2VGMA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
381
structure length
354
Chain Sequence
MKVISLKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIETDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 97
structure length 354
sequence length 381
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgmA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgmA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgmA03
3CCMF 1JJ2F 1YI2F 1W41A 3CCJF 5FLXM 1W2BF 3PAFA 3JAMM 5EO3A 1IPAA 2VGNA 3CMEF 3NK6A 1YJNF 1X7OA 1M1KH 3CC4F 1GZ0A 3N4YA 5DCVA 3RA5A 3CC7F 5GAPK 3IR9A 5FJ4C 3NMUC 3E20B 1VQNF 2ALEA 3ON1A 1KC8H 3G71F 3SIUA 1XBIA 3LWPC 1YJ9F 2OTLF 2KTUA 3LFOA 1YIJF 1VQ5F 5G4VC 3LWVC 3GYQA 1K8AH 1E7KA 3LWOC 3CD6F 3VMFB 2KG4A 1VQPF 1Q82H 3V7QA 1Q7YH 3N4ZA 3PLAC 1RA4A 4BY9D 3CCRF 1YJWF 3CPWF 1H7MA 2VGMA 3SIVA 3CCVF 3CC2F 3CCSF 1W3EX 3CPQA 3JCMM 1QVGF 1GO1A 1X7PA 3O85A 1S72F 2I6DA 5EWRA 3LWQC 3CCQF 5GINC 2HVYD 5IT9M 2LBWA 3NVIB 3NVKE 3LWRC 1CN7A 2KTVA 1VQMF 5A2QM 3E1YA 2LBXA 1NMUB 3G4SF 4LCKA 1W42A 1VQ9F 1KD1H 3VI6A 1QVFF 2OZBA 3CCUF 3J80M 5GIOC 2WALA 3CMAF 1K9MH 1N8RH 2FC3A 3NK7A 1DT9A 2HSTA 1Q86H 1VQKF 2CZWA 3CCLF 4X3LA 1VQ4F 1NJIH 4NUTA 2JNBA 1YITF 3HAXD 4TZZA 3CCEF 3I55F 5G4UC 1VQ8F 3CXCF 1VQ7F 1M90H 2BO1A 3HJWC 1ZWZA 3J81M 1VQ6F 3G6EF 3OBWA 3J7AR 3CG6A 1Q81H 2OHWA 1SDSA 2AIFA 1T0KB 3MCAB 4AF1A 2QA4F 5GIPC 1CK2A 1YHQF 1X52A 4C4WC 1PXWA 3I56F 3V7EA 1RLGA 3FFMA 3OBYA 3OW2F 5GANK 1VQLF 3AGKA 2OTJF 1K73H 1VQOF 1W40A 3RA6A 1GO0A 3WXMB 2QI2A 1KQSF 4BW0B 2QEXF 4X3MA
chains in the Genus database with same CATH superfamily
4B08A 2G8FA 2OZMA 4KRFA 3SAGA 2YXZA 4KH4A 5KYXA 1PKTA 4JKGB 4LSNA 3ULEA 4CK3A 4EB6B 2JT4A 2RHUA 2ESWA 5GAOm 3OYJA 3TSWA 2RKIA 2Z01A 4AQYK 5JQGB 3VTIA 5D7UA 1S1XA 2DBMA 1ZSZB 4M77G 4B3MK 2QA4Q 1W57A 5AQWA 2WSFE 4CF8A 4HCKA 3WVDB 1RT2A 3C0BA 2O8EA 5C8YB 1OKJA 2QG9B 1TUGB 2DTOA 2NZTA 4JV5K 4H5WA 3WQUA 1M1KR 4DSIA 4LF6K 2M51A 3VOAA 2F8SA 2KDSA 2ZPBB 3NH1A 1VQ5T 2W41A 4KGZB 3OYLA 1WSIA 2K57A 1SSFA 4AHUA 3MQWA 2FVUA 1CZAN 1ATNA 2JTMA 4OO1J 3O8VA 3GNFB 3CD6T 2BE2A 3HTVA 4IHJA 2CH4W 4F7UF 4ZOLA 1P8ZA 3LFOA 3GNGA 4PUOA 1RL2A 1ZHIA 1YJNN 3N4PA 1FFXA 1ZBUA 5LJ3h 3DXKA 2A5XA 5C24A 1QP2A 4J9DA 1K4US 2IVWA 3DOLA 2P84A 2RJDA 1HJDA 4OKKA 1MMNA 2YHWA 5FNVB 3WGJA 1D1BA 1K8AR 4DRXA 2IC3A 4CF2A 4ELTA 5BMVB 5J2UB 1I07A 3CPFA 3J7AF 3ISNC 1RABB 4L5GA 2QWOA 2ZVYA 3JS6A 1QQJA 5FLXE 3DKMA 4DHYA 3SIVA 1YVNA 2HF3A 5IH2A 2Q1NA 4YNQA 1D9DA 4KULA 1RILA 5HK0A 3IFRA 4CJKA 2YUNA 3E9LA 2D1KA 3O6WA 5A0LA 3I56A 5GANe 3KXTA 1D3BB 1W3EX 1M3AA 4E0DA 2O8FA 1KVBA 4IIJB 1PNJA 1WOQA 2MF2A 2QWRA 4PQUA 3L6QA 5MN6A 1BUPA 3DYAA 4CJUA 2QTPA 4EMKA 4M41A 1WN7A 2Y1JA 1VUBA 5KH6A 1RDAA 2HKNA 2X9HA 2YSQA 1NMUB 4CI6A 3R6OA 5GANf 4FLWA 2DVEA 4A5AA 5BPLA 2DERA 4JJBA 3G25A 1HSQA 4UQGA 3F0FA 4N4HA 4O4HA 1R8OB 1ZBFA 4C92D 1NG9A 1TU0B 2HSTA 4DU1A 2BTUA 1OU9A 4KBOA 3ID8A 3MDOA 4X1KB 5HCKA 3CCET 3CYPB 3TD3A 3AO2A 4WQ5A 3O8MA 2RHLA 4FWRA 2HBJA 3MWPA 4BI3A 1XRGA 3JALB 5C6SA 2DFFA 4X1YA 1S1NA 5J2NA 3KWIA 3O5BA 3W3DA 2J6OA 2ATCB 5JVDA 4CJQA 4C1NK 3L2WA 3I0RA 1FMKA 3H0FA 5KE3A 1RT6A 5EVZA 3CBPA 3TARA 5GAMg 4DR4K 3VYGA 1S6QA 4FJ5A 3SQ0A 3M8PA 2RN2A 3IKFA 2COZA 1ZQ1A 5M1FA 4F4KA 2ZJPL 3ESJA 4Z4GA 3DLHA 2GF7A 4DTUA 3JAKA 2DEQA 2OTJT 4IG0A 2RHYA 4DA4A 1Z25A 4HHTA 1X52A 2CP5A 1K6YA 1VQLQ 2Q1XA 2F4VK 2HVHA 4BVOA 1OVYA 1X6BA 4PJOC 1QHAA 3BY5A 4CZJA 5JVHL 2QKBA 4CHOA 3A0IX 3G6EN 5CKHA 3RA6A 4ZHYB 1UUEA 5GMKj 2NLUA 3R1XA 4CJ5A 3H41A 3RMBA 5E84A 4BW0B 2FPFA 3VYSC 3U9ZA 3VYUC 4CC4B 3EGUA 3RMAA 4AG2C 2A41A 5MN4A 1BU6O 5BR9A 3EGDB 3V1QA 3RYCB 4KUIA 1WA7A 4XTZA 4J2BA 2RQTA 3N4QA 4G9ZA 1FNKA 2MI6A 2EWNA 2EJFA 4O4LA 4AFQC 3CC7Q 1B92A 4LFBK 3BF1A 3S0YA 4LC9B 3VGKA 3SWNB 2QK9A 3HKBB 3SK3A 4CF0A 4LH5A 2RD1A 1VQKA 4L8RB 3AARA 3RDVA 1Q81C 4DFJA 4BRDA 2AIZP 2E41A 3CD6N 1H47A 5HP8A 5KYXB 3KVGA 3HRGA 5AQXA 3ULEB 1XHZA 3N2KA 4FYVB 1RT3A 2NUBA 1Q9XA 5KYYA 2P9UA 4FFBA 3CQYA 4JI3K 4BRLA 2YUQA 1U4BA 4IZ9A 3C12A 3UA6A 2KR3A 4N4GA 1S1VA 2ABLA 2UUAK 1VQPQ 4GY2B 5LY3A 2KEAA 8AT1B 2O8EB 3VIUA 3VRZA 4C0GA 4BR9A 2VWJA 3VMFB 1E7KA 2G8UA 4PJOG 5M1KA 3J81O 1D0ZA 2YKNA 4I9QA 1YJWQ 2R5MA 2CDTA 2XU8A 4CD1A 3GDQA 2LP5A 3JCMh 5FPNA 3CCRF 2EQJA 3CPWF 2VGMA 4IHJB 3D2FA 1NGHA 1A5WA 2ZPEB 3H0HA 4IBNA 2IAFA 4ZOLB 4QS8A 3VF4A 5FU7C 2DLPA 2O4GA 3RYFA 3FB9A 1FFXB 2DM1A 3DXKB 2HQSC 3LAKA 4FJXA 4NXMK 3KWGA 5C10A 1S72F 2DMOA 2A08A 4PFZA 1MWMA 3ZP4A 5CHIA 4DRXB 2O8CA 1V1CA 3CXCS 2EYYA 4M75B 3RYIA 3VYHB 3SEMA 1RBTA 2OAWA 3MKDA 5BN9A 4WFNL 3OTOK 1SS6A 4FXDA 2PUOB 2DRMA 4PL8A 2PZ1A 4C0DB 1M5Q1 3DLBA 2O8FB 1GLLO 5DLQE 2V8IA 4UC4A 3V7RA 2D0AA 4FJIA 4KREA 2Y4XA 2A6AA 2HNYA 4RTUA 3V81A 4EMKB 5CYQA 4RCBA 1Q86R 4I7FA 3RVCA 4K8XA 4J8OA 3VRYA 1YITQ 1A0NB 4FZXC 1ZA2B 4ZN3A 1I3AA 3SJHA 2AK5A 5KI6A 3G4SN 2M16A 1QKXA 1A5VA 4O4HB 4FYDA 4ZTFA 4JRIA 2C0IA 2O01E 2Y90A 3EE8A 1HMVA 5AQKA 3QB0A 4ELVA 2E1HA 3MEDA 1JJ2S 1VQ5A 4WYBA 3VEYA 3CJ1A 3UKUA 5CAIA 4ZN1A 3BUZB 4KB0A 1X6OA 3TQ7P 3WVEB 4WQ4C 2FPDA 2QGGA 3CD6A 5IAYA 1GLJO 4M7AA 3P1GA 5J2MA 