2VGMA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
381
structure length
354
Chain Sequence
MKVISLKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIETDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 97
structure length 354
sequence length 381
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgmA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgmA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgmA03
1YI2F 2HSTA 1JJ2F 1SDSA 5IT9M 1GZ0A 4NUTA 2FC3A 3LWPC 1Q81H 1VQKF 4X3LA 3HAXD 1DT9A 1M90H 5A2QM 3LWQC 1KD1H 1K8AH 2OHWA 3G4SF 2CZWA 1NMUB 2OZBA 1XBIA 1E7KA 1IPAA 3CG6A 1S72F 3V7EA 2LBXA 3CC7F 2KTVA 5FLXM 3N4ZA 2I6DA 3CD6F 3LWVC 3JCMM 1CK2A 1W42A 1Q82H 1GO0A 1W3EX 3CCVF 3CCRF 1PXWA 5GAPK 1VQMF 4BW0B 1W40A 2ALEA 3E20B 5EWRA 2JNBA 1YIJF 2QEXF 2WALA 4C4WC 3JAMM 1YHQF 1VQPF 5GINC 3LWRC 1VQ6F 2LBWA 3I56F 1VQ7F 1VQLF 3WXMB 3G71F 3CC4F 3CCQF 3PLAC 2KG4A 5G4VC 3CPQA 1W41A 3CMEF 4X3MA 1YJWF 1X7PA 1VQ4F 1QVFF 3ON1A 1T0KB 3SIVA 3G6EF 3IR9A 3CXCF 5G4UC 2BO1A 1M1KH 1X52A 3V7QA 1N8RH 1VQ8F 3PAFA 2KTUA 3CC2F 1Q86H 1Q7YH 3NK7A 1VQ9F 1CN7A 2VGMA 3LWOC 1RLGA 3CMAF 4BY9D 1W2BF 2VGNA 5GIOC 1RA4A 3NVKE 1KQSF 2HVYD 3GYQA 3VI6A 4LCKA 3RA6A 3CCSF 3NMUC 2AIFA 3J7AR 5DCVA 5FJ4C 1YJ9F 3RA5A 1YITF 2OTJF 3E1YA 3OBWA 1VQ5F 3J80M 3J81M 3LFOA 4TZZA 3AGKA 3FFMA 1VQOF 3VMFB 3I55F 1NJIH 1YJNF 1KC8H 3MCAB 3CCMF 3O85A 1GO1A 5EO3A 1QVGF 3CCUF 3SIUA 2QA4F 2OTLF 3OBYA 3CCLF 1K9MH 3CPWF 3CCEF 3OW2F 5GANK 3NVIB 4AF1A 3HJWC 1X7OA 1VQNF 1K73H 1ZWZA 3NK6A 3CCJF 2QI2A 3N4YA 5GIPC 1H7MA
chains in the Genus database with same CATH superfamily
3K9JA 5HOOA 1QSSA 5CZ2A 2WSEE 3LX7A 1QE1A 3C6TA 5AQTA 1SL1A 3ELCA 1U1SA 2HHSA 3PT9A 1GCQC 1KVAA 1W5EA 1VQKQ 5DCVA 4B3MK 1MNEA 4OMQA 1MNDA 4X3LA 5KMGA 4L8RB 1U3LA 4EPCA 1BCOA 3OS2A 4DTSA 5IJ0B 1KD1H 2NUPB 2W6KA 4CRIA 3DLKA 4CGHA 4KGZB 1UGSB 4CW7B 1UHFA 1QVFP 2EW3A 3C8LA 2P0KA 3R6NA 1EP4A 3VQPA 1NMUB 2KMTA 2VWJA 1DJ7B 2CSIA 5HK0A 4M77D 5GANd 3JB9F 2ZPBB 4R0KA 2KE9A 1ZC6A 1WAJA 4EB6B 1N8RU 3I55T 4XH1A 4FCYA 4ZN3A 1I39A 3N4PA 4QS9A 4J2BA 2JM8A 2K3BA 3PX4A 4DBHA 1VSKA 1NLPC 1V1CA 5GAMg 3DYAA 4FO0A 4CZGA 2EGAA 2YHXA 2O8EB 5LA6B 3RKXA 5GAN7 1L5UA 2XY7A 1QCFA 2UUBK 2EYYA 4BRHA 1PXWA 2QA4T 3HXMA 4JPBW 4TV9A 2F8SA 5I2MA 4CJRA 4KBMB 2DD4A 2I2LA 4A2BA 4A4EA 1U4BA 3KJKA 1R8OB 1WXBA 1E4GT 4DV3K 4M3RA 1YHQF 5AQRA 4O6JA 2Y90A 1SZ2A 3MEAA 1TG0A 3RR8A 2YDLA 4DV6K 1ZSZC 3LP0A 3THYB 4U3JB 1I94K 4NCBA 2CREA 4CZLA 3CCQN 1NMDA 4FLTA 1NJIU 4C0ZA 4O2AB 2M1HA 1Q82R 4JK8A 4IIOA 3C9SA 3O3HA 3WNHA 4C92A 3M84A 3HSTB 2FG0A 2FRYA 4BVOA 1WBDA 2OANA 1YJWQ 3FLCO 2MQEA 5B8FA 5IJ9B 4B6MA 5TKYA 4JNEA 1FMKA 5HRNA 3OYYA 3JCMc 2O4XA 2HBLA 3EG2A 3PE0A 5KYUA 5AYFA 3RERA 1SV5A 3VCZA 1Q81C 4XEIA 1XNIA 3SV3A 1T44A 1F1BB 5H1SQ 4BY9D 5M1PA 3ZO8A 1RLGA 4M4ZA 1ZHIA 1N6QA 5JVDA 5AQFA 3CMAF 1JRIA 3CC7T 3D2EB 5BRHA 3P10A 3NVKE 1TS9A 3ZSZA 1XV2A 4CHOA 2KR3A 3CPEA 4BRNA 1QSYA 4Q5VA 3CC4N 5JS1A 5EXWA 3M8RA 3V4DA 2FGYA 3L3VA 3E9FA 1OULA 2GFAA 2LT4A 5EVZA 4ME7A 4B9TA 2OTLA 4BQZA 5JMVA 1ILYA 4ZHWA 3ZP4A 4PKIA 3FFKB 1KAZA 1HYSA 3VS7A 5AZJA 2PMPA 1QD9A 4PJOF 1YJNQ 3H1VX 4E1NA 3V7EA 1PD0A 4BRCA 1HNXK 4DSJA 2YT6A 1BL3A 3CM6A 5C8YA 5JH7A 1YCSB 3M59A 5IYZA 3PTAA 4EMKC 3TU4K 1U1TA 4AFQC 4V2SA 1OH6A 3MMVA 5FW9A 1AWOA 2BTUA 3LAKA 4M7DB 2QTVA 2E6LA 2IGIA 3LM2A 4DTMA 1RTIA 2GTDA 3CCJN 3JAKA 2KRMA 3JAWA 4IUUA 4JUVA 4M78G 2HSPA 1JLFA 2ZF8A 3JB9G 3QNOA 1D09B 3EAEA 3O9TA 5EU7A 3J7YP 3CXCM 4J8FA 2EYXA 5EY4A 2ZGYA 4G4VA 1RBSA 3QBXA 4KHQA 3SZ2A 4B46A 3H0FA 1GZ0A 4NUTA 1O75A 1Y71A 3ATVA 1RT1A 1QQNA 4IJNA 1Q81H 2BUPA 1SF9A 1S1NA 5IT9E 2DZCA 5HP7A 1WSFA 2VB6A 3HVTA 3P38A 3TSPA 1G3WA 3CIPA 2GELA 2IVPA 5KI6A 2ZF5O 4EZ9A 4FM1A 5M1QA 1Q8RA 2EWCA 2OZSA 2K3XA 3WGLA 3OYBA 1TUCA 2D0PA 3ENBA 1EFNA 2RH2A 3FRNA 3ZSVA 5EAZA 2P9SB 2A42A 3CG6A 4DLEA 5EB1B 1VQMA 4M75B 4B9VA 3M6GA 1M1GA 1X6GA 3I7TA 3EGXA 1RAHB 3QKJA 3D01A 5KYXB 4JS5A 5LY3A 2E10A 5FPMA 2W41A 1N8RO 5BN9A 3F9MA 4IO9L 3HKBB 1FFXB 4B3TK 3J7AP 3MDOA 3E9GA 4B9QA 1Y7XA 4IZ9A 4BWJA 4CZIA 3HPWA 3WVDB 1WSIA 3WNFA 3HK2A 3I56A 4JI0K 2BTQB 2EHGA 1Y0MA 2DD5A 2DM1A 4HA8A 5IHIA 1BQMA 1G99A 3G71A 2A41A 4CEFA 1LVKA 1Q9YA 4ZGEB 1YF5L 1S6QA 4A63B 3BZKA 4J8OA 3UKRB 2WALA 5KYWB 1M1KC 4XH4A 1YHQQ 4F4KA 4M78B 5J26A 4E19A 4FL9A 1Q7YC 2DTUA 4E6EA 2W0ZA 4F7UA 1VQLQ 1MA9B 2NLXA 4QVZA 4HUFA 2D6FA 5A0GA 1BG3A 4CC2A 2YKNA 3S3NA 4LSLA 1HPMA 3C9TA 4CE9A 1VQKT 2YNGA 4X1KB 5HROA 3DRPA 2R5AA 1Q86R 1TYQA 4C8QE 5G4UC 1RDAA 4LNUA 1W0HA 3M1XA 3IKFA 2HEQA 1HPZA 3CCSA 4DBFA 4JD2B 1YITA 4C92F 4PJOG 4A62A 5GINA 3V9UA 2KDSA 2WBNA 3EG0A 1QQOA 2GEMA 3TTFA 1XI1A 4NS5A 3CMAQ 3N5BB 2RHYA 1VQ6N 3J81M 3PLAA 3HRUA 2YXZA 4M7AD 1Z9QA 3RA6A 5KX5B 4J5YA 4J9BA 3V81A 4CEOA 2AT1B 3O5BA 1M90U 1X9SA 2HRUA 3D6RA 3ID8A 1LAVA 3AVCA 4DRXB 4EIKA 1C6VA 4TZZA 3X26B 4C0FA 4W5TA 3CPWA 3TSZA 4A53A 3G6EN 3DM2A 5E41A 3ZETB 1NM1A 3MCAB 2ASMA 4IWVA 5GAN4 3O9UA 5LOVA 3ZCMA 2P9LA 5GIOA 1MGQA 2XDPA 2ZE2A 4X1YB 3SPZA 2OTLF 2X9HA 4NL3A 3PY8A 1JD1A 1YI2A 1G83A 4NXMK 1OVYA 3B6OA 4RCBA 2X6NA 2QK9A 3C95A 1J5EK 