A 1YI2A 1VQKN 1CZAN 3RKWA 2GTDA 4LDWA 4GVEA 5GAMf 1HKBA 1SZ2A 3Q1JA 3LH0A 1DEJA 3U9ZA 4C8QB 4EMKA 4TZZA 1ESVA 1I8FA 3BFMA 3CMAF 2KTUA 4IJAA 3JCMd 5GMKl 4IZ9A 5M1KA 3DXKA 4CZLA 4QS7A 2PVGB 3CMEN 4CRIA 2OTLT 4WFNL 4BUGA 2BUPA 2HBLA 4BDZA 2QQRA 1I81A 2YHTA 1JJ2A 5GANh 4JKGB 2D4WA 4L6V5 1RGIA 1H7MA 2DEQA 1BI3A 1M1KH 2DXTA 4BY6C 3R6MA 3BY7A 3LFOA 3CC7A 5G4UC 2M0OA 3A8OB 3CCLA 4C0ZA 2IVNA 5A2QE 5AQTA 2IG0A 1TUYA 3EKUA 3K9KA 4JJNK 1YJNT 4PKIA 3FDRA 1Q7YH 1Q86O 3OSVA 4M7DE 2YLBA 3SMPA 3A5LC 4BRCA 5C10A 1QVGS 2CH5A 3G4ST 5AQOA 5JLFA 3SJHA 2EWSA 3MEAA 4JLGA 1K8KB 3G71F 3MHXA 4HKEA 1KD1O 1YCYA 1Y71A 1OZ2A 3OYBA 1JCGA 4C8QD 3FLCO 2GF7A 1UGQB 4E1JA 2K5LA 2QXFA 3N4YA 2ALEA 3X25B 3T7ZA 5AQQA 4RKUE 1JRIA 3GBTA 2DPNA 3G71T 1Q82C 4H5NA 3BDLA 1W2BS 2JZ2A 4CI0C 1H1VA 3U9DA 5JLHA 3QIIA 1VQ7A 1BWFO 2W40A 5HK3A 3OYYA 5FLXM 2QM1A 3PFSA 2W41A 2LQKA 2RK2A 1GO0A 1YIJA 5LJ3g 4JNEA 1YJ9N 4ILGB 4F7UE 1JBMA 5LJ3d 2V52B 1QVGF 1Y64A 3RKXA 4BRLA 4U7BA 3QDRB 3HI0A 1NBWA 1VQ4A 1KQSS 5GANf 1M1KU 4EI8A 5AQNA 4YDUC 1R8OB 4RG8A 4CZMA 1RDWX 1GLJO 4X34A 3VF4A 5GMKe 3FFMA 1FWZA 5JVGL 1VQ5A 4JKDA 4PJOG 2E10A 3P8DA 1V4TA 1Q82H 5AQFA 1ZXOA 1VQ9T 2CGJA 3B8AX 1VQPN 2WALA 5AQSA 3LDPA 4X3MA 2Q2RA 2EAYA 2MWOA 2E65A 2RHKA 3KBGA 4C0GA 5GANK 2XDDA 2OTLN 3HFNA 2YRVA 3RKYA 2LBWA 3HKSA 3CETA 3CQXA 4Y28E 3QPHA 5CKHA 3UKUA 1W41A 5GAMg 3X24B 5AQYA 3CCSF 1U1SA 4F9OA 5G4VC 4J8FA 4OB2B 4ZGDB 3VERA 2KTVA 3MWTA 4BROA 5BREA 2PVOB 2XDBA 1X01A 2D0OA 2OTJT 5GIPC 1VQOF 2EJGA 1H641 4J6XA 1NGIA 3EAEA 5BPNA 2E70A 3PLAC 5BRFA 1VQMN 4RG2A 5M1FA 5AQXA 1XOVA 5AQUA 2E2OA 1LOJA 4LD6A 3CG6A 2OTJF 2F5KA 2WACA 4BD3A 5A0GA 1XC3A 1D3BA 1NPPA 2Y90A 3P8BB 2FSJA 5FPNA 3VUZA 4M75B 3MK6A 1G3SA 1SQKA 3RESA 4H5WA 4DHYA 5AZJB 5KPZA 1QHAA 2AIFA 3O1BA 5GAN7 1O75A 2RE2A 2V51B 3CCEA 2QQAA 4M7YA 3L42A 3FR0A 2NRHA 5IAYA 1KAZA 4XTVA 4JKAA 4PLIA 3C0BA 2D0PA 3MP8A 3UKRB 1H3ZA 3MWPA 3VU3C 4H5TA 