2VGMA

Structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
381
structure length
354
Chain Sequence
b'MKVISLKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIETDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DOM34
publication title Structure of Yeast Dom34: A Protein Related to Translation Termination Factor Erf1 and Involved in No-Go Decay.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 97
structure length 354
sequence length 381
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03463 eRF1_1 eRF1 domain 1
A PF03464 eRF1_2 eRF1 domain 2
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.870 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vgmA01
3.30.420.60 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2vgmA02
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2vgmA03
2OHWA 3G4SF 1YHQF 1VQ6F 1IPAA 3RA6A 1YJNF 1VQPF 3GYQA 5GANK 3OW2F 3FFMA 3CPQA 4TZZA 1VQ8F 2OTJF 3LFOA 1CK2A 2KG4A 1W42A 1X7OA 5G4VC 3G71F 2OTLF 1NJIH 3G6EF 3CCSF 3LWRC 3LWPC 5IT9M 1CN7A 1VQ9F 3CC7F 1Q86H 2OZBA 3CG6A 2LBWA 3NVKE 2BO1A 1X7PA 4NUTA 1YIJF 4X3LA 3HJWC 1GO0A 5A2QM 3OBWA 2FC3A 1SDSA 3CD6F 2LBXA 1VQ5F 4C4WC 3RA5A 1X52A 1K8AH 3V7EA 1JJ2F 1YJ9F 5G4UC 1Q82H 4LCKA 1DT9A 1K9MH 1VQKF 5GINC 1YITF 2HSTA 1E7KA 2KTVA 4X3MA 3CCRF 5EO3A 1YI2F 1QVGF 1VQNF 3AGKA 3J7AR 3CXCF 2QA4F 2QI2A 1YJWF 1XBIA 3O85A 5DCVA 2KTUA 5GIPC 1GO1A 1KC8H 3J81M 3V7QA 3CCLF 1W3EX 3ON1A 5GIOC 1N8RH 3VI6A 3CPWF 1VQMF 1M1KH 3OBYA 2WALA 3CCQF 3SIVA 3CCVF 3JAMM 3HAXD 1W2BF 3I56F 2VGMA 2I6DA 1Q81H 3CMEF 3PAFA 5GAPK 1VQ4F 1VQ7F 3IR9A 4BW0B 3LWQC 1W40A 5EWRA 5FJ4C 1KD1H 1VQLF 3NMUC 3JCMM 1PXWA 1VQOF 1RLGA 3CCMF 3PLAC 3E1YA 3SIUA 1RA4A 1ZWZA 2QEXF 1QVFF 1H7MA 3CCUF 3LWVC 3WXMB 3VMFB 1S72F 4BY9D 3N4ZA 3CC4F 3I55F 2CZWA 1NMUB 3LWOC 3CCJF 2HVYD 4AF1A 1K73H 3NK7A 5FLXM 3J80M 3CC2F 3CMAF 3NK6A 3E20B 1Q7YH 2AIFA 1KQSF 2ALEA 1W41A 2JNBA 3N4YA 1M90H 3NVIB 2VGNA 3MCAB 1T0KB 3CCEF 1GZ0A
