2VGMA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
381
structure length
354
Chain Sequence
MKVISLKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIETDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 97
structure length 354
sequence length 381
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgmA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgmA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgmA03
1W42A 1X7OA 2OTJF 3CPQA 3CD6F 5FJ4C 2WALA 1KD1H 2OTLF 3CC7F 2OHWA 1IPAA 1NJIH 1N8RH 4AF1A 1VQ9F 3J7AR 3GYQA 3OBWA 3NK7A 3PLAC 4TZZA 2HSTA 2VGNA 3I56F 3LWOC 3CC2F 1KC8H 1QVGF 1M90H 2BO1A 3CCEF 1YJWF 3E20B 4BY9D 3MCAB 2KG4A 1YJ9F 5GIPC 5GAPK 3FFMA 1VQ8F 3OW2F 3WXMB 1YJNF 3CCQF 1H7MA 1K73H 3CXCF 3SIVA 4X3MA 3LWPC 2HVYD 1X7PA 2ALEA 3IR9A 2AIFA 3I55F 3ON1A 3CCVF 1VQNF 3HJWC 2KTVA 3CCUF 1Q7YH 4X3LA 1E7KA 3LWRC 3CCSF 1W40A 3NVKE 1X52A 4LCKA 5DCVA 1VQ5F 3NMUC 4C4WC 1Q82H 3CCRF 3CG6A 3N4ZA 3J81M 1CN7A 3O85A 3CCMF 3JCMM 3CMEF 1VQPF 1JJ2F 1VQ4F 3NK6A 5GINC 3CMAF 3V7QA 1GO0A 1DT9A 5FLXM 1M1KH 2LBXA 5GIOC 3CCJF 1K9MH 1GZ0A 3SIUA 2OZBA 1VQMF 3CC4F 1Q86H 3OBYA 1K8AH 2VGMA 1CK2A 2QEXF 2JNBA 1S72F 5A2QM 2LBWA 1YIJF 1RA4A 4BW0B 3CCLF 2FC3A 1YITF 3LWQC 1RLGA 1VQ6F 3V7EA 1W3EX 3CPWF 1T0KB 3E1YA 3PAFA 3HAXD 5G4VC 1VQLF 5EWRA 1NMUB 3J80M 2CZWA 1W41A 3N4YA 1PXWA 5EO3A 5IT9M 1QVFF 1KQSF 3G4SF 3LWVC 2KTUA 1ZWZA 3G6EF 1Q81H 3NVIB 1YHQF 4NUTA 5G4UC 3VMFB 5GANK 3AGKA 3VI6A 1GO1A 1W2BF 1SDSA 2I6DA 1XBIA 3JAMM 3RA5A 3G71F 1VQOF 3RA6A 3LFOA 2QA4F 1VQ7F 2QI2A 1VQKF 1YI2F
chains in the Genus database with same CATH superfamily
2QTXA 3THWA 4NXNK 1BWFO 1VQPA 4DOVA 4A4HA 3PO4A 2HRYA 4TV8B 5FNVA 5FU6C 2LZ6B 5LL6S 1WNLA 4RG8A 3DLBA 1NGBA 4DTXA 2C0IA 2AT1B 1DTTA 1HYSA 2PZSA 1TTHB 4WCIA 1YVNA 4CZLA 2CGHA 4FJJA 5EIBC 2BE9B 1QCNA 4CHOA 5HY4A 3CXCP 5HY0A 4LH5A 2KY9A 1SL0A 3OYLA 3BW1A 1WBDA 4I9QA 5LA6A 2MK5A 4J9GA 4FSVA 3SFMA 1ITGA 3G1JA 3CMEQ 4ISFA 4OPHA 1KQ1A 1YNZA 1I94K 4NB4A 4O44A 3T69A 2LCAA 1VSLA 4CGJA 5J2MA 1VQOT 3FFMA 3OYCA 1KD1C 1SRMA 3M8SA 1VQ7T 1RAFB 3UB5A 2JXBA 2IPOB 3FFIA 4AHVA 1KRPA 2VAWA 1WHMA 1H7MA 1X43A 5KH6A 3KXTA 5LP6C 3LM9A 5HBMA 1RDBA 3THWB 1X25A 1X7PA 3DKMA 2GELA 5GMKh 5M1FA 1KNJA 3CCVF 3ME9A 1M90C 3VQAA 3HSTB 4KGVB 4E89A 2AP1A 1J9AA 2RN8A 3UKRA 2HP3A 3WGKA 4IFVA 1G3WA 3V1OA 2H8EA 3VCZA 4IFYA 1VQ5Q 3CFPA 1XNQK 1QW1A 3U3YA 3H0IA 4M7AA 3FGUA 3CCSF 5FU7B 1W2BA 2IAFA 4CESA 2F4VK 3I8DA 1QSLA 3WJPA 4OB0B 3CCRF 5LA6B 1CLIA 3QNOA 4LSNA 2ZWHA 3EG0A 3O85A 2O4GA 3IKEA 2LVMA 5B8FA 1BIUA 2LX7A 4C1NI 1DBFA 1FKPA 4DSFA 1QCFA 1HLUA 1GO0A 4O2BB 3VQCA 3WPXA 4Z4HA 1B34A 4JS4A 5I2SA 1YHQQ 1HQEA 1T6CA 1H8KA 2DETA 3DRSA 4XTVA 2E10A 1XUPO 4FWKA 3DC2A 2RD1A 5AQHA 3G0ZA 5C2FA 4BRAA 2OZBA 1Q82R 1WXUA 3VRYA 3FLGA 2F8SA 2H3GX 1M1FA 3ASMA 2HSEB 1T44A 3JAMO 3VERA 1OI1A 2G3RA 1NMNA 4Y92A 3C9UA 1C1AA 4KV8A 3UKRB 4DR1K 4J5YA 4FLWA 4DTMA 4WCEL 4DBFA 4Y28E 3FFKB 4FWNA 1ZBIA 3VS2A 1XRGA 3LWQC 5DLOA 1XHXA 2JWKA 1T05A 4M77C 1F21A 2DLPA 1UJYA 2RHZA 4M78C 4QT7A 2LCLA 3PY8A 4BVOA 2HF4A 1RAEB 5CA1A 4DUZK 3HKBA 3P83D 3S0YA 3MEDA 3I35A 1L3TA 2DL5A 3SHWA 3QO3A 2CP6A 1VQPT 2E6LA 4CEEA 4LNUA 2X4WA 3KKSA 2A1SA 2DY4A 2B33A 3G6EF 1TVRA 4EDUA 5IJ9A 3M1FA 3DJCA 1EP4A 3CMEN 1NEBA 3JXUA 1B34B 4C8KA 5J2TB 3KIOA 3D7EO 1WHHA 3X25B 4FPBA 5G4UC 4CJPA 4YOYA 4C92C 3P8HA 1JO8A 2DVJA 4JRQA 1UWBA 3RR8A 4FWRA 3RA5A 1K8KA 1BL3A 4DRXA 5BRFA 3RR7A 1XV2A 2QI2A 3EH1A 2GWJA 2Q97A 3VEWA 2GZLA 3HKEB 3ZOPA 1BI1A 2QGFB 3TAFA 1XI1A 3ULEA 1L3UA 4A5AA 1R0AA 4BC3A 2JTEA 1SF9A 5AQTA 5LP6A 3QEWA 3V9SA 3CBOA 1VQ5N 2HCKA 3ATUA 1IV4A 5KYWA 5LYJA 2K5LA 5BRDA 5EOYA 2UU9K 1UGPB 2DFEA 5FU6B 4FJHA 4AMCA 4G4WA 2ETJA 2M9UA 4L5GA 4Z4IA 1PWTA 1KFZA 4HVVA 4LNUB 1PD1A 4OVAA 2XY6A 1ZQ1A 1CXUA 5IJ9B 3FIFA 1YJWQ 1RNHA 4NQ3A 1QVGF 3M58A 2D0AA 2P84A 2FBTA 2P5GA 1SRLA 1D9DA 2W0ZA 2MOXA 4JI8K 3OYMA 3LLRA 4PJLA 1M27C 1YHQN 1IKVA 3O9QA 4PJOC 4CZIA 2NUPA 2EWSA 4K25A 5AQPA 4F2RA 1K8KB 4DRXB 1L5UA 1RT2A 3KK3A 3TVTA 3PMIA 3CCMA 1K73H 3ZT0A 3AO5A 1M3AA 2J6OA 2RI3A 3A8GB 2EQIA 3ULEB 1G8XA 5M1OA 4NCBA 3WPWA 1GBQA 1QVFA 1SUQA 1NLPC 1T3SA 1MMNA 3HKSA 1QVGM 4DTNA 2YHXA 1U04A 3QG1A 4PLIA 2VWJA 2GTJA 2RO0A 5KYWB 3GPLA 1JLGA 4FK4A 2DYYA 2R57A 4F7UA 3GNGA 5A2QO 2YUPA 2EQKA 3P0ZA 3TSPA 4X3LA 5AQZA 1FW6A 1W40A 4KHNA 5HP7A 2QWPA 2EKOA 1KQSS 5EXWA 2L5QA 3OYEA 4E7JA 1NNEA 3NMUC 1K9AA 1XTDA 1KLNA 1HKGA 4PY5A 1VQ4Q 1K1ZA 5GAOn 3PUFA 3JSCA 4M77A 3I3FA 1RILA 2LSNA 4IHJB 2DX1A 4M78A 4OPAA 1M8VA 5M1KA 3NK6A 2O8EA 2NUPB 4WFNL 1W581 5J2UA 1FXXA 2GGRA 1HKCA 1JEGA 4MZMA 4CEQA 1OVQA 2QQBA 1K8AC 2KYMA 3NTHA 4JZ4A 3SLCA 3L2QA 3E19A 3SMPA 2EYZA 1Y0MA 2E3IA 3E9FA 1RT4A 2LCSA 3CIPA 2ZF8A 3VYUC 1GX1A 4BDZA 4XH5A 4PL8A 2ZGYA 1T8EA 4XTUA 4BRMA 4C92A 4CIGA 2D1KA 1NK7A 1IG9A 1N32K 4DV1K 4XU0A 3ID8A 3EORA 1U06A 4B6MA 1PNJA 2E8AA 2P0QA 3UA7A 2BE7D 4F7UB 3MXMA 1SKRA 4MQ3A 4J9CA 1AT1B 4K11A 5GMKi 5GAOr 3F2KA 3FZMA 1HQUA 1VQ5T 1WHGA 2WSEE 5LJ5g 1H641 3PT9A 3S3MA 5HXZA 2OTJA 5GANg 1T3VA 2D0NA 4M77B 4H5RA 1QTMA 4CD3A 1NK0A 1YJWN 4M78B 4C8QD 1PSFA 4O4LA 1GOCA 