5DM7L 1B34A 4JRIA 1BI1A 4JLIA 2FPFA 1YJWT 1VQNF 4F9OA 1M5Q1 3VQ6A 5CB4A 3NK6A 3H08A 2HSEB 2OPQA 3UF4A 5KE2A 1BA0A 1KC8R 3B6PA 3WEEA 4TSXA 4H4MA 4PWTA 1S3XA 3G4SA 4WQ4A 2JTFA 2CH5A 2MWOA 4OGEA 1BI4B 2FBXA 4C8EA 2NYSA 3FBAA 1RUWA 1U3OA 2DILA 3SWNC 1K9MR 4BRIA 1K9AA 2QTDA 5M1OA 1FK9A 4CEEA 4GLKA 4OGCA 5A2QM 5LYJA 2CZ7B 2KFZA 2P5OA 3TPQA 2Z01A 1QSLA 3CYQA 3A8OB 2B86A 3MN5A 2AZVA 4F3OA 1KCFA 1Q82U 2LZ6B 1XHXA 2VYTA 3CXCP 2E3HA 2E2NA 3QJ6A 3NF6A 5AQMA 5J2MA 1IPAA 4NQ3A 2DBMA 4BG9A 1W581 3EGUA 1S1TA 1AT1B 5E84A 5FLXM 3C6AA 3OA9A 4G4WA 3JCMM 4M77B 4LC9B 3HVRA 3DWLA 2EWSA 4I9QA 4J2AA 4HNAA 1GO0A 1Z9ZA 2MF2A 4JK7A 3JXUA 1TL1A 4XTVA 4QCLA 2CYZB 2LCAA 4C8IA 4WFAL 4JJCA 1IKWA 3UT5B 3HHTB 2D1KA 1BIUA 1VQMF 4F7UE 5AQOA 5T7BA 2JNBA 3GTZA 1QWEA 1HLUA 1K73O 4ISFA 2YRDA 4E7LA 1DKGD 1RADB 4FM0A 2WFBA 4C92G 3JB9I 2UZHA 1VQ7N 3B8AX 3JAME 3I56F 4BACA 4EFHA 1TL3A 4ZHRA 3KJJA 1N9SA 3G71F 4FLXA 4IO8A 1XWLA 2A08A 3CC2A 1RTJA 1T6DA 1L3SA 1FW6A 3KK7A 3HTVA 1RT2A 3LP3A 1LW2A 1UEBA 3LDSA 1YTUA 1PD1A 1WGSA 1SL0A 4XAXB 1K8AO 5FPNA 3QLHA 4O4IA 4FJJA 1ZQ1A 3CFPA 3A5LC 4E3SA 4F7UF 1D1AA 5GAOr 4KB0A 3CPWS 4FLYA 3S0HA 1IV4A 2CP6A 4Z89A 4HCKA 2ZD1A 3O80A 1YJ9A 4WBNA 4FYVB 3ZBDA 3S3OA 2HF3A 4LH5A 1WBBA 1T0HA 3G1JA 2KTQA 2RK1A 4X62K 1N36K 4V19S 4ERHA 2JN0A 4KO0A 1BU1A 2GUIA 2KYMA 1NPRA 3M53A 4CEZA 1AWJA 2QWPA 3FZHA 4LF7K 1UGQB 2Y1JA 1YNZA 1GX1A 3CCSF 3M54A 2HB5A 2GUPA 1Q95G 4NCGA 2QQ9A 3NH2A 3HKDA 2WONA 3TANA 4DOVA 4FFBA 4ZOLA 3D7EO 5GAN6 4U7BA 2HS4A 3AY9A 1YITF 4JAXA 4JEPA 2JOYA 2RJEA 2EGEA 4F14A 3IFRA 1EWRA 4IEIA 1W5FA 2XY6A 1W57A 3HRTA 2RB9A 5C42A 4CF1A 4IURA 2ZPEB 1VQON 1BISA 3AGKA 1MHNA 1SEMA 4KHUA 3JCMX 4O0IA 2D0AA 3JAKB 1YHQT 5LJ3g 1AEYA 1H1VA 3TAMA 2AKKA 2JVVA 2L3QA 3KK2A 4J9FA 2CH4A 1BIBA 2PVDB 5CAIA 1NM7A 4CGJA 1TK0A 4Y0WA 3S0YA 2FLOA 1IV3A 2OTLQ 1RDBA 2HKQB 2A7YA 4KAZA 1VQLT 1M2VA 2FF3B 5EYPB 3F0GA 5FNVA 1PWTA 3HSBA 3CETA 2CHTA 2Z1HA 3UDCA 2YJEA 3K2PA 4JI7K 3CPWF 1XHZA 1NU0A 2CKKA 2P4RA 3MKDA 4DR7K 4MO5A 5HKCA 3FGUA 2IPOB 4Z02A 2J06A 2YCHA 2E1HA 3VOVA 3OMGA 3QEPA 2L2PA 1K76A 1WSGA 1WDXA 2YNIA 4AM7A 5JVHL 3THXA 3VQAA 2HQXA 3WUHA 1JLGA 2HSTA 4H5RA 3P0ZA 3C7NB 1YI2F 1OZ2A 2RO0A 3RIRA 2NRHA 2IOCA 2WUSA 2ZODA 4KHYA 3C9UA 2DKGA 4JRPA 3LWPC 3J80E 1TOVA 1JLQA 1S72A 4J9DA 2BE7D 2DL3A 2PVOB 3D2FA 2QXLA 1ZBHA 4OB3B 3KTQA 1A5VA 5HLFA 4NYNA 5KYNA 4R79A 1JBMA 3JRZA 1BA1A 5GAEP 3HM9A 3EZWA 1ATSA 4OVLA 3THWB 5I3UA 1O9SA 2E2OA 4B1XB 4FSXA 1R0AA 5D6WA 3G4SF 4FJLA 1XBIA 5GAHP 4CF0A 5HY2A 4ID5A 2ZWHA 4PHTX 2O8DB 4GLMA 4RW4A 3JCMJ 5LJWA 4BVRA 5AQQA 1P92A 2KRNA 2LRQA 3O1WA 1QQJA 1GLAG 4PL8A 2D8JA 2X51A 4B8AB 2QQRA 1Q86U 3RYHB 1ZBXA 3VPZA 2NUPA 1U2VB 4ELVA 2G9IA 1PSFA 1KIKA 3KKSA 4C92C 1BI0A 4DEYA 1TAQA 1W1FA 2E1YA 5JQGA 2LQ8A 1LOJA 2XD0A 5AJ3K 4TUYB 5CQXA 3EFOA 1VQMQ 5CHIA 3EHQA 3F73A 1YIJN 5FWBA 3CC4A 4M7AG 4O8KA 1IV2A 4E7SA 4IIJB 4I6MB 2B8AA 4M3UA 1SRLA 3T3FA 2XK0A 1VSJA 4E0DA 1XQHA 2QWMA 4X20B 3H0IA 4X66K 2C06A 1NNEA 3JCMP 2DFUA 3Q1JA 3JALA 3U0OA 5GANe 3LWLA 3I56Q 1IHVA 1JLBA 2ROTA 1BGXT 4DB3A 4B3RK 5LJ5e 4YJ2A 1VQ5T 1X27A 2JTEA 2QGFB 2RM4A 3G71Q 2BUDA 5J1EA 3LYIA 1IKXA 2HHQA 1GRIA 5GAOq 3A5OC 1VQ4N 2COWA 4ESRA 1FWZA 1X7PA 1WUAA 2YWWA 5LJ5f 3VF2A 3G10A 4ELZC 3IR9A 2K7AA 3SEMA 3ZEHA 3AVFA 4EHUA 3T1AA 3THYA 3RYIB 3CC2F 3QYGB 4II1A 4AFZC 3GP8A 3O3FA 4FM2A 1ZX6A 4JKBA 2DIQA 4EP5A 3ID6A 3T7ZA 1T3LA 5FPDA 4EMGA 3WQUA 1EQYA 3MEDA 3VA0A 3A8MB 1WZOA 2ITGA 1ZA2B 3NMZC 1NBWA 1RDCA 3O4QA 4ILJA 4C23A 4UQGA 3V9XA 2HAXA 3BGRA 1M2OA 3ULDA 2JXBA 3SFMA 3CCSQ 1I5OB 2OTJN 1YJ9F 3OJSA 1KC8U 3LMEA 1YITQ 5J2QA 1VSDA 3DXMA 4CZJA 3BYQA 4JKGB 2LCCA 3K57A 1ZWZA 1N8RR 3ULEA 4A57A 3JARA 4CJWA 4BR9A 4DFMA 3J81E 3OY9A 1VRUA 1U06A 1E3MA 2CSLA 1J54A 3KUFA 2Q97A 3HP9A 3D00A 1K8KB 2XU8A 4HXJA 3DLHA 2Q36A 2F2XA 2ZPIB 4LDWA 3VQQA 3PIPL 3RKWA 3CCLF 2HQSC 3LWIA 2HNDA 1ZBFA 4DQSA 2VXEA 2L8DA 4LNPA 1S1WA 2DX1A 5EZYB 2CW4A 2NRTA 3QMLA 3LH0A 4KUDK 1BQNA 2B5JA 3HWUA 3BF1A 5I2SA 1HJOA 1UAXA 4K41A 1TK5A 2L0AA 4FVUA 3DMJA 3SAHA 4RG2A 4PKHA 2O8FB 3INZA 2DXBA 1YI2Q 4FWPA 3NTIA 1WFWA 2QG9B 5AFUH 3TSUA 5KGXA 2R7YA 4DF4A 5KYYB 2BANA 3NBPA 3WJRA 4BE2A 1IV1A 3E66A 2OAUA 4BB7A 3QUIA 4CJ3A 1WHKA 2G8KA 4CHZA 2ZGZA 2JMCA 3TAGA 1OPKA 4K43A 4CBXA 4XTXA 3V8LA 1LPLA 2RJFA 3SUNA 4GKJK 4UC4A 1JL1A 4WQ5A 4Y28E 1K6YA 2ABLA 3G4SQ 1OQKA 1K0XA 3VQ5A 2EQUA 3SB2A 4BE0A 3MBMA 5CKFA 2FPDA 5A2QO 2FYKA 4CC7A 1E7KA 2XIDA 4ORZA 1S5JA 3VGMA 2VG7A 4YHHK 2DPNA 2O8BB 1S72F 2Z1FA 3A0IX 1TKTA 1H48A 3TD4A 2GQIA 2GGRA 2UXBK 1RAEB 4O8UA 3NVKA 1K1ZA 4DR1K 1Q7YU 5BN8A 5HP8A 1CKAA 4PJJA 4C5HA 5GAOm 2QWLA 4MDBA 5FLXO 3M4YA 3CCRN 1TH7A 2RNAA 3EYZA 1VQ6A 3IRXA 3ZEUA 4BVTA 4XTZA 1VYTA 2OTLT 1U49A 2OAWA 3H8ZA 1W40A 1FXXA 2HMAA 3PFSA 4O4JB 2CGHA 2R5MA 3VF6A 4HKEA 1ASWA 1TUBB 5DK5A 2LTOA 5GAN8 2X74A 1VQPN 4XCQA 1VQNT 1TKDA 5B8HA 2UYTA 1FFXA 2WOMA 2R57A 2NUTB 3HKBA 5GINC 3L3UA 4W5OA 4JZ4A 3MWPA 3FB9A 3G6EA 3P8BB 1GFDA 4GMJB 3F6MA 2DFHA 2J4RA 5J2NA 3CC4F 2BE9B 4CECA 3F9KA 1KJWA 1Q81O 1VHAA 2G8WA 3PLAC 5LMNK 3CYPB 4FK2A 4LFCK 3CPQA 1NMNA 9ATCB 3TTCA 1IV0A 