2VGMA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
381
structure length
354
Chain Sequence
MKVISLKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIETDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords DOM34
total genus 97
structure length 354
sequence length 381
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgmA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgmA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgmA03
1Q82H 5FJ4C 3NVKE 1N8RH 3JCMM 1YITF 2KG4A 3NMUC 1E7KA 1RA4A 4C4WC 1X7OA 4X3MA 3CC4F 3VMFB 3PAFA 1K8AH 3N4ZA 5EO3A 2KTUA 3ON1A 3J80M 3PLAC 1QVGF 1T0KB 1M90H 3RA6A 2BO1A 1NMUB 5G4VC 3SIVA 1VQ8F 3CCUF 1VQKF 4TZZA 1YIJF 5EWRA 3LWOC 2OHWA 3CCVF 1X52A 1VQ9F 3LFOA 3CCQF 2AIFA 1VQ4F 3CMEF 1Q86H 1K73H 3G71F 4BY9D 3E20B 2QA4F 3OW2F 3CXCF 2QI2A 1GO1A 3GYQA 2LBWA 3J81M 1XBIA 1RLGA 3E1YA 3O85A 3CCLF 1JJ2F 3CPQA 2HVYD 3OBWA 2KTVA 5GANK 2WALA 3CCEF 1CN7A 1VQPF 3NK7A 2QEXF 1PXWA 1Q81H 2ALEA 1VQMF 5GINC 2I6DA 2OTLF 5G4UC 1S72F 3FFMA 1M1KH 1KD1H 1YJ9F 5A2QM 5GIPC 3IR9A 1VQ5F 3CMAF 3V7EA 3NVIB 1QVFF 1K9MH 3I55F 1GO0A 3NK6A 3I56F 1DT9A 3MCAB 1W42A 1W40A 1X7PA 1Q7YH 3VI6A 1IPAA 1VQNF 3JAMM 1W3EX 5FLXM 3G6EF 3G4SF 3WXMB 1YJNF 3LWRC 5GAPK 3CCRF 2FC3A 4X3LA 3CG6A 3CPWF 1H7MA 4BW0B 5GIOC 3SIUA 1W41A 3CC7F 3RA5A 1VQLF 2OZBA 3HAXD 1SDSA 5DCVA 4NUTA 1VQ7F 2JNBA 2VGNA 1KQSF 3CCMF 1YHQF 1CK2A 3CC2F 3J7AR 1YJWF 4LCKA 1ZWZA 3AGKA 2VGMA 2LBXA 4AF1A 1W2BF 3CD6F 3LWQC 1GZ0A 3N4YA 2CZWA 1VQOF 2OTJF 3V7QA 3HJWC 1KC8H 1YI2F 5IT9M 3LWPC 1VQ6F 1NJIH 3CCJF 3LWVC 3OBYA 2HSTA 3CCSF
chains in the Genus database with same CATH superfamily
1Q82H 2PVOB 2FYKA 4F3OA 2E65A 1BB9A 1JO8A 4JS5A 4JZ4A 3EFOA 3CXCS 2GELA 1JKHA 3QKJA 5ELZA 1X7OA 3UT5A 1UHCA 1LNXA 1Y96A 4ISGA 4QS9A 5AQWA 3VMFB 1C6VX 2A08A 1YITN 4FFBA 5EO3A 2KFNA 4C8QD 4DU4A 3CD6N 3ON1A 2LT4A 3SB2A 4NO7A 5AJ3K 2IIMA 5J2PA 1E4GT 1IREB 4Q5VA 1RQ2A 3OYHA 2XY8A 1IV4A 1EIFA 2HSPA 4DSJA 1N9RA 1NK4A 2Z1UA 1VSJA 3WNGA 2OJ2A 2CGKA 1TVKA 2D1XA 2DBMA 3QTYA 1RDUA 3AGRA 1HJRA 4NCAA 3KZBA 4CJUA 4CEAA 1SKUB 2YCHA 2KT8A 3VPZA 1P8ZA 1KD1C 3L2VA 1Q86C 2E1YA 1NJIO 3RWUA 4RCBA 3CMAT 4ID5A 3KVGA 4DTMA 2BE9B 5AVMA 3VTIC 4DBQA 4G9ZA 2V1RA 5GANf 2IG0A 2NUZA 3HFNA 3QHSA 4X9DA 2E3HA 2GUPA 1SKSA 4C5GA 3Q8HA 2GFUA 2V9YA 2QWRA 4CD1A 5GAMf 4CK3A 1NG2A 1VYUA 3P31A 3NGPA 2KI7A 1VSMA 3D01A 4QT7A 2JWLA 2P9NB 4RW7A 2ZM6K 3HZ6A 4M3RA 4LD6A 1RCHA 1UAXA 3HBTA 4IUUA 2PZSA 1PXWA 4J9FA 3MO8A 2OTLT 3K14A 4BR9A 2O31A 2UYNB 4M75G 3CQTA 2I7NA 4QS7A 4NL3A 1YJNA 3VQAA 5BREA 3VOAA 1N9SA 2EFIA 4IIOA 2PUOB 4BY6B 3G4SQ 2JMCA 4PA1A 3VEYA 1D1CA 1WSJA 4M7YA 2YYEA 3NHNA 5AQJA 3JATB 4WFAL 1EXQA 1V76A 4DSEA 4FJMA 3S9HA 2W40A 1OZ3A 2K2VA 2RJCA 2YNGA 2DM1A 3UDCA 3AA5X 1DT9A 5EZYB 1Q95G 1X7PA 4DR5K 4LF7K 2YHTA 3U4LA 3THVA 3HRTA 3L2WA 4BQLA 3L2ZA 3CQXA 4J9BA 3O08A 1ESVA 5GAOp 2IC3A 5HRNA 4DUYK 1W57A 2E12A 2P0KA 4P5NA 3M84A 4E7ZA 3VYHB 4M7AG 2RJEA 2SEMA 2HNZA 3NGYA 2UZHA 1JEGA 2GEMA 3QBWA 2RHIA 5EVZA 4U3JA 3NE6A 1HNIA 2EGAA 4DOWA 1Z5VA 2VKNA 3JCMV 1WFWA 3ZX2A 4IO8A 4CF1A 3AV9A 4II1A 3HSCA 5BPLA 3J7ZO 3CCSN 3SEMA 2EQMA 4N47A 1SKWA 2L26A 2NRXA 3OYMA 3J7AF 1ITGA 3E9OA 3KK7A 1RI0A 3QO3A 3INZA 3M0RA 5GMKm 5GAN5 5GAN4 4LD9K 4KHSA 3EG9A 1NPPA 1TVKB 2KBTA 1G5VA 4BGBA 4OX9K 5BMVB 4RTUA 1S6QA 1RNHA 2MI6A 3EGXB 1X9JA 1KFSA 1I8FA 3K5MA 5JQGA 5GMKh 4KH4A 2DXTA 3QJYA 1S72T 1QTMA 2ED1A 5AQZA 2Z1TA 3S6WA 3LWQC 3K59A 1YJ9T 1XHZA 3EAEA 2QGGA 4B1XB 1OZ2A 2EKOA 3M57A 3D2FB 3L3VA 4CFBA 1LW2A 4NXNK 3EE9A 1J9AA 3VS1A 2VXEA 4IEIA 3SNNA 1M1KO 1NNEA 1BIZA 3I56Q 1NZ9A 2P5OA 2P5GA 3LWVC 3OBYA 2A6AA 3AA2A 1MHNA 2I2LA 2EVRA 2IVNA 2LJ1A 1MWKA 2Z1GA 5FROA 4MZMA 3PX0A 1X3MA 3N2GB 4LF5K 4BVOA 1S22A 1B9DA 3HKCA 2DTHA 2HF3A 2OCEA 1QSSA 5IT9E 4I55A 1U1TA 3SUQA 3NF7A 1NG9A 1DJ7B 4IOXA 3T1HK 1HKCA 1H641 7AT1B 3ZETB 2Q3SA 4W5TA 4B9VA 3J80M 2X3WD 1TVRA 1YI2Q 2YLCA 3IEWA 3VERA 3REAB 3GP8A 1QKXA 2IOCA 3O4WA 2PZ1A 3JCMf 1NMUB 4RHAA 4Z4EA 4RTXA 4GLKA 4XTUA 4BRQA 2JM8A 1KFDA 4XIUA 3JALB 5GANd 3LWOC 1QHAA 4JAXA 3O3GA 3EG0A 4KTZA 1XNRK 1PF5A 3JAMO 1OQKA 5AQUA 3FD6A 3CMEN 4PQUA 2X4YA 5EYPA 1UFYA 2W10A 4LFAK 4XTYA 2VAMA 5HRRA 3UKUA 2JW4A 4FOIA 4FCYA 3KLGA 1YJNT 4FVMA 2KGTA 4FJ7A 2OYQA 3TR8A 4BRNA 4ZI7B 2Q0RA 4BDYA 3SUOA 4FJJA 4C8QA 2HQEA 3ZCMA 3GBTA 3FBAA 3LH0A 2JWKA 4CEDA 2ZVZA 1RABB 3WEEA 5J2MA 1GCQA 3OSVA 5KYUA 5L23A 3CCLF 4J9IA 2G8VA 2RN2A 4CECA 2YJEA 4N41A 2JXBA 5AQPA 1IBLK 4MO4A 2HZYA 2XD0A 2LCLA 4FVUA 5IHKA 4M77G 1KG1A 4DB3A 3B6NA 1TV6A 2P51A 2LQ8A 4M75B 1HX1A 1JLQA 2RHZA 5BMVA 4G4ZA 3A2FA 3D00A 4ATOA 1YJNQ 1D0YA 4YTLA 2HBWA 3REBB 3FEOA 1BG3A 5CHIA 3JVHA 3CPWP 1AWXA 2BTQB 4HUEA 4DV5K 4HVVA 5GMKl 1SRMA 4BGAA 4CEZA 4BACA 4FYVB 2O8CB 4A4EA 4QVCA 3CCJQ 2GNCA 4I2PA 1VQMQ 1KLNA 1K8AO 4CVNE 1HK9A 4BE0A 1RTJA 3B6OA 3HO1A 1JLEA 4JLIA 1YJWN 3JB9F 4KAZA 3K57A 4MZTA 4XTWA 3CMET 2BGGA 2O8DB 4IIJA 4B9MA 4NL2A 4WTOB 1OVYA 4CK1A 5DLOA 5GAPK 1T03A 2CWJA 3E22A 2ZPIB 1VSFA 3O4QA 3ZSRA 3OA9A 4Z0UA 4B8AB 2OPSA 3C6AA 3AAPA 2K79A 4E7LA 3M5RA 1OAPA 3RYFB 2KZMA 3O1WA 3RESA 1WSHA 1L3VA 2BZYA 