3P8BB 2P5OA 3OYHA 4DF8A 4DFJA 5IYZA 2HOEA 2O8EB 3C0BA 1HR0K 5J2UB 5HRNA 4FJ7A 4PL7A 4YFUA 3NVIB 3V9WA 3OA9A 3OW2S 4FM2A 3EGUA 5JMVA 1ZSZC 3MCQA 4DSLA 1RT5A 2JS0A 4D6WA 1HXDA 3B8AX 4B9XA 2Z0WA 1JLCA 3RUXA 5FWBA 2NRVA 3LFOA 4PL6A 4C92B 4E2FB 4RW4A 4PJOA 3CD6Q 2VWKA 4PWDA 2HS3A 1RGIA 3CBMA 1EETA 2W40A 4WQ5C 4F3OA 1OYXA 2IVNA 3CI5A 2YX6A 3S02A 1M4ZA 1VQ4A 1GLBG 1HK9A 4U67L 4G88A 1KTQA 3VKIA 1LCUA 2AIZP 3MK6A 3HTVA 4FJ9A 3VQ8A 5GMKe 1SKSA 1WGSA 2JT4A 5IHKA 1TSFA 4B1UB 1GLAG 3HRGA 4O4LB 4TZZA 3KK1A 3ELCA 1VQ4N 3VF6A 3SV3A 4FO0A 5IYZB 1BI4B 4CEBA 5JH7A 1KSPA 2GFAA 4J2AA 2XRIA 2A5XA 2O9SA 2QK0A 5CY4A 4JDSA 1YCSB 5J2QA 4FIBA 2ESWA 5CKHA 3WVDB 5GMKl 2KHOA 2YHBA 4Y1CA 3ZCMA 5KTQA 4JKHA 5KPRA 2DD5A 2QWNA 2HQEA 3JS6A 4IG0A 4CFAA 4IEIA 4F7UE 2LNHB 7AT1B 1BIBA 2KVQG 4YORA 3HT3A 2YXZA 4IIJA 3NMZC 3CCJQ 4PJOB 4LH4A 3K5LA 4YY3K 1IRXA 3QSUA 2XKOC 1KLMA 1NWKA 3DLLA 2ALEA 4ELYC 2A0FB 3Q1JA 1JXOA 4R5PA 3I55F 4M77E 3UA6A 3CCUF 3DLLL 1S9EA 4E7LA 3JSMA 4KGXB 4M78E 4RTTA 4BREA 2UXDK 2QQ9A 3MN5A 1UGVA 2ZZDA 4AHTA 4KRFA 5CR2A 4JKCA 1E7KA 1HSQA 1KQSP 3DYAA 1PRMC 4LF9K 3SMSA 2K5FA 3I7TA 4Q0BA 4BRNA 2LQWA 1YIJA 2HKQB 4C1NK 2GLZA 2O8FA 4BVPA 4X62K 3KHYA 1Q7YO 1FX7A 3FDRA 3TEEA 4CC7A 1WUAA 1X27A 2FPFA 1YT3A 4CHQA 3CCMF 1YJWT 3JCMM 2A6AA 4MMKA 3E9LA 4Y1DA 4DV7K 1N34K 4O8UA 1CKAA 4C92E 3GP8A 1JCFA 1RT1A 1NJZA 3CD6A 3C7NA 1H3HA 3JAWA 2GNCA 1FK9A 3QB0A 3N2KA 1W4SA 3S41A 4A59A 1YWPA 4EZ9A 4IIJB 4RMOA 1MUZA 1NJIU 1XMQK 3L8BA 1X69A 2F2VA 2XIDA 2YT6A 3QEXA 4YDUC 2IG8A 3ENOA 3NCIA 1RT7A 3EG9A 4CF1A 3LDSA 2IC3A 3CD6N 2ZPEB 2YNIA 3P4IA 2HSPA 1TKXA 1ZSZA 2E4HA 3OYFA 3WUHA 4R55A 2BGGA 1CK2A 2DXUA 3OSSC 4OMMA 1X6OA 2J6KA 4IUQA 2IG0A 4Z8AA 4J9HA 4EMKC 1M8MA 5LJ3d 3BF3A 1UJ0A 3MWPA 4DTRA 2HKNA 1FMKA 2HBLA 4M77F 4O8KA 2F9ZC 3HKCA 5KQ8A 4Q5WA 1I07A 2QXLA 1NJWA 2Z1TA 3KK7A 1NM7A 4BROA 2EGCA 2GBQA 2PTKA 1P92A 1YJ9A 2X6SA 4MLHA 3HL8A 2X35A 4WQ5A 3TAQA 4NLCA 5EU7A 1ZA1B 2XY5A 4C8QG 4TUYB 3SYZA 4ZHQA 2DKGA 5LJWA 1B9FA 1IREB 3HVRA 3VQEA 4XU2A 4I55B 1ILYA 2RQWA 4HT8A 4M45A 4PWTA 3VJPA 1VQ4T 5LMNK 3H1VX 3KHNA 3EFRA 4II1A 2EHGA 3AVLA 1O9SA 4JAXA 5LMUK 4PJOE 2W6LA 3C7NB 4KHUA 3F6MA 2ROTA 3IEWA 3JAWB 3N2KB 2Z1GA 1X2KA 2ZPIB 3HI0A 2NUTB 2FLOA 3P38A 5BPMA 3VMFB 4FK2A 3LPUA 5DMRA 3P10A 2D8HA 4BQLA 5FPMA 3V9ZA 3HPWA 1VIFA 1QCOA 4BI4A 4FJIA 2GFUA 3AHUA 2OPRA 3CCJN 3EG9B 4DFMA 2I6DA 3G71F 3PO5A 4GMJB 1WJRA 1YI2F 1WN7A 2L3SA 2BZ8A 4DF4A 3EFOB 4M3TA 5C0YA 1BI2A 4CC3A 2YNGA 1OZ2A 2DRMA 1B07A 1C6VX 3TAGA 4KGZB 3SWNC 3HKCB 2OTJF 2VAMA 2COYA 2DZCA 5AR0A 4CRIA 2KRSA 4HVUA 1H3ZA 2GTDA 4DG1A 2RK1A 1N6AA 1D8YA 1QVGS 2KLAA 2RK2A 2IIRA 2GUIA 4ZHQB 1NJIH 4AF1A 1OH5A 4KUIA 4B3RK 4A4FA 5LJ5h 4FZYA 1M30A 3O5ZA 1UTIA 4X65K 3PLAC 3D00A 5GANh 3EGDA 4NOYA 4U39A 3ZT3A 2H6LA 1NG2A 3E9GA 1VQMA 3KLGA 3BUZB 3CC2F 1M9SA 1KSWA 1Q7YU 3QYHB 3WXJA 1NGEA 1KK7A 1WOQA 4PJOF 5HRSA 1J7HA 1OPLA 3MCAB 4O0JA 4FLUA 3KIZA 3VQ6A 2E1ZA 2D0CA 1KFSA 3ZT1A 4WE1A 4DQ8A 4KI6A 3WXMB 3CCQF 1CSKA 4IOAL 4DV3K 3PX0A 3CQ8A 2HRUA 4M75D 2P1JA 1OH6A 4BC2A 5BN9A 3MEGA 4DBRA 3CD6T 2HDAA 1JXBA 2AIFA 2QW9A 3V4IA 4J2BA 3FLCO 4FJNA 4YDUA 3EG1A 2QWMA 4LFCK 2BTOA 1BG3A 4JUVA 2OI3A 2HBPA 2NRXA 2OPSA 2X51A 3L0QA 5AQRA 3QNNA 2KFNA 2OANA 1Z5VA 3LWRC 3EGDB 5KPZA 4EMKA 4N0AC 3IS9A 2UYNA 2AKKA 4RW6A 5DCVA 1RL2A 4A54A 2PY5A 3KD1E 2EVRA 4B1YB 5T7BA 2HAXA 2ASMA 5AQIA 1TXQA 3CG6A 2RPNA 1CN7A 4UQGA 2O8CB 2SEMA 3OYGA 2X78A 1O13A 3J7AR 1BU1A 3GTZA 1YJ9T 4CZFA 3KFVA 5IT9O 4ILHA 2CP7A 1W2BS 2AK5A 4BRHA 4FWOA 2CP3A 2JNGA 1PSEA 2P9UA 3VA3A 1RT6A 1HNWK 2UYTA 2ZVYA 3FZLA 5EYPA 4I2QA 2ZVZA 1K9MH 4CGFA 1TUDA 3EG3A 5KYNA 3PSFA 1S72Q 4FOIA 2WONA 5AQUA 3JYTA 4ELZC 3QICA 3D01A 5IWAK 4CJVA 3QEIA 1YITQ 3M4YA 4OPJA 2YUNA 2J6FA 2K6DA 4FT4A 3M3ZA 4M7YA 4BDPA 2BZYA 1WYXA 1YIJF 1OEBA 1WQWA 1KAYA 1S22A 3DRRA 3HP6A 2OTMA 3U6FA 3C8LA 2ZF5O 1LWEA 3E1YA 3SUPA 3NFCA 5EZYA 4EMKB 3E2UA 5BPNA 3BDPA 2HHQA 2UYNB 4Y91A 1VQLF 1VQ8A 3SWNA 5CQYA 1IV0A 5I22A 4B9SA 1YJNA 2PQWA 3U3GA 3N4YA 3VYTC 3WGLA 4FFBA 3O3FA 5GJVB 1AVZC 4P5NA 2KZMA 1X9WA 5C12A 1B92A 3A5NC 3PFSA 2E6MA 3RNJA 1Q81H 1HNIA 3PLAA 3IUCA 3MQWA 1W70A 3OONA 2B4JA 4YJ2A 2P9UB 3QWXX 2DIQA 3AGKA 5EYPB 3VI6A 1MMDA 4C82A 2GUPA 4PKGA 2ZJRL 1VQMT 1W5FA 1WFWA 1WHJA 2X3XD 1XBIA 4B8AB 1IB8A 3FEOA 2RA2A 3H08A 2Z1FA 3RA6A 3TAPA 4M4ZA 4DQQA 3CQTA 1NYFA 4EI8A 4HCCA 3TU4K 2UXCK 2KGWA 4ZI7A 4HA8A 2OTLQ 3AARA 1Q95G 3CYMA 2A36A 4LDVA 2VWBA 2DXBA 2OAUA 1QVGP 3IEQA 5CIUA 5GAMd 3CCVQ 5EZYB 1NPPA 3C95A 2F8TA 4CK1A 3W0LA 1IPAA 3CPEA 5GAN3 1VQ9F 3SWNB 2FBXA 1X6GA 5HK3A 1HD3A 2Q1XA 4M3RA 1SEMA 2G8VA 1I39A 5CK9A 1RTIA 4FFBB 1NKBA 2HSTA 2O4XA 1ASVA 3ZP7A 1QHTA 4OKEA 2VYPA 1KC8H 4DCHA 3DDNA 4D8DA 3CCRQ 4NL3A 1IBMK 2HHXA 1K4US 5C24A 2NLXA 2G8KA 2ZAEA 3L2WA 4N0AA 4YJ2B 4NCAA 2W42A 1OOTA 5EAZA 3V6DA 3EO3A 3E20B 2RHIA 1YITA 3JCMX 2FF6A 1GRIA 3PSIA 1QP3A 5HRPA 3ER0A 1NE8A 3TD5A 1MNEA 2PU9B 2FBVA 4M75G 4DR6K 3H0FA 1BQMA 2WOMA 2DJQA 1AWXA 1S72N 1DKGD 1CKBA 2DRKA 1Q7YR 4MDBA 2ABLA 2EIFA 4HTUA 1ZBXA 1YITN 4ZI7B 1IGUA 1R0CB 2HQHA 4KB1A 1RAHB 4CJWA 4HCZA 1YN8A 2KT1A 