2FB7A 4X3MA 5HY4A 2E5QA 2WSCE 3BZCA 3UKRA 3T80A 3ON1A 2KAFA 1HD3A 2VYPA 4OPKA 2DJQA 2PU9B 1EKEA 4G1QA 2G8HA 1BUPA 4O2BB 3QUWA 2ZAEA 1RTDA 4F6RB 5D3GA 3PAFA 3O4NA 3OS0A 3CC2Q 2Z1UA 2LX7A 3JB9D 2PAVA 5BMVB 2Z0WA 4MDAA 5GAMf 4JZ3A 3NF9A 4Z4EA 3LWOC 3AVJA 4ELTA 4BVQA 3L2VA 4KHNA 4ELUA 2A3ZA 3ASKA 5GIOC 5FRNA 3AO3A 4M7XA 2KT1A 3CM5A 1T6CA 4HT9A 4BR2A 2Q31A 2R58A 2ROLA 1NGAA 3K59A 3J7AR 1ZUKA 1ODEA 3M9QA 3CCMA 2V1QA 1YJ9Q 4DWIA 3G25A 2RK2A 1HYVA 3O6WA 1N32K 1LOTB 4JD2A 1OEBA 1ZBSA 3I33A 1NJWA 4J83A 2CZ6B 3VYGA 1VQMT 2MAMA 4QQGA 2RE2A 3RMQA 3I55N 4LF9K 3O08A 4MZPA 4JHDA 3WQTA 4BC5A 4U39A 3VOBA 2OX7A 1IGUA 2DF6A 3OYMA 3C4SA 5C0MA 1KLMA 2P51A 4WQ4C 5C15A 1VQ8N 2ZVYA 2K79A 5EO3A 4DLGA 2HZYA 2QA4N 3WNGA 2EPDA 2FC0A 4I55A 2NUBA 2SRCA 4JLGA 3I56T 5GAMh 3CCLQ 4Q0BA 2HVIA 4ZTJA 3G71T 1K73R 1KTQA 4Z4HA 4BREA 1KD1C 2IG8A 4AMCA 2WC9A 3FJPA 3QSUA 4A4HA 2HL3A 4M7DE 1I07A 3VS4A 2W6LA 2P9PB 3L4QA 2QAZA 3ZETA 5IHNA 4CFCA 2FZKB 1NGHA 4B1UB 2UYPA 4L6V5 3GOXA 4DTXA 2P0PA 5BR8K 3P4IA 3HI0A 1OAPA 3DDNA 5FU6C 4ZK7A 4BUGA 4RTFD 4JLHA 3KLHA 5JLFA 4NXNK 2VAMA 2HMPA 2OA8A 1K8AR 3M57A 4WTOB 1BK2A 3A98A 3CD6A 2FO0A 3OHRA 4FLVA 1SKWA 1HKBA 4X1IB 5HXUA 5FROA 1KQ2A 4BRQA 3IKEA 2VAPA 4OX9K 2CZWA 2DYIA 1YITT 3CQ8A 3CBOA 4L3QA 4DV0K 3CC7N 2JT4A 5I21A 1S72Q 1BI4A 1SS6A 3UKUA 4CJLA 2BH1A 1ZSZB 1OZ3A 1M1KO 4PJOD 3CPFA 4ELYC 1G3SA 2IVOA 3KIOA 4KTZA 4OPAA 2R6R1 3HKEA 3DOLA 2YNFA 3HOTA 2HMIA 4M75E 2L26A 3VA3A 4YOXA 1Q7YO 4F16A 2HP0A 1Q82H 1X25A 4RQOA 1A5WA 3T1HK 4DR6K 5KQDA 1XC3A 4CIGA 1M90R 2M0OA 2DXCA 3QDFA 1XTDA 4QS7A 4Y1DA 2BDPA 3JASA 3L7QA 2V51B 3WXJA 3M0RA 4AH9A 4B1YB 1WHGA 1RCHA 1QZ6A 1SAZA 1YVUA 3VGKA 5KPRA 2AJQA 1GL5A 5JCOA 3SI6A 1VSIA 4BWMA 2MOXA 4BRDA 4E7IA 3SQ1A 5GMKl 4H0OA 3GNFB 2FF6A 3VEXA 4CHYA 3QTYA 2OJ2A 1MV0B 1UTIA 2GBZA 1VQ6F 4M41A 3VF4A 2RHJA 3ZP7A 4M78E 3P1GA 4JI3K 1I0CA 1DTTA 4BR5A 1SPKA 2E4LA 1BKBA 1N34K 2F9WA 1YI2T 3CC4Q 3VQBA 1RLQC 4OJRA 1VAZA 2RJDA 1Y57A 3QICA 4BR7A 4N47A 1RQ2A 2LCSA 1VQ9A 2KHOA 4I4TB 4TV8B 4B9XA 4BRMA 2EWNA 2FVUA 3WGNA 1B3QA 3JCMd 1IZ6A 4LDUA 3E19A 1W2BA 2KVQG 1S1UA 4GKKK 4G4XA 3G6EF 2BZYA 3G7ZA 4X9CA 4EZ6A 2G8FA 4ANJA 3A8YA 4PFOA 5GAOp 5CE3A 5IH2A 4W5NA 3G4ST 5GJWB 3QEIA 2YSQA 4G88A 1JCGA 3EFSA 1HNWK 5CYMA 4WF2A 1PG5B 3C0CA 1O1WA 5KH6A 2KLAA 4NOYA 3SUOA 4H0TB 3SK3A 1IH7A 3OS1A 1ZSGA 2LNVA 3TQ7P 4DBQA 3UA7A 4M3ZA 3JSMA 1N9RA 4P5NA 5LL6Z 5FJ4C 3T9NA 2ED1A 3WNEA 1QVGA 3KWGA 3OONA 3E1SA 3E1YA 4N56A 3CCUA 3M1FA 3L2QA 3E22B 2VUBA 4A4FA 2V8KA 3R6OA 3SAGA 4XU0A 2KQ2A 1W55A 4DSFA 1UB4A 2XMFA 3S41A 2E6NA 2RHLA 3RWUA 2ZZDA 2X3WD 1HKGA 3C0BA 3CCMF 4BT6A 1N5YA 5ECAA 3N2KB 3X20B 4BDYA 1NK9A 1U48A 3M0QA 1RACB 1WOQA 4FW2A 2A5XA 2HP3A 4GNIA 1WLPB 4XH5A 1UE9A 3V7SA 3ZT0A 2ZAUA 2RF0A 2D1XA 3FIFA 4DHYA 4C8QA 2QASA 1KLNA 1BCMA 4Y92A 2P9UA 4PL6A 5SZTA 4GV9A 3EG9B 2NUZA 1QQCA 4N41A 4ZHQB 2DETA 4Z94A 4HTUA 5ITZA 2KY9A 1IB8A 3AVAA 2HD0A 1YIJA 1U45A 4MZTA 5CA0B 2E3IA 3N2GA 2EQJA 1EX4A 2KQWA 2H8CA 4C92D 4MLHA 1SDSA 4EI8A 4DBRA 3CC2T 5AFUA 2NNWA 3WJPA 1SSHA 1VQKN 3M55A 1AZGB 3LDNA 2QQBA 3O8VA 5E26A 3FJ5A 2DFEA 1T0JA 3L6QA 3NF7A 5AQIA 3OYGA 3P8HA 4KI6A 2DY4A 4C8GA 5IWAK 5C2FA 1ZBLA 1NK0A 3DXKB 1VQ4A 1H8KA 3RR6A 3MP8A 4J2DA 1MMGA 4DV2K 2HDAA 1YJ9T 1W7AA 1U43A 5MN6A 1AVZC 2DEQA 1JQQA 4OO1J 2QWRA 1G5VA 3CD6F 4LF4K 4N76A 5KQ8A 5HRPA 2D0OA 3DLBA 1KG1A 4GV3A 2QEXA 3D7SB 4JRQA 5JS2A 3PVQA 2K4YA 3U9DA 4DTOA 4O4HA 3HTNA 4C0DC 3JATB 2JJ9A 2SEMA 4FPBA 4AHRA 1SL2A 1NYFA 4A4GA 4M77E 2RF2A 1GLDG 3H1QA 5DM6L 3THWA 3GDQA 4M8IA 1NG2A 1W2BS 2ZJPL 2DXTA 3CCLT 1GCPA 1QP3A 2KXDA 3A5ZB 5CKHA 5L8RE 1NGJA 3S3MA 4B08A 1GLLO 3CPWM 3KVGA 2O8DA 1MUZA 2KROA 1RL2A 1CLIA 1MMNA 5GAOn 2ZPGB 2RKIA 1QZ5A 5AQPA 3RYHA 1O13A 3GG4A 2O4IA 1VQ6Q 1U2VA 3I3FA 3FE1A 4XK8E 3PO5A 3SQ2A 1VSEA 3V1RA 5FU7C 1GLJO 4OP0A 3CBPA 2RB6A 4MQ3A 1VUBA 4WCEL 5G4VC 4FW1A 4NL2A 4IOAL 1NEGA 3QYHB 1LWFA 4IIJA 3TVTA 3F0DA 1QVGS 5CO7A 2FRWA 3VQEA 3LH5A 1AZEA 3V9SA 4X1VA 1E4FT 3VERA 1KQSA 3G6EQ 4X20A 2BO1A 3M58A 2HF4A 3JSCA 2KTUA 4PY5A 2AA4A 4OLBA 1VQ9F 1XOVA 1K73U 5K14A 5MN5A 1S72T 4BRPA 1W2BF 5BPMA 4YJ3B 1CKBA 4KPYA 1UFYA 1W6XA 4J9IA 1IO6A 5AQYA 3EY1A 4JI5K 3WGMA 3ZX2A 5J2TB 1JLCA 3L0QA 4DQQA 4N4GA 5FRMA 1RT7A 2BZ8A 5HCKA 4YOUA 3AVNA 1CSKA 2AMTA 3RYIA 3TD3A 2DK3A 3UA6A 4BE1A 1UECA 3CG7A 4H0YB 4DV4K 3J80M 2H3JA 2LJ1A 1REVA 4L5GA 1K8AU 3MK6A 3FFMA 1YWPA 3VMFB 4K11A 1KC8H 1TSFA 3QJYA 1RDUA 1OOTA 2DL8A 3RDVA 4Z4FA 1PC0A 3CCMQ 3C6UA 1R1MA 4BGBA 2YHAA 3CERA 4BD3A 1QVGF 3QBYA 3CCUF 4RW8A 3SWNB 1A0NB 4FZZA 4IOCL 2EFIA 1K9MH 3OS5A 4FK4A 4FT2A 2I7PA 4CJ5A 3FPIA 3G0ZA 1C6VX 1XJWB 2L3SA 3RYCB 2OPPA 1T3VA 4OMNA 4WQ5C 2ITMA 3H6ZA 3VOAA 4GBQA 4AHTA 3JVHA 8AT1B 3MN9A 1Q18A 5GAGP 1XMOK 4R40B 1Q81R 4PL7A 3BE3A 4LDXA 1VQPA 2CUBA 2X4WA 4C8QF 4H0PA 1HK9A 3MP1A 3ERNA 4CFBA 3SHWA 3KLFA 1OH7A 5CA1A 4CC4B 5LJ3e 3NHNA 2FSKA 3KZBA 3KFVA 3C9RA 1KVCA 2K5LA 2B6AA 3QPHA 2K5FA 4PKCC 2O01E 3HPGA 4CZHA 3KE1A 4IG3A 3CJ1A 3WJQA 5J2PA 2O8FA 2OZBA 1U5SA 2LQKA 4BRLA 4X64K 5LJ3f 1WQ7A 3CCVA 2LVMA 4O4LB 4FSSA 4CZFA 3K5OA 2UYJA 2BTTA 1WHHA 4KUIA 3CD6Q 