1GCPA 1ZWZA 2ECZA 3M0QA 2HVYD 2AZVA 3VEWA 4ISGA 5LJ5j 3OYMA 4FOEA 3TU4K 5C2FA 5CO7A 1BYMA 2FRWA 1C0GA 4H5RA 2DIQA 4X1YB 3TAGA 3VGMA 1IV0A 4DSJA 4A5BA 4EHUA 1M30A 2C0TA 1QVGS 2AKLA 1VQ4Q 1LW0A 2DVJA 1OVQA 3FZKA 3ZT0A 4EP5A 4V19S 1GX1A 1KC8U 4JZ3A 4OF1A 3GP8A 1KQSP 2Z1UA 1J3TA 4NLCA 2VYTA 3A8LB 4CZKA 2W8BC 2EPDA 5IHIA 5GMKm 1B7TA 3K0TA 1C0MA 5J39A 1IKWA 5TKWA 5HRSA 1MV0B 3T80A 4LDWA 3QETA 5AQPA 2JLEA 3UKRA 2GUPA 2ED0A 5AYFA 3CCMF 2CS7A 2BKDN 3JAKB 1YI2F 1JEGA 1D0XA 3VTHA 4OMOA 5FLXM 2VG7A 4JNEA 2F2WA 4GKKK 5EO3A 2AKKA 2ZPGB 4PLIA 3QZ9B 2VGNA 3AVFA 3VU3C 3H3NO 1YNZA 5IN1A 5KPZA 4LSLA 4DF4A 4Z94A 3PMTA 3H8ZA 3LM9A 4GLKA 3KBGA 4CC7A 2KLAA 5AQOA 4BQLA 2RA2A 4CHYA 4RTZA 4E1MA 4JI5K 1VQOT 3HJFA 1AZGB 4JRKA 3JASA 1U40A 1G2BA 3A8GB 1PG5B 5I21A 1TXQA 1DJ7B 4JN4A 4HUFA 4F2SA 3D7SB 4HT8A 3CYMA 4DTOA 4X1IA 4O8KA 1NGEA 1W7AA 5AZJA 1EIFA 4EIKA 2BE9B 4QQGA 2PVGB 3CCEA 3OQ5A 2DBKA 4BDZA 3HZ6A 1T0HA 1M2VB 3A8MB 4A4HA 3RR6A 2P51A 2RF0A 4O4LB 2FYKA 4OMNA 4XQ3A 3EE9A 3CC4N 2K3BA 5GAN7 3AAPA 2I2LA 5LJ5d 1TK8A 1M8MA 2RHIA 1SRLA 4JI2K 3PNWC 4B9QA 1ASUA 3HPWA 3WNGA 2L3QA 3LP2A 2RI3A 4NYFA 3C0CA 1WBBA 2DF6A 5FW9A 2Q0RA 4K0KK 1SZQA 2GNCA 1X3NA 3N2KB 3ATVA 3H46O 3CCQT 2JJ9A 3EFRA 3M57A 5KYYB 2DZCA 3G71T 1IKYA 2P9UB 4FFBB 1JLEA 1JFFA 3PMIA 3ZT2A 1AOJA 2UU9K 1D4XA 1VQNQ 4M45A 4CHPA 4PHTX 1QVGF 1BI2A 1Q95G 5CKEA 4KH0B 1WXBA 3BDPA 2I6DA 2PZSA 2DPNA 3RMQA 1K1ZA 2WBNA 4B46A 2OTJA 3VQ6A 2AIRB 1F1BB 4DR1K 4KHUA 4CJ7A 1VK3A 5HL7L 3BE3A 2PYJA 3LX7A 4M78F 3PE0A 4LCKA 4PY5A 3ZLJA 2P1JA 3CC2N 4W5TA 1K73O 4CJWA 4IDKA 3J80M 4GVEA 1UAXA 3CCSN 4Y92A 4J9IA 2YUPA 1OZ2A 2KXCA 2YWWA 4QVZA 2CH4A 3V6DA 1G3TA 1TSFA 1O9SA 4CEAA 4B9TA 2I7PA 2WOMA 4JK9A 3H6ZA 4OVLA 1AWXA 4O4JA 2QW9A 2O8CB 4HA8A 3CCLF 2D0OA 2XDPA 3QLHA 3RYIB 1KIKA 3T19A 3E9GA 5LMNK 1NJIH 3A5NC 4OB2B 3QICA 4FYYB 2NUTA 3U4LA 5JH7A 4E1JA 3L2VA 1V4SA 1Z9ZA 3QPHA 4JUVA 1NGJA 2X3WD 1U1SA 3PUFA 1LWCA 1RT7A 3HJWC 1RAEB 4JI6K 4BVRA 2QK0A 3AAQA 5BN8A 2EYWA 3MEVA 4CEEA 1FKOA 3J7AR 4FYWB 4EZ9A 1NGBA 4RTFD 1YHQQ 2YLCA 2QWLA 5GMKe 2J4RA 2CW4A 1M27C 5CKDA 1N8RR 3SAFA 3GOXA 1GOAA 4DG1A 1RADB 1VQ8T 1HYZA 4FLTA 1P92A 4KHNA 3OS1A 1T3VA 3UKUB 3KLIA 3QNNA 4F8RA 5HWEA 4M7AB 2E1ZA 3O4NA 2BDPA 5GAMh 1BIAA 3Q7CA 4E19A 1TG0A 1VQ6T 3BF3A 2Z1EA 8ATCB 3META 1IHWA 1C0TA 3QESA 3V7CA 1LAWA 5CY4A 4KGXB 1Q18A 3RKXA 2QA4T 2PMPA 4CHZA 1M2OA 3PAFA 2L89A 1KHCA 3RESA 4LY7A 4CGFA 1PSEA 4FO0A 2KAFA 5HXUA 3D2EA 4OMQA 3MXIA 4OGCA 2LC4A 3AO1A 3RR8A 3AO3A 1QQOA 3K57A 4JHDB 1VQON 5HXZA 5GAPK 3E19A 1NPRA 4HWIA 4JKEA 5HY6A 3KTQA 4JI7K 2E88A 2XY8A 4QW2A 3LAMA 4JEPA 5HLFA 2CREA 3D00A 2E4HA 4Z4CA 1ZSZC 3B6PA 2FZGB 4BB7A 5GAOq 1PD1A 3AVLA 2OTLF 2GUIA 4W5QA 3TSZA 5GAOl 1SSHA 3CCJT 4DU4A 1ZBLA 4M75E 3L8BA 4KRTA 3OA6A 1U3OA 3HBTA 5IHKA 3H1QA 3ER0A 1VIFA 4KKOA 1BWFO 2BZ8A 2E65A 5KCHA 1NK4A 1EX4A 2H3EB 4KHWA 3EY1A 2P4TA 1LW2A 3FR0A 1DTQA 3WNFA 4HKEA 1BI1A 1UA1A 1N8RU 2VAWA 1U2VA 5GADP 3ASKA 2G8HA 4O0IA 4B3SK 2KGTA 2YX6A 5GAEP 1OAPA 2R57A 1KFZA 3CCQN 3S9HA 3JXUA 1VSKA 3G71N 1RA4A 4BY9D 5AZJB 2O8DA 2LZ6B 5CVIA 1JKHA 4IJNA 4KB1A 2A3LA 2ZODA 2YRCA 5KTQA 5M1NA 4BT4A 4BT5A 1QP3A 1D09B 3C4SA 4O5VA 2A3ZA 2XY5A 3HRSA 3C9SA 5D6YA 1S1UA 4FK4A 1G3SA 3F9MA 1KTQA 4IIMA 2MK5A 7AT1B 1YTAA 1EKEA 5HBMA 4J9GA 1XQSC 3DB3A 3VA3A 3F0GA 1E6GA 3QIPA 4C5EA 1QSYA 4F2RA 4DSEA 2XG8D 4F3OA 2IOCA 1VQMF 3LYIA 1W2BS 5AQYA 4FK2A 4KWEA 4I9LA 1KD1H 1IZ6A 2KKZA 2A7YA 3CXCM 2L8DA 1JFFB 4M78C 3CCUF 2X4XA 4Z4FA 3WPXA 5LJ3d 2MOXA 3A5ZB 4KT0E 3LDQA 2DL4A 1QHTA 3NF9A 5JS2A 4D8DA 3KIOA 2K7AA 5J3BA 1WSFA 3T69A 2XHBA 3SV4A 1Q9YA 3MWTA 4FZZA 4ZGDB 1QSLA 1M90O 4DTPA 5KMGA 3M0PA 3G10A 2ZZDA 4RW6A 3KKSA 3LLRA 2CYZB 4FJ8A 3JCMb 1T44A 2BUPA 3F0DA 3L2UA 1UTIA 2D5RA 3F9KA 4H5VA 1WSGA 1SL0A 2RHOA 2Z0WA 3DB4A 1VQOA 4DV2K 2CP6A 3AHUA 1DTTA 1SZ2A 4K42A 1VQ7F 1QSSA 1H8KA 3QZ5B 1OPLA 4O4JB 4IEIA 3O9UA 4XH5A 1K8KB 4BRKA 5DM7L 4AT1B 4RHAA 3O3GA 1TUDA 1X01A 1JJ2M 1IREB 3KD5E 2K5FA 5AQSA 1GLEG 2HEQA 2HS0A 4M63C 3QJYA 4AHTA 3AVBA 3IKEA 2FRYA 3KK3A 2NUTB 5JH7B 1WZOA 4NB4A 1VQ8N 5DM7R 3KE1A 3AA5X 3F0EA 4FM2A 2EKOA 1JL1A 5DK5A 3V7EA 4QKUA 1QTMA 4DEYA 1QW1A 4C92B 1YF5L 5LXTA 2QQ9A 5GANK 3X28B 5IT9O 4RWTA 2LNHB 4M77F 1TKDA 3MEGA 1W55A 1FX7A 3CCQA 2P9NA 4M3WA 3TABA 1VQ6N 3C9RA 1RDBA 2FL7A 4DKWA 1LCKA 4MFBA 3TAFA 4C8QE 4RMOA 2HB5A 2RF2A 3O9TA 2O9VA 3P8DA 4HVJA 1JBMA 4M77D 3V1RA 2QA4N 2W40A 1FMWA 4I6MA 3FC3A 4RCHA 4EZ6A 1W2BF 4IDHA 3ZX2A 3JAMM 4LXCA 3VN5A 2VC8A 4FT2A 2YNGA 4KH5A 1D1AA 4BE1A 3VF6A 4C1NI 3L7QA 3WQTA 4IUVA 3I56T 3FLCO 5HOOA 1YJNF 3GE1A 2O9SA 3J8AA 3NH2A 3ERNA 5BRFA 3GHZA 2F1LA 3SMPA 3PIPA 2F9TA 4CIGA 3D54A 2X6NA 1UGPB 4EB6A 3NFCA 2V7ZA 4MZTA 4H4MA 4PJLA 1XUPO 4FVUA 4RW4A 3LMEA 2B8AA 1IG8A 4MLHA 2J6FA 5HY0A 3CCJN 3E1SA 4RW9A 3SWNC 5GANg 1VQPT 3O1WA 3NGZA 4PWTA 2XK0A 3CMEN 2QYZA 3S41A 1I81A 3D2EB 1G8XA 1WFWA 2WUSA 4FM1A 2HSPA 3CXCA 4XU3A 5A0DA 3VJPA 1YJWT 5KQ8A 1K73C 2JGUA 4OPAA 1D8YA 2GBZA 1KSPA 5CB4A 1JCEA 3CCRQ 1I8FA 1Q7YH 1YTUA 2CSQA 1XC3A 3M59A 3DWLA 4B1VA 3VTIC 3VQCA 1OYXA 3DLEA 2E6ZA 2YNHA 3OMCA 3DRPA 3HT3A 