3WNGA 1TGOA 2EX3A 5I11A 4DSJA 1TYQA 3REBB 1BOTO 4K41A 3L2ZA 1U3PA 1JD1A 2JS2A 2OAWA 3FE1A 1QS4A 1ZA2B 2Z01A 3VENA 3T80A 3HRUA 1NK5A 2O4XB 1QVFS 2EJGA 3IMXA 2FPEA 3NGIA 3MEAA 3M55A 2DMOA 1T6DA 4NYFA 3CPFA 1Q9XA 2HVHA 3E9OA 1Y07A 2V1QA 5HK0A 3T7ZA 1JL2A 2OPQA 4A61A 2VXYA 3MKDA 3G6EQ 3C9TA 5MN4A 4O5BA 3V8LA 3VYHB 1VSHA 1RDWX 4ZN1A 1VQ8T 2NZTA 3HSBA 3BYQA 3PE0A 4XU3A 1K8AR 2JWLA 1SPKA 1YJNT 3H3OB 2DT4A 1VUBA 3AVGA 4CZEA 5LJVA 2CVLA 5AQQA 3CC4Q 1MGQA 4RKUE 3SBGA 2FL7A 3SPZA 4F17A 4CCHA 3SIUA 1C0MA 5CCAA 3ESJA 1G3YA 2FPDA 3LDTA 4HUGA 3HWUA 1XC3A 3F0DA 2ZD1A 3R6MA 3CJCA 1T0JA 3AVFA 3JCMd 1VQ6Q 2OTLN 1VRTA 3ZL7C 1DLOA 3ZX2A 4BE0A 2LBWA 3CCVN 4OB2B 2XO7A 4I50A 2ITMA 2KQ2A 3AA2A 1VQ7A 3GG4A 4KH4A 4CZMA 4H5TA 3LWHA 1ZHIA 3F0FA 3BFMA 1H48A 4X1KA 4RW7A 3O9TA 3VPZA 1U4BA 3Q8HA 3RYCA 3E22A 2ENMA 2Z1EA 2UYKA 3V7CA 3KLEA 2AMTA 1HX1A 3E01A 3CCRN 1Q8IA 1YVUA 4M7DD 1KQSF 1E4FT 3NPFA 4R40B 2KTUA 3V9UA 5LJ5e 4XTZA 1NJXA 4CD1A 2ED0A 4ME7A 4FYWB 3M54A 5GANe 3RMDA 2CZ0B 2PUKB 2YLBA 4IUVA 5GAOm 4KH6A 4YOTA 2HP0A 2V8JA 3MDOA 4NUTA 5AQFA 1T0HA 4KWEA 2JZ2A 1HPMA 2V7ZA 1WZOA 2ZGWA 3OSVA 2PFUA 3O4WA 1O75A 5TKWA 4PQUA 4JLGA 2HNDA 4C8IA 1RQ7A 3DLEA 3QESA 1S72T 2COWA 1BKBA 4QQGA 4E7SA 2CP5A 1YITT 1WAJA 1GL5A 4JV5K 1RQ2A 4I50B 5FRMA 1KFDA 5FLXE 2MCNA 2LBTA 2RI2A 4C8QC 1X9JA 3QERA 1AD5A 4BC5A 4X1KB 2YHTA 4F16A 4LY7A 1UUEA 4C8GA 1KAZA 3CC7F 1RACB 2Q1NA 1LV5A 3LDPA 4DOWA 1O1WA 1JLAA 4DA4A 4BR2A 3T19A 1UI9A 3E22B 3JCMJ 2YNHA 1U47A 3KTQA 1JXMA 2CH5A 1VYUA 4B1WB 5JLFA 4DR5K 3O80A 5AJ3K 4LF7K 2HBMA 3FPIA 3NHNA 4O6JA 4ZN3A 3CC4A 2WC9A 1U2VA 1NEGA 1SKWA 4LSLA 1YAGA 3JCMP 1BK2A 1AZGB 3HFNA 1W97L 3G6EN 1SL1A 2HP0B 1ASWA 4DV6K 3G25A 4AQYK 4J2DA 1OULA 2JM8A 2UZHA 5CVIA 1D5AA 2O8DB 4BY9D 3NAEA 5JICA 3S3NA 3RYFA 3CC4N 2P9IA 3HYFA 3OW2F 5HY6A 1PD0A 3VV0A 3KKRA 3M9QA 5IAYA 1YWOA 2DYIA 3TCJA 5IXFA 1VQNQ 3T1AA 3CG7A 4DHYA 1VQ6N 2VYTA 2EQJA 2GQVA 3R9PA 4DWIA 2LP5A 1BB9A 3HVTA 4Z4GA 2LCCA 1VSKA 1Z6RA 2HBJA 3TSUA 1UG1A 1K73O 1BO5O 4KHSA 1IXDA 2P9PB 3TPQA 5MLCQ 1UGSB 5AQKA 3EE9A 2D6FA 3A8HB 4C0DB 3AV9A 2E2QA 3OW2M 4FW1A 4M41A 3SV4A 1Q82H 2KFZA 1AEYA 1Y97A 4BC4A 3OS1A 2RJFA 4IKFA 2YHWA 4PKCC 4EMHA 4OKKA 3QETA 2B8AA 2BKDN 1RLPC 5GINC 5CQXA 2P9IB 1PF5A 5J1EA 5IN1A 3SJJA 4K0KK 1OFUA 4JK8A 5FLXM 3ZETA 4BRGA 5BPLA 6AT1B 2DNUA 3DMJA 3NF7A 2KSSA 1RI0A 4DQRA 4LDWA 2QEXQ 5FNVB 1KIKA 4JI2K 5BREA 3X28B 2VXEA 4C8MA 2KZZA 4BRQA 2V26A 3K14A 1V4SA 3KBGA 1NGDA 4M42A 3NMUA 3RESA 2K3BA 3CCLF 3LYBA 2DE0X 1D1BA 3ULRB 3SUOA 1RLGA 3AVMA 3TAEA 1I3AA 4BWJA 2OZSA 2M51A 2HL3A 3HHTB 4N4GA 4OJRA 4A2AA 4BGBA 3V9XA 3HP9A 4E0DA 2QWOA 1MWMA 1H92A 1VOMA 3ZLJA 3AVBA 5KCOA 1KVAA 3G4SQ 1NMUB 4M7DG 3INZA 1ATNA 3CB2A 4C8QA 1VK0A 5GAN4 3WNEA 4XQ3A 3OB9A 4IURA 2EJ9A 4J8FA 1UOCA 3O1BA 4G1QA 3D0PA 1VQNA 2O31A 2RB9A 5I9EB 3G4SN 2VQFK 3ZETB 1XHZA 4XH4A 5CR4A 5HOOA 3MN6A 2ZODA 2HL5C 2O01E 1W5EA 2EGAA 1VQKQ 3M5AA 1VSEA 4IIOA 5AZIA 3CC4T 4DS5A 3KJJA 2JTFA 4JYAK 1VQOF 4ELUA 1WA7A 4PJNA 3AA3A 3DM2A 1TKDA 4B3SK 3HPOA 3VTHA 3HBTA 1VQNN 1VQ7F 1D4XA 3VF2A 3P8DA 3ASKA 4M7AB 3R6NA 1NJIC 1VQ6T 1SQKA 4W5RA 1TUBA 3TQ7P 3DXMA 3R1XA 2CHSA 2KBTA 3CMEA 5HRRA 2X4XA 2L0AA 3AY9A 4PJJA 5A0DA 4JK9A 3EKSA 2K7AA 3O08A 3GIBA 1A5WA 4JRIA 1K73U 1LAWA 2MAMA 4GLMA 2V8KA 4JLIA 1PCXA 1I5LA 1Y96A 4JHDA 3V1QA 2CT3A 3A5ZB 4LE9A 1XC9A 4C8QB 2QG9B 4Z02A 2FF3B 3AVHA 3SQ4A 3TABA 1NKCA 3LX7A 1JFFA 5C6SA 2L8DA 2XHBA 4DQ2A 4D8KA 1WSHA 4BR9A 2PMPA 1NGJA 4C0ZA 2NRTA 4IOCL 1ZUKA 4KRTA 2QEXA 4DR3K 3RIRA 5GAOp 1I5OB 4JKDA 3QZ5B 1XNRK 1U5SA 1FJGK 5AZIB 1VQ5A 2RHXA 3QDRB 1NGAA 5GAPK 3RMQA 2FSNA 4M63C 4FLTA 1DEJA 2DL7A 3B6PA 2QEXN 5ADXH 1HYVA 2F9TA 4AFUC 4XEIA 5GINA 1NGIA 3OJSA 3SIVA 3O8VA 1IGQA 1JXEA 1GCQC 4CJFA 4YOVA 1FWZA 3DXMB 1TV6A 3JB9J 4OGEA 2FSKA 2F2WA 3G4SA 1TL3A 2QDYB 1VHXA 3MWTA 3P39A 4YOWA 4MMLA 3IG1A 3UT5A 1ATRA 5CA1B 2RF2A 3HKBB 3TREA 3SEMA 2LX9A 4X34A 3MXIA 2E2OA 3JAME 2YI1A 1Y96B 4OMPA 1YHQA 3X26B 1MWKA 4JHDB 3PMTA 3WXKA 2G9IA 1EQYA 3ENHA 2JN0A 5LJ3f 1REVA 1N9SA 3V8JA 4E7IA 1KQ2A 3D2FA 2V52B 1WNSA 3CM5A 1QQCA 3P1GA 4GY2B 4B08A 1JFFB 5JLHA 4ID5A 3SNNA 3OMGA 4C4WC 2L2PA 3H46O 1EXQA 3CF5L 1VQKA 2HHUA 3N4ZA 3VUBA 4FPAA 2LMJA 4TVRA 1VQPF 1MV0B 2COZA 4MZTA 2EPDA 2YKMA 4TSXA 3RSEA 4BRDA 4M75C 4C5HA 2XDPA 4IJAA 4CJ5A 4HUFA 1QSSA 4A4GA 2DM1A 2F5KA 5GAN6 4M7AE 4J9FA 2PUOB 2B6AA 1GBRA 1VQKN 2HQXA 2GX9A 3ZSWA 1Q7YC 1UFFA 1FFXA 1ZBJA 1SV5A 2G8FA 3R6OA 1MU2A 4AM7A 5M1QA 2CP0A 5LP6B 3M0PA 4EIAA 3G71Q 4EP4A 1UAXA 3NH1A 3VU3C 1VQNT 1ZBUA 2HMIA 3KVGA 3C65A 3TI0A 1YI2Q 5LYJB 5CYQA 3UT5B 4KULA 4C8QE 1QAHA 1UGRB 4DB3A 4O2AA 4OGCA 3FRNA 4IBNA 5KYYA 4JK7A 1GLJO 2BDPA 2HNZA 1G3TA 4FJMA 2F1LA 2UYPA 4BD3A 5AFUH 2M0OA 5L8RE 1NZ9A 2EW3A 4BE1A 2C06A 3D2FB 5FPNA 1JB0E 1OH7A 3JVHA 1TG0A 3QFUA 3J7YP 2RE2A 2MI6A 3OYIA 3QJYA 3FD5A 4B46A 4JKEA 3THXA 3ZSVA 3VYSC 3CXCA 3CMET 2DYBA 4M7XA 1R1MA 5AVMA 4OMFB 1NJYA 3RSEB 1ZWZA 3M8PA 3WVEB 2X74A 3EKUA 4CHNA 3L2RA 3KK2A 4QQDA 3AVCA 1C0FA 2R5AA 3QXEB 5FDLA 3H8ZA 5JS2A 2R58A 1J53A 2I7NA 5EX5A 4M7AF 4CJ4A 1ZX6A 2DFUA 1W2BF 2P0KA 4OMOA 2CSLA 3JAMM 