2CGKA 4IXCA 3U3YA 3QERA 4ZNXA 1WX6A 2LCLA 2JTMA 2HHUA 1RBRA 1B7TA 1X6BA 3DLMA 1QVPA 3BW1A 2CH6A 1U3PA 4PJOB 1X9JA 3CJ9A 3M8QA 3GHZA 4DKWA 1TKXA 1P90A 1D3BB 1NGIA 1B9FA 4ILHA 3V6DA 4CF8A 4IHJA 3GIBA 3D54A 1KQSS 3FDRA 2ALEA 2O8BA 2OCEA 2A36A 4FWSA 3UT1A 3E9OA 4O44A 4B1ZA 4BQLA 4CVNE 1YHQN 1QW1A 2PQWA 2QEXF 2YHTA 3C12A 2HOEA 3ZSOA 5C25A 1Y96B 3CMEA 4AFUC 4QVDA 3QFUA 1VQLN 2XHCA 3ENOA 3HBTA 4B9NA 4W5RA 2H6LA 2H8EA 4FWKA 5AT1B 4DQIA 2EJGA 3UIQA 4C5EA 1VQ8A 1NJZA 3MEGA 2BE2A 3SBTA 4CJUA 2QA4A 5J2UB 2HBPA 4C5GA 3MO8A 1XQSC 5BPLA 4IUTA 1W70A 1YJNT 4DQPA 5J3BA 2RHOA 5JICA 2YRVA 2H8HA 3CPWP 4KB1A 1M27C 2QDYB 1LCKA 3MEEA 2I0NA 1RTHA 2F69A 1WB9A 2PTKA 3FD5A 4KHWA 4N4IA 3MN7A 3UATA 3I35A 1HUXA 2KW4A 2QK0A 4DUYK 1ONIA 4OF1A 4OVAA 1IKVA 1VQ9Q 2H3EB 1D1BA 2DJZA 2Y4XA 2E88A 1J9AA 4M63C 4DTNA 4A61A 1X01A 1KQSF 4I7FA 1RT5A 3BP8A 5KMGB 1RBUA 4LCKA 1C0UA 2AIFA 4RKUE 1M30A 4XU2A 2F96A 3BEXA 4O2BA 3DLRA 1S22A 4AG1C 1KVBA 5J39A 4D6WA 1KD1U 1M1KR 4E89A 1DLOA 3FR0A 2G8UA 4I50A 5HWEA 3RVCA 3RMSA 1HMVA 4A4KA 3CCEA 1Q7YR 2FSNA 4HUGA 3FFIA 2P9IB 3CC7A 5DLQE 3AGRA 4HHTA 3QZ5B 3AVGA 4CEDA 4JK9A 3CCUQ 3QIIA 4GVEA 2ZJRL 1D9FA 4PLLA 3RMBA 1ZUYA 4TV9B 1WI7A 1WJQA 1BIAA 1JJ2A 4BY6C 3ULRB 3M4SA 2F1LA 3EG1A 1D0XA 3MAQA 3RMAA 5GMKm 2KZMA 1QAHA 3SQ0A 2I7NA 5AQWA 3SV4A 4XTUA 3HJWC 1VOMA 3RRGA 1RNHA 2Z1IA 1ZUUA 4ZI7B 3N4YA 1VQ5N 4JI2K 2YRCA 4LXCA 2A0FB 4CESA 1NJXA 3PNWC 2XDDA 1KNKA 4PLIA 3S06A 1V76A 5SWMA 2CT3A 1JXOA 3MXMA 3W0LA 1SKRA 5GONB 4BVSA 4C92B 1QCNA 4DMNA 1DT9A 3REAB 1Q9XA 2IIRA 2LBTA 3BDUA 3AAPA 2UUCK 1S1VA 1GLFO 2C0IA 1NK5A 1L3UA 2O4XB 2X4XA 2V8JA 3X24B 1DEJA 2COYA 3OVNA 3SAFA 2WTUA 5KYUB 4DR4K 5JCOC 4C0GA 3KWIA 3T69A 4J9EA 3LDPA 4KRFA 2GTOA 2AHJB 3R6MA 2VWFA 4EDUA 4FJNA 2HQEA 5JVDB 4JI6K 4ZN1A 4CGGA 2O8CA 3SPYA 3A8LB 1SHFA 4TVRA 3LALA 1CK2A 4X1IA 2XI9A 4ZHYB 2QM1A 3EO3A 3CCMT 3PGGA 5BRFA 2ZQBA 1IG8A 2KFNA 3HL8A 4LD0A 2YI1A 3CCVF 3NCIA 2A1RA 1XNQK 2QYZA 2X4YA 1KHCA 1NJIC 4KTQA 3CCQA 3CMAT 1Z05A 2QEXQ 1RAFB 1QP2A 3EGDA 3HZ6A 4CD1A 5JLHA 3CB2A 1WHJA 3CJCA 1SA0A 2RQWA 2M02A 3H46O 3VI6A 2EGCA 2AKLA 2ZJQL 4F17A 3K2XA 3ZT2A 4FSVA 2XICA 3MXJA 2LBWA 2YHYA 5JH7B 2VCPA 3BUZB 1NGCA 5IYZB 2RHXA 2N48A 2KGWA 1JLEA 1JFFB 2KG4A 2Z1TA 2Z1GA 1HYZA 1YVNA 1W41A 1UGVA 5CKBA 1RT3A 3CMEF 1EXQA 4AHSA 3QO9A 5IAYA 3KJVA 1XUPO 5IJ0A 2OTMA 1G2BA 2GNCA 4DXDA 1HX1A 3K0TA 3IEWA 3LL3A 4PUOA 2ENMA 4H03B 1N8RH 1VQ8F 1OU8A 3UB5A 3RESA 2P0QA 4KREA 3S02A 4KULA 4HCBA 1LAWA 4F7UG 4R55A 2VVKA 4EB6A 4OMLA 4I4TA 5BREA 1IKYA 3SUPA 1BU6O 1UGPB 1G3TA 3CD6T 1FJGK 2YXYA 1VSFA 2F9TA 5LXTB 2KXCA 3META 3KD5E 2PYJA 4HTLA 1JJ2S 4CF2A 2PUKB 3VQ9A 2O8EA 5LA6A 4C8QC 1Q81U 5DMRA 3H3NO 3NAEA 4A59A 4JKCA 4Z8AA 1I1JA 3EKUA 1Z5VA 2RMOA 1UFFA 1KD1O 1DTQA 3S9HA 5GANf 3HYFA 4KT0E 4BR0A 4B9WA 1NJIH 2P6YA 3EGXB 3V8KA 4LN2A 1VSHA 4CJEA 1VA7A 2QTPA 3J80O 5HBMA 3GPLA 5ADXH 2QKBA 5C2DA 2OZMA 2PVGB 2CSQA 1GO1A 2OTLN 4U3JA 3M8SA 1Z26A 2EVRA 3CCJA 4WYBA 3M0TA 4O2AA 2QWQA 3V7CA 3DOKA 3ER0A 1U04A 4G4ZA 4Z88A 5AQLA 3I5RA 5EC7A 5A0DA 1TUDA 3ZSQA 1HJDA 3CCEF 4QQ6A 5HP1A 5IJ9A 3RSEB 1VQNN 1OYXA 1U6ZA 4WF9L 4FWMA 1WYXA 1YQNA 1FNKA 4FJHA 3SDZA 3TARA 1HXDA 4CJTA 4M7AB 1ABOA 2ZGWA 4O4GA 4MFBA 1JJ2F 3S6WA 4F7UB 3I0SA 5GANh 2DL7A 1VQ9T 5LJ5h 4DCHA 2FC3A 3D2EA 3MX2A 4BT7A 1X6OA 1G3YA 2E5KA 3AO1A 4JYAK 5I9EB 4JV5K 4ZHQA 3GNGA 4DTJA 2P84A 1BBZA 4FJ8A 3VTIA 3A8HB 4CJFA 5LJ5j 4KRTA 5CA0A 4O55A 2J6KA 4PA1A 4LNUB 2P1JA 2FZGB 2EX3A 3VESA 3QIOA 2G3RA 2J05A 1H47A 4YNQA 3VS3A 2GLZA 2QGGA 4KTWA 3ZSXA 2XRIA 2IQQA 3K0SA 3LWVC 4DS5A 4IIMA 3EH1A 3A5NC 3LM9A 2LQWA 1NG9A 5IXFA 4C8LA 5FLXE 3WVEB 3DXKA 3V4IA 2BTOA 3AHUA 3F70A 3CCUT 3CCVQ 1VQMN 4LFBK 4NWOB 4M7DA 3VO8A 1JXBA 3HRSA 1ZYQA 4RW9A 1QCOA 4RCCA 1NYGA 2XHBA 2LC4A 2A37A 3SBGA 1X9MA 1N27A 1YXQA 5MLCQ 3AVKA 3CFOA 1JN1A 3I56N 3EN9A 4GW6A 3JATA 5LOVB 2YUPA 2ECZA 2P9LB 2RHKA 4Y1CA 3G71N 3NFCA 3RBBB 1C0GA 1S9GA 4IBNA 4M3TA 2E12A 3DB4A 1F21A 3CCQF 2UYKA 4F2RA 4CC3A 1M1KU 4AM6A 4RHAA 2I5JA 1TKZA 4BI3A 3CMEQ 4FZYA 3WGKA 1B34B 3MP6A 2H3GX 4RTYA 4LFAK 2CH4W 1AWWA 5F0XA 3OYKA 1M3AA 4QT7A 3O5ZA 3RUXA 3SIVA 3DLLA 2COZA 3LGLA 4B9LA 1YFNA 5LP6B 2PNIA 3AAQA 3LLRA 2I6RA 4H5TA 1VQ8Q 2RI3A 3AO2A 2P9SA 3CEYA 1RBVA 3WEEB 1T8EA 5HK3A 1NJYA 4M75A 3CJ7A 4FOIA 3D45A 1LV5A 5FPEA 1M90C 5KYXA 2LQNA 4O0JA 2LT1A 1RA4A 2EYWA 4XQ3A 2M51A 3TAFA 1NEBA 1LCUA 1W9HA 3BY7A 2QW9A 4F04B 1WHMA 4JKEA 5LYJB 3KK3A 1OH5A 4B3OA 3EEQA 4KV8A 2FHDA 4CJQA 2GTJA 1EIFA 4CFDA 1OPLA 5IN1A 5F1XA 3L4IA 3LFOA 4DTRA 1HNVA 3JCMg 4R5PA 5KYWA 3VQ4A 2QEXT 3OW2A 4M78A 4B5CA 2HKNA 3TTDA 4GY5A 1A5XA 3F2KA 4HUEA 3O85A 3QFPA 1NK4A 2QQAA 4FWOA 3IUCA 1X69A 1W5BA 4HNAB 3L2WA 2C0OA 3I9QA 3EKSA 4C1NI 3H9NA 4LD6A 3NMUA 1D0ZA 3CCEQ 1B92A 4X1KA 1WSHA 3KK1A 1J7HA 3NFAA 3EFRA 3O1BA 1JY8A 2V9YA 3FLGA 3TD5A 2V7ZA 1WNLA 4NLCA 3CCJF 1QS4A 4IEEA 4MLEA 4PFPA 1OFUA 1KFZA 1YI2N 4C8NA 4KBOA 3VJPA 2WSFE 2IDOA 5GMKe 5CKEA 2MWPA 1RABB 1S1XA 3CQYA 4FVMA 1R0BG 4D8DA 2XDBA 4LUEA 2FSJA 4CK1A 5IT9M 2F5TX 2PZSA 1VQLA 3ZOPA 1Q82C 3CYMA 4H8KA 1IBKK 3JCMV 1NOYA 4OPHA 3PV8A 3UPUA 4Q5WA 