chains in the Genus database with same CATH superfamily
2NWMA 5D6YA 4FJ8A 1QVGP 4B9QA 1OV3A 1R59O 3OW2M 2GVIA 1VQ6F 3LALA 4MO4A 2Y1JA 5C42A 5M1OA 2IIRA 3HTNA 5LJ3g 1BU6O 3H41A 4OGEA 4CJ5A 3IDHA 1VSLA 3ENOA 3ZT0A 5AFUA 1VQMN 5KYWA 2LQWA 4M41A 4CEEA 3OYIA 2L0AA 1W2BA 2GGRA 2NUTA 4XQ3A 1ZBJA 2X51A 2UU9K 1YJ9Q 3VQBA 3PX6A 3X20B 3KTQA 3OY9A 4FWNA 2RO0A 1TUBA 1RLPC 4DTXA 4E89A 1UUEA 2JJ9A 1W2BP 3LAMA 1VQ7N 1NK8A 4EFHA 2OZBA 3L3VA 2KMTA 4C8QB 5BMVA 4MDXA 2YHWA 1VQLT 2EBPA 3LP2A 4W5NA 5HP1A 5KE3A 3E22A 1V29B 1QWFA 3K5MA 1VYTA 1RAFB 4RTVA 1YI2Q 4DTPA 3HVRA 4O4LA 1K6YA 2E1YA 2HCKA 5AQSA 2MK5A 2CREA 4KHWA 2LBXA 4CECA 5SZTA 5J2UA 2O8CB 1RLQC 3KIOA 4DFMA 1I07A 2F2XA 3WGMA 3AA4A 5HY6A 2K9GA 3M0RA 3CC4A 4M4ZA 1PD0A 2HBMA 5KRTA 2G8FA 2DA9A 1VQ8T 2E12A 5JLHA 2Q31A 4O4IB 1DT9A 2NUBA 4IUUA 3LDLA 2O2OA 2OTLT 3VYHB 3K2XA 1BO5O 3L2WA 4FJJA 4ZHQB 2M0YA 4A5BA 3HP9A 3VF4A 5GAEP 2P84A 4JLIA 3AGRA 3DB3A 4ERHA 3K0TA 2EHGA 3SQ0A 3M0TA 4O4JA 4YFUA 1GLJO 1PWTA 1NJZA 5K14A 3AVAA 3AVHA 1E4FT 4C5EA 1YVUA 5KYUA 1T8EA 2QQSA 2VB6A 1Y96B 4EDUA 1KQ2A 4A4EA 2YHBA 3A5NC 1JY8A 1JU5C 4QW2A 5I2SA 4XH5A 2DVJA 2JMCA 3P31A 4H8KA 2R751 3U0OA 2KE9A 3SWNC 3IKMA 1XHXA 2PVDB 4MLEA 4CEAA 4KHNA 1SRMA 1U04A 4C1NI 1LWCA 5GINA 3M57A 3THXB 1WJSA 2QEXQ 4W5QA 3HAXD 4OMQA 2MOXA 4YY3K 4AMCA 1BA0A 1VSFA 2I6DA 1ZUYA 2XI9A 3OA6A 1D3BB 3CC4Q 2VYTA 2BDPA 4OMNA 1QP2A 3EFOB 2QQBA 1ACMB 1LOTB 1KD1H 1SPKA 2PVOB 3BYQA 4M78D 5AQGA 3RESA 1AZEA 1NK9A 1JD1A 3FGUA 5KQ8A 2DM1A 3ZSRA 1K73R 1YIJA 1KVAA 3THWA 3RYHA 5GAGP 4WBNB 3OA9A 4CF0A 3JAMO 1S1WA 4WFNL 2L5QA 3QEPA 3MX5A 5ITZA 1RQ2A 1QVFF 1WHHA 3LW5E 2EQIA 4BE1A 5CB4B 4DLGA 1M90R 4CF1A 4CC7A 2QTVA 1XC9A 4HKEA 3I55F 3DLEA 2EYZA 1QZ6A 1ZBUA 3CCQN 4FJLA 3OYGA 3CCJF 4UY8O 5FLXM 4DR1K 1RT6A 3A5LC 3X28B 2E5LK 3V3TA 1AT1B 2FB7A 1TL3A 5I3UA 1OX9A 1AVZC 5JS2A 4DF8A 2WSEE 4BG8A 4DUYK 4LFAK 3UA6A 4FZZA 2D9TA 4BQZA 4M78C 4C0DC 1NGIA 1K73U 2BE2A 3S41A 2VWJA 3META 1G15A 2PTKA 1IZ6A 3LWIA 1TKDA 1T0JA 1YWPA 2DXTA 4Z94A 