2VB6A 4Y0WA 4KBMB 4EI7A 3CCQQ 2X4YA 2QEXT 1W7AA 4ISEA 1YJWA 3T1HK 1QZ6A 4DU4A 4M3XA 4O2AB 4C8LA 3RE3A 5KYYB 3SPYA 4BRFA 1UEBA 1VIEA 1R8OB 2DL8A 1WDXA 3KJKA 1GCQA 1G15A 1HJRA 1UHCA 2H8HA 2KW4A 3MO8A 2OCEA 3KLIA 1KC8C 5KI6A 4CZKA 2CT4A 4DFKA 1N8RH 2YRCA 1M1KU 1Q18A 3DLHA 3I56Q 2DAQA 1JLQA 4NYNA 2YJFA 3G4ST 2WUSA 1W2BM 5A2QE 4ISGA 1SA0A 1E4GT 4ZHRA 2F5TX 2YCHA 4AFSC 5LJ3j 3NVMA 4EFHA 3CCEQ 3CJ9A 4MFBA 1NJIO 1D9FA 5HY1A 5GMKm 1YHQT 3BF1A 1PC0A 4ZNXA 4N76A 3JCMc 2CS7A 2ZJPL 3GF5A 2Q0RA 4MZPA 1EWQA 3WGJA 3MXJA 4L6V5 2B5JA 2GV9A 1NLVA 2YNFA 2KE9A 1VQKT 1C1BA 1LPLA 5E26A 3RWUA 1RBUA 1SSHA 3G71N 4I4TA 3ZX0A 4M75A 3VS3A 1T0AA 3CYPB 1YI2N 5AT1B 1GOAA 3CFRA 1PKSA 3NTIA 1RFQA 1RBSA 3NHGA 3ZSZA 4FCYA 5AQXA 5C42A 2CH4W 3BDUA 4N4IA 3CYQA 2EFIA 4BUGA 3VS5A 4FM0A 1EFNA 1Y71A 3VA0A 3MBMA 3VOVA 1GFDA 1WSGA 5AQWA 5F2RA 1PRLC 3D45A 2ZCFB 3LH0A 3N4PA 4CJKA 4F4KA 3SI6A 4GV9A 1RDDA 3HTNA 3C6HA 1VQLQ 4ZK7A 2HZYA 1S6QA 1VQ5F 2HMAA 5C2DA 2Y1IA 3META 3OJUA 3LANA 4CGIA 1YQNA 1WHLA 3TTCA 1V1CA 2ZAUA 1LWCA 3NBPA 4RW9A 5EG2A 5J3BA 2GQIA 2RQRA 4AHRA 3OA6A 5KCHA 2PVDB 4K8XA 4E1MA 2HHSA 3BDLA 4GNIA 2ZJQL 2V9YA 4CIEA 1MMGA 2JTMA 4DBQA 1LW2A 4CEAA 3AO4A 3LWMA 1T7PA 1M1KH 1M3BA 3LALA 3I5RA 2WTUA 4I4TB 4M75B 4JJBA 1H1VA 3CCQN 2ZQBA 2QTVA 1WXTA 2M1HA 2EYYA 3EGXA 4OMLA 3EE8A 4FWMA 4FWSA 4DLEA 2PYJA 4V19S 3JB9I 4LDYA 5A2QM 3OYNA 4OKJA 1K9MO 1NYGA 4WYBA 2I6RA 4RCBA 4DQSA 3V7EA 2HW3A 3QZ9B 1OX9A 2CH4A 3VYGA 2KR3A 2EGEA 3CCEA 4CJLA 4BVQA 5JH7B 4FLZA 2P0PA 4IDHA 3I56N 3IAYA 3D54A 5D6YA 2E3HA 5GAMf 4H8KA 5EWRA 1QP2A 4QS8A 1W41A 5IH2A 1EIFA 3FB9A 4CK2A 1UA1A 3CCEN 4DR4K 2VAPA 1QVFF 2VC8A 5EY4A 2WACA 3W3DA 2IVWA 1BI0A 5FWCA 4HT9A 4DQIA 4GKKK 5ELZA 4LF8K 3ZSYA 4JJCA 2XU8A 4F7UF 4HNAA 4JI3K 4XIUA 3AVKA 2PVGB 5M1PA 4DV5K 3VGMA 3EGXB 4RW8A 4Z4CA 1Q81O 3F70A 5CAIA 3TSWA 4K42A 4DTOA 4M78F 1IKYA 2IQQA 4IJNA 5KRSA 3E9PA 1KG1A 1BCOA 5AYFA 1RLQC 3M53A 4FM1A 2MPXC 1ABOA 5C0MA 1VSDA 4ELTA 5AQNA 2O8FB 4GLKA 4W5NA 4M7DC 4FYVB 1A0NB 4J9EA 1KD1H 1OX8A 3ISNC 1BYMA 3L4IA 4M3UA 3LZIA 3HRSA 2A7YA 4ATOA 4JKAA 1VQLN 2K1SA 4XTXA 3CEYA 3CCJA 3DLMA 1TK0A 4ZOLA 1ZXOA 3OW2P 3RTVA 4BT2A 3DWLA 3C94A 4RUGA 2HF3A 4C92F 5LY3A 4M75E 3AAQA 3FJPA 1M90H 4PUOA 4DMNA 2XY7A 1RAIB 2PNIA 2W41A 4F8RA 4J2EA 5CKEA 1YJWF 4HNAB 4XK8E 3JV3A 4BT7A 1ZSZB 2FO0A 1L3SA 1TWBA 4M77D 3J8AA 3MECA 1KC8O 4R79A 3A8YA 2FSJA 4CC4B 3E1SA 2FZCB 3BY7A 1A5XA 4PFZA 2KDSA 4Z89A 4A57A 1HRHA 2D0PA 4FSXA 5H1SQ 3PVLA 1KNKA 1D09B 3S0WA 5CZ1A 1Y64A 1V29B 3QWYA 3UWNA 1JLFA 3LPTA 4C8NA 4N41A 2YYEA 2LDMA 3PX6A 3HJWC 4GW6A 4J83A 3K12A 1OU9A 3JCMf 3EAEA 1E6GA 1K9MU 4GVEA 4C0FA 1QQJA 4X66K 4CJTA 4ZOLB 3S03A 3M4SA 1JBMA 3RKYA 3M56A 3I56T 4BY9C 1GCPA 4H03B 4M3ZA 2HHWA 1ODEA 3LGFA 1QWFA 1K0SA 5GAMj 1TAQA 2E5QA 3CMAQ 2E88A 4KTWA 3VQBA 3CCET 3WJRA 4JI7K 4HXJA 3M5RA 4IO8A 3K58A 1VQ4F 4IUUA 4FJ8A 1W9HA 4E6RA 1P8ZA 1B7TA 2P9SA 5JQGA 1W59A 3JCMb 5HXUA 4ELVA 2CYZB 4JRKA 3M84A 1NOYA 3ERNA 2NRWA 2PAVA 3LM2A 4AHCA 4CBUA 4XTYA 1GZ0A 1X1PA 4FYYB 4B1VA 5CA0A 2KAFA 3MMVA 1Q81U 5AQMA 4ERHA 3SQ2A 2X6NA 3THKA 3QMLA 4KB0A 3BY5A 3QEVA 1M2VA 1VYTA 1RI9A 2D5RA 3M0SA 2YUOA 3SB2A 5AQGA 5BRHA 4HWIA 1AZEA 2V51B 3EEQA 3L7QA 2K9GA 4PJOD 3KD5E 2C0TA 3D6RA 3CC7Q 4CGHA 1W0HA 5BR8K 3AT1B 1XQSC 4JJDA 3AGRA 4WTOB 1GLDG 1D0YA 1S9GA 4GV3A 2RQUA 3M8RA 2JVVA 2WFBA 4OF1A 4QVDA 3JB9F 2CUBA 4M7DA 1UA0A 4A5BA 1LAVA 1YF5L 3JAKA 2Y4XA 2HHVA 3QUIA 3NTKA 1ASUA 4AHSA 2GF7A 2P9SB 3EZWA 1U1SA 3PIPA 2P9LA 2BE2A 2YWWA 3CCJT 5CB4A 2QA4Q 3O8MA 3PIPL 1WB9A 4QS9A 3U9ZA 1KC8U 5CA0B 1LOTB 3RMCA 3LYIA 1UECA 4CEZA 3S9HA 3HM8A 3RYIA 1NJIR 2HBKA 1V76A 5KX5A 2YHYA 2Y4YA 1M2VB 4L59A 3LP0A 1E6HA 5I21A 1CXQA 4BVRA 3CPQA 4HCKA 3CD6F 4CHYA 1U45A 5I3UA 1OAPA 3THYA 2LQKA 4CBWA 1RAAB 4BG9A 4EHTA 2SRCA 4RTXA 2LT4A 2YV0X 4B9LA 3BE3A 1PG5B 2HNIA 2Z1JA 4JI1K 3OMCA 4YJ3A 3QHSA 4C5GA 4M7DB 4B3MK 4DFPA 4Z88A 1SSFA 3CMAN 4FLXA 2DK3A 3TR8A 4OMNA 4AHUA 1BIAA 4K8ZA 1COMA 3FC3A 4C8EA 3CHWA 3M59A 4J9BA 2BO1A 2AIRB 4FLYA 2L3RA 5SZTA 4KPYA 1NQ3A 3DOKA 4N47A 4CEFA 4RWTA 3FJ5A 5DM7L 3J81O 2V8IA 3H1QA 1NBEB 3ZFJA 3SJHA 3SZ2A 1YJ9F 2ZPBB 3NH2A 5IT9E 2FHDA 2E6NA 2NRHA 1N5YA 3RYIB 3A8OB 1VH8A 3OYBA 2IS3A 1V4TA 3N2GA 2NYSA 4QAGA 2K5IA 5HL7L 3J7AF 3HOTA 4QOZB 4RG2A 1B3QA 1QVFM 3REAB 1WXBA 1JKHA 3K5MA 3THYB 1RLUA 3JB9H 3CCSQ 3HK2A 4CFCA 3CCLQ 1IJJA 3QLHA 2RHOA 3CC7N 5IHIA 3RMSA 3J7ZO 4YJ3B 4DEYA 2MIOA 5CO7A 2MWPA 3CETA 4BVSA 1S72A 3RR6A 2ZPFB 1IG8A 3O9UA 3NDKA 1K73C 3FZFA 1NBWA 3MHXA 1W6XA 1K9MR 3J80O 1X9MA 1DTQA 1AHJB 1OPKA 4HCBA 5I42A 1DT9A 1H47A 4RTFD 1Q82O 1TVKA 1SKUB 1UHFA 2VASA 4C0GA 2XD0A 2NRRA 3EN9A 2QA4N 3NF8A 2ATQA 5GAHP 2VG7A 2DBKA 4IUTA 1NG9A 2RJEA 2L3PA 3D2EA 4CI6A 4JLHA 1GFCA 3DRPA 2KYBA 1D3BA 3N2GB 2DPPB 1VQMF 2RQVA 4L3QA 1VQOQ 4WF2A 3I5SA 4Z94A 3KZBA 3TWHA 3MN7A 1Q86H 3VQDA 3OBYA 5EB1B 3TD3A 4MDAA 4OB1B 4M7DE 3A5OC 5BR9A 2A1RA 5M9OA 2EYXA 2I7PA 2Q3SA 4DV2K 4IO9L 2YXYA 1C0UA 4A53A 3QO9A 3V1RA 4DSEA 2P9KA 3I0SA 1Q81R 4BG8A 1JRIA 5MN6A 1ZBSA 2CZWA 1UDLA 1W2BP 5CKDA 3VEOA 1NM1A 5KMGA 4EMGA 1S3XA 2PYLA 2EKHA 3NE6A 5IT9M 