3MCQA 2MYSA 2QQSA 1YGYA 2AZSA 1W2BM 5LMUK 5KX5A 2K9GA 1M90H 2RN8A 1PRLC 2VXFA 3U9ZA 3G4SN 3L2ZA 4O4IB 3H3OB 3NH1A 1G8XA 3DB3A 1IO2A 1CZAN 1RAAB 2YLBA 4DRXA 3PX6A 3L8BA 5CR2A 1BO5O 1RDWX 4IJAA 4R56A 1CXUA 4JI1K 4BG8A 2XO7A 4F2SA 4WBNB 3P8DA 5GAMj 3DRRA 1X2KA 1M8MA 5KPTA 3TREA 1QLYA 2ETJA 5ELZA 1C1AA 2E8AA 4ZHVA 4MMLA 1ACMB 4J7IA 3MQWA 3DJCA 3CFRA 4X1YA 4JRKA 2QWNA 2R751 2Q1NA 3NGPA 2XY5A 4ZOLB 5GAN3 2UYNB 4FFBB 1QVGM 2O31A 2VASA 4E6RA 4ZTFA 1HQUA 3RTVA 1VQ7A 3Q8HA 3E20B 5EWRA 4AT1B 4O4LA 2AK5A 2DPPB 4K42A 1XHOA 4BRGA 3J7ZO 2QTXA 5GMKh 3O9SA 5EB0A 1MMAA 2DTIA 1HSQA 2DRMA 3QWXX 3KXTA 1QVFA 4CFAA 3CCST 4ISGA 5GAN5 3LWRC 4CJ4A 2RD1A 1HKCA 2CGJA 4CK2A 4M7DF 4PJOA 2VG6A 3AO4A 3MXIA 4RTXA 2CDTA 4LUDA 2EKOA 1KK7A 1M2VB 3CCQQ 1Y97A 5FNVB 3VN5A 1D9DA 2P4TA 4RUGA 4G4YA 3WGJA 1T0KB 1WJSA 4AG2C 2JLEA 4BR4A 2DL4A 2Q0UA 3CHWA 2PY5A 3CC2N 1RDDA 3VENA 3THXB 3OW2S 1LNXA 1I81A 4OB0B 2GV9A 4KH6A 2DMOA 1SZQA 3MEVA 5AQKA 4H5VA 3NK7A 1ATRA 4BVPA 4IDHA 1VQ5A 5GADP 4M77A 1BWFO 4OB1B 3NHGA 3VQ8A 2HHXA 3CQTA 1VQOA 3EORA 3AA2A 3PIOA 1YJ9N 5FDLA 1ESVA 3UT5A 4JI8K 2DZ9A 3V3TA 3WPWA 4LE9A 4M75F 2HBKA 3F0FA 1IGQA 3CCVT 3MJXA 1NLVA 2MI6A 4DSKA 3HT3A 2HX0A 2NRRA 1WN7A 2FZCB 3SNNA 4DU4A 1UGRB 4B9MA 3AO5A 1IREB 2HNIA 4HVUA 1FSZA 4J9HA 3SYZA 5ADXA 1C0TA 1Y64A 1N5ZA 3LPUA 3CCLN 3CQXA 1XMQK 3RYFB 4PKGA 4QQDA 2EYZA 5AZIB 3KLEA 1TK8A 2CZ1B 4XTYA 1QU9A 3O3GA 5JQGB 4C8MA 3B6NA 2X4JA 4BROA 3EFOB 5HXZA 2F9ZC 3OW2F 4M78F 3M0PA 2X35A 3VS5A 4EMKB 4C8KA 4KHSA 1TU0B 2M9UA 5LJ5d 1G15A 3NVIB 3CMET 1XC9A 2L89A 4OMFB 2P9IA 3QDKA 4G9ZA 1NGFA 1CLQA 3CCJQ 4BI8B 4XIUA 1SRMA 2C0TA 4OMMA 3FZMA 2FXUA 3OYJA 3JALB 2DAQA 3GBQA 4CJ7A 3DLEA 3AVBA 3HP6A 1VQ8T 5BRDA 4YJ2B 4B9SA 3QEVA 4C0DB 4BDZA 1WNSA 2CWJA 1HJRA 4I2PA 2VV5A 4LH4A 4FJ9A 3HAXD 4IKFA 2CP2A 1WLJA 4JDSA 4PWDA 4MZMA 1Z25A 3VEVA 2V52B 3U6FA 1J5OA 1KQSM 3NE6A 3HFNA 3P39A 4JKDA 2UUAK 3RR7A 4NO7A 4GV6A 1Q86C 4ZI7A 1M9SA 4L59A 3LDOA 3OYFA 4FJKA 1OV3A 1NGDA 4O5VA 2B4JA 2WACA 1S72N 2DBKA 3LWHA 1QVFS 1ZBUA 3N4QA 3O9RA 4DV1K 5EX5A 4H5WA 3TABA 3CF5L 2VKNA 2K5IA 3N4ZA 4Z4CA 1KFSA 5GONA 1JL2A 2VC8A 1TVRA 4HCZA 2KYBA 4RG8A 5KCOA 4M7DG 2VWBA 3CBMA 5FU7B 2RI5A 3H45C 3NGYA 2J7IA 3ATUA 5CR4A 1KHIA 3VYTC 1W2BP 4J6XA 5JVGL 1SKSA 5EYPA 4CGDA 2E2QA 4BGAA 3OYNA 2UXDK 4LSNA 1KD1R 4PJOE 1MWKA 3DXMB 1QKWA 2RQTA 1FKOA 3QB0A 2E5LK 4QVCA 1PCXA 3CCET 1LWEA 4DQ8A 3ULEB 5KPZA 4FJXA 2X3XD 1UA0A 3JARB 3JAMM 1R59O 5GAN2 2K1SA 1T7PA 3VYUC 1GLBG 3L1AA 2P9KB 5A0LA 2DEUA 1YUWA 2X6SA 3CI5A 3E9LA 4VUBA 2E1ZA 3HPHA 4YORA 2RA2A 4PJNA 1D5AA 2GWKA 3C7NA 3TU5A 4K8XA 4C8QD 1OH8A 1VQ7F 5I11A 3U23A 3FZLA 3KLGA 3GL1A 2YKMA 3DRSA 1QVGP 4CD3A 4Z4IA 1OI1A 4O5BA 1KRPA 1QVFF 2CP3A 4DTUA 2RHIA 4M75G 3SQ4A 3TEEA 3RNJA 3ENHA 4ID1A 2IS3A 4GY2B 1VQNA 1HNZK 3V7RA 5AQNA 3PX0A 1AWXA 4FU6A 1Q86H 3GBTA 4DSLA 1ATNA 1KC8C 3A2FA 4E47A 2OTJA 2XKOC 4AHCA 1JFFA 3QEXA 2NMUA 2K57A 4FXDA 1BYMA 3RRHA 1KNJA 4IUPA 1QMCA 2DFFA 1TVKB 3KIZA 1RLPC 4MMKA 3LDQA 2HVYD 3LW5E 4Z0UA 3IKMA 3WXIA 2AP1A 3HKCB 1E6GA 4OMOA 1K9MC 2OPSA 2ZM6K 3K5NA 4C8OA 3AT1B 1VIEA 2OI3A 2GCXA 1WJRA 1Z5WA 3ZX0A 1MMDA 4E7KA 4TUYA 4JJBA 5KGWA 3AVIA 3EG3A 3ZSWA 2A1SA 1VQ5F 3VRZA 1YJWN 3QHSA 2ZPFB 1K0SA 4I6MA 3ZSYA 3J8AA 3ZT1A 4M77F 1VH8A 4FLWA 4DQ2A 8ATCB 1VQOF 1P8ZA 1HNIA 3E9PA 3MX5A 3M5AA 3VUBA 1NGEA 5LXTA 4PK4A 3PSIA 1NE8A 2D0CA 4XTWA 1PNJA 4BT3A 2HBWA 3SIUA 5CVIA 1B07A 2RQUA 5CK9A 2E41A 2CZ0B 2IG0A 3OBYA 4JJNK 3MN6A 2EJFA 3JCMb 3ZEUB 2GWJA 1TUBA 2CT4A 3VV0A 3VTIC 4B1WB 3CCQT 4CHPA 4BY9C 4BC3A 1QWFA 3P83D 3LZJA 1PRMC 2D0BA 1QQMA 1R0CB 1J53A 1Z6RA 2OYQA 2KKZA 1JXEA 3R8EA 4DA4A 1RAIB 2ATCB 3QDRB 1ZBIA 4CGFA 3HKSA 1GOAA 5HY6A 5CYQA 2YYEA 2JZ2A 5GAMd 4YY3K 4ZGDB 2HHTA 4J7FA 3VS0A 4YFUA 2YV0X 2FL7A 1YJNN 1W59A 3P5JA 3ESJA 1UG1A 3PVLA 1OVQA 3RSEA 2IIMA 1KSWA 4E7ZA 1S6PA 1VRTA 4YOTA 3TAQA 5IT9O 4CZKA 3ZYYX 2HL5C 4M7DC 4C92E 3R1XA 4KGXB 2DYYA 2MIOA 5KE3A 2OHWA 3JS6A 1YBYA 4M7AA 3CC4T 2F5KA 5EOYA 4CJKA 4JKGA 1JEGA 3TAEA 1X9WA 4KWEA 3CCRA 1NJIO 3URGA 1U40A 3MDQA 1D4XA 4LF5K 5GIPA 3TI0A 2VQFK 2JM9A 3LGFA 4HT8A 1K4US 4CERA 1JCEA 4KGVB 3QESA 1AOJA 3MPUB 2LX9A 2W10A 3U3GA 2W8BC 4RTTA 1K8KA 4YDUA 1WAFA 1TTHB 3GE1A 1L3VA 4KI4A 4D8KA 1KAYA 1NOZA 3AA4A 3Q7BA 1KQSP 4ILGB 2DXUA 2HHHK 4BT2A 4J6YA 7AT1B 1T03A 1TAUA 1WXUA 1J3TA 3KLIA 4CI6A 2RHZA 1C0FA 3VEYA 1M1FA 1Y07A 4BC4A 2HBMA 1JO8A 3I0RA 3H41A 1PSEA 2LSNA 3EL2A 1BI3A 3M8PA 4K25A 4A5BA 4CJPA 3K5MA 4OB2B 2MMPA 1YIJF 2D9TA 3EHRA 4JHDB 2CVLA 1KXPA 4RMOA 1EO1A 3KKRA 4I9LA 4NLBA 3DI6A 4A54A 4M75C 3CCJT 1HYOA 2KI7A 3CXCA 4BRAA 1VQ7Q 1MDUB 2DYBA 4JI4K 4WCIA 4EIAA 4I55B 3M3ZA 5KYYA 1KFDA 4CI0C 5GAOl 2IAFA 1S9EA 3BF3A 3NDKA 4CCHA 4CIFA 1JJ2M 2Z1JA 1VQ4F 4M3WA 2UXCK 5DM7R 5AVMA 4CGIA 2YUOA 4E1JA 3ITHA 3HTRA 4DFKA 1FNJA 1I4K1 5C10A 1FKPA 2O9VA 4XU1A 3V7QA 4EI7A 1M1KH 4M77G 4KHPK 1H3ZA 4FJ5A 1RGIA 4M78C 2YJFA 1Q7YH 1GFCA 2K6DA 4QOZB 1TXQA 1X3NA 2VWKA 5MN4A 3PMTA 3J7AF 2YHWA 1U47A 2IC3A 4FK0A 3HJFA 4LY7A 4BT5A 2V7YA 4AFSC 2RQRA 3I55A 3NMUC 2K3YA 3JV3A 5LJ3h 2BZXA 4BY6B 4JKAA 4DQRA 1UJ0A 1UWBA 5LP6A 2ZCFB 2OTJF 