3C6TA 2IGIA 4CK2A 2LCCA 1GL5A 3FJPA 2LQ8A 4OMLA 1NM1A 1RAAB 1S72Q 2RHZA 2LQKA 1KLMA 4A59A 4ILHA 4FWPA 1K9MO 4FM0A 4WFBL 1JXOA 5H1SQ 2CGJA 1YFNA 3NVIB 3VPZA 2MPXC 5F1XA 4CFBA 2P9PB 3QSUA 5LL6Z 4CEDA 4CGGA 3DDNA 2Q36A 1VYVA 1XTDA 4WFAL 1JJ2A 3UPUA 2O8DB 4GY5A 1HRHA 1KAXA 3CCVN 2PU9B 4IIJA 4A4GA 4K43A 2QWQA 3S06A 3O3FA 2NRWA 3CETA 2LTOA 4CF9A 3L42A 2CSLA 5CR2A 1RBSA 3QFUA 3EGXA 4PJJA 1HUXA 4H0PA 5BRHA 1KNKA 3SI6A 2QA4A 2H8EA 2EGCA 3EHRA 3BGRA 3C94A 3JCMd 2A36A 3AVJA 3L0QA 4HUEA 4C0DC 3MPUB 1Q81O 3IEWA 4M7AE 1WB9A 3ITHA 2NMUA 1U6ZA 4MDBA 4JPBW 2Z1GA 2X35A 1NJIR 3A5MC 4DQQA 1AZEA 1VHAA 3R0PA 3MO8A 4EMKC 5CA1A 3OYNA 5BPMA 2KVQG 1TKZA 5LP6B 1WPYA 4TV8A 2CGKA 1E7OA 1LJOA 1M90H 4R79A 4O2AB 2CP0A 2YUOA 5AFUA 3HO1A 3MK6A 2EWSA 2AP1A 4BWJA 1UI9A 1IXDA 5KMGB 3PFSA 1VQKT 4AHCA 3G6EF 3ZETA 2RQRA 3Q7BA 2HRYA 1KFDA 1WLJA 1YCSB 2EGAA 5KPTA 4MQ3A 1VQ4T 4DFMA 1NJYA 4BRNA 4QCLA 2WACA 3ENHA 5GAHP 4FJGA 1D0YA 4R40B 1JN1A 1NYFA 4WQ5C 2PHNA 2RK2A 1ABQA 4X64K 2G8IA 2OANA 2WSEE 1N9SA 1BL3A 1TVRA 3CIPA 5B8HA 1BDGA 3IEQA 5C42A 2ZGYA 3CB2A 1JXMA 4M75G 4FJ7A 3CCMQ 2HS4A 2B4JA 3NVMA 3VO8A 3NFAA 3OJUA 2GQIA 2YJEA 3EYZA 4ZHWA 1OPKA 1VQ9A 2DTIA 2E4LA 4FSVA 3E66A 3I56N 3LWIA 2UUBK 1BISA 4XTVA 3L3UA 2V51B 5LXTB 5GJWB 1IGQA 3O9RA 5GMKl 5AQLA 5GAOn 1D1CA 4DQSA 2XDBA 1QWFA 2P9NB 2UYNB 3X20B 2RK1A 4J9CA 2XY6A 4PJOF 5GAOr 4LDVA 3K9KA 3HPGA 5AZIA 4LFAK 4K11A 4FJ9A 4J7IA 4IOXA 4CJ4A 2NWMA 1VQPN 3R6NA 2KNBB 2ZE2A 3U3GA 4FWLA 2JMAA 4Z8AA 3MXJA 4PJOD 3V4IA 2HP3A 5GONA 4ME7A 2BTTA 1YJWN 5ADXA 2RH2A 3CJ7A 4AFZC 5FLXO 4A2BA 4B1XB 2IQQA 1ASVA 3NMZC 1VQVA 4R0KA 1I94K 2E3IA 2O4XA 2FLOA 4PKHA 4CGIA 4C8GA 3I0SA 5GIOA 3A2FA 4E7LA 4CW7B 3M1FA 2Z1HA 1PWTA 1VQNT 1M90C 2JM9A 4FWSA 2JZ2A 4DBQA 1RNHA 3F70A 1WSJA 3NGIA 1Z26A 3S3OA 3FBAA 3RNJA 1OI1A 3SD4A 4BY6B 2IG0A 3H0IA 5CQYA 1VQLA 4FWMA 4G1QA 3KJVA 4OX9K 4YJ2B 4II1A 5EWRA 5GINC 4FZYA 5CB4B 4DV4K 3VQAA 3EZ5A 1ZLMA 3AO5A 5EG2A 1YIJQ 3DI6A 1K0XA 2LT4A 1VSFA 3I33A 3MN6A 1ZYQA 2K5IA 2J7IA 3M8QA 2X3XD 2QEXA 2HRUA 2PFUA 2LBXA 4OB0B 1HYSA 3LGFA 4BT2A 3G4SF 3VQEA 4YJ3A 3K5MA 4TSXA 2JXBA 2YNFA 2JMCA 3ME9A 4QQDA 1OH6A 1ONIA 2RB9A 4DQ8A 1UEBA 3EZWA 3JCMQ 1KD1R 3HVRA 3TTDA 1OEBA 3KZBA 5EXWA 1K9MH 3NK7A 2NRRA 4M75A 3INZA 4E7SA 1W9HA 2QAZA 3CCLQ 4KHSA 4FSSA 3OYBA 4KV8A 1B3QA 4IIOA 3QKJA 3SB2A 3CC7A 2IAJA 4QS7A 4MZMA 4C92E 3SYZA 3F6MA 1UJYA 3QWXX 4DTXA 3NAEA 3V9ZA 5FROA 4C8NA 2LQNA 4BRAA 4OMPA 4KUDK 4N4IA 4JS5A 1OZ3A 1KSWA 2L5QA 3CQTA 3ZYYX 1SF9A 4BR2A 3HM9A 1G3WA 3EGXB 4K25A 4J9EA 1VQ9Q 1HNVA 2GTDA 4A57A 3ZFJA 1VQKN 1XV2A 1YHQT 2F5TX 3J80O 2SRCA 3EH2A 3V3TA 2E20A 1VQPA 2CZ1B 4OB3B 4BI4A 5J26A 4ATOA 2OCEA 3DMJA 3SPYA 2RM4A 1VQ4N 3CG6A 1Q81H 1RLQC 1M1KU 3SFMA 3MCAB 4IUPA 1L3UA 4AF1A 1M1FA 3BEXA 4PNOA 3LDPA 2MWPA 1YJWA 2YHXA 2LCLA 4DS4A 3L2ZA 4B9LA 1QS4A 5L8RE 4X65K 3DLLL 4E3SA 5CA1B 5C0YA 4C8KA 2XDDA 4TV8B 2E10A 2ZWHA 3VQ8A 2W10A 4FCYA 2F69A 4CC2A 2JTFA 1C6VX 2VXEA 4NXNK 1W40A 4Z89A 2GX9A 3ZETB 4AM6A 5J2QA 5GJVB 3FZLA 3O1BA 3RRGA 1AEYA 5KX5A 5KYUA 2NUPA 1K8AU 1H48A 3ELCA 4H03B 2RI5A 5CZ1A 4YOWA 1WJQA 2AZSA 3EG0A 3M84A 2ZAUA 3PLAA 4GV3A 2GFAA 1BB9A 3CFOA 4J2EA 3CC4F 3CPWS 4OPKA 1BG3A 4DV3K 1T6CA 2DXCA 2E5LK 4LNUA 3RA5A 5I9EB 5HRRA 3J80E 2HAXA 4CC3A 1Q82O 1T0AA 1MU2A 1QZ6A 1K76A 1K9MC 1PHTA 2OTLQ 5CIUA 3VS1A 1QMCA 4JDSA 1HJRA 1TUCA 3EG2A 1YITA 3EKSA 4I2PA 3VERA 4CBWA 2CUBA 3P83D 3AO4A 2QEXQ 5GMKi 2YJFA 2VWBA 3O9QA 3THKA 3M54A 3URGA 3OYAA 1RTIA 1KHIA 2EHGA 1HXDA 2WC9A 3EEQA 1AHJB 3I35A 3R9PA 3KK1A 1T05A 4W5NA 1OX8A 3TSQA 1SKSA 2HHHK 2P6YA 1UGSB 5GAMd 2ZVZA 1O75A 2D0NA 4BWMA 4C8LA 2O2OA 1LAVA 1TKXA 5AZIB 1PRMC 3HI0A 4YFUA 1VQNN 4M7DA 4WBNA 2RQVA 1M2VA 4J2DA 3JCMX 4I50A 1T6DA 4ZGEB 1Q7YR 1QVFM 2PQWA 4C8QA 3DXMA 4RW8A 1QCNA 2COWA 1MMDA 2DD4A 5GONB 3CC2F 1TVKA 3LPUA 2COYA 5GANh 3OW2S 3LP3A 3SAHA 1U04A 1NJWA 1VQ5N 3CCSF 4Z4EA 4M7AG 3CJBA 4NLBA 3I8DA 2YCHA 3C6AA 3ZX0A 1VQ4A 1YWPA 2O4XB 3IMXA 3TTCA 3X25B 2K2VA 1VQMQ 4BGAA 4N56A 3MCPA 2RO0A 4QS9A 3EL2A 5A2QM 3V4DA 1JLCA 1RBUA 1TL1A 2E6MA 1BI0A 3QO3A 4CZEA 4DQIA 1R0BG 2L3RA 3D0PA 1CLIA 3ZSOA 2OZBA 3IS9A 5BR8K 3C95A 2WALA 3DLMA 3AA4A 4DOWA 2KBTA 3FFKB 2FPEA 2O8BA 4DQ2A 1UGQB 4BRHA 2OI3A 1TKTA 3SUNA 1YQNA 5I42A 1FW6A 3PGGA 3SBGA 3JCMc 1GCQA 3CXCP 4J9HA 3A5LC 2GFUA 5J2TA 3REBB 2DILA 4YJ3B 2VCPA 3HAXD 3PO5A 1YJ9A 3M58A 1JLBA 3I55F 4OGEA 4JJCA 1VQ7Q 2P9KA 3E01A 4LDYA 1J6ZA 3KK7A 1DKGD 4RW7A 2HL3A 2BO1A 3BZCA 2LVMA 3HSTB 1Q7YU 4BVPA 1UECA 1GBQA 3MMVA 2E12A 1SG5A 2EYXA 1GXIE 3MX5A 3D7EO 4L3QA 4IO9L 1Z5WA 3A8OB 3ZEUA 3CCEN 2VAPA 4OJRA 1N33K 2Z1TA 4V2SA 2R5AA 5AQZA 1PXWA 2P0PA 4OMFB 2CT3A 2RJFA 3Q1JA 4R56A 3SPZA 3OW2F 3SQ2A 5CYMA 3E9OA 4JKDA 1E6HA 4H8KA 1V76A 2NYSA 1VQNA 1JJ2P 3QYHB 3IDHA 4IG3A 1YXQA 4PKIA 1VQOF 2J6KA 1NKCA 4J6WA 3UATA 5MN5A 1E4FT 1X2KA 2YKMA 2DETA 4EHTA 4PJNA 4X3MA 4E7IA 3ALYA 1EO1A 1E3MA 2RHJA 3WJRA 1G99A 4JI4K 1HNWK 3TCJA 1YJNQ 1QVFA 1XNIA 3V8JA 3VUBA 3E9PA 4CFDA 2L0AA 4R55A 1I1JA 2JVVA 4W5OA 3NK6A 1OQKA 3V8KA 3B6NA 3HPHA 1WHMA 2LCAA 5CA0A 1NE8A 3NGPA 5FDLA 4ZHRA 2OTJN 1RLUA 1MNEA 1IJJA 1YBYA 