3LGLA 3TU5A 4LFBK 4C5IA 2OTLA 3CMAT 2A37A 3MJXA 5HY2A 4PKIA 5A0LA 1CZAN 4X20A 3CCVA 4HVJA 1RTDA 1TH7A 4BVTA 1R0BG 2FEIA 3GL1A 3QKJA 4HHTA 3D2EB 4WF9L 3B6NA 3CQXA 2DXTA 2KNBB 2E70A 1U6ZA 4O5VA 1TYQB 4H5VA 2ECZA 1TAUA 1JQQA 2YJEA 4BE2A 2GTOA 3G10A 2RF0A 4AT1B 2RJCA 1CZ9A 2QASA 5DLQE 3CCRA 2UXBK 1FSZA 1W42A 2CW4A 2AZVA 1KJWA 4CC2A 3UPUA 3CCSN 3CCLN 3S06A 8AT1B 4G4XA 3H9NA 4ANJA 1KC8R 2ZPHB 4BB7A 2YSQA 2P9KB 2XDBA 3F9KA 3LZJA 3SUNA 2HS0A 1NGHA 1W5AA 1FMWA 1RUWA 3CJBA 3M4GA 3K5OA 3C4SA 2W10A 4CEDA 1XMOK 3NK7A 3HO1A 3QIIA 2O2OA 4DXDA 3PIOA 1S1UA 4AG1C 4JI5K 3H45C 3ZSRA 3VTIC 2A28A 2DTHA 1K6YA 4PHTX 3CJ7A 4E6EA 3ZEUA 1U1TA 3H6EA 5LJ5d 3PIOL 2Z1UA 3C9RA 3QPHA 4X20B 1D1CA 4BT5A 5DM6L 3ZT2A 5GANd 1VQPQ 3NGYA 4CZHA 4F6RA 3AO1A 3JRZA 2EYQA 4OLBA 4KHWA 2XG8D 2G8HA 3O4NA 1Q82U 1K0XA 2X4JA 3ID6A 2QA4T 2OJ2A 2CZ6B 4JKGA 4V2SA 1VQ8F 3JARA 1YJNF 5FW9A 1RDCA 5LJ3g 2LC4A 4H0YB 1JJ2A 1VQON 3ZT4A 4DTJA 2L26A 3R3LA 4IG3A 2LNVA 3EH2A 2MMPA 3RYCB 2ZOVA 4IOXA 2F69A 2I5JA 3G6EA 2OA8A 4HVWA 4PK4A 2FVUA 3SQ0A 1WAFA 5GAN5 1RBVA 4LC9B 5KGWA 1IH7A 4U3JA 3BZCA 1JN1A 1BQNA 1T03A 2P4TA 2P4RA 3EHQA 3IFRA 3PX4A 5JS1A 5JVDA 1NLOC 3V4DA 2BTFA 4CEOA 2UUCK 5J2NA 1BDGA 3ZEUB 1X9SA 1VQ6A 4M3WA 2J06A 4J7FA 3UF4A 3TD4A 4HTLA 3CPWA 1M1KC 2JGUA 4CVNE 3NH0A 4F6RB 4FZXC 1ARKA 1WIEA 1E7OA 1JL1A 1YCYA 4DEXA 1S1TA 1GLEG 2QQRA 3ZEHA 4GVMA 4BRCA 3KLFA 1HYOA 1N9RA 2Q36A 4JKGB 3NVKA 3LMEA 3JARB 1X6BA 1NK6A 2VXFA 3RMAA 4A2BA 4PA1A 3NGPA 4J6YA 1C6VA 1BBZA 2OTLT 2DPNA 2R5MA 5AQSA 2DD4A 1U3LA 5IHNA 4LXCA 2NWMA 4FW2A 3CCVT 4BY6C 1TK5A 1IBLK 4QVZA 2VGMA 4F2SA 2JNBA 1S72F 1QVFP 2O8BA 2BTTA 1KVCA 3CQYA 3ENBA 4EB6A 4OP0A 1YITF 4U3JB 1VAZA 4DTUA 3RERA 4KHPK 3CCST 2FZKB 3MP1A 4CFDA 1U2VB 4CFBA 4LDXA 5JVDB 2YRDA 5G4VC 4CE9A 3M0UA 5HCKA 3CCRT 3D7SB 2I2LA 1TUGB 3MP8A 3K2XA 4M3YA 2XK0A 2RHJA 3RYFB 3AA5X 5EO3A 3MEVA 1AWJA 1MMAA 3L42A 5KYUA 4KT0E 4G4ZA 1C0GA 2HD0A 3FZHA 3HM9A 1IHWA 2LQ8A 1VQPN 1QSYA 4FJ5A 3VS4A 4BRPA 1D0ZA 1U48A 4PJMA 3V7QA 3K59A 3V3TA 4CGGA 9ATCB 1QQMA 3OYJA 4JKFA 3VTIA 3DB4A 1NGGA 1ZUUA 2XDDA 4IEEA 2YKNA 2JJ9A 5GJWB 4FZZA 2LJ1A 1SG5A 1ATSA 3VGKA 2DO3A 2E1HA 2C0OA 5L23A 5E41A 5D6XA 4EIKA 3QDFA 3JASA 1ZLMA 4KH1B 4MO5A 1S1XA 2FYKA 1MV3A 4UC4A 5KYXA 2R7YA 2DTIA 4KH5A 1NU0A 3WEEA 4BACA 4BGAA 2G8WA 4DUYK 3KLHA 2FZGB 3A5MC 4DQPA 2JOYA 4ZHYB 5HP8A 3HTRA 4O55A 2DTOA 2OTLF 3F73A 2CH6A 4MDWA 2KMTA 1TK8A 2NUBA 1Z25A 4CHPA 1WBBA 1XQHA 2XY8A 5KYUB 2I0NA 3G6ET 3EHRA 4QQ6A 3VUZA 4RQOA 1VYVA 2NLUA 2VGNA 2VVKA 4LDUA 3MPUB 2FC0A 3M1XA 3NFAA 1N8RO 2KT8A 1BCMA 5EB0A 4DV4K 5GAN2 2O88A 5F1XA 3M0TA 4LD6A 3NF9A 1XWLA 4KUDK 1NK4A 4FVMA 1W1FA 4ID1A 2CHTA 5C8YA 4B3OA 5AQOA 4GV6A 1RT3A 3PV8A 3JCMQ 3IRXA 2E4LA 1IV1A 3JASB 1PM3A 2RQTA 1VSFA 3VQ5A 4BR4A 2L3QA 3RRHA 4X3MA 5KYXB 3I55Q 3LWPC 3K5NA 2KRNA 3WEEB 4K43A 1U43A 5J2TA 3FBAA 5D7UA 3CCUQ 3FD6A 4O4IA 4BI3A 4TV9A 2EWCA 2EQUA 2W6KA 3LDOA 1CZBA 4CF2A 4R56A 2GCXA 2A42A 4NS5A 1C1CA 4B8CA 3L3VA 2BIVA 2QWLA 1D0XA 5DM7R 2LRQA 2LJ3A 3L6QA 4FWQA 3R8EA 1W55A 3HKEA 2Q2RA 2QAZA 3NVKE 1RCHA 2H8CA 4OVLA 5AZJA 1YUWA 2OX7A 1VA7A 3CCMQ 4FXDA 3JCMW 4RCHA 3QJ6A 2X9HA 1QQOA 1OU8A 1RTHA 1WSEA 2VCPA 1NK8A 4KREA 4J9DA 4XCQA 3ZP4A 4EI9A 3A1PA 2HQSC 2HHHK 3LDNA 4A63B 2CWJA 3RDVA 1Z5WA 3SUQA 2BTUA 4BT6A 1JJ2F 2JMCA 4LUEA 4IUPA 5EVZA 5C8YB 3U4LA 5A0GA 5CYMA 4WQ4C 2PVOB 4F3TA 4CF8A 1TUBB 3QINA 1WHKA 4B9WA 4X1IA 4ZGEB 3BZKA 4EPCA 1MHNA 1G5VA 4B45A 4PFPA 5LJ3h 5B8HA 3B6OA 5GAMg 2P51A 3A8MB 4DTSA 3KJVA 4O4IB 4TV9B 3CC4F 4JEPA 2BTQB 1LJOA 1M1KO 3N5BB 3QHDA 5LXTA 4JD2A 4W5OA 1RTJA 3VEVA 4BRKA 1VQ6F 4KH0B 5HP1A 4BY6B 1JJ2M 3M0RA 2CGLA 1B9DA 2VKNA 3A2FA 3V7RA 1HNVA 3CPWF 5IXBA 5AZJB 3O1WA 2VQEK 3C12A 4FM4B 5HLFA 2IDOA 4BR0A 2JLEA 1I0CA 2MYSA 1K9MC 4CJSA 1FNJA 3MN9A 2RJDA 1S5JA 1HYZA 4KKOA 1LOJA 3UT1A 3ZSOA 1M2OA 5CKFA 1N8RU 3I55A 2IAJA 2KK4A 5GMKj 3CCUA 1I1JA 1SL2A 1CLQA 3M8QA 3VIUA 4X1IB 4IHJA 4RTZA 3O4QA 3CPWM 2IOCA 2OZMA 1SDSA 2HVIA 1UFYA 3RYHA 1WJSA 3A5LC 3I55N 4PFOA 3OYAA 5ITZA 2M02A 2OTJQ 4LFAK 3CCUN 3SDZA 3RBBB 2AZSA 1SHFA 4JD2B 1LVKA 5LXTB 3ATVA 1UGQB 3PGGA 1NGFA 1X7OA 2E12A 2VWFA 5CZ2A 4QW2A 1J5OA 4OPKA 1GLLO 1Z26A 3VO8A 1HJOA 2AHJB 3VRZA 5J39A 1Q81C 2CGJA 2GBZA 5ECAA 2NUZA 2OHWA 1ZC6A 2K2MA 4X1VA 3CC2Q 2YHAA 3K9KA 3CCMN 1WSFA 4C8OA 2B86A 4J6XA 1WLJA 5GADP 4O4HA 1FFXB 3U23A 3EFSA 3C6UA 5F0XA 1KD1O 3LWOC 3TTFA 1BA0A 4X9CA 1VSJA 4KTZA 3J7AP 3FZKA 2K2VA 2O4IA 3LP3A 2BUPA 4JI0K 1KAXA 3E66A 2A3LA 4B1ZA 5GIPC 3JCMg 3RYHB 4YNQA 1XNIA 2LTOA 1M90O 5ITZB 1Y7XA 4RTWA 4JKBA 3R0PA 3PTAA 2E20A 4C8QF 3F0EA 2DEUA 4I9LA 4WQ4A 2VG5A 2CSQA 1WSJA 3H0HA 4J9IA 3IR9A 3K0TA 3DB3A 2DBMA 5KPTA 3ON1A 1VQNF 2RM4A 4EAHD 3THXB 4B9MA 2KTVA 3MEWA 4XU1A 1VK3A 1OKJA 2E1YA 4CJQA 1BUPA 3L3UA 4QS7A 2EAYA 3S0HA 4ILJA 2M0YA 3BGRA 4M7AD 1T3LA 4O4HB 1K73R 3WJQA 3G71A 4Z4EA 4RHAA 4DR7K 2MWOA 4CJ3A 3VN5A 2ATCB 4I7FA 4DTPA 1YI2A 3TAMA 2RI5A 3VS6A 3L2VA 1TUCA 3CMEF 1AWWA 2E64A 1S6PA 3NF6A 2N48A 3WGMA 1DJ7B 4RTUA 2FBYA 5DK5A 4BRLA 4CJ7A 2BUDA 5CE3A 5BMVA 4IIMA 1D1AA 4JNEA 1Q8RA 4QKUA 1Q86C 1J3TA 2HEQA 1BI4A 3WNFA 3EY1A 