3WQUA 5HK0A 1Q82U 2LT1A 2FGYA 1WJSA 3VEWA 1ATSA 3QSUA 5CHIA 4BRKA 2KDSA 5AQPA 1QZ5A 4P5NA 2VXFA 3FZFA 3CCMA 5IT9M 4AM6A 1UEBA 3ME9A 4WF9L 4XU3A 4M75F 1ILYA 1K8KA 1OYXA 3M4GA 3O08A 1GLAG 1HK9A 2K57A 5M1QA 3SIUA 1Q7YC 1KXPA 3ZEHA 4JKHA 3PIOA 3JB9G 2VWBA 3CCJF 3MCPA 4BVRA 1G3YA 2ZPIB 3FZLA 3I56N 2LDMA 2GEMA 2P9NB 3SDZA 3CEYA 1X7OA 2FSNA 2CZ7B 1GLCG 1K9MH 3CCQN 4MO5A 3CCJT 4OB0B 3DLLA 1M8VA 3TU5A 4RMOA 3FRNA 1VQ8A 5BN8A 5HKCA 4BRFA 3SWNC 3IKMA 4DQ2A 5AZIA 2JWKA 5FU6C 2XI9A 4CZJA 2NRXA 3JS6A 4KT0E 3I55T 3CBPA 5FPEA 4H03B 2DIGA 3MEUA 4PL6A 1MA9B 1HLUA 1DT9A 5AFUH 3QDKA 4MDBA 1VQNA 5I2MA 3JB9F 3CCSA 2XD0A 4WCEL 3OYDA 3JXUA 3J7ZO 1X52A 2G3RA 4PJOB 1M4ZA 3JCMJ 5AQZA 5TKYA 2VGNA 2DXUA 3J8AA 2GFAA 1BA1A 5LL6S 1U6ZA 4R79A 2KMTA 3KXTA 4LDYA 2XDPA 1NM1A 4LCKA 2GLZA 1NWKA 3MN5A 3PMIA 1YJ9F 3QJYA 5BPMA 1G99A 2PBDA 3E9PA 2K2VA 3KVGA 1HKGA 3TTCA 5EO3A 3HRUA 2P9SA 4MDAA 1PXWA 4EI9A 3SK3A 2AP1A 3ER0A 3RUXA 3MDQA 3QBYA 1QVFA 3FZHA 3TTFA 3CCQT 2M9UA 4N4GA 4XTXA 3AGKA 2C06A 2FVUA 2CGKA 5FRNA 4RCBA 3VTHA 3ZYYX 2RI5A 1KAYA 3C4SA 1Q86U 4K41A 2K4YA 3FE1A 4BW0B 2ZZDA 3OS5A 4J7FA 4IO9L 5LJ3f 4K42A 1NGFA 2QTDA 5BRHA 2ZGYA 5GINC 2RHYA 2P0PA 4M78C 3IUCA 4OP0A 3JCMh 3NVMA 3IMXA 4NOYA 1GXIE 5LJVA 3OW2M 1GLEG 1K8AU 2VYTA 2DTIA 1VQ5F 4RTFD 3AHUA 3HZ6A 3CCQA 5FU6B 2HF4A 3CD6N 1VQPT 4FWLA 3S3NA 3H1VX 5E84A 1Y96B 1TYQB 2MAMA 1ZWZA 4H0XB 2XHCA 4A54A 3CC2N 5KQDA 4A2BA 1YXQA 5GIOC 4QQDA 1VQLT 1WPYA 3U8XA 3CCMF 3GOXA 1IZ6A 3M5AA 3SLCA 2A40A 3G71A 1QW1A 5LJ5j 5EXWA 1NGJA 4BR9A 3NK6A 2ASMA 3A5ZB 3GG4A 3W0LA 5HXUA 2MWPA 4A57A 5F0XA 3TPQA 2EYQA 5CE3A 4HT8A 1EIFA 3CCEF 3PMTA 1PSEA 4HT9A 4J7IA 3JRZA 2QA4N 2JNBA 2RA2A 1KC8O 1RFQA 4QQ6A 1WQWA 5GINA 3OS1A 2K5FA 3CCET 5GAN4 3HRTA 3CCVT 2IVOA 4FU6A 1JJ2M 2RJDA 5KPTA 1RI0A 3L1AA 3M57A 3VEOA 4V2SA 3NVKE 4FWKA 3P4IA 4BR0A 1QVGA 1LOTB 3AY9A 3JCMg 2XK0A 3P38A 4XU2A 3P8HA 3VEYA 3EN9A 3QXEB 4BY9D 1UGPB 