4BREA 1SA0A 4RTWA 2O31A 2YHTA 4ISFA 1EZZB 5CKBA 5FJ4C 5KX5B 2SEMA 5KYUB 2NUPB 4DMNA 3CI5A 3QUWA 3RMSA 4JK8A 4DTSA 3M9QA 3MCQA 3FEOA 4PKGA 3G71F 2B6AA 4YY3K 2ZJQL 4B9NA 2LX7A 2BTFA 4JHDA 4WTOB 2EBPA 4AHRA 4J5YA 3TAMA 1N9RA 3LWVC 3VS3A 3CCRT 3JAMO 4LNUB 1LNXA 3M56A 1Q82H 3V8LA 4CEBA 1RAHB 2RJEA 3AA3A 2CZ7B 4G88A 2K9GA 4E7ZA 3GF5A 1EXQA 3PX4A 4EMGA 2DRKA 3RERA 1Q86U 1W1FA 2M02A 3TAEA 1DGKN 1S72T 3FGUA 1TL3A 4FT4A 4RG8A 3VGLA 3B6OA 4JI8K 4C81A 1YHQA 3QEPA 1JL2A 1PM3A 3BFMA 1IGUA 4C92G 3HVTA 2CHSA 4B9XA 3OONA 2HBLA 2V8KA 2DXBA 2ITMA 4G4WA 4M42A 3M3ZA 2HHUA 3I9QA 1LCUA 3VYTC 1TS9A 3PIOL 4E7KA 1YJ9Q 1GO1A 5M9OA 3CBMA 4HVWA 4F14A 1KJWA 2XHCA 4FW1A 5FPDA 5SZTA 3ZOPA 2VG5A 4Z88A 2KK4A 5I11A 1KQSS 3AGRA 3HFOA 2K79A 2QQRA 3P38A 4X62K 3WNHA 5IYZA 4WBNB 5LJ5g 4M7DB 4FL6A 5D3GA 3E1YA 2KTVA 1A5XA 5LJWA 4DOVA 3SBTA 4I50B 2OJ2A 1VSMA 3FIFA 4C8QB 3DXMB 3LW5E 1V4TA 4YOTA 2E2NA 4CZIA 2CKKA 5LA6A 4BVSA 1TVKB 3SV3A 1TTHB 2FZCB 4H5NA 4WF9L 1BCMA 3PSFA 3HOTA 3LDSA 3SUOA 4FJLA 2FC3A 6AT1B 4EPCA 1KVAA 3VV0A 2HX0A 4BT6A 1X3MA 2JWLA 2Z1JA 2FEIA 5IJ0A 4LUDA 3JAME 2HBWA 4LH4A 3SQ4A 4AM7A 2DTHA 3VS7A 4MMKA 4CJSA 1GOCA 2CP2A 2BANA 3QNOA 2HW3A 1M1KO 3ZCMA 2E70A 4FLYA 5IXBA 1ITGA 3QERA 2LJ0A 4F7UA 2O4IA 1VQ8F 3JCMW 1H641 4BR4A 3L2QA 1LPLA 3MN5A 3EG9A 4DCHA 1N5YA 4FJJA 2O8BB 3G6EQ 1F21A 3OJSA 4Y1CA 4DU3A 4B3OA 1HNZK 2XKOC 2P5OA 2HKQB 2CHTA 1VQ6F 3CMAQ 2AHJB 4ZHVA 1U43A 4DS5A 5J2TB 2EWCA 3NDKA 1ESVA 1KXPA 2QA4F 4M78D 1Q81R 2GTOA 1RBVA 4CEFA 1CK2A 1U49A 1K8AO 2P0QA 1X25A 2MAMA 3P8HA 4OVAA 1Q82C 2DFEA 2XO7A 2P9KB 1NOYA 1N34K 2DFUA 2JS2A 1K8KA 1I39A 3FZFA 3GPLA 3CCMT 2P5GA 4LNPA 3DAWA 5JMVA 1X1PA 3ULDA 2HQHA 1MNDA 1KQSF 3DRSA 5IHNA 4C0ZA 2DL7A 1M3CA 3E9FA 4C5GA 4CVNE 3LWLA 3UT5B 2HQXA 3VQQA 2PVOB 1HKBA 3ZEUB 4C92A 3J7ZO 3CCJF 2F96A 3GL1A 4O4GA 3P5JA 4FWQA 4M3UA 3LDLA 4CGDA 1IPAA 3CMEF 1NWKA 4DBRA 2X4WA 3LGLA 4B1UB 3P8BB 2DKGA 1VSEA 1FMVA 3VS4A 1PKSA 3K0SA 4WCIA 2OPQA 4B62A 5FPMA 4X34A 1B07A 3WXIA 1DBFA 4CJLA 4A2AA 4DLEA 1CLQA 1ZUYA 3HKCA 1CZBA 4HUGA 3KD1E 4B6MA 3CPWM 2LDMA 5JLFA 4B9SA 1AWJA 3PO4A 2ALEA 1WAFA 3NPFA 5AQRA 3DLGA 2NRTA 2YYEA 3S0WA 3AT1B 1IHVA 1OFUA 5BREA 1NGIA 1VAZA 1NKBA 4XK8E 5CA0B 2N48A 4JJNK 2V9YA 4H0TB 1B9DA 5A0GA 1W5EA 2FO0A 1WNLA 4QVDA 1ATSA 3SQ1A 5FPEA 5LL6S 1OH7A 2AJQA 1SA0B 1BIBA 4N76A 4XAXB 3KUFA 3M0TA 1Z6RA 2F8TA 3N4ZA 2I7NA 1OOTA 3BW1A 4WF2A 1KLNA 3CCVF 2EQMA 3MP1A 3VKIA 4GV6A 4C82A 4O55A 5ECAA 1BO5O 2D0CA 5LJ3j 3M8RA 3HKEA 2V1QA 4IFEA 1YIJT 3I8BA 4EI8A 2DAQA 4ID5A 3VEXA 1QD9A 5AFUH 2RHKA 1W5AA 4UY8O 3M0RA 3OW2M 5EOYA 3DLKA 4CESA 3AVHA 4OMMA 4XTWA 3G4SQ 1AVZC 1KFSA 3PSIA 2QWPA 1N32K 3QTYA 2DJZA 4BY6C 2ASOA 4AMCA 3P31A 1E4GT 1RQ7A 1WSEA 2ITGA 2FBYA 3KFVA 4E1NA 3MP6A 3OYKA 3THWA 2DX1A 2IIRA 2P9PA 1YP5A 1HK9A 4I2QA 2Y1IA 2DE0X 1RTJA 4FLXA 4H0XB 1NM7A 2D0PA 5IYZB 3QHDA 1I0CA 2RQUA 1ABOA 1TYQA 5HRPA 4GMJB 5SWMA 2JTEA 1W5BA 2KROA 2RI2A 5CK9A 2JNBA 4G4ZA 5LA6B 1I5OB 1VRTA 2KHOA 2XI9A 4F6RB 2W0ZA 1VQ9T 3WGLA 5G4UC 1OU8A 3NCIA 1IBMK 4EI7A 4RKUE 1YWOA 2DA9A 4CF1A 2KZMA 2WONA 1OV3A 5IJ0B 5EX5A 4N0AA 3J81M 1MHNA 3QXEB 4B9VA 1REVA 2JM8A 3ZBDA 5ELZA 4L6V5 5CKFA 5GMKh 1QLYA 5HY1A 1NGAA 2KY9A 5LP6A 5CQXA 3TVTA 3CCRA 1NBEB 3OS0A 1JLFA 3CHWA 3TI0A 4O2AA 3ZT1A 4CI0C 4F7UB 2F9WA 1RI9A 4GW6A 2DZ9A 2EX3A 5AQHA 2GWKA 3I56F 4M4ZA 3T1HK 1BI4A 3M5AA 3EG9B 4LF4K 3ZO8A 4A4KA 1JD1A 2Q3SA 1S72A 5MLCQ 3C9TA 3SMSA 1K73H 5LJ5e 1RLPC 2FB7A 2MIOA 2QI2A 3C6HA 5AQVA 5AQUA 2IVPA 4NL3A 2CUDA 4P5NA 4Z0UA 2QTXA 2Y4YA 5AT1B 2IVNA 4J8FA 1U48A 2IG8A 1MWKA 2Q0UA 2JS0A 1KC8O 1PC0A 3HOSA 4OP0A 2QKKA 1I4K1 3CC4Q 1B34A 4FIBA 3ZEHA 5LJ5f 1K9AA 1S22A 1GZ0A 1VQLT 4B9WA 3ZSVA 2M1HA 5K14A 4CD3A 2KZZA 2OTLT 1T0JA 4QVCA 4AFSC 1UOCA 2EGEA 2VYPA 3NMUC 4CZGA 5JICA 2C06A 2LJ3A 3O08A 4CJVA 4YOXA 4DUZK 1IV3A 2CVLA 4LD6A 2GGRA 2QEXT 1H3HA 4Y1DA 3AVCA 4JKAA 3ON1A 4DTJA 3LWPC 1WHKA 1Q86O 3ZSRA 4FLUA 1YT3A 3JB9G 3WEEB 4BE2A 4M7DE 2UYNA 2AA4A 1R59O 3O9SA 1QVGM 3KHNA 1NGGA 1XI1A 4D8KA 3QHSA 2DT4A 5G4VC 1OULA 3PVLA 4BC3A 1X6GA 4H0VB 4XCQA 4JKBA 4DB3A 5DLOA 4CJFA 4BRIA 2ZQBA 2K3XA 5CCAA 1BKBA 1Y7XA 3CC7T 1WNSA 2KQWA 5JVGL 3MXMA 1IV1A 3HKCB 5JCOC 1GLFO 4FWOA 3CC2Q 1GLDG 2RHHA 1H7MA 1NMNA 1Z5VA 2KRSA 1UDLA 3VETA 5F0XA 3CCSQ 4E2FB 3P0ZA 3NBPA 3JB9J 1YIJN 4XH1A 1M9SA 3JRZA 1VOMA 4CGHA 4IOCL 1ACMB 4DR6K 1M1KC 1QAHA 3JCMM 2PAVA 3ZSZA 1SEMA 4LD0A 1NK5A 1X7PA 1XNQK 3N2GB 3O85A 3H3OB 2ROLA 5FU6B 2LBWA 3KLEA 5T7BA 4ANJA 1QVFP 3LWHA 3TAPA 2EQKA 2IS3A 1XHOA 1NK7A 2DTUA 2HF4A 5TKYA 2EW3A 2JUFA 3CQ8A 1ZX6A 3CCMA 3WGNA 5FRMA 4ESRA 1SAZA 4B1ZA 2CH6A 3C6UA 4JI0K 1UA0A 4YJ2A 2HMAA 2BZXA 1H92A 1ZBSA 3AVGA 3HKEB 2ENMA 1SPKA 1C0FA 5GIOC 1CKAA 2OZSA 2KGWA 4H4OA 2P4RA 2QQBA 4HVVA 1K8AC 4QAGA 2GZLA 3QDFA 1SKRA 2DPPB 1D5AA 1NEGA 1HX1A 1COMA 1VQKF 3K9JA 4AILC 3VUZA 4WE1A 4E89A 1VQ4F 1VQ7T 3FD6A 5LJ5h 1VK0A 3I55Q 3GBTA 1VQ9N 5KYWB 2ZF8A 3LPTA 1XHXA 5GANd 2B5JA 3RIRA 4C8OA 1C6VA 3IUCA 3THWB 5I3UA 4CFCA 3H9NA 5AQQA 3CM5A 1C1BA 3M0UA 3TEEA 3UT1A 2NRHA 3O3HA 4NQ3A 3SUPA 2F9ZC 4IFVA 2EIFA 2PVDB 2RE2A 2FXUA 3F73A 1TYQB 2DL8A 