2HS3A 2EKHA 3BEXA 3LM9A 4V19S 1YIJN 3P4EA 2JNBA 1VQMT 2QDYB 3N4PA 4E89A 3TD3A 3CCMF 3H0FA 3VS2A 1ZSZA 4M7DA 1IB8A 4AM6A 1KHIA 2LCCA 3SWNB 3OW2S 3AGKA 4F7UG 4CBWA 2KYMA 3F0DA 3VRYA 2HMIA 2B4JA 4J83A 4LUEA 4N5SA 2M0OA 3S3OA 1JCGA 4NCBA 3AVAA 4GKKK 3VEZA 3ENOA 4BRAA 1IV3A 5AZIB 5BN9A 3NH0A 2O8FA 2YSQA 4QAGA 1KCFA 3ZETA 2ZJQL 3M1FA 2UYKA 5GAN3 4H5WA 3WUHA 3VA0A 5B8HA 1ZBXA 3URGA 2YUPA 1VQLQ 3CCUA 3E66A 3VEXA 4FM2A 4ELVA 3BDPA 2XY7A 2P1JA 2KG4A 4JKBA 4BT3A 1V4SA 1NYFA 2RJDA 2W0ZA 4DR2K 4F7UF 1YJWT 2JNGA 1X43A 4HVWA 2K4YA 4A4KA 1K8AH 1HJDA 3DLLA 2LNVA 3MJXA 2HF4A 2PHNA 1UTIA 1F1BB 5F2RA 2DVJA 2R57A 3KIOA 1XNQK 4DTOA 5IJ9A 5G4VC 1QD9A 1OV3A 5EC7A 5LYJA 3I55N 5J2UB 5GMKj 2EWSA 5GINA 5KYWA 4IO9L 2O8CA 3IRXA 3TD5A 1RT5A 4GNIA 3J80E 1U8RA 4G1QA 4C1NK 2KROA 2F9TA 3RSEA 4LF4K 4KHUA 2KEAA 2ESWA 2FXUA 1K73C 1VQNT 1J5EK 4UY8O 4YOXA 1D3BA 4PFOA 3GOXA 1UA0A 3G4ST 4B46A 4XU0A 2BZ8A 5I11A 4HTLA 4YJ2B 3RYCA 2I0NA 1UEBA 3JRZA 4ZGDB 1WXUA 1W4SA 4O2BB 4FLWA 3HK2A 3ZP4A 3RKWA 3CI5A 3D6RA 3WVEB 4A2AA 2HL5C 2ROTA 1TK0A 4LF8K 4GV6A 1PNJA 4BT5A 4H5VA 1CN7A 1YIJQ 2UUAK 3FB9A 4L8RB 3E2UA 1W2BM 4E6EA 2JS2A 3C0BA 3JXUA 1YITT 3LP1A 5LL6S 3CCEF 2PVGB 5EXWA 3G6EN 2OPPA 4DTJA 2QXFA 3SK3A 1T3SA 3RDVA 4JNEA 4CEQA 3J7AP 4H0TB 2QW9A 4AHVA 5JVHL 4WCIA 5M1PA 4QCLA 2V8IA 4JUVA 1GOAA 2X9HA 4M77F 2AA4A 3G6EA 4C8QE 4E7HA 4GY5A 3BYQA 1QLYA 2ZJPL 4BT6A 3CMAQ 2OPRA 3H3OB 4I9LA 3A98A 4FSXA 4J6XA 2F9ZC 3T69A 1VQOT 3N2KA 4C92A 3JCMd 1K9MH 4FLXA 1VQLN 1MMDA 2CREA 4OPHA 5C8YB 4ZOLB 4E6RA 1BI1A 2XDPA 4OB3B 4JN4A 3VTHA 2BTTA 3FDRA 4IZ9A 3RYFA 4C92F 2VXFA 2MPXC 4IG0A 5J2NA 4JKEA 3A8LB 4H4OA 3HM9A 3K5LA 1KVAA 1YJ9A 2FZCB 3CQ8A 2YLBA 2NNWA 1BI2A 1VSKA 2A28A 3U3YA 1PWTA 2E10A 1NMDA 2AIRB 2ED0A 4MDXA 1W2BP 3PTAA 4BR4A 1N34K 4LFCK 4TUYB 3FIFA 3OYDA 2QEXA 3SQ1A 1K9AA 2DK3A 2QA4Q 3P38A 1U4BA 3LDTA 1XC3A 3DYAA 4F4KA 2M51A 1JCEA 4A63B 1VQOQ 5J39A 4KB0A 3CHWA 1X6GA 2QK9A 5IJ9B 2PFUA 3WXKA 2G8FA 1SDSA 3UT5B 4E3SA 1AEYA 3A8YA 1BBZA 1SEMA 5KYWB 1VQPQ 4C0DC 2VG5A 1MWMA 4EP4A 5GAHP 5I3UA 1NJYA 1NK7A 4Z4FA 2HHQA 2AJQA 4F2RA 2ASMA 4FZYA 3C9UA 4O6JA 1W97L 3EORA 4HCKA 1WHGA 3JCMg 2FSJA 3HVRA 1ABQA 5M1FA 4Y91A 4BRLA 4CF0A 5GAN6 3CCQA 2YNIA 3LDPA 4CGFA 1O9SA 4M75D 4CZJA 4KFBA 4AHSA 3B8AX 3KHNA 2Y4XA 5GJVB 1GFDA 4JJBA 3SHWA 2BTUA 2LTOA 1MA9B 3SUNA 1QVPA 5GAN8 4RTFD 2HHXA 4BB7A 1X69A 3L3UA 4OVLA 3NVKE 1VQ8A 2QWNA 4OMLA 5KE3A 5KX5B 5TKWA 3WGMA 3HFOA 3L8BA 3B6PA 1Z26A 3HRUA 4DBRA 1RACB 1W1FA 1N8RR 3CG7A 1MV0B 3MN7A 2YHBA 3AO3A 2DD5A 1SZ2A 1QVGF 5A0LA 1VRTA 3K0SA 4F16A 3DWLA 2XIDA 4FIBA 5GAOr 1D0ZA 1YJ9Q 4M7DE 3EL2A 1HYVA 4Y0WA 3V1RA 1QQOA 3CCSA 4CJ7A 2L89A 1JJ2P 1YUWA 2MF2A 4J9EA 1WSFA 1WLPB 2Q1XA 4O2BA 1J54A 2ZPFB 2K3YA 2P9UB 2V26A 2WUSA 3CCMT 3WJPA 1LWCA 4H4MA 3LFOA 3CEYA 2KY9A 1W5FA 1U3LA 1AD5A 1QP2A 5HL7L 3U9DA 1BI0A 2EYZA 1TUCA 1VQOA 3CC2N 4R79A 4KH0B 1OPKA 1XV2A 1K73H 3HJFA 1WA7A 5CY4A 3UKRB 2PY5A 3OQ5A 3RR7A 3C9SA 2RQUA 3VQ7A 1A5WA 5KYYA 4MO5A 3CC7N 4EI7A 5KYXB 1DTQA 1KSWA 3SQ2A 4Y28E 4C82A 5KPTA 1VQ7Q 2HKQB 4H5NA 3V9XA 2WONA 3CCLN 4F8RA 3ZEHA 1VH8A 2ZAUA 4DBHA 3ATUA 3SAHA 1CZ9A 3A5ZB 2RK1A 3CCQQ 3DM2A 3VQDA 5GAOn 1RT7A 3CBOA 3QFUA 2VUBA 2HB5A 5JS2A 2JMAA 3ZYYX 3K5NA 1NK0A 4LH5A 2FGYA 2ZPBB 1I39A 4YOTA 3TABA 2IDOA 2ALEA 4MDWA 3NPFA 4BC5A 3I0SA 3KK2A 5J1EA 3O5ZA 3SQ4A 1GRIA 4ZHQA 1TH7A 4FT2A 2KK4A 1YTAA 1JJ2M 3RRGA 3KLFA 1U43A 3QHDA 1TU0B 1Z9ZA 5LMNK 3ENHA 3DRPA 4YDUA 3ZO8A 2DXUA 1PG5B 3VEOA 1N8RO 3EY1A 1XHXA 4O5VA 5AQNA 3I55F 1GO0A 5IYZB 4PWDA 2ZF5O 5KGWA 4KRTA 3LDSA 1X3NA 2A41A 3UPUA 4H0VB 3CCQT 3QJ6A 1YTUA 2MCNA 1D1AA 2XI9A 2NZTA 3DXKA 1FXXA 4OLAA 3KIZA 3G4SF 2OTLA 4E7IA 4PFZA 2NRRA 4ELTA 1WHMA 3OA6A 3ZSVA 3DLLL 1NGDA 2ZOVA 2V52B 2LSNA 5KQ8A 4JZ3A 4C5HA 3CC7T 3PIPL 5FPDA 3JARA 2G8HA 2E41A 4YOUA 1MMAA 1KAXA 3NGIA 1LOTB 3N2GA 5HY0A 3TCJA 1XOVA 3IS9A 5GAGP 1H48A 1K6YA 4L3QA 5EOYA 1U2VA 4RTTA 3A5MC 4PWTA 2VGNA 4C92E 1VQ9T 3GHZA 3IQLA 1NQ3A 1LOJA 4KUDK 4O0IA 2JM9A 2VGMA 3G71A 1YBYA 1RQ7A 3I35A 4M78G 1HQEA 1HKBA 1DBFA 5JCOA 1TWBA 4OPAA 3NF8A 2FBXA 1ZBSA 2OI3A 4FWQA 1GZ0A 3VCZA 1M2VA 1IKVA 4M77B 2LJ0A 3EO3A 1BI4B 3VOVA 5KYYB 5C25A 3ASMA 4BDZA 2YNFA 4A61A 4B9QA 3VIUA 4FYXB 1T6CA 3V9WA 4M77D 4CJWA 3MCQA 2F8TA 3C95A 4WBNB 1VSDA 3D7SB 2Z1EA 3G1JA 3HL8A 3T19A 5AQHA 2CGHA 1GLLO 2EGEA 4DBFA 4Q0BA 4GBQA 3C6TA 3AVIA 3EE8A 1S72N 1EO1A 1GCPA 3BY5A 5GMKe 2RHUA 1IH7A 4C0FA 3PLAC 1VQ5Q 3RA6A 2NRTA 3IUCA 1YITA 4DR6K 1WQ7A 2HW3A 1LJOA 4C8NA 4CZIA 3SJJA 2P9NA 2QKBA 3TREA 1RBTA 3CCJA 1RILA 3WQUA 2AZSA 5CKEA 4BR0A 4IOCL 3T1YK 5CQXA 3LWIA 1UGRB 4HHTA 2LZ6B 3JSMA 5CQYA 1QVFS 1LPLA 4BDPA 1KHCA 4XAXB 1LWFA 4J2BA 2HP0B 2Z1HA 1YVUA 1VYVA 4FOEA 3TAMA 4PLLA 3HVTA 2EQKA 5E26A 1ATRA 4CGHA 3G71F 1M27C 4KTWA 2EJGA 1PD1A 4B3OA 4QVZA 4I7FA 1KRPA 2HX0A 4FK0A 2QI2A 4ZNXA 1GO1A 4FWMA 1RTIA 1RDAA 2GZLA 3LYIA 5AQOA 3MXMA 3GNFB 2P4RA 4A5AA 4L6V5 3QDRB 3AO1A 4RTYA 5AFUH 3PO5A 4E1JA 4YJ3A 3P83D 3GBQA 2E70A 2MMPA 4OVAA 2F5TX 2V7YA 1Q86O 4B9LA 1V1CA 4FL9A 1C0MA 3QEPA 3X26B 4FO0A 4KH6A 3LWHA 2FPFA 1WB9A 1WPYA 4ISFA 1QVGM 4B9NA 4M42A 2O8EA 