4MLEA 4EHUA 3SK3A 1HMVA 2LBXA 4H4OA 2R751 4OB3B 2A41A 3HOSA 2AKLA 2OTJN 1M5Q1 4JI6K 4DLGA 4MO4A 2E6ZA 1JLEA 1YIJQ 4E7HA 2Q0UA 3I55T 3HPGA 4I2PA 3F9MA 4CW7B 2RN2A 3VS0A 3CFOA 5KRTA 3CCUT 3CC2A 4E1NA 2G8IA 4AH9A 4BRIA 2QEXF 3HRTA 2KXCA 1G83A 1Q9YA 1MNDA 2F7TA 1ZBHA 4BW0B 1SA0B 2QWRA 3C0CA 1S1NA 1W3EX 3CJ1A 3OYKA 3HAXD 3CC2N 3UIQA 2QQSA 3OYYA 1BIZA 3HKDA 4R0KA 3CCQA 2V7YA 2HS4A 3CCMT 4N56A 1VQVA 1HKBA 4BT3A 2CZ1B 1K76A 5CKBA 2E65A 4XH1A 3G4SF 2DF6A 2NNWA 2JW4A 3CERA 3DLGA 1KD1U 2RHYA 1SHGA 5BMVB 3QFPA 4PNOA 4WFBL 3ULDA 3P4EA 3DOLA 1YHQF 2Z1HA 3DLRA 3TANA 5EIBD 1QQNA 1GO1A 1FMVA 2MQEA 4FL6A 3I56A 1YJ9Q 5AQVA 5KE2A 1WX6A 1WI7A 4IXCA 4H0XB 5AQJA 1M90U 4YHHK 2YDLA 4E3SA 3SCXA 4X64K 2CUDA 5GAMh 3THVA 3ZSQA 2QQAA 3QBYA 1UE9A 2JM9A 1N8RR 1W57A 1VQKF 5GIPA 3GE1A 3L2UA 1YXQA 5KGXA 3KUFA 4WBNA 1M3CA 1VQ9Q 5I2MA 3U9DA 5GAEP 2D1XA 4NLBA 2XICA 2HNYA 1TS9A 4JJNK 3SQ1A 5D3GA 1RADB 4BR5A 4FU6A 3OY9A 3OS0A 5KE3A 4LF6K 4JS5A 2DTUA 3HKDB 3F5TA 2HHTA 2DIGA 3HFOA 5K14A 4LUDA 3DAWA 4JI4K 1SS6A 4VUBA 2W8BC 4B9NA 4O0IA 4DBHA 4CJEA 4B9UA 3UATA 5JVHL 1NOZA 2H3JA 5CHIA 1ABQA 2QDLA 4TUYA 1M1GA 1WLPB 4ZGDB 2CGKA 1IZ6A 4ORZA 2D4WA 4KAZA 4I55A 2YLCA 3ZYYX 3G71T 1A5VA 2E41A 1YI2T 4FWLA 4O4GA 1VQLA 2RKIA 1YIJN 3CXCF 4A62A 1DGKN 4A4EA 4KHQA 2OTJT 3SAHA 1VQMQ 2NUTA 4WBNB 2O8BB 4ZHVA 1LNXA 1EO1A 2G6FX 1OZ3A 4FL9A 2P6YA 3T3FA 2A08A 3V81A 4CF9A 1BISA 5GAN7 4XTWA 3VQ4A 1ZSGA 1C0TA 4BQZA 2ZPGB 5LJ3e 4H5NA 4KI4A 1JY8A 4CIFA 4F04B 4KHYA 4M7AG 4IZ9A 3SBTA 3QTYA 3EG2A 4N4HA 1JJ2S 2ZE2A 3MAQA 3K9JA 3EFOA 2F9WA 1TUYA 3CC2T 4DSIA 4LN2A 3AVAA 2KRMA 2A40A 2LT1A 3WXLA 1M1KR 3IKMA 3CXCM 2HB5A 2ROLA 2D8JA 3RVCA 3O3GA 1K8AO 1HNXK 1NGCA 4ZTFA 1WQ7A 4JZ3A 2JUFA 4M78D 3T1YK 4N5SA 1RABB 1OVYA 4W5QA 3HSCA 1VSMA 3TARA 1NPRA 3JCMh 3CCQT 1YJ9N 3H41A 2NMUA 4A4KA 1VQ9A 4MDXA 1IHVA 4IDKA 5EC7A 1EWRA 5BN8A 5GIOC 3CPWS 2JMAA 2PBDA 2FRYA 2Y90A 5GAOq 4FVUA 3AVNA 1Q82C 1BI3A 1EKEA 3K57A 4C92D 1VQ9N 1JCEA 3TTDA 3WGNA 4CJUA 1W5BA 3VF4A 2K3YA 4CI0C 3QBWA 3HZ6A 1HNZK 2CSIA 3SD4A 1RBRA 2XMFA 4CECA 2QM1A 1U49A 3PAFA 1Q86O 2V1RA 4B9TA 4JRPA 4BR7A 2YRVA 3F0GA 2CZ7B 2D0BA 5SWMA 1LCKA 4M75F 1YTAA 3GBQA 3H3NO 4FYDA 4E1JA 5C25A 3VGLA 5LOVA 5AQYA 2L89A 2RHLA 1OV3A 3S6WA 1G99A 1QWEA 5C10A 2RHKA 4U7BA 2ED1A 5M1NA 1RAGB 3QDKA 5GONA 1I8FA 1YBYA 2PZ1A 2RPIA 4X1YA 1GLCG 3RMBA 3VQ9A 3QBXA 2KQWA 3GLXA 1QU9A 1KHIA 2EWNA 2RHHA 5LJ5f 5GANK 4ICLA 1XHOA 3O5BA 5GANf 2O8CA 1ONIA 2Y1JA 1VQ8Q 5GAGP 1MA9B 3WQTA 3I8BA 4DS4A 2QKKA 3OVNA 4FJLA 2XHCA 1YJNQ 1KD1R 1RDAA 1VQMN 1SZQA 5J2PA 1YIJT 4LD9K 1NMDA 3VQPA 3HJFA 2DZ9A 3K2PA 4I6MA 4B62A 3LWLA 4XAXB 4ZGJB 2IVPA 3QIOA 3VOAA 4E7KA 3QUWA 1AWOA 3VOBA 1I81A 3H6ZA 1ESVA 3AA4A 3LDQA 1VQLT 4KO0A 2WALA 5FJ4C 2O9VA 1M90R 3GOXA 1Z05A 3OHRA 1X2QA 3I33A 3OBWA 2LQNA 4ZTJA 1KVBA 2K4YA 5LOVB 3WNHA 3P31A 2EJFA 2E2PA 1OQKA 1QE1A 3ALYA 1FNKA 5JQGB 2G8UA 3V7SA 5GONB 2E5LK 4BI8B 3UKUA 4ILGB 4AG2C 3I56F 3C6AA 4X1YB 4H0OA 1YP5A 4HKEA 5D6WA 1K8AU 3AO3A 3L4QA 1G3SA 2DXCA 4J8OA 5JCOC 4NCGA 2Z1IA 3QEPA 4OLAA 2RMOA 2QTPA 3CCEF 4CHZA 3MX5A 1ZBLA 3EYZA 1E3MA 2IVOA 2F2XA 5J26A 4JN4A 4DU3A 4OO1J 3KWIA 1JU5C 2HVYD 3LDLA 3QIPA 4I6MB 4NL2A 4OX9K 4IWVA 5LL6Z 3CMAA 4DKWA 4FSSA 3JB9D 1KQSA 4EZ6A 2AJQA 3HXMA 4CZGA 5GIOA 3X24B 1GOBA 3LAKA 1N5ZA 1VQ9T 3ZBDA 4F7UG 4J6WA 1JJ2P 4CK3A 4LD0A 4H0PA 1Q7YH 3GDQA 2DFHA 3U8XA 3I9QA 2EQMA 3URGA 1MDUB 3JAKB 3ZO8A 2E5KA 4LNPA 5TKYA 1Q86U 1BA1A 4GKJK 1X52A 1YGYA 2P9LB 3RKWA 2J05A 4EP5A 3UKUB 1IKXA 4H0TB 4C81A 4M77G 5CB4B 4FJGA 3P5JA 5HWEA 3MEUA 2MF2A 5E84A 4M78G 1VRUA 3ITHA 2X3WD 4J7IA 2NRZA 1ACMB 3N4QA 2RH2A 4BWMA 3PNWC 3S3OA 1LW0A 3GOIA 3MCPA 3VEXA 5KX5B 4FOEA 3M0QA 5JVGL 2CREA 4AFQC 1WSIA 3CC7A 2FB7A 1PHTA 3CPWP 1YTUA 1NK9A 1VQ8N 3CCJF 1FYNA 5KQDA 1AOJA 2K79A 3LH5A 4NO7A 1YJNN 5LJ5j 4B9VA 4C92G 4CBXA 3QYGB 2HX0A 2RNAA 4WFAL 5GANj 3O3HA 4RTYA 2RB6A 5IJ0A 4LF4K 1Z9ZA 2EBPA 1K8AH 4Z0UA 3MEEA 2PHNA 2KI7A 2CDTA 3I0RA 3RKXA 4RTVA 3JATA 2FC3A 2OPPA 3TSZA 2QTDA 2KEAA 5GAMe 3FR0A 2BZXA 4QVCA 3CM6A 1T0KB 4FLVA 1YFNA 2K57A 2QA4A 1P90A 2FG0A 2DA9A 3KWGA 4O5FA 3G7ZA 2RHUA 5DY9A 3OQ5A 2ZM6K 3OW2A 4H4MA 1WJQA 2DEQA 2KXDA 5FPEA 1VSIA 4B9QA 1IO6A 2H3EB 4F9OA 3LWVC 3WXIA 2P9NA 2CKKA 2QWQA 2D0QB 2J7IA 1N27A 3O6WA 4DU1A 4C5EA 3VETA 2KGTA 4E47A 4CGDA 4HUEA 2UUBK 3BEXA 5HKCA 1IKWA 3GBTA 4YOXA 1EX4A 1QKWA 3WT0A 3PVQA 3AAPA 2IGIA 3AO2A 1VQ7Q 3O9SA 1UB4A 1TKTA 1X01A 1X3NA 4CJRA 1X75C 2LJ0A 3VS7A 3J81E 3Q7BA 5JCOA 4PJOG 3OS2A 4KBOA 4ESRA 3VESA 5IJ0B 3UDCA 1N36K 1QMCA 2VV5A 4CF0A 1N33K 3JATB 1L3VA 4O2BA 4GBQA 1KCFA 2DFFA 4DV0K 1G2BA 2IIMA 3VQQA 4NWOB 2KROA 2DILA 5HROA 1QLYA 3JALA 1JLBA 1ZUYA 3HPHA 1HPZA 2GWKA 3K0SA 4AFZC 3OS5A 1GLFO 1HUXA 3UE5A 3GYQA 4ZHWA 4H5WA 4O4JA 1XJWB 2QGGA 3OYDA 3O9RA 2DL3A 4FWPA 4C0DC 1IO2A 1SZ2A 4W5TA 4DSKA 1TVKB 3EL2A 2P9NB 3RRGA 3LP2A 3C6TA 1N6QA 2FGYA 2FXUA 3CXCS 3VQ7A 2AA4A 3KE1A 4B5CA 2CP2A 1D3BB 2HBWA 4RCCA 4CERA 4AILC 2R6R1 1GXIE 3CCSA 3NGZA 4F14A 3CCLA 2KG4A 5ADXA 1J5EK 2QXFA 2GVIA 3J80E 3SAFA 4BDYA 3IMPA 4M8IA 2E2NA 1BGXT 1N8RC 2ZGZA 1Y57A 2DJZA 2HMPA 4AM6A 