3MEUA 4KFBA 5HL7L 1VQ5Q 1TUGB 3OSVA 3EE9A 5LJ3j 4CF9A 2P9NB 3V9WA 3T1YK 4O4JA 5AQUA 4BDPA 1YTAA 2NRZA 5AQXA 3UKUB 3DKMA 2HW3A 1VQOQ 4FLUA 2JGUA 2E70A 3NGIA 3CCMN 2HVHA 1SHGA 2E4HA 1RT4A 4N0AA 3HKEB 2NUTA 5CIUA 2HQHA 3ZT4A 2HP0B 4ICLA 3OQ5A 3QBWA 2P5GA 1EETA 2PYLA 2KGTA 1VK0A 3CMAN 3X25B 4QAGA 2EYQA 3JASB 5C12A 2RJCA 1WXTA 3M0UA 5D6YA 1RT6A 3QWYA 4NCAA 3PMIA 1ZLMA 2DLPA 4IDKA 1X7OA 1ITGA 1NGGA 3BDLA 4HVJA 2FBYA 4CHNA 2EKHA 5AQSA 2CHSA 3RKYA 1FMVA 4F6RA 1VHXA 3VQ7A 4QKUA 5BMVA 2HNZA 2Q2RA 3FZKA 1CZBA 4QW2A 4I2QA 4M7AE 4DR3K 4KH0B 4FJIA 1N6AA 1QKXA 2EQMA 3JB9H 4X34A 4E7JA 1HRHA 4C8QG 3K5LA 2D0NA 2CS7A 3ZFJA 1VQ6T 4JKFA 4M45A 3SMPA 3M5RA 1IBMK 3HFOA 3UWNA 5AQGA 3RMCA 4KH1B 3OYHA 1VQLF 2QWOA 1YP5A 3A8GB 5L23A 3SLCA 3QEWA 4C1NK 1X3MA 1YWOA 3FZFA 1IXDA 3MECA 2LBXA 3CD6N 1UHCA 4H4OA 5BPNA 3I8DA 2CP7A 1NK8A 3ZLJA 1X2QA 3CXCS 4IFEA 2HS3A 3WXKA 2I6DA 5EIBC 4PJOC 1UDLA 4CJSA 4RTUA 1JB0E 4DU1A 4B9UA 2KEAA 3G6ET 1JLAA 1GCQA 3MEWA 5KRTA 2HHWA 4M7AF 2XG8D 2KK4A 1COMA 2BIVA 3U4LA 4WE1A 4OLAA 1FX7A 1M3BA 3CCRF 3M4GA 1NKCA 1C0MA 4ZGJB 3NPFA 3OYEA 3RE3A 5GAPK 2W42A 1BI2A 2D8HA 2KRSA 1WA7A 4NYFA 1JKHA 3A5MC 1UUEA 1YIJQ 1DBFA 4XU3A 2P9PA 2LP5A 2LDMA 2Z1EA 1IHWA 4AHUA 1N8RC 2HNYA 2CGLA 4FOEA 1HR0K 1VQPF 2G8IA 2QXFA 4CZEA 4RTZA 3DLLL 1SUQA 1NQ3A 4LF6K 1PF5A 2EAYA 2JNGA 3VTHA 1EWQA 3JAMO 4K8ZA 5FWCA 3QIPA 2UYNA 5DY9A 1OX9A 4M77C 2ZVZA 4Z4GA 1NLOC 1PM3A 2GQVA 3IQLA 2ASOA 3CJAA 1YT3A 4H0XB 1RQ7A 2O4GA 1NKBA 4B62A 1YN8A 1M90O 3OYLA 5HY1A 3CCLA 3ZSRA 1MWMA 4C8QB 4BRFA 3EH2A 4CBWA 2Y4YA 3D0PA 1VQ4Q 4F3TA 2P9UB 2NRXA 2Y1IA 5ITZB 3AVMA 3CXCF 4N4HA 3KHYA 1BB9A 1LWCA 1IRXA 1C1BA 3R9PA 1IJJA 1YAGA 4H5NA 1VQ9N 3HOSA 3N2GB 4A2AA 4JS4A 3LWMA 3SJHA 2KNBB 2VGMA 4X9DA 3VS2A 1RILA 2CP5A 1ZSZA 1D1CA 1RI0A 1B9DA 4FZXC 1H641 2HCKA 5AZJB 5CCAA 2L5QA 1JJ2P 1MV3A 2L3RA 3GYQA 4E1MA 2D0QB 2E64A 5C24A 1D8YA 4EHTA 3VEZA 4B1VA 3SMSA 2JMAA 4J9GA 1VQNQ 4DF8A 4C82A 4YOVA 5C8YB 3QG1A 3VUZA 4RTVA 4CK3A 3RMDA 1VQVA 4BC2A 1WSEA 2OTJQ 4A5AA 3LYBA 2BTFA 4YOYA 2DE0X 2ASPA 2QDLA 2GZLA 4H0VB 5HRRA 1EZZB 2RPIA 4IFYA 3VU3C 1OX8A 3VGLA 1M3CA 3BDPA 3NF8A 3I55F 3F0EA 3JAWB 3IMPA 1VSLA 5IHKA 3S03A 4FJMA 1IBLK 5BR9A 3CCUN 1BHLA 3JYTA 4O4HB 4B45A 3DC2A 4CBUA 1NK7A 2DT4A 2QA4F 4OKKA 3DAWA 4CEQA 1VQ7T 3T19A 3ME9A 3K9KA 2ED0A 4DR2K 4TV8A 2CUDA 3LDLA 3IMXA 1Q82O 4K0KK 1T0AA 3LANA 4DV7K 2L3PA 1J6ZA 2B33A 2NLUA 4IG0A 1VQKA 1UOCA 2PFUA 2MK5A 3VEWA 4AF1A 4DV5K 2EQIA 1JXMA 4E2FB 3U8XA 4B3SK 4EI9A 2DRKA 1FYNA 3QO3A 3PO4A 1H7MA 3RYFA 4OKEA 5AZIA 4FLZA 1RAGB 4MO4A 1ZA1B 4X65K 3JCMe 3ZL7C 5I22A 3OYCA 1GBQA 3OYIA 3VEOA 3VS6A 4DG1A 1L3TA 1KSPA 4EMKA 1NPPA 1HQEA 4LF8K 1W4SA 4FYXB 1RFQA 4N5SA 3SJJA 2IVNA 1GOCA 1VIFA 1BIZA 2O9SA 2J6FA 1VSMA 1QHTA 2V1RA 3JCMf 5DLOA 3IDHA 5GMKi 3TR8A 2RI2A 1C1CA 3VQDA 4LD9K 4PNOA 1NKEA 2J6OA 1SSFA 3E22A 3LAMA 3TWHA 3IEQA 1Q8IA 1PKTA 3NTKA 3CC7F 4J2EA 5LJVA 3VRYA 1CXQA 3L42A 4M7YA 2F8TA 1VQOT 1VYUA 1OKJA 1PKSA 1WPYA 4J9CA 1W42A 3N2KA 4M42A 2DVJA 1H92A 2RHHA 2HRYA 3REBB 1V29B 3CCRQ 4DUZK 1ABQA 4F8RA 1IG9A 4FJGA 4BW0B 2QEXN 3THVA 1NWKA 1X43A 4DTPA 4BT4A 3EG9A 5GANj 4FYYB 1RI9A 1VK3A 1OU9A 1W97L 3AA3A 3OW2M 1GBRA 3IS9A 2MPXC 3JCMh 1TYQB 1YJWA 1WHLA 2DIGA 4FYDA 5C0YA 4MDWA 1VQPQ 4M3YA 2YNHA 2G6FX 5A2QE 2E2PA 4CZMA 4JN4A 3VS1A 3Q7CA 3WXMB 3R0PA 4CIEA 1ASVA 5AQHA 3MWTA 3BY5A 4YOWA 2PUOB 3H0HA 4CEAA 3GF5A 1H3HA 4RCHA 1K73C 5M1NA 3KD1E 2LNHB 5D6XA 1K9MU 3LZIA 2GVIA 3V1QA 3V1OA 4C81A 3HSCA 2ESWA 2P9KA 4HWIA 3PIOL 4DR5K 1X52A 2HBJA 3QETA 2A28A 5I42A 5LL6S 5LJ3d 2YHBA 1GOBA 2RHUA 1KAXA 3AVHA 4WFNL 4FJ7A 2KZZA 1NZ9A 1CN7A 4Y91A 3TSWA 4FWNA 3GLXA 4KKOA 1M8VA 5F2RA 3OJUA 3TAPA 4OKJA 1WSJA 2GFUA 1E7OA 2VGNA 1V4SA 3E01A 3WT0A 3K12A 4B8CA 4FL6A 5CA1B 3VETA 2DO3A 2QKKA 1K8AC 3EE8A 1YJNA 4GVMA 4DEXA 2GBQA 2DTOA 1I5LA 3O9QA 4FWQA 3QNNA 3OTOK 5KTQA 2JS2A 2F4VK 1NJIR 4JKHA 1XRGA 4DOWA 2LJ3A 3OBWA 1V4TA 2YUQA 4EP4A 1T05A 2Q1YA 4UY8O 3FEOA 1XNRK 5C6SA 1JU5C 2ZOVA 3VQCA 3LDTA 5EZYA 3DLGA 4DU3A 1YIJT 4PFZA 3I55Q 4PQUA 1TVKA 2RPNA 5CB4B 2RN2A 1NBEB 1TUYA 3J81O 4AQYK 4YTLA 1N33K 3HKCA 2FBVA 4FYWB 4M7DD 3ASMA 4OMPA 3SUQA 1TWBA 2DL5A 3S0WA 2E65A 4IUVA 2XY8A 3EZ5A 2QA4Q 2ZPHB 2D4WA 3K14A 1U8RA 4IHJB 2HHVA 3AA5X 4EAHD 4QS8A 3HPOA 4W5QA 3CCSN 4DSEA 4DSIA 5GANK 4ISEA 3TCJA 1VQ4T 4M7AC 3ZX3A 3IAYA 1YITN 1K73H 4LDYA 2NWMA 3NTHA 3AV9A 3WXLA 1QVFM 4DFJA 1UI9A 2V8IA 2KBTA 5CQYA 2QI2A 1QHAA 1Q86O 1JCFA 4HCCA 3K58A 3OA6A 5GIPC 2JS0A 2DA9A 4HVWA 2KT8A 2DTHA 3MHXA 3LPTA 4KH4A 1TUUA 5D7UA 3I8BA 1QTMA 4RW6A 4ATOA 2NZTA 3NGZA 3C94A 2YX6A 1LW0A 4DS4A 3P4EA 4YDUC 3QXEB 3UE5A 5FU6B 3KBGA 4YJ3A 1GLCG 1VQKF 4O5FA 3OMCA 3JCMW 3SCXA 2CP0A 3QZ9B 3LWQC 5CKDA 3ISNC 5J2TA 1X75C 1ZXOA 2NRWA 2FPEA 3HO1A 1K8AH 4M75D 2VG5A 1T3SA 3IG1A 2JWKA 5GANg 5CZ1A 2F7TA 1FMWA 4FM4B 3FC3A 4CEBA 5LJ5g 2OTJT 3L2UA 4RWTA 3M0SA 4U67L 2K2MA 2A3LA 2EJ9A 2F2WA 3CC7Q 2KTVA 3NVMA 1NK6A 2BGGA 1X1PA 1YCYA 3V9ZA 1E6HA 2YLCA 5IXBA 2GX9A 1YHQA 3AVLA 5GAMe 2DERA 1I8FA 1R77A 1W3EX 3CCVN 3SWNA 2Q3SA 2W40A 2M0YA 2E6MA 1W5AA 3M56A 3VYHB 2PHNA 4M78D 3OYAA 2KSSA 