4ZHQB 4AMCA 4FPAA 2OTLN 3WT0A 5AQQA 1I81A 1HQUA 2GWKA 3BDUA 3RTVA 2H8EA 3ZP7A 3WGJA 1VQ5F 5AQVA 4EP5A 4C8LA 2AT1B 1KQSM 4B3SK 3F0FA 1SSHA 3CERA 1WXBA 4KHQA 3GE1A 2LQWA 1KVCA 4M7DB 2KE9A 3JARB 1PM3A 1YITQ 2NRVA 2Q1NA 3F5TA 3VJPA 5AZJA 1S72Q 4AQYK 2AHJB 1TAQA 2LRQA 2EBPA 1UGPB 2EHGA 1H92A 2MQEA 1X9MA 1WNLA 3RYIA 4CJLA 3G71N 4C81A 4KH1B 4XTZA 1QS4A 3OYKA 2QWQA 1XI1A 1I07A 3FJPA 4KWEA 3JB9D 3OW2P 4CF2A 4B9XA 1WHLA 2CH4W 1RT3A 4CBUA 1N8RC 3AHUA 1Q82R 3OONA 2DX1A 5FPMA 3JATA 3ELCA 2CS7A 1IGQA 3K0TA 4KGXB 3O4NA 2F4VK 3AVNA 1GOBA 2NMUA 4DU3A 1XUPO 4CW7B 4N0AA 1T7PA 3OYJA 1BU6O 2H3GX 4AFQC 3UE5A 5CCAA 4HNAA 5CZ2A 4MLEA 4HWIA 3D2EB 1XNIA 3U23A 5D7UA 3KWGA 2CZWA 5I2MA 3QIPA 4MFBA 4LY7A 2LP5A 1YHQF 4WE1A 3FZHA 1Q7YU 2ITMA 4BRPA 3NCIA 1NGHA 4M8IA 3TQ7P 3MEEA 3HOSA 4CCHA 3META 4OO1J 2OTMA 3O9UA 5EB1B 2JGUA 1Y71A 2B86A 5CKFA 1EP4A 3QIOA 1VIFA 5FJ4C 4DU1A 1N8RU 1RBSA 5EIBC 2ZPHB 1M8VA 3EFSA 1T3LA 2NLXA 1WBBA 3TEEA 3AVLA 1AVZC 2J6KA 3TTCA 3G4SN 2YUOA 2F8SA 3S0HA 1MV3A 4ELYC 2V8KA 1Y57A 3MKDA 3LP3A 1VQ4N 1ZUKA 2XICA 1RDDA 4CHNA 4J7IA 3JCMQ 1CXUA 2YNHA 5A2QO 2IS3A 1M90H 2DTUA 3KJJA 2P9KB 4PJOE 4C8KA 1VQKF 1Q7YR 4AFUC 1Q7YC 1ZXOA 4IHJA 3VGMA 5L8RE 2LX7A 3DAWA 4DSKA 1SG5A 1VQ9F 1ZBFA 2GWJA 3U0OA 3PT9A 4PKHA 5HWEA 1R1MA 4LD0A 1VYTA 4V2SA 4BY9C 1XHOA 2K57A 4Z8AA 1Q86H 1JBMA 3EFOB 4M63C 2RHYA 1M1KC 3FFKB 1I4K1 3CC4N 2FVUA 4A62A 4KT0E 2FEIA 4Z02A 5AQTA 2RHHA 5ECAA 1YI2N 3N2KB 4A4HA 3M8RA 1ZUUA 4OMMA 4DF8A 1VQKN 4JI3K 1KQSA 2C0TA 2P9LB 3FZMA 3RE3A 2CSLA 1BU1A 3S02A 3VF4A 3T80A 4NYNA 4M4ZA 2N48A 1G83A 3LDLA 3P0ZA 1CZAN 2CZ6B 3VRZA 4KI4A 4A59A 2YKNA 5GAN7 3I3FA 2QK0A 1A5XA 3NK7A 1K1ZA 3SWNC 4JLGA 4PJNA 1K9MU 2VVKA 3ZSQA 2VXYA 4AHTA 1X01A 4ZHYB 5GINC 2QQRA 3CCRQ 5DLQE 1S72F 1JLCA 2QWLA 4E2FB 4ZK7A 1YJ9F 5KCHA 4YORA 1PC0A 3UKUB 3RRHA 3TI0A 5M1NA 5GIPC 5CIUA 1JQQA 4M7DD 2JVVA 1Q82C 1JL1A 4OGEA 3BZKA 4C8QC 5FPEA 3TPQA 1NKEA 1SQKA 3LAKA 3NK6A 1NK8A 1ZBIA 4C8GA 3VYUC 2ZAEA 4ERHA 4QS8A 2FZKB 3TVTA 3FR0A 4KI6A 3WEEB 4NYFA 4X1VA 2PMPA 1TK5A 1YGYA 5FU7B 4JLHA 3OYCA 1XQHA 4DTRA 1TUBB 4BI8B 3Q1JA 3RNJA 1RI9A 5I21A 2V7ZA 3WXMB 1NEBA 4HKEA 4DV4K 3CJ7A 1YVNA 2KAFA 3HI0A 3L4IA 1JL2A 2A5XA 3R1XA 1M1KR 4AHUA 5J2QA 2L8DA 4IUPA 1AHJB 4JKCA 2GGRA 1VQKT 3EGUA 4FWSA 3EYZA 4KHYA 1FNJA 2XKOC 5KPZA 5LA6A 4X1YB 2F96A 3SV4A 2PYJA 3KTQA 4PL8A 1FMWA 1VQLF 2YRCA 2NYSA 1M90R 1BOTO 2JJ9A 4PJMA 4RW4A 1NJIU 3VQ9A 2PQWA 2COYA 3WVDB 4EMKA 4RG8A 4LDUA 4OKJA 4KPYA 2YDLA 3HKBB 2YUNA 1YJWQ 2GQVA 1G2BA 5I22A 4B9SA 4JRIA 3UT1A 4DMNA 1V29B 1Q81R 1FSZA 2RB9A 3JAKB 5EIBD 1J5OA 1Z25A 1X2QA 1RADB 2FPEA 2OANA 4EMGA 3N4YA 4CJFA 1VQ4A 4FJ9A 3HPWA 4FYDA 2O8DA 1RAGB 1VK3A 4BD3A 2BDPA 3VF6A 3WGKA 3PMIA 2EYQA 1J7HA 2P9UA 2RO0A 2ZVYA 4B9UA 4NQ3A 2CP7A 5HXUA 3VUBA 1W0HA 4O8KA 5I2SA 3QXEB 4BREA 2HHTA 1J53A 2KQ2A 1JB0E 1HNVA 1D5AA 3CC2T 4YJ2A 4I9QA 1PKSA 1R0BG 5GMKi 5GAOq 1SF9A 4DOVA 3WNEA 4EHUA 3M0SA 2O8BA 1YJNN 5FW9A 4JHDA 3HKEB 3HPOA 3N4ZA 2P0PA 4CGGA 4O4JA 5I42A 2YJFA 4B3MK 2M0YA 4G4XA 4BRIA 1IHVA 4CJKA 4XU2A 2E6MA 2DVEA 3CJBA 3DOLA 4CZKA 4OPJA 1NYGA 4OMNA 4AILC 2RJFA 2E1ZA 3LDQA 5LJVA 1SV5A 3CCUF 4J9CA 1W6XA 1VQ8T 4FJHA 2JTEA 1YFNA 4PJOF 3OYFA 1YF5L 5JVGL 2Z01A 2O8FB 2QTVA 3M59A 4IUQA 2DMOA 3I55T 4C8MA 3KK3A 4BVSA 1WUAA 1F21A 4C92D 1WIEA 2RKIA 3KK1A 1I1JA 1IO6A 3H0HA 3OYIA 4C5IA 2HNYA 1S1NA 5EU7A 3ESJA 3CMEF 4BVTA 3ER0A 1W2BA 4KV8A 1CKBA 4M7AB 4CFCA 4F9OA 5AQFA 4CJVA 3LYBA 2NUTA 1SSFA 1YJWA 3NGZA 3KXTA 4O4LA 2LCAA 3EGDB 2HEQA 3QYGB 3QEVA 4FW2A 2A3LA 4M77C 4DQRA 3E9PA 3MBMA 3L1AA 1NKCA 3TAEA 1AT1B 1RLGA 3R6NA 5I9EB 5LA6B 3VS5A 1U3PA 4M77E 4M3YA 1QZ5A 4M78C 1UA1A 5AQKA 4JI7K 5LYJB 3JALA 1CKAA 4C0DB 4JI0K 1XTDA 4C8OA 3CFPA 3CPWA 5J2UA 3VN5A 4TUYA 5ITZA 5CVIA 3S0YA 3FD5A 1X1PA 3MWPA 1UDLA 3HTNA 2H8CA 4TV9A 4ZHWA 2DYYA 1VQNQ 3SBGA 1N6QA 3CBPA 3PX4A 2VASA 1M4ZA 2D0QB 4BR7A 4CESA 1B92A 1BWFO 1GLCG 1GCQC 2HNDA 4WQ4C 4ZI7A 5M1OA 1BKBA 4BC3A 4BY6C 5KRTA 4DHYA 4CHYA 2X6NA 2BKDN 3DLGA 2EQIA 2YUQA 4WQ5C 1J3TA 2AKKA 3NBPA 3I56F 3G6EQ 1IGUA 5JCOC 4N0AC 1DEJA 2Q31A 2Q36A 2QWOA 3ULDA 5D6XA 1M8MA 1JXBA 2QEXN 4X1YA 1X75C 1BIAA 1KSPA 1NGEA 5HROA 1NOYA 1OFUA 2HL3A 1VQ4T 5CKBA 4A4GA 3RMBA 4CC4B 1QWEA 2VB6A 1Q9YA 5AFUA 4FZXC 5C15A 5JICA 1EWQA 3HKBA 3VOBA 3LWRC 1GXIE 3QWXX 3QICA 1KQ2A 4FSVA 3LMEA 3TSPA 1C1CA 3CPWF 3OHRA 3JAKA 1VQPA 3RMQA 3T9NA 3V1QA 1BL3A 4JV5K 2IVWA 1QCOA 2W41A 4Z89A 5FU7C 3MWTA 3QWYA 1BHLA 4ELUA 4WBNA 4ILHA 2DL5A 2YRDA 2DXBA 4H8KA 2ZGZA 3M53A 4DTXA 5IHIA 4X20B 2UXBK 2DJQA 4F6RB 4E7JA 3HM8A 2AMTA 1RBUA 5HP1A 4IIMA 1WHHA 2DPNA 4CZLA 4J2DA 5C8YA 2ROLA 3CCVT 2QA4A 2V1QA 4J9GA 3LAMA 4WQ5A 3HXMA 1ZBHA 2GQIA 4D8KA 4ESRA 2OX7A 4M7AD 3O1BA 4FWPA 4EAHD 2XY5A 2HMPA 2HHSA 5FNVB 1UE9A 3KUFA 1TUGB 2GCXA 4WYBA 4UQGA 4WQ4A 2P9PA 4CERA 3UIQA 2Z0WA 1RT4A 2IVOA 4PJLA 2RPIA 1KNKA 2HRUA 2K5IA 1QMCA 1RAHB 1VIEA 1Z6RA 2Q1YA 4PJOA 3SJHA 3IMPA 3CXCP 4I50A 3PVQA 3VTIA 4LE9A 3LH5A 2BTFA 2YI1A 2CUDA 1KQSP 1PRMC 4HUFA 1YITF 2L3PA 4BG8A 1JY8A 5LL6Z 1UI9A 3OYGA 3VQ5A 3I7TA 4C4WC 5FWCA 3AVBA 1ARKA 5DY9A 3BE3A 5ITZB 3O9QA 1KTQA 2KTUA 