4MZPA 1E4FT 4MLEA 5C12A 1QVFS 5CR4A 3CXCM 1LNXA 3CC4T 2XG8D 3LL3A 1S72F 4ZTJA 4IWVA 4A53A 1KQSA 4PHTX 2EQUA 3H6ZA 4BRGA 2X4XA 1XQHA 3GP8A 4XH4A 5A0LA 3CC2F 4LD9K 2F9TA 3FGUA 1Z6RA 3FZKA 1MGQA 3HM8A 1W40A 2A3LA 1BDGA 3L6QA 1T44A 1JJ2S 3H8ZA 3CCQF 3V7SA 2WSEE 4MLHA 1TYQA 1VIEA 3HPWA 3X20B 4Q5WA 4FWMA 3QYGB 3S41A 4G9ZA 2P4TA 4J83A 3L2VA 2QWPA 4F7UG 2XU8A 4M77D 4KUDK 2ASPA 3ID6A 3IFRA 4XEIA 4JDSA 4F7UB 3EE9A 1YHQN 4FPAA 5B8HA 2P9LA 3GF5A 3RERA 4X3LA 3UDCA 2X35A 3CCUF 1VQ4F 1T3VA 3UKRA 3MO8A 1UGRB 3PAFA 2L5QA 2R57A 1YJWT 1SDSA 3OYHA 1RDUA 1X3MA 3VGLA 3V7RA 5CKDA 4FL6A 3G6EF 2DJZA 5E26A 5GAMe 3CCVN 1VQ6T 2Q97A 5GAOl 2ZPEB 5GAMj 3O1WA 5LJ5g 3VENA 1N8RC 3LWHA 2QW9A 3ID8A 3TSQA 4M7AE 3GYQA 3CI5A 4NQ3A 3DJCA 3G4SN 1VQLF 4BY9C 1M1KC 4M77A 1G3WA 5CCAA 4BVQA 1QVFF 3M3ZA 3I56F 3O9SA 5EWRA 1Q18A 1XUPO 1U1TA 2XIDA 3O8MA 2BIVA 1K8AO 3VOVA 1Q81U 4YORA 2LCCA 1K73U 2V7ZA 3LGLA 3CCRF 2Y4YA 2QA4A 1YITN 3E9OA 4PL8A 4MZMA 4TVRA 3VYHB 1M90U 4JK9A 3O85A 1ZC6A 4JHDB 2HBKA 3CPEA 4WQ4A 4QS9A 2MMPA 3M58A 3LWOC 4N4IA 1VQLA 1YJNA 4NUTA 4CD1A 5GAPK 2LT4A 4KH4A 1JCFA 3FIFA 1I4K1 2X4WA 3WVDB 4C23A 4D6WA 1QQMA 1O9SA 4M63C 4K43A 2E8AA 4JKEA 1IPAA 1BU6O 1MWMA 1YIJT 4FO0A 3AAQA 3C6AA 4CJ7A 3URGA 2YHYA 2CS7A 3WXIA 1KAXA 2CGLA 3WQTA 4BR5A 1Q82O 1W2BF 3PIPL 3M56A 5JMVA 2E2PA 4QVCA 1NPRA 2P9KA 4C92D 1P90A 3J7AR 1BI0A 4YOXA 3LYIA 4PKHA 2VC8A 1Y7XA 2DD4A 3UWNA 5FRMA 3LM2A 4JRIA 1VQMT 1X7PA 5LJ5d 3DAWA 3M54A 1U8RA 4ILHA 5CAIA 3PIOL 1JB0E 2YX6A 3WXLA 3CQYA 4MMKA 1XTDA 1U2VA 2QWMA 2I6DA 3LLRA 3QYHB 1N6AA 5ADXA 4M78E 5LJWA 4IUQA 4JS5A 2R5MA 3SAHA 3VMFB 4C92A 5LJ5e 2NZTA 4B1XB 3J7AF 2RO0A 5D6YA 3M9QA 4M7DG 1HX1A 4FPBA 2JVVA 2A41A 3H45C 2E1HA 3LX7A 2VUBA 4CZEA 1BKBA 2D9TA 4PNOA 3OA6A 1VQNT 3SBGA 1VQ6F 1Q7YU 3V8LA 2EJFA 3NFCA 5HOOA 4A4GA 4E7KA 2Q0UA 4O8UA 1WJRA 5DLQE 5AQIA 4XK8E 5LJ3j 1YJNN 2Y4XA 2H3GX 2DTHA 2J4RA 3LDNA 3F5TA 5TKWA 2O01E 2XKOC 5DY9A 