1Y97A 4ID1A 4BR5A 3MJXA 2RPIA 4EAHD 2FF3B 2K5LA 4M75C 5GAN6 2NLXA 4AHVA 4X20A 4EIAA 1YITT 1UGVA 3JCMg 4C4WC 3D45A 2UUCK 3AVMA 4KBMB 3OBYA 4J83A 2ASPA 1R77A 1WXUA 1QVGA 5EYPA 1OH8A 4BC4A 4C8MA 4U3JA 1YCYA 4X9CA 5CE3A 2NRXA 2E1YA 3AVAA 2IPOB 5AVMA 1BQMA 3VQ7A 1WJSA 2CP7A 1YJNT 4BC5A 1UGRB 1YIJA 2ZPIB 3B8AX 5DM6L 1YGYA 3SLCA 3OS2A 2CT4A 2VKNA 1VIEA 2KYBA 3GG4A 4IEEA 1KRPA 3QG1A 2GTJA 4KGVB 3WJPA 4L59A 1BI4B 1QZ5A 4YDUA 4ILJA 3JVHA 5A2QE 1N5ZA 1VQLN 4BT7A 1HQUA 2IIMA 1NLVA 4O0JA 4NCBA 2DK3A 3C7NA 4FJNA 2FF6A 3OMGA 1HLUA 3BZKA 4Y28E 3G71Q 3CCLA 3OSVA 1YVUA 2E2OA 1FKPA 4FLVA 2QEXN 2YLBA 1IV4A 5HP7A 1VQNF 3WXJA 4KFBA 3TAQA 4RTXA 1KC8H 4NS5A 2FGYA 2UZHA 3P10A 2HL5C 1NBWA 2ASMA 3PX6A 3M4YA 1QWEA 4CFAA 3RWUA 3HK2A 4CIFA 1HJOA 3VOVA 1B34B 1VQ5F 4E6EA 1T7PA 1YI2Q 3LP0A 4PFOA 4CZHA 5EZYB 4EFHA 4DTRA 5LJ3e 1VSHA 3J7AP 2K1SA 4LE9A 5I22A 1NGFA 3QO9A 4M7AF 3TSPA 3JYTA 3CC7N 2DY4A 3LWOC 3CD6F 2PBDA 3WJQA 3S3NA 3U9DA 1ARKA 2LBTA 2RHXA 4Q5WA 3IKMA 3SJJA 1SL2A 3PLAC 3T7ZA 3A98A 3OHRA 1PRLC 1L3VA 1WHGA 1VSLA 1KQ2A 2E5KA 3THXB 5LJ3f 1YJ9T 4FL9A 3MX2A 4BQZA 1SHGA 2F5KA 1NJIU 1WGSA 3MN7A 1HR0K 2JWKA 4CJRA 5AQIA 2YV0X 1N8RO 1SV5A 2OTMA 4XU0A 2QDYB 4A61A 1SRMA 3QEVA 2X6SA 5FRNA 1KG1A 3U8XA 1WJRA 2ZPFB 1JCFA 1HPZA 3UE5A 2ZM6K 3CM6A 2E2QA 3U23A 2H3GX 1XMOK 3AV9A 1ODEA 3LALA 5AR0A 4CIEA 4XTUA 4NL2A 3GBQA 3HL8A 2ZF5O 1W42A 4KH6A 3KKRA 1ZA1B 4LF8K 2HHVA 5E26A 4A53A 4OLAA 3OA9A 3H1VX 4QQ6A 4M7DC 1BBZA 5GIPA 4G4XA 4F7UE 5LYJA 2VG6A 5HKCA 1WAJA 4C8QC 4M3XA 3U3YA 3HFNA 5I2MA 1RCHA 3MDQA 2LJ1A 4FJMA 3HSBA 1MUZA 3WGMA 2H8HA 4IURA 4NUTA 4XTYA 4HTLA 1VQ8Q 4M7YA 2R751 1JY8A 4WCEL 3CCEF 2OTLA 3GTZA 1VYTA 3G6ET 3WXLA 3QINA 4MO4A 3TTFA 2E2PA 3CJAA 4B3RK 2OAUA 3TD4A 3A8YA 3DOKA 3KLGA 3CMAT 1IO2A 1X2QA 4W5RA 1VQ6Q 3AVNA 1KC8C 2AMTA 2BZYA 1DEJA 4IUQA 1CKBA 2HMPA 3QFPA 1MMAA 2EKHA 4IXCA 1N27A 4BC2A 1FNJA 1SDSA 2E3HA 1W70A 5FWCA 1NKEA 3S02A 3VF2A 2FG0A 2CZ6B 2HQEA 1WQWA 1T0KB 2G8KA 1YITN 1W2BM 4GV9A 1V29B 3HWUA 1QE1A 4PA1A 2RQWA 4XU2A 5C0MA 2P9IA 3FE1A 1HKGA 4BDPA 4ZI7A 3OB9A 2E6NA 4DXDA 3TPQA 4N41A 1GCQC 1Q86C 3K2PA 4QOZB 1W581 3RUXA 2W6LA 5KRTA 4LFCK 4ERHA 2OTJF 2J05A 3N5BB 4M7DG 1XWLA 1QQNA 1GO0A 4NOYA 2EYQA 3V9XA 3HRUA 1K73R 4C8QG 4BDYA 2YRDA 1BK2A 3DLLA 3CCJQ 2HNIA 3CQXA 5GAN8 1VQMA 2RN8A 4C23A 2UXBK 4BVQA 3I7TA 1U47A 4OB1B 4JJDA 4X20B 3CMEQ 4U67L 3JATB 1HPMA 5CZ2A 1XMQK 1EETA 5BRDA 4PFPA 3CCUA 1G15A 1HNIA 1HQEA 2VXFA 1NYGA 2GQVA 2X4YA 1T3LA 1LWEA 2QM1A 1K0SA 5EYPB 2M0YA 3VEOA 4U3JB 5GAMj 4BI8B 3UA7A 1S9EA 2FHDA 4M3RA 2HHQA 3BY7A 4PJMA 2YRVA 2NUZA 1BOTO 3M4SA 1SQKA 1X9WA 1Q8RA 2D9TA 4M78B 3WGKA 3L1AA 4CZLA 3CFRA 2K3YA 2X51A 4JLHA 3JAWA 3KK2A 3LYBA 4YHHK 4JRQA 2QGFB 3QUIA 4C92F 1L3TA 4DSKA 1UHCA 5IJ9A 5KYNA 4NCGA 2Q1YA 4I55A 1IB8A 1VQ7A 1KD1U 3C7NB 1OH5A 2KG4A 1NZ9A 1NGCA 2CGLA 4I4TB 3CPWP 1WUAA 1U3LA 2D8HA 1GLBG 3K5LA 2OPPA 4IFYA 4DR5K 4TV9A 1GRIA 4M7AC 3F5TA 2DNUA 4ELZC 1N6QA 3V7QA 1GOBA 3CCVQ 3CF5L 4JAXA 2E6LA 4DBHA 3JCMe 1WXTA 2K4YA 1LOJA 1WHLA 3OYIA 4OKEA 1YJ9N 3NTIA 4DV6K 3ZX3A 4ZTJA 1UHFA 2K2MA 3VQ4A 1BIZA 2YXYA 2MCNA 2VQFK 3HKDA 1K73U 1RQ2A 5ITZA 4J6XA 2IDOA 3G4ST 3LWQC 5IT9M 4M77A 3MEWA 1CXQA 5KRSA 1UB4A 4Q0BA 3JCMf 1W0HA 2HHTA 2EVRA 4FWNA 1NJZA 3ZT4A 4KTQA 3S03A 1FWZA 1WHJA 3WUHA 4U39A 3VA0A 3O80A 3FZMA 3FJ5A 5KPRA 3V9SA 3T3FA 3C9UA 3FRNA 4A4FA 3PTAA 2HZYA 2KQ2A 1W2BA 1Y96A 4OKJA 4IWVA 2PNIA 1R0CB 2VQEK 1ASWA 4M7XA 1L5UA 2UXCK 3RBBB 2X74A 4XIUA 1N8RH 1J7HA 1IRXA 2BIVA 3OW2P 1YJNA 1S6PA 1RAFB 1BI3A 1U5SA 3OYEA 2Z1IA 2KTQA 4ORZA 4JZ4A 4LF9K 4DV7K 2ZOVA 3PT9A 3KLFA 4GKJK 4HVUA 4CRIA 4GLMA 3JSMA 2IVOA 2GVIA 4ELYC 4JLGA 1NOZA 4TZZA 2RPNA 3HP6A 5LOVA 4LUEA 2VUBA 1VA7A 2PUKB 3NF6A 3CMAN 4DR3K 4FPAA 3WNEA 2A40A 3IAYA 4QT7A 3OYDA 1UE9A 1NGDA 5LYJB 4DSLA 4NWOB 3JARA 3NF8A 3NH0A 3NTHA 3VESA 1IKXA 4MMLA 3CCUQ 3FDRA 5M1OA 1DLOA 5J2PA 1CSKA 2LNVA 1NQ3A 3ZL7C 1PD0A 3LM2A 4BROA 1M8VA 2YDLA 2JN0A 4M3TA 3EG1A 1SUQA 4IKFA 3THVA 3I56Q 1RBRA 1RDCA 3KHYA 5EIBD 4RG2A 2NNWA 4O5FA 4EI9A 1RAGB 5GINA 2C0OA 4IJAA 3K14A 4B9UA 4G4YA 2A1SA 3FFIA 4NYNA 1QQCA 5M1QA 4IUTA 3LANA 3VS2A 5KE2A 4CECA 3CC4T 2OX7A 3LDTA 4MZPA 1AWOA 1YHQN 3RSEA 2KW4A 2P9IB 3ZT3A 2I5JA 4ZI7B 5J1EA 4U7BA 1M90R 4C0FA 2RMOA 1LOTB 3K59A 3UT5A 1MGQA 1C1CA 3ENBA 5L23A 2D8JA 2GEMA 2BTOA 4A54A 4TUYA 5DCVA 4Z4HA 3JASB 5D6XA 2I6RA 2E8AA 4LF7K 2EQIA 3LL3A 3O4QA 4IO8A 3QMLA 5KQDA 3FPIA 3EFOA 4C8EA 1N8RC 1JXBA 3K2XA 4PLLA 4O44A 3VQBA 3EORA 2F7TA 4VUBA 3QIOA 4DR2K 1YAGA 4B8AB 3BDLA 1KC8R 3U0OA 3A5OC 3M4GA 1AT1B 2ZAEA 1FK9A 1G3YA 2RB6A 3OYHA 4LDXA 1BQNA 1NJIO 1IG9A 1RDDA 4C92C 3CC2T 4J7FA 3ZSXA 1XC9A 4BD3A 3QBXA 3W0LA 2V26A 3G6EA 4DTMA 4K41A 3CCST 4BE0A 1KVCA 2NRVA 2V7YA 5IWAK 4F7UG 2E5QA 3CMAA 1QVGP 5AQJA 4DQRA 2DL3A 4CCHA 5HROA 3DC2A 1KQ1A 3JAWB 3J81E 3RTVA 1BA0A 1HKCA 5HK3A 5IJ9B 3L4IA 4GBQA 2Q31A 4B1WB 4I55B 4KO0A 3CCQF 2QQSA 2DD5A 1RFQA 3RRHA 4H0YB 1QCFA 2HHSA 4TV9B 2DEUA 3LWRC 1U06A 5I2SA 1IV2A 2UYPA 4E47A 1M90U 2ZGZA 3OY9A 2G3RA 5B8FA 3LDNA 3NTKA 2LX9A 3PIOA 3JCMP 3VI6A 4B45A 4BRGA 5FU6C 4Z02A 3MECA 5DMRA 1ZXOA 3HKDB 