3VEYA 3ZSXA 3GHZA 3JB9G 4M7DF 1QZ5A 1QHAA 5FLXO 4L8RB 1TL1A 4GY5A 4PLLA 1TUUA 4CZJA 1KHCA 2D9TA 1S1WA 1I4K1 2M16A 4E7ZA 3JCMe 1R77A 3JCMV 5GAN8 8ATCB 2WBNA 3DXKA 1IBKK 1IV3A 1U40A 3JALB 3A8LB 3A0IX 4OMQA 3CC7T 5KMGB 1BU6O 4YTLA 5AQLA 5FU7C 4PKHA 2OYQA 3MDQA 4FJXA 1X3MA 4B1XB 3L1AA 5FROA 4O4JB 3LWIA 2A3ZA 2K3XA 3DLKA 3ZX3A 4DR2K 4B3TK 4FJKA 3C9SA 3V8KA 3LL3A 2ASPA 4LCKA 1VQOA 1R59O 1TOVA 1FKOA 3TSQA 3M57A 2QKBA 4BT4A 3J81M 5MN5A 4UY8O 3AVJA 5FRNA 1IV2A 4H0VB 2GEMA 1QKXA 1XOVA 3CMAF 1Q86R 1JCGA 1TKZA 2VUBA 3BP8A 4FT2A 1J6ZA 4X9DA 1NKEA 1VQ7N 3SAGA 4IFEA 1F1BB 1LWFA 2BANA 1QD9A 3IKFA 1SAZA 1PKTA 4NXMK 3A98A 3DXKB 3X20B 1HJDA 4C23A 2O8DA 2FRWA 2QYZA 2DERA 3MX2A 2Q1YA 4M7AC 5AFUA 3IQLA 4FK0A 1WPYA 2EYWA 2J4RA 1OH8A 1RA4A 2UUAK 3EZ5A 4KTQA 3CBPA 1RBTA 1J54A 1VHAA 3VEZA 2DL4A 2QK9A 1EZZB 2YUQA 4TV8A 1KQSM 4LF5K 1ZBFA 3DI6A 3M6GA 2KTQA 3OTOK 4QCLA 3J80M 1U3OA 1PXWA 2F96A 2WSFE 3Q7CA 4KFBA 2D0OA 3LW5E 2P9PA 1QVPA 4Z4FA 4EB6B 1BHLA 1U8RA 1KXPA 3T9NA 3IDHA 3WQUA 4G4VA 2UYJA 4E19A 5C15A 3LP1A 3U0OA 3AVIA 4G9ZA 4Q5VA 3GNFB 1TU0B 4FYXB 1RDUA 2ASOA 5GAOl 4YOUA 1Z9QA 3VS1A 4JPBW 2ITGA 3LAMA 4G4YA 2DVEA 3MP6A 1QVGA 5FPDA 2BH1A 2QA4F 2Q31A 2KKZA 1ZYQA 2XI9A 2WSCE 3CJAA 2VG6A 1S1VA 3CCLT
chains in the Genus database with same CATH topology
2QTXA 1BWFO 1VQPA 4DOVA 4A4HA 5FU6C 5LL6S 1WNLA 4RG8A 1NGBA 1YVNA 4CZLA 2CGHA 5HY4A 5HY0A 2KY9A 3OYLA 3BW1A 4FSVA 3SFMA 4ISFA 4OPHA 1KQ1A 4NB4A 3T69A 1VQOT 3FFMA 3OYCA 1KD1C 1VQ7T 3UB5A 1H7MA 5KH6A 3KXTA 3LM9A 1X7PA 3DKMA 2GELA 5GMKh 5M1FA 3CCVF 3ME9A 1M90C 2AP1A 3UKRA 1G3WA 1QW1A 4M7AA 3FGUA 3CCSF 5FU7B 1W2BA 4OB0B 3CCRF 2ZWHA 3O85A 2LVMA 4C1NI 1HLUA 1GO0A 1B34A 4JS4A 5I2SA 4FWKA 3VOVA 1T6CA 4XTVA 2E10A 1XUPO 2RD1A 5AQHA 5C2FA 4BRAA 2OZBA 3FLGA 2H3GX 1M1FA 1T44A 3VERA 1OI1A 2G3RA 3UKRB 4J5YA 4WCEL 4FWNA 4Y28E 3FFKB 3LWQC 5DLOA 2JWKA 4M77C 2RHZA 4M78C 2LCLA 4BVOA 2HF4A 1VQPT 3QO3A 2X4WA 3G6EF 4EDUA 3M1FA 3DJCA 3CMEN 3JXUA 1B34B 3D7EO 3X25B 4FPBA 5G4UC 4YOYA 4C92C 3P8HA 4JRQA 4FWRA 3RA5A 1K8KA 5BRFA 2QI2A 2GWJA 2Q97A 3VEWA 1BI1A 3ULEA 4A5AA 4BC3A 5AQTA 3CBOA 1VQ5N 3ATUA 2K5LA 5BRDA 5EOYA 1UGPB 5FU6B 2M9UA 4L5GA 4OVAA 1ZQ1A 3FIFA 4NQ3A 1QVGF 3M58A 3OYMA 3LLRA 1YHQN 3O9QA 4PJOC 4CZIA 2EWSA 5AQPA 4K25A 1K8KB 3CCMA 3PMIA 1K73H 2RI3A 3A8GB 3ULEB 5M1OA 1QVFA 3HKSA 1QVGM 2YHXA 3QG1A 4PLIA 2RO0A 3GPLA 2R57A 4F7UA 3GNGA 4X3LA 2EQKA 3TSPA 5AQZA 1W40A 2QWPA 2EKOA 1KQSS 5EXWA 2L5QA 3OYEA 4E7JA 3NMUC 1XTDA 1HKGA 5GAOn 3JSCA 4M77A 4M78A 4OPAA 1M8VA 5M1KA 3NK6A 4WFNL 1FXXA 1HKCA 4MZMA 2QQBA 1K8AC 3NTHA 3SLCA 3L2QA 3E19A 3SMPA 3CIPA 3E9FA 4BDZA 4XH5A 4PL8A 2ZGYA 4XTUA 4BRMA 4C92A 2D1KA 4XU0A 3ID8A 2E8AA 2P0QA 4F7UB 5GMKi 5GAOr 3F2KA 3FZMA 1VQ5T 2WSEE 5LJ5g 1H641 3PT9A 3S3MA 5HXZA 2OTJA 5GANg 1T3VA 4H5RA 4M77B 4CD3A 1YJWN 4M78B 4C8QD 1PSFA 3P8BB 3OYHA 2HOEA 3C0BA 4PL7A 3NVIB 3OA9A 3OW2S 5JMVA 3B8AX 4D6WA 1HXDA 4B9XA 3RUXA 2NRVA 3LFOA 4PL6A 4C92B 4PJOA 1RGIA 3CBMA 2W40A 4WQ5C 1OYXA 2IVNA 3CI5A 2YX6A 1M4ZA 1VQ4A 1GLBG 1HK9A 4U67L 3VKIA 1LCUA 3MK6A 3HTVA 5GMKe 1WGSA 4B1UB 1GLAG 3HRGA 4TZZA 1VQ4N 3VF6A 4FO0A 2GFAA 2A5XA 4JDSA 4FIBA 5CKHA 3WVDB 5GMKl 2KHOA 3NMUA 4JKHA 5KPRA 2DD5A 2QWNA 2HQEA 3JS6A 4IEIA 4F7UE 4YORA 1BIBA 2KVQG 4PJOB 3QSUA 2XKOC 1NWKA 3DLLA 2ALEA 4ELYC 3Q1JA 3I55F 4M77E 3CCUF 3DLLL 4E7LA 4M78E 4BREA 2QQ9A 3MN5A 2ZZDA 5CR2A 4JKCA 1E7KA 3SMSA 2K5FA 4BRNA 1YIJA 2GLZA 4C1NK 4BVPA 3KHYA 1Q7YO 1FX7A 3FDRA 3TEEA 1WUAA 3CCMF 1YJWT 3JCMM 2A6AA 4MMKA 3E9LA 4O8UA 4C92E 3GP8A 1JCFA 3CD6A 3C7NA 3QB0A 1W4SA 3S41A 4A59A 4RMOA 1NJIU 2XIDA 4YDUC 3ENOA 3CD6N 2ZPEB 3P4IA 3WUHA 3OYFA 4R55A 1CK2A 2DXUA 3OSSC 1X6OA 4IUQA 4EMKC 2IG0A 5LJ3d 3BF3A 3MWPA 4O8KA 2HBLA 4M77F 2F9ZC 5KQ8A 4Q5WA 2QXLA 3KK7A 4BROA 4MLHA 1P92A 1YJ9A 1QVFM 3HL8A 2X35A 4WQ5A 4NLCA 4C8QG 2DKGA 5LJWA 1IREB 4XU2A 1ILYA 4HT8A 3VJPA 1VQ4T 3H1VX 3EFRA 4II1A 1O9SA 4JAXA 4PJOE 3C7NB 2ZPIB 3P38A 3HI0A 5BPMA 2FLOA 3VMFB 4BQLA 5FPMA 3HPWA 1VIFA 4BI4A 2I6DA 2GFUA 3AHUA 3CCJN 3G71F 1WJRA 1YI2F 5C0YA 1BI2A 1OZ2A 2OTJF 3SWNC 2DZCA 5AR0A 4CRIA 1H3ZA 2GTDA 2RK1A 1N6AA 1QVGS 2KLAA 2RK2A 2IIRA 1NJIH 4AF1A 4KUIA 4A4FA 5LJ5h 3PLAC 3D00A 5GANh 4NOYA 3E9GA 1VQMA 3BUZB 3CC2F 1M9SA 1Q7YU 3QYHB 3WXJA 1NGEA 1WOQA 4PJOF 3MCAB 2E1ZA 4DQ8A 3WXMB 3CCQF 4IOAL 4M75D 4BC2A 5BN9A 3CD6T 2AIFA 2QW9A 3FLCO 4YDUA 2QWMA 1BG3A 4JUVA 2NRXA 2HBPA 3L0QA 5AQRA 2OANA 3LWRC 5KPZA 4EMKA 4N0AC 5DCVA 1RL2A 4A54A 2HAXA 2ASMA 5AQIA 3CG6A 1CN7A 3OYGA 1O13A 1YJ9T 4CZFA 4ILHA 1W2BS 4BRHA 4FWOA 2JNGA 1PSEA 2P9UA 2UYTA 3FZLA 1K9MH 4FOIA 5AQUA 4ELZC 3QICA 3M4YA 4FT4A 1YIJF 3M3ZA 4M7YA 1WQWA 1KAYA 1S22A 2ZF5O 3E1YA 3NFCA 4EMKB 5BPNA 4Y91A 1VQLF 1VQ8A 3SWNA 5CQYA 1YJNA 2PQWA 3N4YA 4P5NA 5C12A 3A5NC 3PFSA 1Q81H 3PLAA 3IUCA 2P9UB 2DIQA 3AGKA 3VI6A 2GUPA 4PKGA 2ZJRL 1VQMT 1XBIA 3FEOA 2RA2A 3RA6A 4EI8A 4HCCA 3TU4K 4HA8A 3AARA 4LDVA 2VWBA 2DXBA 2OAUA 5CIUA 5GAMd 1NPPA 3C95A 3W0LA 1IPAA 3CPEA 5GAN3 1VQ9F 3SWNB 5HK3A 5CK9A 2HSTA 2O4XA 2VYPA 1KC8H 4DCHA 4NL3A 2NLXA 3L2WA 4N0AA 3EO3A 3E20B 2RHIA 1YITA 3JCMX 2FF6A 1QP3A 