1JU5C 1YP5A 1VSHA 2VC8A 1VK0A 2ZGYA 4WFNL 4QW2A 3H8ZA 4TV9B 1FMKA 3RUXA 4EIKA 4JJDA 4ILJA 3U6FA 3FLCO 2H3EB 5ADXA 4RMOA 1AWJA 5IWAK 1Q7YO 1OH5A 2XY6A 2NUTB 5JH7B 2RMOA 2VWFA 2QGFB 4A4FA 4IDHA 3ZSOA 8ATCB 2A36A 1L5UA 4KRFA 3FJ5A 5D6YA 5EWRA 3EGDA 3WGLA 1NBEB 4DG1A 2XDDA 1S1XA 2D8HA 2G6FX 4FFBB 3P1GA 2RF2A 2PYLA 3TAPA 1NK9A 3THKA 3CPWM 1U3OA 3PIOA 3H3NO 4OPKA 1MNEA 3X28B 1QAHA 2QTPA 4M3XA 5KTQA 3CD6A 3P8HA 3CCEQ 1NLVA 3O9RA 3D54A 4XQ3A 1ASUA 1FMVA 1T8EA 1WX6A 3R9PA 3J81O 4CZHA 2P9SA 2NUPA 1ZBUA 2FC0A 4U7BA 4JKAA 1VQON 1N27A 1WOQA 4N76A 2IG8A 1YI2T 3GYQA 3CCJT 3MDQA 1VHXA 4GY2B 5C10A 2E4LA 1XBIA 3O85A 5LJ5d 3RYHB 5AQXA 1UWBA 4G4YA 2QKKA 1GBQA 5HBMA 5AQYA 4R0KA 3ULRB 1R77A 2EJFA 4JI1K 1VQPN 1XQSC 1K9MO 3NTKA 5LY3A 5HY1A 1J6ZA 1Y96B 2CKKA 1M90U 1BGXT 1S1VA 1YHQQ 2BE7D 3CCMQ 1RFQA 4BR5A 3NH2A 3CXCM 3JCMX 4C8QG 3A8HB 3QNNA 3RYIB 3L2UA 2QEXF 4MLHA 4GW6A 4FJXA 3S3NA 4NLCA 3MEWA 3G4SA 2GVIA 3V9SA 3CC7Q 1P92A 4B1YB 2RB6A 4DA4A 3V9ZA 2RM4A 1BCMA 3LDNA 2X4XA 2PUKB 3L4QA 2ZJRL 4X66K 1U1SA 1VSLA 1KQ1A 1JN1A 2LDMA 1VQ7T 1LV5A 2LCSA 3UF4A 4BWJA 5HOOA 2CZ7B 1ZX6A 3F70A 4BE2A 3QDKA 3N5BB 1Q7YH 4DFJA 1LAWA 1HNXK 1VSEA 5FU6C 1M2VB 4IBNA 1M90C 3HPGA 5IN1A 4XCQA 3JAMM 4FJNA 1ZA1B 1VA7A 4M77A 4XEIA 4MMKA 1BI4A 4B45A 1WJQA 2F1LA 4X3LA 4ORZA 4EIAA 2KMTA 4PLIA 3DXMB 4D8DA 5LP6C 5CR2A 3GIBA 4ZGJB 3ZSXA 4AT1B 4CIFA 3ZX3A 1TS9A 4JJCA 1AWWA 1BI3A 2EW3A 4CHZA 4E0DA 3CC7F 2KHOA 3ZBDA 2OZBA 1NGJA 3HAXD 3IEQA 2M02A 4J9HA 3ZFJA 4CIGA 1WDXA 3EG3A 4XTVA 3CC2Q 2R751 1FWZA 2FB7A 1WN7A 3M4GA 4JKGA 3LLRA 5C2DA 3I8BA 2XU8A 2AZVA 3CCEN 3OW2A 1WHKA 4AG1C 4FYWB 4PJOB 3BZCA 1RGIA 3ZX0A 2K3BA 4HXJA 1NWKA 3L6QA 2QXLA 2XHCA 1B07A 2F69A 3U9ZA 3W3DA 4F2SA 1ZWZA 2G8WA 1B7TA 4CJPA 4FJ5A 3AT1B 3RBBB 4R40B 2D0PA 4I6MB 3ULEA 2P9KA 4DWIA 5KMGA 1KC8H 4I4TA 4IJAA 1YI2F 1U6ZA 1HR0K 2E5QA 1MDUB 2M1HA 4QVDA 4CI0C 3MECA 4O4IB 3OS1A 3P10A 1EX4A 3I9QA 1UOCA 2X74A 3E19A 5IH2A 1K73O 2HVIA 5EAZA 3BFMA 5FPNA 2FBYA 2HSTA 3VETA 3CCSF 2VG7A 1OU9A 1ZA2B 1YHQN 3VYTC 1N8RH 3RYHA 3JSCA 4D6WA 3BP8A 3NMUC 3VGKA 4Y92A 5LJ3d 3QPHA 3JAME 1ABOA 3DLRA 3DLMA 2CH6A 4FM0A 4FLTA 3QNOA 1RA4A 4X3MA 3C7NB 4IXCA 5LOVA 4NWOB 3ID8A 2G9IA 3S41A 2VQEK 1NBWA 3I5SA 5JMVA 5LJ3f 1VQ8F 4EZ6A 9ATCB 1WAJA 4NXMK 1YIJF 3E9LA 2FL7A 1NU0A 4I55B 4CEOA 4NS5A 3DLHA 1YWPA 3MK6A 3GG4A 1VQLT 4ZHRA 3L0QA 2RA2A 1WSEA 2DERA 1WZOA 2D9TA 1BYMA 4QQDA 2ITGA 4IG3A 2CP3A 3LW5E 3CCQF 4MZPA 1RAAB 2A42A 3CD6Q 2NRWA 3TTFA 3PFSA 5MLCQ 3M55A 2VWBA 4I2QA 2WSCE 3OMGA 1VQ5N 3ZOPA 1TYQB 2JUFA 3LP0A 3QFPA 3KLHA 4CHQA 3PNWC 4LDWA 5HCKA 4B6MA 2A3ZA 3SPYA 1NGIA 2CZ0B 3F9MA 1VQ8Q 4KGVB 2EIFA 1DLOA 3ALYA 1E3MA 1W7AA 2WALA 4KO0A 2Y90A 4AHRA 1GLJO 1GFCA 2HDAA 1JJ2S 4M7XA 2LX9A 2A37A 4EZ9A 4FK2A 3WPXA 5LMUK 1MUZA 3WPWA 2H6LA 5FRNA 3MMVA 5CE3A 3TD4A 3FFMA 1TG0A 3PMTA 2YKMA 2D8JA 1BO5O 3ZEUA 4E19A 1NJZA 3IR9A 3UKRA 4BRGA 2O9VA 1C1BA 2RPNA 3M3ZA 4DRXB 3CCSQ 1OULA 4I4TB 3BF3A 3JCMW 1N5ZA 4LN2A 2FZGB 4BE1A 2AIZP 2R58A 4N4GA 2EJ9A 4RQOA 1MMGA 2V8JA 3VF2A 5GADP 1KC8O 1W5AA 1HUXA 4EMKC 3SFMA 4BRCA 4YJ3B 3G6EF 3E9GA 3VGLA 4DSIA 2FC3A 5AQIA 4EI9A 2DXCA 4X65K 2RQVA 3U8XA 4B1ZA 1KD1O 3PGGA 5GAOl 1DGKN 3E9FA 2YHXA 2Z1IA 4CJ3A 3JV3A 1W70A 4CJ5A 4UC4A 1Q9XA 1W41A 1C1AA 2ASOA 2BANA 4GMJB 3FC3A 1SPKA 5A0GA 3V7CA 4JRQA 3ERNA 2AP1A 3CCUT 1GLFO 4O4IA 3O9SA 2BH1A 4W5QA 3Q7BA 3AVMA 3E22B 4DR4K 4U39A 1I3AA 4O4JB 5LP6B 1RLUA 4C8QF 3MEDA 2COZA 1Q81U 4B8CA 4DV1K 1VSIA 4NB4A 2LBXA 2QQAA 3KD5E 3AAQA 3V1OA 3EKSA 4PKIA 2F7TA 1DTTA 2KSSA 3HJWC 2QWPA 5HRPA 2E4HA 2K2MA 3QBYA 1KJWA 2XG8D 4MQ3A 2IQQA 3VS3A 4ANJA 2KYBA 3WJRA 3T1AA 3TSWA 2D0AA 3MPUB 1ZSZB 4DFKA 1NJWA 1XMOK 1EFNA 1T44A 2Y1JA 5KPRA 3NFCA 3G25A 1ZSZC 1WXTA 3I33A 1X27A 5CB4B 4LSNA 3OYYA 4LDYA 4EB6B 4CZEA 1LVKA 3QUIA 3CM6A 3V81A 3M0PA 1EZZB 1Q81C 4DQIA 2JZ2A 2XRIA 1JRIA 3M4YA 3ZL7C 2CDTA 1S1WA 1OOTA 3M56A 2J7IA 2DRKA 2LMJA 2OTJT 2BO1A 3SIVA 5C2FA 3OS0A 3OJUA 1KVBA 3D2EA 3I56N 3PV8A 1T05A 1ILYA 4ZN1A 2O2OA 1NEGA 2ZD1A 5HP8A 1GOCA 4KUIA 4ZTFA 3AVGA 5KI6A 5BPNA 1QSLA 2O9SA 1FJGK 3V7RA 1WSGA 5HY4A 3JCMP 3M0TA 2H3JA 2HQHA 4OMOA 1ONIA 5GAOm 4HT9A 3VQ6A 1Z9QA 1SHGA 1ZLMA 4N4HA 1X25A 2DO3A 2WSFE 3V8LA 4J6YA 2MWPA 5GAMg 4C0ZA 3G71Q 4M7AE 2DETA 3TU5A 3WNFA 5BRDA 4F7UE 3VQEA 2C0IA 3D7EO 4KKOA 4M7DF 4HCZA 2Y1IA 3EZ5A 1JFFB 2LBWA 3TSZA 2UYNA 1QU9A 4Z4IA 1M5Q1 2E2QA 2OTJQ 4YHHK 3O3HA 3RSEB 2OZMA 3CPQA 4DV7K 3PLAA 1NLPC 5FRMA 1TUBA 3VS4A 4K43A 3PX6A 3JYTA 3OS5A 3CMEQ 2QEXT 1SS6A 3RYCB 2ZE2A 3F9KA 4BI3A 3FGUA 2RHLA 3ZT2A 1N33K 1WSIA 3H1QA 2DBKA 1COMA 4K8XA 3PSIA 1OYXA 5G4UC 3G71T 1KQSS 4FJGA 2HCKA 4RWTA 2QA4F 2DTIA 3CMAF 2RI3A 1VQ6N 4FZZA 2RQWA 4BRDA 5JLFA 3HPHA 2HHWA 3D2FA 2CW4A 4XU3A 3R8EA 4BVPA 4JRPA 2EQUA 2GTOA 3TWHA 3N4QA 3BY7A 3AO4A 3M9QA 1HYSA 1W40A 4KHNA 3VS6A 1BIUA 1IHWA 3VI6A 1S1TA 4FJ8A 3HTRA 2VYPA 4PJJA 1BUPA 4C8EA 3QB0A 2LT1A 2HBMA 1KXPA 3X25B 1R59O 2CSIA 1V4TA 4DR7K 3L42A 3R0PA 1UGSB 4BC4A 3CG6A 3CCRT 3MP6A 5D3GA 4DF4A 2X35A 5JVDA 3ME9A 3ZT1A 4HT8A 1E4FT 3H9NA 3DLEA 5GIOC 3JB9G 4CBXA 4QQGA 4PL7A 3EKUA 4FT4A 2YWWA 3S3MA 3CCLA 4BC2A 