3CJBA 3RYCA 3AARA 4KH5A 4I50B 3WPXA 2Q1XA 3VIUA 3JB9J 5AQZA 2PZ1A 1NGBA 5M1FA 1ZBJA 1VYVA 5M1KA 1WQWA 4FWLA 1UA1A 1LJOA 3QINA 4PJLA 4BRKA 4JJDA 2EBPA 2LMJA 2V26A 3SD4A 1KC8O 4PJMA 3TSQA 4CJVA 5EG2A 1SQKA 2LJ0A 3CMEN 2IVWA 4FPAA 4MDXA 5TKWA 1SG5A 1PHTA 1YJWF 3ALYA 3L2RA 5GJVB 5HRSA 5LP6C 3CMAA 2F2VA 4LDVA 4C5IA 3H6EA 3PSFA 2OPRA 1K9MO 4BI4A 3OW2P 2JWLA 3HKDB 2D5RA 2GF7A 2DVEA 3E2UA 4NB4A 2IAJA 4M3XA 3GOIA 1AHJB 2K2VA 3O8MA 1CZ9A 4N0AC 1RBTA 4C4WC 2EQKA 3FD6A 3C6HA 2E6ZA 3F5TA 2VQEK 4AILC 2BKDN 4CHQA 2M16A 2VXYA 2VAWA 1MU2A 1TGOA 2A40A 3LP1A 5GMKj 4DFPA 5KRSA 1I3AA 1D3BA 1BOTO 1ASUA 1UJYA 3RA5A 3THKA 3VKIA 2ATQA 2O88A 1TV6A 2Q0RA 3C65A 3CCRT 1WIEA 4EMHA 1GXIE 2FBTA 2PBDA 3HM8A 4J6WA 3I5SA 5KCHA 2DNUA 3A1PA 2A6AA 3LP2A 4HVVA 2AIRB 3R3LA 4WFBL 3BFMA 3JCMQ 1AD5A 1Y96A 2EIFA 2O2OA 3O4WA 3PUFA 5CY4A 3ZT3A 1KQ1A 3QHDA 1YJNF 4AHVA 2O8CB 2JW4A 5AR0A 2AIZP 2X78A 2NRVA 1VQPT 1BDGA 1GLEG 3MCPA 3HRGA 3OYDA 5AQJA 4E7HA 4OPJA 4RW7A 3X28B 3VYSC 2FEIA 3W3DA 3CCEN 5J2UA 1SKUB 4FIBA 3P31A 2E20A 4FT4A 3V8JA 6AT1B 2P9NA 1D0YA 3OB9A 1ARKA 2G8VA 2HS0A 2RQVA 2YUNA 3D2FB 5AQVA 3NH0A 2UU9K 2JUFA 3EGDB 5EIBD 4RTWA 3KHNA 4IFVA 1M4ZA 4IUQA 1SA0B 1RLUA 5HY0A 5M9OA 3OSSC 1DGKN 3PIPA 4IOXA 2MCNA 4FWRA
chains in the Genus database with same CATH topology
3K9JA 5HOOA 2WSEE 3LX7A 5AQTA 1U1SA 3PT9A 4X3LA 4EPCA 3OS2A 1KD1H 4CRIA 1UGSB 2P0KA 1NMUB 2KMTA 1DJ7B 5HK0A 5GANd 4M77D 3JB9F 2ZPBB 1ZC6A 1N8RU 3I55T 4XH1A 4QS9A 4ZN3A 3N4PA 4NQ3A 5GAMg 4CZGA 4FO0A 2YHXA 3RKXA 5GAN7 4BRHA 1PXWA 2QA4T 5I2MA 4KBMB 2DD4A 2I2LA 4A2BA 4A4EA 1R8OB 1E4GT 1YHQF 5AQRA 4O6JA 2Y90A 1SZ2A 3MEAA 1VQLF 4CZLA 3CCQN 1NMDA 1NJIU 4C0ZA 2M1HA 4JK8A 4C92A 4BVOA 2OANA 3FLCO 5TKYA 4JNEA 3OYYA 3JCMc 2O4XA 2HBLA 3RERA 5AYFA 1Q81C 4XEIA 1XNIA 1T44A 5H1SQ 5M1PA 1RLGA 1ZHIA 3CMAF 5AQFA 1JRIA 3CC7T 3D2EB 5BRHA 3NVKE 3CPEA 4BRNA 3CC4N 5EXWA 3E9FA 2GFAA 2LT4A 5EVZA 4ME7A 2OTLA 4BQZA 5JMVA 1ILYA 4PKIA 3FFKB 1KAZA 5AZJA 4PJOF 3H1VX 4BRCA 3M59A 3PTAA 4EMKC 3TU4K 1U1TA 4V2SA 3MMVA 4M7DB 3LM2A 2GTDA 3CCJN 4IUUA 4JUVA 4M78G 3JB9G 3EAEA 3O9TA 3CXCM 4J8FA 5EY4A 2ZGYA 3QBXA 1GZ0A 4NUTA 1O75A 1Y71A 3ATVA 1QQNA 4IJNA 1Q81H 2BUPA 5IT9E 2DZCA 3P38A 3TSPA 1G3WA 3CIPA 2GELA 2IVPA 2ZF5O 5M1QA 2K3XA 3OYBA 2D0PA 3ENBA 2RH2A 3FRNA 2P9SB 2A42A 3CG6A 1VQMA 4M75B 3M6GA 1M1GA 3QKJA 4JS5A 5LY3A 2E10A 5FPMA 2W41A 1N8RO 5BN9A 3F9MA 4IO9L 3E9GA 4B9QA 1Y7XA 4IZ9A 4CZIA 3HPWA 3WVDB 3I56A 1G99A 2DD5A 4HA8A 2A41A 3G71A 4ZGEB 1YF5L 3UKRB 4J8OA 2WALA 1M1KC 4XH4A 4M78B 5J26A 4FL9A 1Q7YC 4F7UA 1MA9B 2NLXA 4QVZA 2D6FA 5A0GA 1BG3A 3S3NA 1HPMA 1VQKT 2R5AA 1TYQA 4C8QE 5G4UC 3CCSA 4JD2B 1YITA 4C92F 4PJOG 4A62A 5GINA 2KDSA 2WBNA 1QQOA 2GEMA 3TTFA 4NS5A 3N5BB 2RHYA 1VQ6N 3PLAA 3HRUA 4M7AD 3RA6A 4J5YA 3O5BA 1M90U 3D6RA 3ID8A 4TZZA 3X26B 4C0FA 3CPWA 4A53A 3G6EN 3ZETB 1NM1A 3MCAB 2ASMA 4IWVA 5GAN4 3O9UA 2P9LA 5GIOA 1MGQA 2XDPA 2OTLF 4NL3A 1YI2A 1OVYA 4RCBA 3C95A 5DM7L 1B34A 4JRIA 1BI1A 4JLIA 1YJWT 1VQNF 1M5Q1 3NK6A 5KE2A 1BA0A 3WEEA 1S3XA 3G4SA 4WQ4A 2JTFA 2CH5A 2MWOA 4OGEA 3SWNC 4BRIA 2QTDA 5M1OA 5A2QM 4GLKA 4OGCA 2CZ7B 3TPQA 3A8OB 3MN5A 1Q82U 1IPAA 2VYTA 2E2NA 5AQMA 3QJ6A 4BG9A 5FLXM 5E84A 3C6AA 3OA9A 3JCMM 4M77B 4LC9B 3DWLA 2EWSA 1GO0A 2MF2A 4JK7A 3JXUA 4XTVA 2CYZB 4WFAL 3HHTB 2D1KA 1VQMF 4F7UE 5AQOA 2JNBA 1HLUA 1K73O 4ISFA 4E7LA 1DKGD 2WFBA 4C92G 3JB9I 1VQ7N 3B8AX 3JAME 3I56F 4BACA 4EFHA 1N9SA 3G71F 4IO8A 3CC2A 1T6DA 3KK7A 3HTVA 1UEBA 1WGSA 4XAXB 1K8AO 5FPNA 1ZQ1A 3A5LC 4F7UF 5GAOr 3CPWS 3O80A 1YJ9A 3ZBDA 3S3OA 2HF3A 2RK1A 2JN0A 1NPRA 3M53A 2QWPA 3FZHA 1UGQB 3CCSF 3M54A 2GUPA 5DCVA 2QQ9A 4DOVA 1YITF 3D7EO 5GAN6 4U7BA 3AY9A 4JAXA 4JEPA 2JOYA 2RJEA 3IFRA 4BVTA 4IEIA 3HRTA 4IURA 2ZPEB 1VQON 3AGKA 1MHNA 3JCMX 1YHQT 5LJ3g 1H1VA 2JVVA 1BIBA 2PVDB 5CAIA 4Y0WA 2FLOA 2A7YA 1VQLT 2FF3B 3CPWF 3HSBA 3CETA 3UDCA 2YJEA 2CKKA 4MO5A 5HKCA 3FGUA 4Z02A 2YCHA 2E1HA 3VOVA 3OMGA 4AM7A 5JVHL 3WUHA 2HQXA 1YI2F 2HSTA 4H5RA 3C7NB 1OZ2A 2RO0A 3RIRA 2NRHA 2WUSA 2DKGA 4JRPA 3LWPC 3J80E 1S72A 2PVOB 3D2FA 2QXLA 4OB3B 4R79A 1JBMA 3JRZA 1BA1A 5GAEP 3EZWA 1ATSA 3G4SF 1O9SA 2E2OA 4B1XB 4FSXA 5D6WA 1XBIA 5GAHP 5HY2A 2ZWHA 4PHTX 3JCMJ 4BVRA 5AQQA 1P92A 2LRQA 3O1WA 4PL8A 5LJWA 1GLAG 2FGYA 2QQRA 1Q86U 1ZBXA 3VPZA 1U2VB 1PSFA 4C92C 1BI0A 2E1YA 2LQ8A 1LOJA 2XD0A 5CQXA 5CHIA 1YIJN 4M7AG 3CC4A 4O8KA 4I6MB 2B8AA 2XK0A 1XQHA 2QWMA 2C06A 3JCMP 3Q1JA 5GANe 4DB3A 5LJ5e 1VQ5T 2RM4A 2BUDA 3LYIA 5GAOq 3A5OC 1VQ4N 1FWZA 1X7PA 1WUAA 5LJ5f 3VF2A 3IR9A 4ELZC 3ZEHA 4EHUA 3CC2F 3QYGB 4II1A 3GP8A 4JKBA 2DIQA 3ID6A 3T7ZA 5FPDA 4EMGA 3WQUA 1EQYA 3A8MB 1NBWA 3VI6A 4ILJA 4C23A 2HAXA 3SFMA 2OTJN 1YJ9F 1KC8U 3DXMA 4CZJA 4JKGB 2LCCA 3ULEA 4A57A 4BR9A 3J81E 3OY9A 2Q97A 3KUFA 3HP9A 3D00A 1K8KB 2XU8A 2Q36A 2ZPIB 4LDWA 3PIPL 3RKWA 3CCLF 3LWIA 2VXEA 2L8DA 2NRTA 3QMLA 3LH0A 4KUDK 3BF1A 5I2SA 1HJOA 4K41A 4FVUA 3SAHA 4RG2A 4PKHA 3INZA 2DXBA 4FWPA 3NTIA 5AFUH 3TSUA 4BE2A 3E66A 2OAUA 4BB7A 3QUIA 2ZGZA 4K43A 4CBXA 4XTXA 3V8LA 2RJFA 4UC4A 4WQ5A 4Y28E 2EQUA 3SB2A 4BE0A 5CKFA 1E7KA 2FYKA 2XIDA 3VGMA 1S72F 