5ITZB 4KAZA 1VQKQ 3NVKA 3G0ZA 1RUWA 2PTKA 1DT9A 1Q8IA 3S3MA 4M77B 1ZC6A 5JVDB 1S9GA 3KIZA 2DJQA 1NU0A 4CERA 2CZWA 3I55T 2VB6A 3ZSWA 4CBXA 1EFNA 3PV8A 4CHNA 2D0QB 1D9FA 4PJOA 3RYHA 3JB9I 2A42A 3HM8A 3SHWA 1JXEA 1RDWX 3QBWA 1NEBA 3HPOA 1Y96B 3CG7A 5D6WA 3KJKA 3CXCF 1AWWA 4CZFA 4MDXA 1U1TA 4FM4B 2VXYA 1WIEA 3GLXA 1TUYA 2KFZA 3Q8HA 2HBPA 4D6WA 2XD0A 2D4WA 1X75C 4FVMA 5FWBA 3TANA 4IOAL 1VSDA 4O2BA 3MAQA 1MMGA 4KI4A 2R6R1 2D6FA 1S3XA 2P9SA 4F6RA 3I5RA 5GAOp 2HNZA 4FJHA 1FSZA 1NLOC 3WXKA 4ISEA 4O5BA 3IQLA 3VQDA 4DV1K 2XY7A 3EFSA 4OPJA 5EIBC 5LOVB 1PSFA 3ZP7A 1K9MR 3SDZA 2M9UA 3E2UA 4RCCA 3QDRB 1EP4A 4AHSA 1MV3A 3QEWA 4M78E 4XEIA 3OYCA 1UFYA 4X9DA 3JARB 5C15A 2GV9A 4LDUA 1U8RA 3IRXA 4BVTA 3QJ6A 4H0OA 2CH5A 3WPWA 4RTVA 4DEXA 2QWNA 4F04B 5GAMe 4BR0A 4DUYK 3CYQA 2KMTA 3EH1A 1JJ2F 1R1MA 5KCOA 4B3TK 2LT1A 2BUDA 3QWYA 3G4SA 4RUGA 4DTNA 4X66K 4N0AC 1J5EK 1TOVA 3HP9A 4HCCA 2F2VA 2WSCE 3JB9F 1WDXA 3WT0A 3OVNA 2EJGA 5AJ3K 3U6FA 3HTNA 1ZBXA 1BIUA 5GAMf 2K6DA 4R5PA 4DBFA 5LP6C 1TWBA 3CPEA 1R0AA 3BDUA 1KD1O 2UYJA 1C0UA 3JB9D 1M4ZA 4G4VA 1YUWA 3E20B 1Y64A 4GVMA 3DLRA 3VCZA 2MMPA 3SIUA 3RSEB 3F2KA 4BRCA 3PX0A 2CGHA 1YI2T 5AQTA 1G5VA 1RT4A 4FJKA 1VQ5Q 5GAN5 2H6LA 3SNNA 1YIJF 3VQ5A 1VRUA 3ID6A 3CD6Q 3QEXA 2YNIA 3D2FB 1NK8A 3G1JA 1AD5A 3GYQA 1JO8A 1N36K 2V1RA 3I3FA 2AT1B 1ZSGA 1NK0A 3RYFB 4KH1B 2YI1A 1K9MU 3WEEA 4JD2A 1FYNA 2DXUA 3EFOB 4C8IA 4DV5K 3VOBA 4ZHQA 1W59A 1EQYA 1TGOA 3J7YP 3MEUA 2EJ9A 2CSIA 2P0KA 4E7JA 1ATRA 5C2DA 2L26A 4F17A 1W5FA 3ATUA 3CPQA 2DYBA 4FSXA 2Q2RA 2KT1A 3IMPA 1T3SA 3THYA 1X9MA 1Z05A 1TUBA 1CN7A 4CJEA 4KHPK 1HNXK 3CCRN 4HNAA 4BUGA 3H45C 2KE9A 3JB9H 1CXUA 1S1TA 4WQ4A 4CE9A 2B33A 3E22A 2VAMA 3N2GA 1VQ9F 4YOUA 4FW2A 3EAEA 1SHFA 1Q81U 4Y91A 5KGWA 4DV0K 4NCAA 4O4IA 2I0NA 2DXTA 3P4IA 3VEZA 2DL5A 1S72N 2XRIA 3CC4A 1JU5C 4B1YB 3I55N 1IH7A 1TAQA 2VASA 1S1WA 1JRIA 1OX9A 1J5OA 1W4SA 4EMHA 4N5SA 2FBXA 2G8WA 2NRZA 4ICLA 3CCEQ 2HBMA 2W6KA 3R3LA 4DLGA 4BT3A 1RGIA 3QBYA 2W42A 3RKWA 5EC7A 4JI1K 2QASA 4F9OA 3REAB 1JLQA 2GBQA 4M3YA 3EKUA 4Z4IA 1M1GA 1J53A 4XH4A 5KYWA 1TK5A 4ZGJB 1BCOA 1C1AA 2DIGA 1X43A 1S5JA 2L3SA 1XQHA 4PJOB 2AIFA 4RTYA 3CCLT 2QTDA 3K5NA 3RYHB 3RMDA 2D0BA 4M8IA 1KAZA 1W6XA 3VQPA 4BG9A 4BRQA 5JLHA 2OA8A 3UDCA 3TWHA 2QDLA 2XMFA 3CC2A 3AVIA 3M6GA 4EDUA 3UKRB 2X78A 1PCXA 2FC0A 2HP0A 1RLGA 1U45A 1Q7YO 3C8LA 3HRTA 3CCSA 2OTJQ 3RR7A 1VQLF 1FJGK 3A8HB 4MDWA 1RDUA 2VWKA 5HRNA 3JCMV 3AGKA 1GFDA 4O2BB 1PF5A 4CJPA 2H8CA 1RT5A 2P9SB 3FZHA 2V8JA 1W2BP 1SKUB 3CMET 1MDUB 2BE7D 1O13A 2ED1A 1RTDA 1NJIC 5DY9A 2HOEA 4MDAA 5C25A 2QEXF 1WBDA 1EWQA 4FU6A 1W41A 2WFBA 2L2PA 4MO5A 4JRPA 4HT9A 5AQGA 4YORA 4YOVA 5LJ3g 2JW4A 4AG1C 5BPNA 3T9NA 3CERA 2E64A 4M75F 4X1IB 2P9LA 1GBRA 2KI7A 1M1KH 1HYOA 4HCZA 3FLGA 4KPYA 1NLPC 4PKCC 3CC7F 3CPWA 1Y71A 5IXFA 1CZ9A 5AQMA 4PL7A 2HHXA 3IR9A 4AH9A 2KSSA 4J9BA 4M75D 3MEEA 2OPRA 3CCMN 3PVQA 2DFHA 3M1XA 1YI2N 1WI7A 4BRMA 5ADXH 2PYLA 3AA2A 4KTWA 3NE6A 2DYIA 2JNGA 1GLCG 2RNAA 2HMIA 1JCGA 3CJ9A 4OPHA 2KTUA 3LH5A 3ASMA 3P4EA 2Z1FA 3I55A 2EYZA 4A63B 3D01A 1KK7A 3H08A 3HYFA 3LDOA 1U3PA 1WSHA 4JKCA 3DRRA 1YN8A 4OLBA 1K8AH 1Y07A 3CCVT 1VQPF 4J9FA 5FU7B 3O5ZA 4LN2A 1JQQA 3JV3A 3HSCA 2LQWA 1O1WA 4DFKA 1X27A 4M77E 4YDUC 3L4QA 1NG2A 4X1VA 3TR8A 3RMCA 3AY9A 4CEZA 1HD3A 1YJWF 5KGXA 5EZYA 3TSUA 2KYMA 4PWDA 4B8CA 3DJCA 4CJ3A 2D1XA 2KRNA 3QDKA 4H5TA 3T1AA 4PL6A 4EP4A 2QQAA 4JKHA 4DFPA 2BTQB 2G6FX 3S0HA 2VWFA 4E6RA 3KLHA 1IBKK 3OW2A 4ELUA 3TD5A 1FXXA 3QYGB 4HXJA 3THXA 3K58A 4JD2B 3VS5A 1RACB 2L3PA 1H3ZA 1XOVA 4ZHQB 3HKSA 2OYQA 4A4EA 5GAGP 5HP1A 1NJXA 1NK6A 4KI6A 1VSIA 5GANj 4FLZA 2VVKA 2HVIA 4ZNXA 1RI0A 1VSJA 1UJ0A 3LWMA 2F2XA 3PY8A 2HHWA 3V1OA 1Q82R 1ILYA 5F2RA 3CFPA 3UB5A 2GELA 2PY5A 1TAUA 1W97L 3THYB 3K12A 3A1PA 1TUBB 3C65A 1LVKA 2CP3A 4M78G 2Q97A 4JLIA 4X3LA 3R8EA 4HNAB 2HD0A 1RAIB 2ZGWA 1VQMT 3E22B 3T1YK 1YITF 2G8VA 3G71A 2FZKB 2FSNA 2GWJA 5EB1B 4O4IB 4FYXB 4RTTA 3UF4A 3X26B 3CCUT 4C5IA 4BR7A 2QXFA 2BH1A 3LZJA 4DSFA 4YTLA 4FK0A 4B5CA 3O4WA 1BGXT 3K5OA 1JB0E 1BU1A 1YI2A 1KQSM 3UIQA 3OBWA 3CCLN 2RJCA 4HCBA 2ZD1A 3HTRA 4M7DF 1BA1A 2OHWA 3NHGA 3KJJA 3MBMA 2YT6A 4J2AA 3CEYA 1TH7A 3HXMA 4C8QF 5GIPC 1KD1C 4JKGA 1Y0MA 3H6EA 4XU1A 3L3VA 4B9MA 2BGGA 2UXDK 4M7DD 3SCXA 3OYGA 3VS6A 5JQGA 3FFMA 1ZSZA 3AVKA 2X4JA 3JCMJ 4C8QD 3OYFA 4Y0WA 3V9WA 3M55A 5C8YA 2VV5A 3VQ9A 2ZCFB 3LP1A 5GAN4 3QEIA 1T03A 1M3BA 3P39A 3BP8A 4C5HA 4BG8A 5GAN2 3SZ2A 5HY2A 3G7ZA 5A2QO 5EU7A 4IUUA 4XTXA 3VS0A 4JK7A 2CZ0B 3PIPL 3M8SA 1XJWB 3EG3A 4BRPA 3MHXA 5IT9E 1Q82U 1QVFS 1NMDA 2QXLA 1WLPB 4NO7A 1QVPA 4CBUA 4BY9C 1ZUUA 3VEVA 2ROTA 2JOYA 2HP0B 4M3ZA 1WQ7A 1JLGA 4LF5K 1X7OA 2H3JA 3VENA 1KNJA 3N4YA 5HY4A 5AQFA 3LH0A 5GAN3 5LMUK 4E7HA 1KCFA 1MA9B 1UG1A 1RT1A 2YHAA 1J54A 3TU5A 2UYKA 1X69A 3LZIA 3JATA 5FNVA 3CBOA 1BHLA 4BACA 1B9FA 3V7SA 5BMVA 5J2UA 4CEOA 5EAZA 1N6AA 1VQOQ 1XBIA 3OS5A 1YJ9F 2QWMA 1Y57A 1NNEA 1H1VA 1U2VB 1GFCA 3ULRB 4DQPA 2ATQA 3IG1A 3ZSQA 1VQ8A 4CJTA 3CJCA 1UWBA 2P9LB 2FSKA 1D3BA 5M1PA 4DR7K 4JS4A 3GOIA 1QU9A 1RTHA 4ILGB 2DYYA 4CHQA 4M78A 1TK0A 4GNIA 2XICA 