4E47A 4M7AF 1KG1A 5HY0A 1M90O 1N8RH 4H0YB 4BQZA 3D2EB 3LM9A 3J81E 5AQJA 4C0DB 2YLCA 2E6ZA 4UY8O 3MEVA 1NMDA 4QVDA 4E7LA 4QVZA 3O80A 5C6SA 3V7EA 3OYJA 3QBXA 2VCPA 5M1NA 3QICA 3AAPA 3HRGA 4II1A 3VUBA 3CMET 1BYMA 3RVCA 1OZ3A 4M7AB 1VQ6N 4IUTA 3HFOA 3GNGA 3ZFJA 3JCMe 2MF2A 4WQ5A 4C5IA 3K9JA 2DXCA 1WOQA 4PJOF 2CGHA 2BKDN 5GAN8 4LC9B 1VQ7N 4XQ3A 3CMEF 4JD2A 2VYPA 4HCCA 1GLFO 1NJIU 1Y96A 3QB0A 3D2EA 2M1HA 1B34B 5A0DA 5GAOm 4R56A 2E2NA 3QFPA 1NE8A 3H3OB 1VQ8F 3A8HB 5GAN3 3I8BA 3PGGA 5AQGA 3QBWA 3I55N 3JB9J 3WT0A 2E12A 3RSEA 5C2DA 4J5YA 2RH2A 2HVYD 4U67L 2QWQA 3JCMM 1VQ4N 5KCOA 3LWIA 1BO5O 3ZEUB 3BF1A 1Q81C 4XTYA 3IR9A 3TREA 4LDVA 1VQ8T 3M1FA 4M78D 4CBWA 3SAGA 3T69A 4M78F 4BVTA 2ZGWA 3JCMP 1C0GA 2GELA 4C8QA 1YIJN 2LX9A 1GO1A 2AHJB 5GANj 3ZBDA 4EHTA 4PKGA 2E2QA 4IDHA 4JKBA 4EMKB 3G4SF 3H3NO 2XICA 3CPFA 1NGEA 2HBMA 4LDUA 5ELZA 1BUPA 4PJOC 4JK8A 4BACA 2F9WA 4FWRA 1WQ7A 3L4IA 2NRVA 3RIRA 3HOTA 1N9SA 2CZ6B 1MDUB 4BRDA 4Y0WA 5H1SQ 4CZFA 4EIAA 2V8IA 3VPZA 4MZTA 4Y91A 4HTLA 2P9PB 4M78A 4M75C 1VQPA 4BRPA 3OMCA 1WJQA 5CKBA 3A5NC 1YAGA 4CZIA 3CPQA 3CXCS 2RI3A 2IVWA 3E9GA 4ISEA 1XQSC 4FT4A 4DA4A 1UB4A 4M7AA 2DXBA 2HD0A 1ZQ1A 2KY9A 5AQVA 4O8KA 1K8AC 5AYFA 3L4QA 1KQSM 3M5RA 1YF5L 4BREA 5A2QM 2HNIA 3NTKA 4YOTA 2RM4A 1NGBA 3KHYA 4BRNA 3CJAA 3ZETA 1VQ6A 2HQEA 2RK1A 3C7NB 3G25A 1RA4A 3J80M 3OBWA 4IUUA 5CKEA 2OTJA 3OS0A 3CBOA 4EAHD 3GL1A 4M75E 4JKGA 2PUOB 2FXUA 5LJ5h 4OPHA 5F1XA 1KHCA 3DXMB 3CCEN 3CMAN 4ZN1A 4GY5A 4OVAA 4C5EA 4EI7A 4BI8B 3CMAT 3META 1VQ9F 3E20B 4M7AD 2LQ8A 3EL2A 5AQMA 3OHRA 3OA9A 4C5HA 3OYCA 1VQMA 4FWPA 1TUUA 2EFIA 4QQGA 4C8QC 4KULA 5FPMA 2IVPA 4OPAA 3CCMN 4IXCA 1U2VB 1TH7A 2HQXA 3A5MC 1OKJA 3F70A 4BI4A 1VAZA 1K9MU 2OAUA 4JRPA 2ZJQL 1NGCA 4YDUA 3M4YA 3HL8A 5J3BA 2B8AA 2E88A 2GCXA 5HXZA 4OGEA 3C95A 2OTLF 2WSFE 4BGAA 3L2ZA 5EOYA 2FYKA 5LJ3e 4BDYA 2CYZB 5FU7C 2P9KB 4FVUA 5M1OA 1W42A 4NL2A 5AQKA 2JOYA 1P92A</