2R5AA 5CA0B 4HCBA 3O8MA 4DRXA 3NVKA 1GLDG 4DSFA 3KLEA 2DFEA 2LVMA 2SRCA 1Y97A 3NMZC 3OTOK 3VESA 4C92C 4DV6K 1E7OA 2FRYA 4AFSC 5AZJB 3SZ2A 2X78A 2V51B 4M3TA 3CMEA 4YDUC 2P0QA 4PFPA 2QYZA 3OYBA 1QVGP 2ZWHA 4C92B 2G8IA 2QQSA 1C0GA 1KAYA 2G8KA 4DCHA 4Z94A 1IZ6A 3G10A 2Q0UA 3QZ9B 4M75C 5KRSA 4OMFB 5J2TA 3I55Q 1I5LA 1ATNA 4B9WA 3D45A 5GAMh 4JD2B 3SPZA 1TK8A 5KYUB 2DJZA 3K5OA 2HBJA 3M4SA 5EB0A 3JCMM 5TKYA 4BVQA 4JK8A 2CHTA 2CGJA 2F2VA 2L3SA 4JI5K 3VQ4A 4OKKA 4H0PA 1UUEA 3BDLA 1Q86R 1QVGA 1VQ9Q 3CCRN 1BK2A 2F2XA 1T3VA 3NF6A 3CC4F 3IG1A 4KHWA 3PSFA 3LWMA 3OYNA 3AARA 2UUCK 4LNUB 1VQ6Q 2GV9A 3HTVA 4B08A 2PBDA 2ZPGB 1TSFA 2CP6A 1H1VA 4IEEA 5M1QA 3RKYA 1IRXA 1W55A 4J2AA 1YIJT 1RLPC 1FNKA 3HKDA 2KNBB 1UGQB 4GKJK 2EYYA 2XHBA 2HQSC 2OHWA 1QSYA 1JFFA 3O80A 3C9RA 2IGIA 1Y07A 3VQCA 3WXJA 4Z4GA 3VO8A 1K73R 1LAVA 4O4GA 2JT4A 1BDGA 4BRMA 2QDLA 1GBRA 1JXMA 2D5RA 3J81E 4K0KK 1TOVA 1N36K 1NJXA 4KHPK 4CE9A 1LCKA 1WJRA 2E2OA 2YRVA 4C23A 1X2KA 4GLMA 4M75A 1VQ7A 1AWOA 5GONA 1OX9A 2L5QA 5FWBA 4LXCA 3EN9A 2R7YA 4LFBK 2HVYD 5KH6A 2HBKA 3QEIA 3DLKA 3JCMc 2KTVA 3MN6A 3UWNA 2KQWA 4NCGA 1TAUA 5KX5A 2IAFA 1D0XA 3ITHA 4B3RK 3LWLA 4EDUA 4AM7A 3OW2M 1VQMF 2K9GA 4KB1A 1IO2A 4FWOA 1OU8A 4F7UB 1LCUA 3ZSYA 1K8AU 1K73U 3KWIA 3QETA 4LDXA 1KD1U 2DZ9A 1BCOA 1KIKA 3GL1A 4IIJB 5BRFA 1M1KH 3M5AA 2KLAA 3NVIB 3H6ZA 3VS0A 2D6FA 4ME7A 4M7AA 1N5YA 1ZUYA 1QQJA 3K2XA 1YWOA 2LJ3A 3E1SA 4JKGB 5E84A 5K14A 4CGJA 3LDOA 3VEWA 4BRHA 5C6SA 5T7BA 4HTUA 2P84A 4E1MA 4TSXA 4JI8K 3PUFA 3MAQA 5CR4A 2DA9A 3CIPA 1BIBA 4CJ4A 2CH4A 3VUZA 4M78A 3A1PA 3THWA 1TKDA 3ATVA 1Y0MA 1IV1A 2CUBA 3QSUA 1NM1A 1TKTA 1VQNN 5GIPA 4YOVA 1EKEA 3HKSA 5GANg 1K8KB 1K8AC 3DRSA 1SA0B 3M58A 4LNUA 1QCNA 1UB4A 4IFVA 1D9DA 5LXTB 3EG2A 2C0OA 4PK4A 3JCMb 1WLJA 3AVHA 1G3WA 3DMJA 3RA5A 1HPZA 3KLIA 3NHGA 3I0RA 3IKMA 1M1FA 1PD0A 1IJJA 2A40A 3J7YP 3HOTA 4HCCA 3LZJA 3IMXA 5AZIA 1RAEB 1WAFA 3OS2A 1KAZA 3AVJA 4CJEA 4JDSA 3G6ET 4JJNK 4YFUA 1L3TA 1CK2A 3CC2F 2UXDK 3CFOA 5J2TB 1VAZA 2EAYA 4OMPA 2VWJA 4TV8B 3O9TA 1BQMA 2CZ1B 1I0CA 1IV0A 2FF3B 1O75A 4R56A 3VENA 1U49A 2C06A 1XMQK 1Q8RA 3CB2A 1VRUA 5JH7A 1TUYA 1AZGB 5BR9A 2QA4N 3X20B 1C6VA 4RKUE 1CSKA 5CO7A 4R55A 3SUPA 5E41A 3V7SA 3QZ5B 4FL6A 3LWPC 1PCXA 2ASPA 2Z1FA 1NJIH 2H8HA 2NRHA 1FFXB 5GONB 5GAMe 1QE1A 3SBTA 2KXCA 3JCMJ 8AT1B 1ZSGA 3CCUQ 2K6DA 4FSSA 4DEXA 1RDCA 2O4GA 4HVUA 3M6GA 4CHPA 3CCET 3QG1A 1D1BA 5F1XA 1SL1A 4IOAL 4F6RA 3CCVQ 2ABLA 4HVJA 3THXB 4DEYA 2RH2A 1U45A 4L59A 2YX6A 3O6WA 2DL4A 4F7UA 2GBQA 1E6GA 2DTOA 4DQ2A 1QW1A 2O01E 1YAGA 4OB0B 3MP1A 2GF7A 3JCMe 2P9PB 2CP0A 4CC7A 4YOYA 2J6FA 4DV2K 4XK8E 4X1IB 2A7YA 3I56T 2QEXQ 3FPIA 1QWFA 3V9UA 4F04B 3R6MA 1NK6A 1G3YA 1HKGA 4CHOA 3AVFA 4CGDA 5FU6B 2DLPA 1W5EA 1TUUA 2KKZA 2ZZDA 2O4XB 3RR8A 4YOWA 5MN4A 1Y64A 3LL3A 3VQ8A 3ZEUB 2PNIA 4M78B 3KKSA 3QBXA 5BR8K 3KBGA 5LJ5g 2FBVA 2E64A 2I7PA 4OMQA 1G99A 3CBMA 2DNUA 3T3FA 2O8BB 1YCSB 1HMVA 3DOKA 1RUWA 1YHQA 3QIIA 4ELZC 3CCMA 1K0SA 5BPMA 1NPRA 3VV0A 3TANA 1OH7A 4C8IA 2RHKA 3HT3A 4DXDA 5D6WA 1VQOF 3HRSA 3M8SA 1JXOA 3OJSA 4CD3A 3CC7A 1Q8IA 3X24B 3TSQA 4CEBA 1NKBA 4KULA 1H3HA 3CJ1A 3DI6A 4CIEA 3HHTB 1M90O 5HK3A 3ID6A 4YNQA 1HYOA 1A0NB 2WFBA 4FWLA 1X9WA 4DR1K 4FK4A 1NGGA 3DXMA 2KXDA 4U3JB 4XH4A 4O4HA 2VWKA 1U48A 1R0AA 2KT1A 1O1WA 2HBPA 3QUWA 2Y4YA 2RQRA 4BI4A 2W8BC 5GIOA 4M75E 5DM7L 5LJ5f 1K0XA 3THWB 3JASB 4M3WA 1SL0A 2PVDB 4Q5WA 4JKDA 2B33A 3QLHA 3A8GB 1K8KA 2DKGA 3V8KA 3I56A 3CCUN 1SA0A 3ASKA 4DLGA 2HD0A 3MCAB 1N6AA 4A54A 4X62K 4HA8A 5J26A 3CCVN 2OZSA 2JTFA 4CEFA 1VQ5A 5HK0A 3A5OC 1G8XA 2QQ9A 4K11A 2CSQA 3L2RA 3K2PA 5LJ3e 3DRRA 1ZYQA 2RHOA 3CCRF 1K4US 1OX8A 3VU3C 1BISA 2MAMA 3FZFA 4H5RA 5GAMj 4M7DG 1S3XA 4LSLA 3VQBA 3THXA 2DFUA 1YQNA 4BW0B 5EG2A 1PHTA 2DL8A 1Z05A 1KLMA 2J6OA 3OMCA 3SQ0A 1E6HA 3MDOA 3S06A 4J6WA 3K9JA 4F3TA 1FKOA 3RMCA 2YXZA 1UG1A 2GLZA 1B3QA 2IVPA 2W6LA 4JI6K 2EYXA 2F9WA 2RN8A 3NMUA 2WTUA 2HMAA 4RTWA 4WCEL 4X1IA 4CGIA 4KBOA 2G8UA 1M2OA 3RIRA 1KFZA 2MK5A 2RI5A 2X4WA 2B5JA 2E88A 3IDHA 5KCOA 1FFXA 1YN8A 3PIPA 4B9TA 1H47A 1VQVA 2EWCA 4M78D 3NFAA 1WNSA 4EB6A 4IDKA 4IJNA 3PY8A 2FPDA 3CD6F 2E6LA 4LDVA 2MWOA 5BRHA 2DF6A 2YV0X 5C12A 5AT1B 2WOMA 1MMNA 1CLQA 2L3QA 1HNZK 5A2QE 2IPOB 1I94K 4LF9K 3TTDA 2CHSA 3CCJF 4FWKA 1B9FA 2BTOA 4C1NI 2R6R1 2WC9A 5EYPB 3JB9H 1UFFA 1IKWA 1HSQA 4RTZA 1L3SA 1UGVA 4K8ZA 2HHUA 1RDWX 4X64K 4CZFA 2RHJA 1JLGA 2FRWA 3FZKA 3CFRA 4FJKA 4B1UB 2O4IA 1G15A 1UJ0A 1T0AA 3AY9A 2XMFA 4KGZB 1IG8A 2O4XA 2D0OA 1T0KB 1YXQA 1RDBA 3P39A 3CJ9A 3J8AA 1G3SA 3EG1A 4I6MA 3ULEB 3RKXA 5C42A 2VQFK 4TZZA 2RI2A 2ZODA 5GANh 2HSEB 3MCPA 4IUVA 1XRGA 3C0CA 2Q2RA 3BGRA 4Z4HA 4FLVA 2UYJA 4B62A 2K7AA 5AYFA 5IHNA 1KD1R 3MN5A 2AK5A 1DKGD 4DSLA 2LBTA 4HUGA 2DYBA 2NRZA 1OEBA 2AKLA 4MMLA 4ICLA 4WFBL 5HXZA 2GTJA 3A0IX 3E20B 2QG9B 1VQ6T 1P90A 4WF2A 4M7AC 2D1KA 2YHWA 2EPDA 3M8PA 5CYMA 2KTQA 4FPBA 5EZYA 1YCYA 2A1SA 3J81M 1VQ5T 1XJWB 3MN9A 3FE1A 5CA1A 5LJ5h 1JJ2F 4DFPA 5H1SQ 4KREA 3SI6A 4VUBA 1QVGS 4C92G 1LW0A 4PHTX 2UYPA 2PAVA 1VQPF 4DQSA 4A5BA 4O2AB 1U2VB 1W581 5IYZA 1RTHA 3MEGA 5C24A 4DV0K 3QEWA 5HLFA 