2YHBA 4PK4A 1VQ6A 2QTVA 2HCKA 3OYYA 4J6YA 3GIBA 3BYQA 2LRQA 4YOYA 1NPPA 1WHHA 4CZMA 1WX6A 1ZBJA 2YHYA 4DF8A 3JSCA 2M0OA 4TVRA 4LD9K 1VH8A 2OTLN 1P90A 3RE3A 1UFFA 4A62A 1TUUA 1J9AA 2B86A 3NF7A 1X9SA 2KT8A 4I4TA 1IO6A 4JKFA 1SL1A 2FBTA 4O8UA 3ZSYA 2A0FB 1T8EA 4ZK7A 3CCQQ 3X24B 1HYVA 2HBKA 4CK1A 2XIDA 3TREA 3M53A 5C12A 2O88A 3UWNA 2HS3A 4FPBA 2ZJRL 4RQOA 4X1KA 2EAYA 3NVKE 2FBVA 4F3TA 2MYSA 4F16A 1KQSA 4CGJA 5CR4A 4TUYB 4AFUC 4HTUA 1QQMA 3JALA 1JLAA 3V9UA 3I5SA 2V52B 2R7YA 1LV5A 1WYXA 3CCJA 3M0SA 4PJOE 5JS1A 1QVFF 2GLZA 1I5LA 2KFNA 3NHNA 2LSNA 4MLEA 3L2RA 3CMEA 3CMAF 3NGYA 2KXDA 1ZBIA 1ZBHA 4KHYA 2FSJA 1XNRK 1Q86H 5EY4A 5E41A 4M7AD 4Q5VA 1G83A 2A28A 3NMUA 2CWJA 1Q7YC 2ETJA 2OPSA 1ZUKA 1VQMN 2HNDA 1VHXA 5EB0A 3M5RA 3HHTB 4BRFA 2EFIA 4CEQA 4M77C 3DM2A 3OSSC 3CCUN 5LJVA 4K8ZA 2GCXA 1TV6A 3EHQA 1KAYA 2A37A 4O6JA 3SUQA 2MWOA 2UYTA 1QCOA 3R6MA 4FOIA 1Z9QA 2LCSA 2HDAA 1NK9A 5JCOA 1GLAG 2DO3A 3EO3A 3S6WA 4BGBA 9ATCB 2ZPHB 1LWFA 2KRMA 2G9IA 3QIIA 4KTZA 1QKWA 2EQUA 2LMJA 3MEAA 1IKVA 1YHQF 2A1RA 3EGDA 4N47A 3CCVA 3RYCA 3RKYA 2J06A 4FWKA 3D6RA 3EN9A 3MN9A 1EWRA 1X9JA 1VQ7N 4I6MB 3FD5A 2R58A 1IBLK 2MQEA 4KHQA 2WTUA 1L3SA 3SWNA 3HKBA 3MP8A 4DWIA 3WXMB 2HSEB 3ENOA 5AQNA 4JYAK 1VYUA 1SKWA
chains in the Genus database with same CATH topology
3SAGA 4KH4A 4JKGB 3ULEA 2RHUA 5GAOm 3OYJA 3VTIA 4M77G 5AQWA 2WSFE 3C0BA 3WVDB 1OKJA 2NZTA 2DTOA 4H5WA 3WQUA 2KDSA 2ZPBB 1VQ5T 2W41A 3OYLA 2K57A 1SSFA 2FVUA 1CZAN 1ATNA 2JTMA 4OO1J 3O8VA 3GNFB 3CD6T 3HTVA 4F7UF 1P8ZA 3LFOA 3GNGA 1RL2A 1ZHIA 1YJNN 3N4PA 5LJ3h 3DXKA 2A5XA 1QP2A 2IVWA 2RJDA 2YHWA 3J7AF 3CPFA 4L5GA 2QWOA 3JS6A 5FLXE 3DKMA 4DHYA 3SIVA 1YVNA 2HF3A 2Q1NA 4KULA 3IFRA 5HK0A 3E9LA 2D1KA 3O6WA 5A0LA 3I56A 5GANe 3KXTA 1D3BB 1W3EX 1WOQA 2MF2A 2QWRA 3L6QA 1BUPA 4EMKA 1VUBA 5KH6A 1NMUB 4CI6A 3R6OA 5GANf 2DVEA 4A5AA 5BPLA 3G25A 4N4HA 1R8OB 4C92D 2HSTA 4KBOA 3ID8A 3CCET 4WQ5A 3O8MA 4FWRA 2HBJA 3MWPA 4BI3A 5C6SA 3KWIA 3O5BA 3W3DA 4C1NK 3L2WA 5KE3A 5EVZA 3CBPA 5GAMg 3VYGA 1ZQ1A 5M1FA 2ZJPL 2GF7A 2DEQA 2OTJT 1X52A 2RHYA 4DA4A 4BVOA 1OVYA 4PJOC 1QHAA 5JVHL 4CZJA 3A0IX 3G6EN 5CKHA 3RA6A 5GMKj 2NLUA 3R1XA 4BW0B 5E84A 3U9ZA 2A41A 1BU6O 5BR9A 4KUIA 4XTZA 3N4QA 4G9ZA 2MI6A 2EWNA 2EJFA 3BF1A 4LC9B 3VGKA 3SWNB 3SK3A 2RD1A 1VQKA 3AARA 1Q81C 4BRDA 2E41A 3CD6N 3KVGA 3HRGA 5AQXA 3ULEB 2P9UA 3CQYA 4BRLA 4IZ9A 3C12A 4N4GA 4GY2B 5LY3A 1E7KA 4C0GA 4BR9A 3VMFB 4PJOG 5M1KA 2R5MA 2XU8A 4CD1A 3GDQA 3JCMh 5FPNA 3CCRF 2EQJA 3CPWF 2VGMA 3D2FA 1NGHA 2ZPEB 4QS8A 3VF4A 5FU7C 3FB9A 3DXKB 3KWGA 5C10A 1S72F 1MWMA 5CHIA 3CXCS 4M75B 3VYHB 5BN9A 4WFNL 1SS6A 2PUOB 4PL8A 4C0DB 1M5Q1 1GLLO 5DLQE 2V8IA 4UC4A 3V7RA 2Y4XA 2A6AA 4EMKB 4RCBA 3RVCA 4J8OA 4ZN3A 3G4SN 3SJHA 2M16A 4ZTFA 4JRIA 2O01E 2Y90A 3EE8A 5AQKA 3QB0A 2E1HA 1JJ2S 1VQ5A 4WYBA 3VEYA 3CJ1A 3UKUA 5CAIA 4ZN1A 3BUZB 1X6OA 3WVEB 4WQ4C 1GLJO 5IAYA 3CD6A 4M7AA 1ZWZA 3VEWA 4ISGA 5LJ5j 3OYMA 4FOEA 3TU4K 5C2FA 5CO7A 1BYMA 1C0GA 4H5RA 2DIQA 3VGMA 4A5BA 4EHUA 1QVGS 3FZKA 1KC8U 4OF1A 3GP8A 4NLCA 2VYTA 3A8LB 4CZKA 5GMKm 5J39A 5TKWA 4LDWA 5AQPA 3UKRA 2GUPA 5AYFA 3CCMF 2CS7A 2BKDN 1YI2F 3VTHA 5FLXM 4JNEA 5EO3A 2ZPGB 3QZ9B 4PLIA 2VGNA 3H3NO 3VU3C 5IN1A 5KPZA 4Z94A 3PMTA 3H8ZA 3LM9A 4GLKA 3KBGA 2KLAA 5AQOA 4BQLA 2RA2A 1VQOT 4JRKA 3A8GB 5I21A 1DJ7B 4JN4A 4HT8A 4O8KA 1NGEA 5AZJA 1EIFA 4QQGA 2PVGB 3CCEA 3OQ5A 4BDZA 3HZ6A 3A8MB 4A4HA 2FYKA 4XQ3A 3EE9A 3CC4N 5GAN7 3AAPA 2I2LA 5LJ5d 2RHIA 3PNWC 4B9QA 3HPWA 2RI3A 2Q0RA 1X3NA 3ATVA 3H46O 3CCQT 3EFRA 3M57A 3G71T 2DZCA 2P9UB 3PMIA 1D4XA 4PHTX 1QVGF 1BI2A 5CKEA 2I6DA 2DPNA 3RMQA 2WBNA 2OTJA 4CJ7A 5HL7L 3LX7A 4M78F 4LCKA 3CC2N 1K73O 3J80M 4GVEA 3CCSN 1OZ2A 4QVZA 1G3TA 1O9SA 2I7PA 4JK9A 3H6ZA 2QW9A 4HA8A 3CCLF 2D0OA 2XDPA 1NJIH 3E9GA 3A5NC 4OB2B 3QICA 3U4LA 4E1JA 3L2VA 1V4SA 3QPHA 4JUVA 1NGJA 1U1SA 3HJWC 4BVRA 3AAQA 5BN8A 3MEVA 3J7AR 1NGBA 4RTFD 2YLCA 2QWLA 5GMKe 2J4RA 5CKDA 3SAFA 3GOXA 1VQ8T 1P92A 3OS1A 1T3VA 3UKUB 5HWEA 4M7AB 2E1ZA 5GAMh 1BIAA 3Q7CA 1VQ6T 3BF3A 3META 3V7CA 1Q18A 3RKXA 2QA4T 3PAFA 2L89A 1KHCA 3RESA 1PSEA 4FO0A 2KAFA 5HXUA 3D2EA 4OGCA 2LC4A 1QQOA 4JHDB 1VQON 5HXZA 5GAPK 3E19A 1NPRA 4HWIA 4JKEA 5HY6A 2E88A 4QW2A 4JEPA 3D00A 4BB7A 5GAOq 2OTLF 5GAOl 3CCJT 4M75E 3OA6A 3HBTA 3H1QA 3ER0A 1VIFA 1BWFO 5KCHA 2E65A 2P4TA 3FR0A 1BI1A 4HKEA 1N8RU 1U2VA 5GADP 3ASKA 2YX6A 5GAEP 2R57A 3CCQN 1RA4A 4BY9D 3JXUA 3G71N 5AZJB 5CVIA 4IJNA 2A3LA 5M1NA 1QP3A 3C4SA 4O5VA 2A3ZA 3HRSA 5D6YA 1G3SA 3F9MA 2HVYD 1XQSC 3DB3A 4C5EA 2XG8D 1VQMF 3LYIA 1W2BS 5AQYA 1KD1H 1IZ6A 2KKZA 2A7YA 3CXCM 2L8DA 4M78C 3CCUF 2X4XA 5LJ3d 3A5ZB 4KT0E 3LDQA 3T69A 5J3BA 3MWTA 4ZGDB 1M90O 2ZZDA 3LLRA 2CYZB 3JCMb 1T44A 2BUPA 3L2UA 4H5VA 1VQOA 3DB4A 4K42A 3AHUA 1SZ2A 1VQ7F 3QZ5B 4IEIA 3O9UA 4XH5A 1K8KB 4BRKA 5DM7L 1X01A 1JJ2M 1IREB 2K5FA 5AQSA 1GLEG 4M63C 3QJYA 4NB4A 1VQ8N 5DM7R 2EKOA 3V7EA 1QW1A 4C92B 1YF5L 5GANK 2QQ9A 3X28B 4RWTA 4M77F 1FX7A 3CCQA 2P9NA 1VQ6N 2FL7A 4DKWA 4C8QE 4RMOA 3O9TA 3P8DA 1JBMA 4M77D 2QA4N 2W40A 4I6MA 4RCHA 3FC3A 1W2BF 4IDHA 3ZX2A 3JAMM 2VC8A 4FT2A 3VF6A 4KH5A 4BE1A 