2DPNA 3A0IX 4O8UA 1Q7YU 5BN8A 4C5HA 5GAOm 2QWLA 4MDBA 3CCRN 3M4YA 1TH7A 1VQ6A 3ZEUA 4XTZA 2OTLT 3H8ZA 1W40A 1FXXA 3PFSA 2CGHA 2R5MA 3VF6A 4HKEA 2LTOA 5GAN8 1VQPN 4XCQA 1VQNT 5B8HA 2UYTA 5GINC 2R57A 3MWPA 3FB9A 3G6EA 3P8BB 2J4RA 3CC4F 1Q81O 3PLAC 3CPQA 3TTCA 5HY4A 2FB7A 4X3MA 2E5QA 2WSCE 3UKRA 3ON1A 2KAFA 2VYPA 2PU9B 1BUPA 3PAFA 3OS0A 3JB9D 2PAVA 4MDAA 5GAMf 3LWOC 4BVQA 3L2VA 2A3ZA 3ASKA 5GIOC 5FRNA 4M7XA 4BR2A 1T6CA 4HT9A 2Q31A 2R58A 1NGAA 3J7AR 3M9QA 3CCMA 3G25A 2RK2A 3O6WA 1LOTB 4JD2A 1ZBSA 3I33A 4J83A 2CZ6B 3VYGA 1VQMT 2MAMA 4QQGA 2RE2A 3RMQA 3I55N 3O08A 4MZPA 4JHDA 3WQTA 4BC5A 5C15A 3OYMA 3C4SA 5C0MA 1VQ8N 4WQ4C 5EO3A 2QA4N 4JLGA 3I56T 5GAMh 4ZTJA 3G71T 4BREA 1KD1C 2WC9A 3FJPA 3QSUA 4A4HA 4M7DE 3L4QA 2P9PB 3ZETA 1NGHA 4B1UB 4L6V5 3GOXA 2P0PA 3P4IA 3HI0A 5FU6C 4BUGA 4RTFD 5JLFA 2HMPA 3M57A 3CD6A 3OHRA 1HKBA 5HXUA 5FROA 1KQ2A 4BRQA 2CZWA 1YITT 3CBOA 4L3QA 3CC7N 5I21A 1SS6A 3UKUA 2BH1A 1OZ3A 1M1KO 4PJOD 3CPFA 4ELYC 1G3SA 2IVOA 4OPAA 3N4ZA 3HOTA 4M75E 4YOXA 1Q7YO 1Q82H 5KQDA 1XC3A 2M0OA 2DXCA 1XTDA 4QS7A 2V51B 3WXJA 4B1YB 1QZ6A 1SAZA 3VGKA 5KPRA 4BRDA 4E7IA 5GMKl 4H0OA 3GNFB 2FF6A 3VEXA 1VQ6F 3VF4A 4M78E 4BR5A 1BKBA 2F9WA 1YI2T 1VAZA 2RJDA 3QICA 4BR7A 1VQ9A 2KHOA 4B9XA 4BRMA 2EWNA 2FVUA 1W2BA 3JCMd 1IZ6A 4LDUA 3E19A 2KVQG 3G6EF 3G7ZA 4X9CA 3A8YA 5CE3A 5GAOp 3G4ST 1JCGA 3EFSA 4WF2A 2KLAA 5KH6A 4NOYA 4H0TB 3SK3A 3OS1A 2LNVA 1N9RA 4P5NA 5FJ4C 3T9NA 1QVGA 3KWGA 3E1SA 3E1YA 3CCUA 3M1FA 3L2QA 2VUBA 4A4FA 2V8KA 3R6OA 3SAGA 4XU0A 1UB4A 3S41A 2E6NA 2ZZDA 1HKGA 3C0BA 3CCMF 3X20B 4BDYA 1WOQA 2A5XA 4GNIA 4XH5A 3V7SA 3FIFA 4DHYA 4C8QA 4GV9A 2P9UA 4PL6A 4Z94A 2KY9A 2HD0A 1YIJA 4MZTA 2EQJA 2KQWA 4C92D 4MLHA 1SDSA 4EI8A 3CC2T 5AFUA 2NNWA 1VQKN 3M55A 3LDNA 2QQBA 3O8VA 5E26A 5AQIA 3L6QA 3OYGA 3P8HA 5C2FA 3DXKB 1VQ4A 3MP8A 1YJ9T 2DEQA 4OO1J 2QWRA 1G5VA 3CD6F 5KQ8A 2D0OA 4GV3A 1KG1A 2QEXA 4JRQA 3U9DA 2K4YA 4C0DC 4FPBA 4A4GA 4M77E 1GLDG 3H1QA 5DM6L 3GDQA 1W2BS 2ZJPL 2DXTA 3CCLT 1NGJA 1QP3A 3A5ZB 5CKHA 5L8RE 3S3MA 1GLLO 3CPWM 3KVGA 1RL2A 5GAOn 2ZPGB 1QZ5A 5AQPA 1O13A 3GG4A 1U2VA 3FE1A 4XK8E 5FU7C 1GLJO 4OP0A 3CBPA 2RB6A 1VUBA 4WCEL 5G4VC 4NL2A 4IOAL 3QYHB 1QVGS 5CO7A 1E4FT 3VERA 1KQSA 2BO1A 3M58A 2HF4A 3JSCA 2KTUA 2AA4A 1VQ9F 1XOVA 1K73U 1S72T 4BRPA 1W2BF 5BPMA 5AQYA 3ZX2A 3L0QA 4N4GA 5FRMA 4YOUA 2DK3A 3J80M 4BE1A 4H0YB 2H3JA 4L5GA 1K8AU 3MK6A 3FFMA 3VMFB 1KC8H 3QJYA 1RDUA 1QVGF 4BGBA 3CERA 4BD3A 3QBYA 3CCUF 3SWNB 4IOCL 2EFIA 1K9MH 3OS5A 4FT2A 2I7PA 1T3VA 4WQ5C 2ITMA 3H6ZA 3MN9A 1Q18A 5GAGP 4PL7A 4LDXA 1VQPA 2X4WA 4C8QF 4H0PA 1HK9A 3MP1A 5LJ3e 2FSKA 3KZBA 2K5LA 3QPHA 2K5FA 4PKCC 2O01E 4CZHA 3CJ1A 2OZBA 2LQKA 4BRLA 5LJ3f 1WQ7A 3CCVA 2LVMA 4CZFA 2CGKA 4KUIA 4IXCA 2LCLA 2JTMA 2CH6A 3DLMA 1QVPA 3BW1A 4PJOB 1X9JA 3CJ9A 4DKWA 1P90A 1D3BB 1NGIA 4ILHA 3GIBA 1KQSS 3FDRA 2ALEA 4FWSA 4B1ZA 3UT1A 3E9OA 4BQLA 1YHQN 2QEXF 1QW1A 2PQWA 2YHTA 3C12A 2HOEA 1Y96B 3CMEA 3QFUA 4QVDA 1VQLN 2XHCA 3ENOA 3HBTA 4FWKA 2EJGA 4C5EA 1VQ8A 3SBTA 2QA4A 2HBPA 4C5GA 3MO8A 1XQSC 5BPLA 4IUTA 1YJNT 5J3BA 5JICA 2YRVA 2QDYB 2F69A 4N4IA 3MN7A 1HUXA 4OF1A 4OVAA 2DJZA 2Y4XA 2E88A 4M63C 4A61A 1X01A 1KQSF 3BP8A 4LCKA 2AIFA 4RKUE 4XU2A 3BEXA 1S22A 5J39A 4D6WA 1KD1U 5HWEA 3FR0A 3RVCA 3RMSA 4A4KA 3CCEA 2FSNA 2P9IB 3CC7A 5DLQE 3AGRA 3QZ5B 4JK9A 3QIIA 4GVEA 2ZJRL 4PLLA 1WJQA 1BIAA 1JJ2A 4BY6C 5GMKm 3HJWC 2I7NA 5AQWA 4XTUA 3N4YA 1VQ5N 3PNWC 2XDDA 4PLIA 3W0LA 4BVSA 4C92B 1DT9A 2IIRA 3BDUA 3AAPA 1GLFO 2O4XB 2X4XA 2V8JA 3X24B 1DEJA 3SAFA 4C0GA 3KWIA 3T69A 3LDPA 2AHJB 3R6MA 4EDUA 2HQEA 4ZN1A 3A8LB 4TVRA 1CK2A 2XI9A 2QM1A 3EO3A 3CCMT 3PGGA 5BRFA 1IG8A 3HL8A 2YI1A 3CCVF 2X4YA 1KHCA 1NJIC 3CCQA 3CMAT 1Z05A 1QP2A 3HZ6A 4CD1A 5JLHA 3CJCA 3H46O 2ZJQL 4FSVA 2XICA 2LBWA 2YHYA 2VCPA 3BUZB 1NGCA 2RHXA 2KG4A 1YVNA 1W41A 5CKBA 3CMEF 5IAYA 1XUPO 1HX1A 3LL3A 4H03B 1N8RH 1VQ8F 3UB5A 3RESA 2P0QA 4KULA 4HCBA 4F7UG 4R55A 5BREA 1BU6O 1UGPB 1G3TA 3CD6T 2F9TA 3META 4HTLA 1JJ2S 2PUKB 4C8QC 1Q81U 3H3NO 4A59A 4JKCA 3EKUA 1KD1O 5GANf 4KT0E 4BR0A 4B9WA 1NJIH 3V8KA 5ADXH 3GPLA 5C2DA 2PVGB 1GO1A 2OTLN 3CCJA 4WYBA 2QWQA 3V7CA 3ER0A 5AQLA 5A0DA 3CCEF 4QQ6A 3RSEB 1VQNN 1OYXA 1U6ZA 4WF9L 4FWMA 3SDZA 1HXDA 4M7AB 2ZGWA 1JJ2F 3S6WA 4F7UB 5GANh 1VQ9T 5LJ5h 4DCHA 2FC3A 3D2EA 3MX2A 1X6OA 1G3YA 5I9EB 3GNGA 3VTIA 3A8HB 5LJ5j 3VESA 2G3RA 2GLZA 3LWVC 3A5NC 3LM9A 5FLXE 3WVEB 3DXKA 3AHUA 3F70A 3CCUT 1VQMN 4M7DA 3HRSA 4RCCA 2LC4A 3SBGA 1N27A 1YXQA 5MLCQ 3I56N 3EN9A 2P9LB 3G71N 2RHKA 3NFCA 1C0GA 2E12A 3DB4A 3CCQF 1M1KU 4AM6A 4BI3A 1B34B 3MP6A 2H3GX 5F0XA 3OYKA 3SIVA 3RUXA 3DLLA 3LGLA 3AAQA 3LLRA 4H5TA 2RI3A 2P9SA 3CEYA 3WEEB 5HK3A 4M75A 3CJ7A 4FOIA 5FPEA 1M90C 1RA4A 2LT1A 4XQ3A 1LCUA 2QW9A 3BY7A 4JKEA 2FHDA 1EIFA 5IN1A 5F1XA 3L4IA 3LFOA 3JCMg 2QEXT 3OW2A 4M78A 3TTDA 4GY5A 3F2KA 3O85A 3QFPA 2QQAA 4FWOA 3IUCA 3L2WA 3EKSA 4C1NI 4LD6A 3NMUA 3EFRA 3O1BA 3FLGA 2V7ZA 1WNLA 4NLCA 3CCJF 4IEEA 4MLEA 1YI2N 4KBOA 3VJPA 2WSFE 5GMKe 5CKEA 2MWPA 3CQYA 5IT9M 2XDBA 2FSJA 2F5TX 1VQLA 1Q82C 3JCMV 4OPHA 3UPUA 4Q5WA 2QQSA 1M90H 1W2BM 2VXFA 3U9ZA 3G4SN 3L2ZA