4M78E 3CCRA 2P9LA 4A53A 2I6DA 1U40A 4GV9A 3JS6A 5CAIA 4GVMA 2E20A 1KD1H 2COWA 1OH8A 2FLOA 1YNZA 2X51A 4JK7A 3ZSZA 3M8QA 1OH6A 5F0XA 3I8DA 1U47A 1IV2A 3V4DA 2PTKA 3AO5A 1VQ8N 3I55A 5MN5A 2P4TA 5LJ5e 3EGXA 2MOXA 2QASA 5J3BA 5JQGB 3SWNA 3LX7A 1T0JA 1I5OB 2E3IA 4KBMB 2KRSA 1ZQ1A 4LUDA 5GJWB 1QQNA 4CK2A 1KNJA 4QQ6A 1H3ZA 2L3RA 3C6HA 3CM5A 4IFYA 4LH4A 4M3UA 1ZBJA 4K42A 1VUBA 2E8AA 4B1WB 1JD1A 1YJNF 5IXBA 1EETA 3H08A 2OTLQ 3IAYA 3R3LA 4KTQA 3GDQA 1SRLA 2D0NA 3OB9A 4PJOC 4TVRA 1UHFA 1K76A 4ISEA 2M16A 4JK9A 1QZ6A 3ZSWA 3SYZA 4JD2A 1U5SA 4H03B 2RQTA 1NOZA 1UECA 2HS4A 2GTDA 3SIUA 1RLQC 2ATQA 1IG9A 1O13A 3MP8A 2QWMA 3HKDB 3S0WA 5CB4A 3SMPA 3FLGA 3OSSC 4OB1B 3CCST 4OJRA 3V8JA 4J7FA 4AFZC 2LC4A 5GANe 4IURA 1KQSF 1QVFM 3CXCA 3EEQA 2K5FA 2B6AA 1YJWF 4EMHA 4LF6K 3PVLA 1W5BA 1C0FA 3RMSA 1BA0A 1D4XA 1T6DA 5CKDA 3SMSA 3TSUA 2BZXA 4JYAK 1VQ4Q 1W2BF 4J8FA 4FYYB 1WJSA 1RT6A 2I6RA 3NVMA 5IT9M 3VS7A 1XC9A 3ZT4A 4FJLA 2VAWA 1C0UA 2RE2A 1FYNA 3MX2A 1M9SA 5KYNA 2E2NA 1L3UA 2JS0A 2UU9K 3OYLA 1YIJA 4RW6A 4ZN3A 2HQXA 1A5VA 1RT2A 3WXLA 2Z1JA 2A1RA 3QINA 2DT4A 2WBNA 1HRHA 4R5PA 4QKUA 3A8MB 1UJYA 3VQPA 3CCJN 3SCXA 1VQMN 4E1NA 5LJ3h 1TL3A 3K58A 1AOJA 5FLXE 1QQCA 1N32K 3I5RA 4C8QB 2A0FB 2MYSA 2FHDA 2JLEA 3CC4Q 3C4SA 3ENBA 2E2PA 1QCFA 3SV3A 2LQKA 3RMAA 2HHHK 3ZLJA 2O8EB 4FJIA 1VQ7F 4AH9A 4OF1A 4XTXA 1JLAA 2DZCA 4CZMA 3K12A 1FX7A 2BUDA 1S6PA 2YHAA 4AHCA 2YXYA 4KH5A 4Y1DA 3KJVA 3H41A 5A0DA 2GFAA 2QAZA 2ZCFB 4JHDB 1M3BA 1X52A 3HKEA 3HP9A 5JS1A 3O3FA 1YI2A 4AG2C 1K9MC 2HBLA 3DB3A 1JXEA 4BR2A 4CZGA 4O8UA 5AR0A 2OTJA 2AIFA 3ZT0A 1CXQA 1W59A 3WGNA 3AVCA 1VQ4F 1NGFA 4PNOA 3CETA 2ZGWA 2G3RA 4JPBW 3HKCB 3HSBA 1WGSA 1X6OA 3C7NA 4M3ZA 1Q82U 4G4WA 3U3GA 4NUTA 2RD1A 4PL6A 3V4IA 5HP7A 3CXCF 5HKCA 5EY4A 3OW2F 1HYZA 4DR3K 2NUBA 3M0QA 3F0EA 4CRIA 4J5YA 3THYA 4B5CA 1QP3A 3E1YA 4OKEA 3GPLA 3QMLA 4CFDA 1KC8R 4N4IA 1TXQA 4RUGA 4X9CA 1SUQA 3RMDA 1IBMK 2KZZA 4MDBA 1W2BS 3OY9A 2WSEE 2ENMA 3BF1A 4B3TK 3CQYA 2D4WA 3CPFA 3MEUA 3HSTB 1VOMA 2NLUA 2K5LA 3NTHA 1ACMB 1KK7A 2R5MA 1RT1A 1NLOC 3RERA 4JI4K 4FWRA 4RG2A 4FU6A 1M1KU 4DKWA 4CC3A 1PSFA 4M78F 1VQKQ 3SD4A 1PSEA 4H0YB 3KFVA 3F0GA 3NDKA 3NAEA 1QVFF 2UYTA 2J06A 1WI7A 1TUDA 3JCMh 3VQQA 4C0GA 4Z88A 2HKNA 4K41A 1NJIC 2E5KA 1R8OB 3AVKA 2F2WA 5CK9A 2HRYA 3JB9J 1KC8C 3H45C 3A8OB 3AA3A 1R0CB 1QVFA 4GV3A 5CKHA 4XH1A 3C9TA 4ZHVA 5MN6A 2IIRA 4BT2A 2P9IB 1Y7XA 1TL1A 1VQNF 4F17A 3OYAA 1S72A 3JB9I 5GAEP 1ZHIA 4IKFA 5LJ5j 4O4LB 2MIOA 1VQMA 1IKYA 2QM1A 5EX5A 1H7MA 4J2EA 4PJOG 3FRNA 1FK9A 4HNAB 4BROA 3KKRA 3DDNA 3GTZA 5LJ3g 4A57A 4EFHA 1WBDA 2ZPEB 5M1KA 4FLZA 4FM4B 3RR6A 1JJ2A 5FDLA 2FG0A 3EHQA 4CC2A 3DJCA 2CP2A 2DEQA 1BA1A 2L0AA 2VCPA 3MXJA 4M45A 2ZF8A 4FLYA 2RHXA 3PE0A 5AQGA 3WNHA 3Q7CA 3SLCA 4H0XB 4XH5A 3WJQA 2YHYA 3P8DA 3IFRA 4G4VA 2VG6A 2OTJN 4X20A 4LNPA 2I5JA 4XU1A 4CF9A 1VQ9A 5DMRA 3J80O 1SKRA 4FW1A 5BN8A 3CMAN 1NK5A 3DLBA 1SHFA 4CJQA 2RNAA 2DY4A 3QDFA 2KR3A 4O44A 4RCHA 4QOZB 2P6YA 1TTHB 1VQKA 3TU4K 3AO2A 3V6DA 1JCFA 4OGCA 3NF9A 3W0LA 1YT3A 4CI6A 2CT4A 1Q86U 1HLUA 5HRSA 3CD6T 2FO0A 2W6KA 4DV3K 3PAFA 3C6UA 5GAN2 4J8OA 4BQZA 3QESA 3R6OA 3CC4A 2FSKA 3CJCA 1NM7A 3UB5A 2RF0A 3VKIA 3HYFA 1D09B 3CYPB 2DE0X 3UA6A 4FWNA 4E7SA 4NOYA 1JLBA 1ZC6A 3ISNC 1REVA 4ID1A 5AQRA 4DUZK 4PY5A 1D8YA 1MNDA 1W9HA 2KRMA 3ZT3A 3OVNA 5HY6A 1VQ6A 1QHTA 3CCVF 3P8BB 1VHAA 3HRGA 4O4HB 1T0HA 2M9UA 5AQLA 3GOIA 1S1UA 5DK5A 2FBTA 4CF8A 2JN0A 3THYB 2HP3A 3MEVA 1OKJA 1RTDA 2DPPB 1H8KA 4DS5A 5GANj 2K1SA 3F73A 4DTNA 4BY9D 2QTDA 4OB2B 1IKXA 1SAZA 4RW9A 3MQWA 1S9GA 1EQYA 3P4IA 3SAFA 1LWEA 3F2KA 1MGQA 2OAWA 3DC2A 3PIOL 2KGWA 2DIQA 4DLEA 4RTVA 5C0YA 4FXDA 3CJAA 1HD3A 1NE8A 2CH5A 4W5NA 1M30A 3EHRA 3V3TA 4JS4A 3O5BA 2HOEA 3H46O 1RBRA 2X3XD 1NGCA 1S9EA 3LPTA 3G7ZA 4PKCC 3CYQA 3K9KA 4LC9B 1GX1A 5IJ0B 2OPQA 3H6EA 1QKWA 1GL5A 1AZEA 5CZ1A 2OTLF 2VAPA 4G88A 3O8VA 3A5LC 1GLEG 1RBVA 1SL2A 2P9IA 1X9SA 3V7EA 3GLXA 3M1XA 1NMNA 2RK2A 1YJ9N 1M3AA 5LJ3j 4M7DC 1U06A 1OVQA 2J4RA 3HWUA 3JAWB 4BVRA 5DM6L 4WF9L 1W42A 2XDBA 3LP2A 1VQ9N 2ETJA 2D0BA 1IPAA 3CMAA 1FW6A 5C0MA 1OPLA 3LGLA 2DILA 3CPWS 4EI8A 1C0TA 1CZBA 2QQBA 2P9SB 1ASWA 4EMKB 2X6SA 4CJTA 4O0JA 1IXDA 4U67L 1ZBLA 4Z4CA 1CLIA 1NGBA 2DAQA 4DTSA 3UATA 3L7QA 3C8LA 2XO7A 5IJ0A 4BT7A 3EFRA 4H0OA 2Q97A 3TAQA 3RVCA 1Q82O 1ASVA 1PKTA 2KRNA 5DCVA 2IAJA 1U04A 2NWMA 3TARA 3CCQN 4H5TA 2DRMA 5AQMA 3CC4T 5B8FA 5IAYA 2CT3A 4YY3K 4M41A 2UUBK 2EYWA 3G0ZA 1QQMA 1M1GA 3C65A 2VYTA 4JRKA 1GLBG 2X4JA 1NJIR 3V7QA 2E1HA 3DKMA 4Y1CA 4X1KA 5DM7R 3LALA 3VYSC 1PRLC 3CCVA 2QA4T 1VQ6F 1B34A 2JTMA 5FLXO 3VEVA 1WQWA 5GAMd 4E7KA 2HS0A 5LXTA 2PU9B 3QYHB 4E47A 2D0CA 4BG9A 3VA3A 2ATCB 3LPUA 2HP0A 4JKFA 5ADXH 5KGXA 3GNGA 1E7KA 3MHXA 3SDZA 5CA0A 3TAGA 3L2QA 5KMGB 3PO4A 1VQPT 1X6BA 4A2BA 3TAFA 4CJSA 5LJWA 2W42A 4BT4A 3QERA 4ZGEB 3C12A 2LNHB 4TV8A 5CA1B 3GF5A 3MEAA 1IBKK 5IT9O 2DD4A 2QTXA 3S03A 1ATSA 3IKFA 3NTIA 4IHJB 3CCLQ 4K25A 1VQ7N 4MDAA 5LOVB 4O2AA 5IXFA 2OA8A 3IKEA 2VV5A 5GANK 5SWMA 3FZLA 2JOYA 3C94A 4O5BA 1MU2A 3KHYA 4L5GA 4OLBA 2K3XA 1GLAG 5AQSA 4ZTJA 3NH1A 3CCMN 2B8AA 2LQNA 1K9MR 