4C1NI 3WQTA 4IUVA 3I56T 3FLCO 5HOOA 1YJNF 3GE1A 3J8AA 5BRFA 3SMPA 3PIPA 2F9TA 1UGPB 3NFCA 2V7ZA 4MZTA 1XUPO 4FVUA 2B8AA 1IG8A 4MLHA 5HY0A 3CCJN 3E1SA 3SWNC 5GANg 1VQPT 3O1WA 2XK0A 3CMEN 3S41A 1I81A 3D2EB 2WUSA 3CXCA 4XU3A 5A0DA 3VJPA 1YJWT 5KQ8A 1K73C 4OPAA 1JCEA 1I8FA 1Q7YH 4B1VA 1XC3A 3M59A 3DWLA 1OYXA 2E6ZA 3OMCA 2LCCA 3FJPA 2LQ8A 1NM1A 2RHZA 2LQKA 4A59A 4ILHA 4FWPA 1K9MO 4WFBL 5H1SQ 2CGJA 3NVIB 3VPZA 5F1XA 2P9PB 3QSUA 2Q36A 1XTDA 4WFAL 1JJ2A 3UPUA 4GY5A 1KAXA 3CCVN 2PU9B 4A4GA 4K43A 2QWQA 2NRWA 3CETA 2LTOA 3L42A 5CR2A 3QFUA 1HUXA 5BRHA 4H0PA 2QA4A 3C94A 3JCMd 3L0QA 4C0DC 1Q81O 4M7AE 1U6ZA 4MDBA 2X35A 3A5MC 3MO8A 4EMKC 3OYNA 5BPMA 2KVQG 1WPYA 2CGKA 1LJOA 1M90H 4R79A 5AFUA 3MK6A 2EWSA 2AP1A 3PFSA 1VQKT 3G6EF 3ZETA 3Q7BA 5KPTA 1VQ4T 4BRNA 2WACA 3ENHA 5GAHP 4WQ5C 2RK2A 2OANA 2WSEE 1N9SA 3CIPA 5B8HA 1BDGA 2ZGYA 4M75G 3NVMA 2YJEA 1VQ9A 2DTIA 4FSVA 3E66A 3I56N 3LWIA 4XTVA 2V51B 3O9RA 5GMKl 5AQLA 5GAOn 2XDBA 2P9NB 3X20B 2RK1A 4PJOF 5GAOr 4LDVA 3K9KA 5AZIA 4J7IA 4IOXA 1VQPN 4FWLA 4PJOD 4ME7A 1YJWN 5ADXA 2RH2A 3CJ7A 4A2BA 4B1XB 2O4XA 2FLOA 4PKHA 5GIOA 4E7LA 3M1FA 1VQNT 1M90C 4FWSA 2JZ2A 3F70A 3S3OA 1OI1A 3SD4A 4BY6B 2IG0A 5CQYA 4FWMA 1VQLA 5EWRA 4II1A 5GINC 5EG2A 3I33A 2LT4A 3MN6A 2K5IA 2QEXA 2LBXA 2PFUA 4OB0B 3LGFA 3G4SF 3ME9A 4QQDA 4DQ8A 1UEBA 3EZWA 3JCMQ 1K9MH 3TTDA 3KZBA 5EXWA 3NK7A 2NRRA 4M75A 3INZA 3OYBA 4QS7A 3SB2A 3QKJA 3CC7A 4MZMA 4C92E 5FROA 4BRAA 4KUDK 4N4IA 4JS5A 1OZ3A 2L5QA 3ZYYX 4BR2A 1G3WA 4K25A 2GTDA 4A57A 3ZFJA 1VQKN 1YHQT 2F5TX 3V3TA 2E20A 1VQPA 2CZ1B 4OB3B 4BI4A 5J26A 4ATOA 3CG6A 1Q81H 2RM4A 1VQ4N 1M1KU 3SFMA 3MCAB 4IUPA 4AF1A 1M1FA 3BEXA 4PNOA 3LDPA 2MWPA 1YJWA 2YHXA 2LCLA 3L2ZA 5L8RE 3DLLL 5C0YA 2XDDA 2E10A 2ZWHA 2F69A 2JTFA 2VXEA 1W40A 2GX9A 3ZETB 4AM6A 3FZLA 3O1BA 1K8AU 4H03B 2RI5A 4YOWA 1WJQA 3PLAA 4GV3A 2GFAA 3CC4F 3CPWS 1BG3A 1T6CA 2DXCA 3RA5A 5I9EB 3J80E 2HAXA 1Q82O 1QZ6A 1K9MC 5CIUA 4JDSA 1YITA 3EKSA 3VERA 4CBWA 5GMKi 2YJFA 2VWBA 3O9QA 3M54A 3URGA 3OYAA 2WC9A 1KHIA 4O8UA 1HXDA 3R9PA 1AHJB 3TSQA 1UGSB 5GAMd 1O75A 5AZIB 3HI0A 1VQNN 4M7DA 3JCMX 1T6DA 4ZGEB 1QVFM 2PQWA 4C8QA 3DXMA 2DD4A 3CC2F 5GANh 3OW2S 3SAHA 1VQ5N 3CCSF 4M7AG 3CJBA 4NLBA 2YCHA 3C6AA 3ZX0A 1VQ4A 2O4XB 3IMXA 3TTCA 3X25B 2K2VA 4BGAA 3MCPA 2RO0A 4QS9A 3EL2A 5A2QM 1BI0A 3QO3A 4CZEA 2L3RA 2OZBA 3C95A 2WALA 3DLMA 4DOWA 3FFKB 4DQ2A 1UGQB 4BRHA 3PGGA 3SBGA 3JCMc 3A5LC 2GFUA 3HAXD 2VCPA 1YJ9A 3M58A 3I55F 4OGEA 2P9KA 4LDYA 1J6ZA 3KK7A 1DKGD 2BO1A 2LVMA 1Q7YU 4BVPA 3MMVA 2E12A 1GXIE 3MX5A 3D7EO 4L3QA 4IO9L 3A8OB 3ZEUA 3CCEN 4V2SA 2R5AA 5AQZA 1PXWA 2P0PA 4OMFB 3Q1JA 2RJFA 4R56A 3OW2F 3E9OA 4JKDA 3IDHA 1VQNA 4PKIA 3QYHB 1YXQA 1VQOF 4J6WA 1E4FT 4EHTA 4X3MA 4E7IA 1EO1A 1G99A 3TCJA 1QVFA 1XNIA 3V8JA 3VUBA 3E9PA 4R55A 2JVVA 3NK6A 3V8KA 1NE8A 2OTJN 1IJJA 1YBYA 4BREA 2YHTA 4ISFA 5FJ4C 5CKBA 3CI5A 3RMSA 4JK8A 3G71F 3M9QA 3FEOA 4PKGA 2ZJQL 2BTFA 4JHDA 4J5YA 1N9RA 3LWVC 3CCRT 1LNXA 3M56A 1Q82H 3V8LA 2RJEA 2CZ7B 3GF5A 4EMGA 3RERA 1Q86U 1DGKN 1S72T 3FGUA 3VGLA 4FT4A 4RG8A 1YHQA 4C92G 3BFMA 4B9XA 2HBLA 2V8KA 2DXBA 2ITMA 3M3ZA 1LCUA 3PIOL 4E7KA 1GO1A 5M9OA 3CBMA 5FPDA 2XHCA 1KQSS 2KK4A 3AGRA 3HFOA 2QQRA 3P38A 5LJ5g 4M7DB 4FL6A 2KTVA 3E1YA 5LJWA 4DOVA 3SBTA 3FIFA 4C8QB 3DXMB 3LW5E 1V4TA 4YOTA 2E2NA 4CZIA 2CKKA 4BVSA 4H5NA 4WF9L 3HOTA 2FC3A 4EPCA 3VV0A 1X3MA 2JWLA 3JAME 4AM7A 2DTHA 4MMKA 1M1KO 2E70A 4F7UA 1VQ8F 3JCMW 1H641 4BR4A 3L2QA 3MN5A 4DCHA 2XKOC 1VQ6F 2AHJB 1ESVA 1KXPA 2QA4F 4M78D 1CK2A 1K8AO 2P0QA 2MAMA 3P8HA 4OVAA 1Q82C 2P9KB 1K8KA 3FZFA 3GPLA 3CCMT 3DAWA 5JMVA 1KQSF 4C5GA 4C0ZA 3E9FA 2HQXA 2PVOB 1HKBA 3ZEUB 4C92A 3J7ZO 3CCJF 3GL1A 4FWQA 3LDLA 1IPAA 3CMEF 1NWKA 2X4WA 3LGLA 4B1UB 3P8BB 2DKGA 5FPMA 4X34A 3WXIA 4A2AA 3CPWM 2LDMA 5JLFA 2ALEA 5AQRA 2NRTA 5BREA 1NGIA 1VAZA 4XK8E 4JJNK 4H0TB 5A0GA 4QVDA 1WNLA 1ATSA 5FPEA 5LL6S 1BIBA 4XAXB 3KUFA 1Z6RA 3N4ZA 2I7NA 3BW1A 4WF2A 3CCVF 2EQMA 3MP1A 3VKIA 4GV6A 1BO5O 5LJ3j 4IFEA 1YIJT 3I8BA 4EI8A 2DAQA 3VEXA 5AFUH 2RHKA 4UY8O 3OW2M 5EOYA 4XTWA 2QWPA 2DJZA 4BY6C 2ASOA 3P31A 1E4GT 3MP6A 3OYKA 2IIRA 2P9PA 1HK9A 4H0XB 2D0PA 1TYQA 2RI2A 5CK9A 2JNBA 2KHOA 2XI9A 1VQ9T 5G4UC 4EI7A 4RKUE 5EX5A 4N0AA 3J81M 1MHNA 3QXEB 3ZBDA 5ELZA 4L6V5 5CKFA 5GMKh 5HY1A 1NGAA 2KY9A 5CQXA 3CCRA 3OS0A 3CHWA 4CI0C 4F7UB 2F9WA 2DZ9A 5AQHA 2GWKA 3I56F 3M5AA 4A4KA 1S72A 5MLCQ 1K73H 3SMSA 5LJ5e 2FB7A 2QI2A 3C6HA 5AQVA 5AQUA 2IVPA 4NL3A 4P5NA 2QTXA 2Y4YA 4J8FA 2IVNA 1MWKA 2Q0UA 1KC8O 3HOSA 4OP0A 1I4K1 1B34A 4FIBA 3ZEHA 5LJ5f 1S22A 1GZ0A 1VQLT 4B9WA 4CD3A 2M1HA 2OTLT 4QVCA 2VYPA 3NMUC 4CZGA 5JICA 2C06A 3O08A 4YOXA 4LD6A 2QEXT 3ON1A 4JKAA 3LWPC 1Q86O 3JB9G 3WEEB 4BE2A 4M7DE 2AA4A 1R59O 3O9SA 1QVGM 1NGGA 3QHSA 5G4VC 4BC3A 4XCQA 4H0VB 4JKBA 4DB3A 5DLOA 4BRIA 2K3XA 5CCAA 1BKBA 1Y7XA 3CC7T 5JVGL 2KQWA 1GLFO 4FWOA 1GLDG 1H7MA 5F0XA 3VETA 3JB9J 1YIJN 4XH1A 1M9SA 3JRZA 4IOCL 3JCMM 1M1KC 2PAVA 1X7PA 3O85A 3H3OB 5FU6B 2LBWA 3LWHA 2EQKA 2HF4A 5TKYA 2JUFA 3CCMA 5FRMA 1SAZA 4B1ZA 2CH6A 1ZBSA 5GIOC 1C0FA 2QQBA 1K8AC 2DPPB 1HX1A 1VQKF 3K9JA 3VUZA 1VQ4F 1VQ7T 5LJ5h