3ER0A 1NE8A 2PU9B 4M75G 1S72N 1DKGD 4MDBA 2EIFA 1YITN 1ZBXA 4HCZA 1TYQA 1BOTO 4K41A 3L2ZA 3FE1A 3VENA 3HRUA 2O4XB 1QVFS 2EJGA 3IMXA 3MEAA 3M55A 1T6DA 3CPFA 3E9OA 1Y07A 5HK0A 3T7ZA 4A61A 3V8LA 3VYHB 3V7QA 1RDWX 4ZN1A 1VQ8T 2NZTA 3HSBA 4XU3A 2JWLA 1YJNT 3H3OB 1VUBA 5LJVA 4CZEA 5AQQA 3SBGA 1MGQA 4RKUE 2FL7A 3SIUA 5CCAA 1G3YA 1XC3A 3R6MA 3CJCA 3JCMd 2OTLN 3ZX2A 4BE0A 2LBWA 3CCVN 4OB2B 2ITMA 1VQ7A 3GG4A 4KH4A 4CZMA 4H5TA 3LWHA 1ZHIA 3BFMA 3O9TA 3VPZA 3V7CA 1HX1A 3CCRN 1KQSF 4M7DD 1E4FT 2KTUA 5LJ5e 4XTZA 4CD1A 4ME7A 3M54A 5GANe 2CZ0B 2PUKB 2YLBA 4IUVA 5GAOm 4KH6A 4YOTA 4NUTA 2V8JA 5AQFA 2JZ2A 1HPMA 2V7ZA 2PFUA 2ZGWA 3OSVA 3O4WA 1O75A 5TKWA 4JLGA 1S72T 1BKBA 4QQGA 1YITT 5FRMA 5FLXE 2RI2A 4C8QC 1X9JA 4BC5A 3CC7F 2YHTA 3J7AR 1KAZA 2Q1NA 3LDPA 4DOWA 4BR2A 4DA4A 3JCMJ 2CH5A 4B1WB 5JLFA 3O80A 2HBMA 4O6JA 4ZN3A 3CC4A 2WC9A 1U2VA 1YAGA 3JCMP 3HFNA 1W97L 3G6EN 3G25A 4BY9D 5CVIA 5JICA 3S3NA 3CC4N 2P9IA 3OW2F 5HY6A 3VV0A 3M9QA 5IAYA 3TCJA 4DHYA 1VQ6N 2VYTA 2EQJA 2GQVA 3R9PA 2LCCA 1Z6RA 2HBJA 3TSUA 1K73O 1BO5O 2P9PB 3TPQA 5MLCQ 1UGSB 5AQKA 3EE9A 2D6FA 3A8HB 4C0DB 2E2QA 3OW2M 1Q82H 4BC4A 3OS1A 2RJFA 4IKFA 2YHWA 4PKCC 4EMHA 2B8AA 2BKDN 5GINC 5CQXA 2P9IB 5IN1A 4JK8A 5FLXM 3ZETA 4BRGA 5BPLA 2KSSA 1RI0A 4LDWA 5BREA 3X28B 2VXEA 4BRQA 1V4SA 3KBGA 1NGDA 3RESA 3CCLF 1RLGA 3HHTB 4N4GA 4A2AA 4BGBA 3HP9A 2QWOA 1MWMA 5KCOA 1NMUB 4M7DG 3INZA 1ATNA 4C8QA 5GAN4 4XQ3A 3OB9A 4IURA 2EJ9A 4J8FA 3O1BA 1VQNA 5I9EB 3ZETB 4XH4A 5CR4A 5HOOA 3MN6A 2O01E 5AZIA 3M5AA 3CC4T 2JTFA 1VQOF 1VQNN 1VQ7F 3VTHA 3HBTA 1D4XA 3VF2A 3P8DA 3ASKA 4M7AB 1NJIC 1VQ6T 1SQKA 3DXMA 3R1XA 3CMEA 2X4XA 3AY9A 5A0DA 3EKSA 3O08A 3GIBA 4JRIA 1K73U 2MAMA 2V8KA 4JLIA 4JHDA 1I5LA 1Y96A 3A5ZB 4C8QB 4Z02A 2FF3B 3LX7A 5C6SA 2L8DA 4DQ2A 4BR9A 1NGJA 4C0ZA 2NRTA 4IOCL 2QEXA 3RIRA 5GAOp 4JKDA 3QZ5B 5AZIB 1VQ5A 2RHXA 3QDRB 1NGAA 5GAPK 3RMQA 2FSNA 4M63C 1DEJA 2QEXN 5ADXH 2F9TA 4XEIA 3SIVA 5GINA 1NGIA 3O8VA 4YOVA 1FWZA 3DXMB 3JB9J 4OGEA 2FSKA 3G4SA 3MWTA 2QDYB 3P39A 4YOWA 4MMLA 1ATRA 3TREA 2LX9A 4X34A 2E2OA 3JAME 2YI1A 1Y96B 1YHQA 1MWKA 3X26B 4JHDB 3WXKA 3PMTA 1EQYA 3ENHA 2JN0A 5LJ3f 1N9SA 3V8JA 4E7IA 1KQ2A 3D2FA 2V52B 3G4SN 4GY2B 5JLHA 4C4WC 3OMGA 3H46O 3CF5L 1VQKA 3N4ZA 3VUBA 4FPAA 4TVRA 1VQPF 4MZTA 3RSEA 4BRDA 4M75C 4C5HA 2XDPA 4IJAA 4A4GA 4M7AE 2F5KA 5GAN6 2PUOB 1VQKN 2HQXA 2GX9A 1Q7YC 3R6OA 4AM7A 5M1QA 4EIAA 3VU3C 1VQNT 3KVGA 3C65A 4KULA 4C8QE 1UGRB 4DB3A 4OGCA 3FRNA 4JK7A 1GLJO 1G3TA 4BD3A 5AFUH 2M0OA 5L8RE 1NZ9A 3D2FB 4BE1A 2C06A 5FPNA 1JB0E 3QFUA 2RE2A 2MI6A 3OYIA 3QJYA 4JKEA 3CXCA 3CMET 4M7XA 4OMFB 3RSEB 1ZWZA 3WVEB 3EKUA 3L2RA 4QQDA 1C0FA 2R5AA 3QXEB 3H8ZA 2R58A 2I7NA 5EX5A 4M7AF 1W2BF 2P0KA 3JAMM 4Y0WA 4KBMB 4EI7A 2X4YA 2QEXT 4ISEA 1YJWA 1QZ6A 4BRFA 1UEBA 1VIEA 1R8OB 4JK9A 3MO8A 1N8RH 4CZKA 1KC8C 1M1KU 1Q18A 2DAQA 2YJFA 3G4ST 2WUSA 1W2BM 5A2QE 4ISGA 1E4GT 2F5TX 2YCHA 5LJ3j 3NVMA 4EFHA 3CJ9A 1NJIO 5HY1A 5GMKm 1YHQT 3BF1A 3JCMc 2CS7A 2ZJPL 3GF5A 2Q0RA 4MZPA 4L6V5 1NLVA 1VQKT 5E26A 3G71N 3ZX0A 4M75A 1YI2N 3NTIA 1RFQA 5AQXA 3BDUA 4N4IA 2EFIA 4BUGA 1Y71A 5AQWA 5F2RA 2ZCFB 3LH0A 3N4PA 4GV9A 3C6HA 1VQ5F 5C2DA 3META 3TTCA 5EG2A 5J3BA 3OA6A 5KCHA 2PVDB 3BDLA 4GNIA 2ZJQL 2JTMA 1M1KH 4M75B 1H1VA 3CCQN 2M1HA 3EE8A 4FWMA 4FWSA 3JB9I 4LDYA 5A2QM 3OYNA 1K9MO 4WYBA 3V7EA 4RCBA 3QZ9B 3VYGA 3CCEA 2P0PA 4IDHA 3I56N 5D6YA 5GAMf 5EWRA 1QP2A 4QS8A 1W41A 1EIFA 3FB9A 3CCEN 1QVFF 2VC8A 5EY4A 2WACA 3W3DA 2IVWA 1BI0A 4HT9A 5ELZA 2XU8A 4F7UF 2PVGB 5M1PA 3VGMA 1Q81O 3F70A 5CAIA 4K42A 4M78F 4IJNA 3E9PA 1KG1A 5AYFA 3M53A 5C0MA 5AQNA 4GLKA 4M7DC 1KD1H 1BYMA 3L4IA 3HRSA 2A7YA 4ATOA 4JKAA 1VQLN 4XTXA 3CEYA 3CCJA 3DLMA 1ZXOA 3DWLA 3C94A 2HF3A 4C92F 5LY3A 4M75E 3AAQA 3FJPA 1M90H 2W41A 5CKEA 1YJWF 4XK8E 1KC8O 4M77D 3J8AA 4R79A 3A8YA 2FSJA 3E1SA 3BY7A 4A57A 2KDSA 2D0PA 4FSXA 5H1SQ 1Y64A 1V29B 3UWNA 2LDMA 3HJWC 4J83A 3JCMf 3EAEA 1K9MU 4GVEA 4C0FA 1JBMA 3RKYA 3M56A 3I56T 4BY9C 4H03B 3LGFA 5GAMj 2E5QA 2E88A 3CCET 3M5RA 4IO8A 1VQ4F 4IUUA 1P8ZA 2P9SA 3JCMb 5HXUA 2CYZB 4JRKA 2NRWA 2PAVA 3LM2A 4CBUA 4XTYA 1GZ0A 4B1VA 2KAFA 3MMVA 1Q81U 5AQMA 3QMLA 3SB2A 5AQGA 5BRHA 4HWIA 2V51B 4PJOD 3D6RA 1XQSC 3AGRA 4GV3A 1GLDG 2JVVA 2WFBA 4OF1A 4QVDA 3JB9F 4M7DA 4A5BA 1YF5L 2Y4XA 3QUIA 3NTKA 2GF7A 2P9SB 3EZWA 1U1SA 3PIPA 2P9LA 3CCJT 3O8MA 3PIPL 4QS9A 3U9ZA 1KC8U 1LOTB 3LYIA 3HM8A 2HBKA 2YHYA 2Y4YA 4L59A 5I21A 4BVRA 3CPQA 3CD6F 2LQKA 4CBWA 4BG9A 4EHTA 2LT4A 2HNIA 3OMCA 3QHSA 4C5GA 4M7DB 1SSFA 3CMAN 2DK3A 1BIAA 3FC3A 3CHWA 3M59A 2BO1A 2L3RA 4RWTA 5DM7L 2V8IA 3H1QA 3SJHA 3ZFJA 1YJ9F 2ZPBB 5IT9E 2FHDA 2E6NA 2NRHA 3A8OB 3OYBA 1V4TA 2K5IA 5HL7L 3J7AF 3HOTA 4RG2A 3JB9H 1IJJA 3CC7N 3RMSA 3J7ZO 5CO7A 2MWPA 3CETA 4BVSA 1S72A 1IG8A 2ZPFB 3O9UA 1K73C 3FZFA 1NBWA 3MHXA 1AHJB 4HCBA 1DT9A 4RTFD 1Q82O 4C0GA 2QA4N 2XD0A 2NRRA 5GAHP 4IUTA 2RJEA 4CI6A 3D2EA 1D3BA 2DPPB 1VQMF 4L3QA 4WF2A 4Z94A 3KZBA 3MN7A 1Q86H 3OBYA 4MDAA 4OB1B 4M7DE 3A5OC 5BR9A 5M9OA 2I7PA 4IO9L 4A53A 2P9KA 4BG8A 1JRIA 1ZBSA 2CZWA 5CKDA 3VEOA 1NM1A 1S3XA 4EMGA 5IT9M 3LGLA 3TU5A 4C5IA 2OTLA 3CMAT 5HY2A