4N56A 1QVFP 6AT1B 3BUZB 1JLFA 5CYQA 2GX9A 1S5JA 5KQDA 4JKHA 2CYZB 2DFFA 2KFZA 1TKXA 3P5JA 1HXDA 4B1VA 4BWMA 4EPCA 3CC2A 4PUOA 1HNWK 5HY2A 3KD1E 5M9OA 3LM2A 3QO9A 4IUTA 3EZWA 4O55A 3LZIA 3WXIA 4DQQA 2DEUA 3FFIA 1WHJA 1TGOA 4IFEA 3OBWA 1VQLA 4PKGA 3DXKB 3CCLT 3KJKA 3H1VX 2YT6A 2HAXA 4F14A 4GVEA 4FLUA 4O5FA 1FKPA 1D9FA 2DL3A 3M0UA 4OP0A 3JAWA 1Q81H 1TYQA 3MX5A 4CFAA 2CP5A 3UA7A 2EWNA 3M54A 1HPMA 1VQNA 2E6NA 1BQNA 1D3BB 2DFHA 3CPEA 5FNVA 5A2QM 4LCKA 3LANA 5KE2A 4PJOD 4X1KB 1EWRA 2EQJA 4FM1A 5KYXA 2HVHA 4NLBA 4RW8A 1B34B 2L2PA 4ILGB 4DS4A 1NGAA 1TKZA 4DTPA 1XWLA 1Q81O 5SZTA 1K8AR 4M7AF 2FF6A 2GBZA 5JLHA 2DL7A 2BIVA 3VYGA 4BRFA 1M3CA 4J9DA 2BE2A 2XK0A 4DQ8A 1W3EX 1YHQT 4W5OA 5FLXM 2DIGA 1HJOA 1SZQA 1RAFB 2EGCA 1WYXA 2DYIA 3T7ZA 3SAGA 1ODEA 3MXIA 1RL2A 3E01A 2KVQG 3QEXA 3LGFA 3CCEA 2EX3A 2FSNA 2E5LK 4CEEA 1Q18A 3JASA 3WQTA 4RCCA 1RAIB 4DFMA 5JVDB 3EH2A 3DB4A 2ZQBA 3AA4A 4M75F 4BRKA 4ZOLA 2E6ZA 1KC8U 2KDSA 4DTUA 3CF5L 3J7AR 4I50B 4JI2K 2BUPA 3HP6A 3D0PA 2KW4A 2GUIA 2CGLA 3KE1A 4AF1A 4W5RA 3F6MA 4IWVA 2HHVA 4DQPA 4EHTA 2OTJF 2WACA 3BW1A 1G3TA 1OI1A 3OYEA 2UXCK 3EH1A 2CVLA 4X34A 4BUGA 2NUPB 3H0IA 2ECZA 2O88A 2F5KA 4JEPA 3EG9B 4CJRA 1Z5WA 5LP6A 2OAUA 2J05A 3A5NC 2HNIA 4C5EA 3CYMA
chains in the Genus database with same CATH topology
1Q82H 2PVOB 2FYKA 2E65A 4JS5A 2GELA 3CXCS 3QKJA 5ELZA 1X7OA 1LNXA 1Y96A 4ISGA 4QS9A 5AQWA 3VMFB 1YITN 5EO3A 4C8QD 3CD6N 3ON1A 2LT4A 3SB2A 4NO7A 1E4GT 1IREB 3OYHA 1EIFA 1N9RA 2CGKA 1RDUA 3AGRA 3KZBA 2YCHA 3VPZA 1P8ZA 1KD1C 3L2VA 1Q86C 2E1YA 1NJIO 4RCBA 3CMAT 3KVGA 4G9ZA 5GANf 2IG0A 3HFNA 3QHSA 4X9DA 2GUPA 4C5GA 2GFUA 2QWRA 4CD1A 5GAMf 3P31A 2JWLA 2P9NB 3HZ6A 4LD6A 3HBTA 4IUUA 1PXWA 3MO8A 2OTLT 4BR9A 4M75G 2I7NA 4QS7A 4NL3A 1YJNA 5BREA 1N9SA 2EFIA 2PUOB 4BY6B 3VEYA 4M7YA 5AQJA 4WFAL 2W40A 1OZ3A 2K2VA 2RJCA 3UDCA 1DT9A 1X7PA 2YHTA 3U4LA 3HRTA 3L2WA 4BQLA 3L2ZA 3CQXA 3O08A 1ESVA 5GAOp 2E12A 2P0KA 4P5NA 3VYHB 4M7AG 2RJEA 3QBWA 2GEMA 2RHIA 5EVZA 4DOWA 3JCMV 3ZX2A 5BPLA 4IO8A 3HSCA 4II1A 3J7ZO 3CCSN 2EQMA 2NRXA 3OYMA 3J7AF 3E9OA 3KK7A 1RI0A 3QO3A 3INZA 5GAN5 5GMKm 5GAN4 4LD9K 1VQ7F 1NPPA 1G5VA 4BGBA 2MI6A 1X9JA 1I8FA 5GMKh 4KH4A 2DXTA 3QJYA 1S72T 5AQZA 3S6WA 3LWQC 1YJ9T 3EAEA 4B1XB 1OZ2A 2EKOA 3M57A 3D2FB 3EE9A 2VXEA 4IEIA 1M1KO 1NZ9A 3LWVC 3OBYA 2A6AA 1MHNA 2I2LA 2IVNA 1MWKA 5FROA 4MZMA 1X3MA 4BVOA 1S22A 2DTHA 2HF3A 5IT9E 1U1TA 1DJ7B 4IOXA 1HKCA 1H641 3ZETB 3J80M 2YLCA 3VERA 3GP8A 1NMUB 3O4WA 3JCMf 4XTUA 4GLKA 4BRQA 5GANd 3LWOC 1QHAA 4JAXA 5AQUA 3CMEN 2X4YA 4XTYA 3UKUA 4FOIA 1YJNT 4BRNA 2Q0RA 4BDYA 4C8QA 2HQEA 3GBTA 3LH0A 2JWKA 3WEEA 3OSVA 3CCLF 2YJEA 5AQPA 4MO4A 2XD0A 2LCLA 4FVUA 4M77G 1KG1A 4DB3A 2LQ8A 4M75B 1HX1A 2RHZA 3D00A 4ATOA 4YTLA 3FEOA 1BG3A 5CHIA 5GMKl 4BGAA 4BACA 4A4EA 4QVCA 1K8AO 1HK9A 4BE0A 4JLIA 1YJWN 3JB9F 4MZTA 4XTWA 3CMET 4NL2A 1OVYA 5DLOA 5GAPK 2ZPIB 3OA9A 3C6AA 3AAPA 4E7LA 3M5RA 3O1WA 3RESA 3BEXA 3LM9A 1YIJN 2JNBA 1VQMT 2QDYB 3N4PA 3CCMF 4M7DA 4AM6A 1KHIA 2LCCA 3SWNB 3OW2S 3AGKA 4F7UG 4CBWA 4J83A 2M0OA 3S3OA 1JCGA 3VEZA 3ENOA 4BRAA 5AZIB 5BN9A 3ZETA 2ZJQL 3M1FA 5GAN3 4H5WA 3WUHA 5B8HA 1ZBXA 3URGA 3E66A 3VEXA 3CCUA 2KG4A 4JKBA 1V4SA 2RJDA 4F7UF 1YJWT 2JNGA 2K4YA 4A4KA 1K8AH 3DLLA 2LNVA 2HF4A 5F2RA 2R57A 5G4VC 3I55N 5GMKj 2EWSA 5GINA 4IO9L 4GNIA 3J80E 1U8RA 4C1NK 2F9TA 3RSEA 2FXUA 1K73C 1VQNT 4UY8O 4YOXA 1D3BA 3GOXA 3G4ST 4XU0A 4HTLA 3JRZA 1UEBA 4ZGDB 1W4SA 3RKWA 3CI5A 3D6RA 3WVEB 4A2AA 4GV6A 4H5VA 3FB9A 1W2BM 3C0BA 3JXUA 1YITT 3CCEF 5LL6S 2PVGB 5EXWA 3G6EN 2QXFA 3SK3A 4JNEA 4H0TB 2QW9A 5JVHL 5M1PA 2V8IA 4JUVA 4M77F 2AA4A 3G6EA 4C8QE 4E7HA 4GY5A 2ZJPL 3H3OB 4FSXA 4J6XA 2F9ZC 3T69A 1VQOT 4C92A 3JCMd 1K9MH 1VQLN 4OPHA 1BI1A 2XDPA 4OB3B 4JN4A 3VTHA 3FDRA 4IZ9A 4C92F 2VXFA 4JKEA 3A8LB 1YJ9A 2YLBA 2NNWA 1BI2A 2E10A 1NMDA 4MDXA 4BR4A 3PTAA 3FIFA 3OYDA 2QEXA 2DK3A 3P38A 1XC3A 1JCEA 5J39A 3CHWA 1SDSA 2PFUA 3WXKA 3A8YA 5GAHP 4C0DC 1MWMA 2ASMA 4O6JA 1W97L 3JCMg 2FSJA 5M1FA 4Y91A 4BRLA 5GAN6 3CCQA 3LDPA 4CZJA 1O9SA 4M75D 3B8AX 2Y4XA 2LTOA 1MA9B 1QVPA 5GAN8 4RTFD 4BB7A 3NVKE 1VQ8A 2QWNA 5KE3A 5TKWA 3HFOA 3HRUA 3MN7A 2DD5A 1SZ2A 1QVGF 5A0LA 3DWLA 2XIDA 4FIBA 5GAOr 4M7DE 3EL2A 4Y0WA 1QQOA 3CCSA 4CJ7A 2L89A 1YUWA 2MF2A 2ZPFB 2K3YA 2P9UB 2WUSA 3CCMT 3LFOA 3CEYA 2KY9A 3CC2N 1QP2A 5HL7L 3U9DA 1BI0A 1VQOA 4R79A 1K73H 3UKRB 3OQ5A 4MO5A 4EI7A 3CC7N 4Y28E 5KPTA 4H5NA 3CCLN 3ZEHA 3ATUA 3SAHA 3A5ZB 2RK1A 5GAOn 3CBOA 3QFUA 2VUBA 3ZYYX 2FGYA 2ZPBB 4YOTA 2ALEA 4MDWA 4BC5A 1TH7A 4FT2A 2KK4A 1JJ2M 3ENHA 4YDUA 2DXUA 3VEOA 4O5VA 5AQNA 3I55F 1GO0A 2ZF5O 1X3NA 2A41A 3UPUA 4H0VB 3CCQT 3QJ6A 2XI9A 2NZTA 3DXKA 1FXXA 3G4SF 2OTLA 4E7IA 2NRRA 3OA6A 3DLLL 1NGDA 2V52B 5KQ8A 4C5HA 3CC7T 3PIPL 5FPDA 2E41A 4YOUA 1KAXA 5HY0A 1LOTB 3TCJA 1XOVA 5GAGP 4L3QA 5EOYA 1U2VA 3A5MC 2VGNA 4C92E 1VQ9T 1LOJA 4KUDK 2VGMA 3G71A 1YBYA 4M78G 1HKBA 4OPAA 1ZBSA 4FWQA 1GZ0A 4M77B 3EO3A 3VOVA 4BDZA 4A61A 4B9QA 1T6CA 4M77D 3C95A 3HL8A 5AQHA 2CGHA 1GLLO 1EO1A 3EE8A 1S72N 5GMKe 2RHUA 3PLAC 4C0FA 3RA6A 2NRTA 3IUCA 1YITA 1WQ7A 1LJOA 4CZIA 2P9NA 3TREA 3CCJA 3WQUA 4BR0A 5CKEA 4IOCL 5CQXA 3LWIA 1UGRB 5CQYA 1QVFS 1KHCA 4XAXB 4FOEA 4PLLA 5E26A 2EQKA 1ATRA 3G71F 2EJGA 4QVZA 2QI2A 1GO1A 4FWMA 3LYIA 5AQOA 3GNFB 4A5AA 4L6V5 3QDRB 5AFUH 4E1JA 5GANK 2E70A 2MMPA 4OVAA 2F5TX 2V7YA 1Q86O 4FL9A 3X26B 4FO0A 4KH6A 3LWHA 1WPYA 4ISFA 4FPAA 2OTLN 3WT0A 5AQQA 1I81A 2GWKA 3BDUA 1VQ5F 5AQVA 1KQSM 3CERA 3GE1A 4M7DB 2NRVA 2Q1NA 3F5TA 3VJPA 5AZJA 2AHJB 2LRQA 1UGPB 1WNLA 3G71N 4XTZA 3OYKA 2QWQA 3FJPA 3JB9D 4B9XA 4CBUA 1N8RC 3AHUA 5FPMA 2CS7A 1XUPO 4N0AA 3OYJA 1BU6O 2H3GX 3UE5A 5CCAA 4MLEA 4HWIA 3D2EB 1XNIA 3KWGA 2CZWA 5I2MA 3FZHA 1Q7YU 2ITMA 4BRPA 1NGHA 3HOSA 3META 4OO1J 3O9UA 1Y71A 5CKFA 1VIFA 5FJ4C 1N8RU 2ZPHB 1M8VA 3EFSA 2NLXA 3TEEA 3TTCA 3G4SN 1VQ4N 4ELYC 2V8KA 2XICA 4J7IA 3JCMQ 1M90H 2P9KB 4PJOE 1VQKF 1Q7YC 1ZXOA 3VGMA 5L8RE 3DAWA 1VQ9F 2GWJA 3PT9A 4PKHA 5HWEA 4V2SA 1Q86H 4BY9C 2K57A 1JBMA 4M63C 3CC4N 1M1KC 2RHYA 3FFKB 1I4K1 2FVUA 4A62A 4KT0E 4Z02A 5AQTA 1YI2N 4A4HA 1VQKN 1KQSA 2P9LB 3FZMA 3VF4A 3LDLA 1CZAN 2CZ6B 4A59A 5GAN7 3NK7A 3SWNC 4JLGA 1K9MU 1X01A 5GINC 2QQRA 5DLQE 1S72F 2QWLA 1YJ9F 5KCHA 4YORA 5GIPC 3UKUB 5M1NA 5CIUA 4M7DD 2JVVA 1Q82C 5FPEA 4OGEA 4C8QC 3TPQA 1SQKA 3NK6A 4QS8A 3FR0A 3WEEB 5FU7B 3OYCA 1XQHA 4BI8B 3Q1JA 5I21A 2V7ZA 3WXMB 4HKEA 3CJ7A 1YVNA 2KAFA 3HI0A 3L4IA 3R1XA 2A5XA 2L8DA 4IUPA 1AHJB 4JKCA 4FWSA 1VQKT 2XKOC 5KPZA 1VQLF 4PL8A 1BOTO 4BC4A 1NJIU 2PQWA 3WVDB 4EMKA 4RG8A 4LDUA 2GQVA 4JRIA 3UT1A 1V29B 2OANA 4EMGA 3N4YA 1VQ4A 3HPWA 4BD3A 3VF6A 3PMIA 2EYQA 2P9UA 2RO0A 4NQ3A 5HXUA 3VUBA 4O8KA 5I2SA 3QXEB 4BREA 1JB0E 3CC2T 5GAOq 4EHUA 5GMKi 4DOVA 1YJNN 4JHDA 3N4ZA 2P0PA 2YJFA 4BRIA 4XU2A 3CJBA 2DVEA 4CZKA 2RJFA 2E1ZA 3LDQA 5LJVA 3CCUF 1VQ8T 4PJOF 3OYFA 1YF5L 5JVGL 3M59A 4IUQA 3I55T 4BVSA 1WUAA 4C92D 3OYIA 4C5IA 3CMEF 4BVTA 3ER0A 1W2BA 4F9OA 4M7AB 5AQFA 1SSFA 1YJWA 3KXTA 3QYGB 2A3LA 4M77C 3E9PA 3L1AA 1RLGA 5I9EB 4M77E 1QZ5A 4M78C 5AQKA 4C0DB 1XTDA 3CPWA 5CVIA 3MWPA 3SBGA 3CBPA 1M4ZA 2D0QB 4BR7A 1BWFO 4WQ4C 1GLCG 5M1OA 1BKBA 4BC3A 4BY6C 4DHYA 2BKDN 4WQ5C 3I56F 4N0AC 1DEJA 2Q31A 2Q36A 2QWOA 5D6XA 2QEXN 1X75C 1BIAA 1NGEA 1VQ4T 5CKBA 4A4GA 5AFUA 3LWRC 5C15A 5JICA 1GXIE 3QICA 1KQ2A 4FSVA 3TSPA 3CPWF 3OHRA 1VQPA 3RMQA 3T9NA 2IVWA 2W41A 5FU7C 3MWTA 4ILHA 2DXBA 2ZGZA 3M53A 4E7JA 3HM8A 2DPNA 4CZLA 3CCVT 2QA4A 4WQ5A 4M7AD 3O1BA 4FWPA 4EAHD 2HMPA 3KUFA 2GCXA 4WYBA 4WQ4A 2P9PA 2IVOA 2K5IA 1VIEA 1Z6RA 4PJOA 3SJHA 3VTIA 2BTFA 2YI1A 1YITF 4BG8A 3OYGA 4C4WC 5DY9A 3O9QA 2KTUA 4WFNL 2VC8A 2ZGYA 3H8ZA 4QW2A 3RUXA 4ILJA 3FLCO 5ADXA 4RMOA 1Q7YO 4IDHA 4A4FA 5EWRA 5D6YA 2XDDA 3CPWM 3PIOA 3H3NO 3X28B 3CD6A 3P8HA 1NLVA 3O9RA 4XQ3A 3R9PA 4CZHA 2P9SA 4U7BA 4JKAA 1VQON 1N27A 1WOQA 3GYQA 1YI2T 3CCJT 3MDQA 4GY2B 5C10A 1XBIA 3O85A 5LJ5d 5AQXA 1VQPN 5AQYA 1K9MO 5HY1A 2EJFA 1XQSC 1CN7A 3NTKA 5LY3A 1J6ZA 1Y96B 2CKKA 1M90U 4BR5A 1QVGM 1RFQA 3CXCM 2QEXF 3JCMX 4C8QG 3A8HB 3L2UA 4MLHA 3S3NA 4NLCA 3MEWA 3G4SA 1P92A 4B1YB 2RB6A 4DA4A 2RM4A 3LDNA 2X4XA 2PUKB 3L4QA 2ZJRL 1U1SA 1KQ1A 2LDMA 1VQ7T 5HOOA 2CZ7B 4BE2A 3F70A 3QDKA 1Q7YH 3N5BB 5FU6C 4XCQA 1M90C 3JAMM 5IN1A 4M77A 4XEIA 4MMKA 1WJQA 4X3LA 4EIAA 2KMTA 4PLIA 3DXMB 5CR2A 3GIBA 4ZGJB 3ZX3A 1BI3A 3CC7F 2KHOA 3ZBDA 2OZBA 1NGJA 3HAXD 3ZFJA 4NUTA 4XTVA 1FWZA 2FB7A 4JKGA 3M4GA 5C2DA 3LLRA 1YHQF 3I8BA 2XU8A 3CCEN 3OW2A 4PJOB 3ZX0A 1RGIA 1N8RO 1NWKA 4LCKA 3L6QA 2QXLA 2XHCA 3U9ZA 2F69A 3W3DA 1ZWZA 2D0PA 4I6MB 3ULEA 2P9KA 1KC8H 4IJAA 1YI2F 1U6ZA 2E5QA 1MDUB 2M1HA 4QVDA 4CI0C 3OS1A 3E19A 1K73O 3BFMA 5FPNA 2HSTA 3VETA 3CCSF 1YHQN 1N8RH 3JSCA 4D6WA 3BP8A 3NMUC 3VGKA 5LJ3d 3JAME 3QPHA 1RA4A 3DLMA 2CH6A 4X3MA 3C7NB 4IXCA 3ID8A 3S41A 1NBWA 5JMVA 5LJ3f 1VQ8F 1YIJF 3E9LA 2FL7A 4NS5A 3MK6A 3GG4A 1VQLT 3L0QA 2RA2A 3CCQF 2D9TA 1BYMA 4QQDA 3LW5E 4MZPA 2A42A 2NRWA 5MLCQ 3TTFA 3PFSA 3M55A 2VWBA 2WSCE 3OMGA 1VQ5N 1TYQB 2JUFA 3QFPA 3PNWC 4LDWA 2A3ZA 1NGIA 2CZ0B 3F9MA 2EIFA 2WALA 2Y90A 1GLJO 1JJ2S 4M7XA 2LX9A 5FRNA 3MMVA 5CE3A 3FFMA 3PMTA 1BO5O 3ZEUA 3IR9A 3UKRA 4BRGA 3M3ZA 3BF3A 3JCMW 4BE1A 2R58A 4N4GA 2EJ9A 2V8JA 3VF2A 5GADP 1KC8O 1HUXA 4EMKC 3SFMA 4BRCA 3G6EF 3E9GA 3VGLA 2FC3A 5AQIA 4EI9A 2DXCA 3U8XA 4B1ZA 1KD1O 3PGGA 5GAOl 1DGKN 3E9FA 2YHXA 1W41A 4UC4A 2ASOA 3FC3A 5A0GA 4JRQA 3V7CA 2AP1A 3CCUT 1GLFO 3O9SA 2BH1A 3Q7BA 4C8QF 1Q81U 2LBXA 4NB4A 2QQAA 3AAQA 3EKSA 4PKIA 2F7TA 2KSSA 3HJWC 2QWPA 3QBYA 2XG8D 1T44A 5KPRA 3NFCA 3G25A 3I33A 3OYYA 4LDYA 4CZEA 3QUIA 1Q81C 2JZ2A 1JRIA 3M4YA 3M56A 2OTJT 2BO1A 3SIVA 5C2FA 3OS0A 3D2EA 3I56N 1ILYA 4ZN1A 4KUIA 4ZTFA 5BPNA 3V7RA 5HY4A 3JCMP 2H3JA 5GAOm 4HT9A 4N4HA 2DO3A 2WSFE 5GAMg 4J6YA 2MWPA 3V8LA 4C0ZA 4M7AE 3TU5A 5BRDA 4F7UE 3D7EO 4M7DF 4HCZA 2LBWA 1M5Q1 2E2QA 3RSEB 3CPQA 3PLAA 5FRMA 4K43A 3OS5A 2QEXT 1SS6A 4BI3A 3FGUA 3H1QA 1OYXA 5G4UC 3G71T 1KQSS 4RWTA 2DTIA 3CMAF 2RI3A 1VQ6N 4BRDA 5JLFA 3D2FA 4XU3A 3R8EA 4BVPA 4JRPA 2EQUA 3N4QA 3BY7A 3M9QA 1W40A 3VI6A 2VYPA 1BUPA 3QB0A 2HBMA 2LT1A 1V4TA 3X25B 1KXPA 1R59O 3L42A 1UGSB 3CG6A 3CCRT 3MP6A 2X35A 3ME9A 4HT8A 1E4FT 5GIOC 3JB9G 4CBXA 4QQGA 4PL7A 3EKUA 4FT4A 3S3MA 3CCLA 4BC2A 2R5AA 4HCBA 3O8MA 3NVKA 1GLDG 2LVMA</