4DSLA 4IO8A 3EO3A 4X1KA 4IFEA 2NLUA 1M90U 2AIRB 4PL6A 1YIJQ 2QEXT 1LAVA 2V7ZA 4KO0A 3CM5A 4HNAA 4C8GA 1HMVA 2E3HA 4ZHYB 2C0OA 3IKFA 3CC4T 4J7IA 3I8BA 4MDWA 2H3GX 1D8YA 4A4HA 2W41A 4N4GA 4ISFA 3CCVN 4BC3A 1W5FA 1UECA 2DILA 4UC4A 3JCMh 2D6FA 1B9DA 2YNFA 2R5MA 4CJQA 4QAGA 4HUFA 4DS4A 1X6GA 4PJOD 4AHTA 4I55B 1LAWA 3H3OB 2ZGYA 4N4HA 3VQ8A 1JQQA 4M77F 1NM1A 1RT7A 4YHHK 1N33K 2LBWA 3HFNA 3OSVA 3HFOA 1S1XA 4KHQA 4DV1K 1VQLN 3VS5A 1D0YA 3NF7A 3TTDA 2J6FA 5C6SA 3QJ6A 1RAAB 3EE9A 1P92A 3OMCA 4X9CA 4C8QF 2KRSA 3H0IA 2W6KA 3DM2A 4PL7A 5BRDA 1WOQA 1RUWA 5DLOA 4BT4A 1TYQA 5JMVA 2IG8A 2HHUA 5AQPA 2CZ1B 1RBRA 3B6OA 1ASVA 4Z4CA 3RUXA 3A8GB 3J7AP 5GONB 3ZSWA 1RDWX 1G2BA 5HL7L 4F14A 2FSNA 1TAUA 3TPQA 1WFWA 2WTUA 5J2QA 2OTLN 3RMBA 1GOCA 2YI1A 2VQEK 3A98A 1QW1A 2BZYA 2FBVA 1Z9QA 2BZXA 3NF6A 3MEUA 3FZHA 1BI2A 3AAQA 1EIFA 4XIUA 1IG8A 1NGGA 5GAN8 2RB6A 2DTUA 3ZYYX 4BVSA 2LQKA 4KH0B 1AOJA 4Y28E 1YIJT 4C8LA 1M9SA 2VG6A 3EG1A 2ITGA 1D5AA 1W3EX 4WCEL 4LXCA 2ZE2A 3QNOA 3WVEB 1I3AA 5CVIA 4TSXA 4DQSA 2FLOA 5LJWA 3VI6A 3VF6A 1QHTA 5MN6A 3A8MB 1VQMF 5LJ5f 1KRPA 5LP6B 4WQ5A 3M8QA 5FPDA 3V6DA 4OB3B 4CEDA 5HP7A 5HK0A 4FSSA 3GG4A 2A40A 1XJWB 5GAPK 1VQ7F 4HVWA 3ID6A 3G71N 2W0ZA 2I0NA 3VEOA 4LE9A 1RLGA 2FRYA 2YJFA 5FJ4C 1BI4A 2RPNA 3BF3A 3KVGA 4O0JA 3L8BA 4FLUA 5EWRA 2KR3A 1HYOA 4U3JA 2P4TA 3KD1E 2P9IA 4J6XA 4JV5K 1VQOF 3FIFA 1VUBA 2WUSA 1QVFS 1KNJA 3SEMA 3PLAC 1HYZA 3F9KA 1IKWA 1G3TA 1CZBA 1XNQK 2UYKA 2Z1TA 1D0XA 3CD6A 1VQ5A 4LSLA 4FYDA 4ELYC 2CHSA 2KGTA 1ZBSA 3MEAA 4B8AB 1E4GT 3PX4A 3OYEA 2H8CA 5FU6C 4M77G 4M7AB 1IHWA 4CEZA 3WPXA 5BR9A 2QDLA 4H5WA 4PQUA 1K73H 5GAOr 2EJ9A 5CO7A 1VQPQ 4NCGA 4J5YA 5CZ2A 4CF8A 4IOCL 3SV4A 4KWEA 3VS4A 2WBNA 1X27A 2QWPA 4F8RA 2XMFA 4C8QG 4PKIA 4X1VA 4KB0A 3MN5A 4FJ9A 5DK5A 3RBBB 3DXMA 2ALEA 5CYQA 3CCRA 4G4YA 1M90H 1OEBA 1VQNA 2HQSC 1M3AA 5LA6A 3UE5A 4BT5A 3UKUA 3KD5E 7AT1B 3KBGA 2GUIA 1YT3A 3O4NA 2E10A 4JLHA 3M3ZA 5FLXO 1TU0B 1VSDA 2E4LA 2RK2A 2FPFA 2Z1GA 2QEXN 2P9LB 3S0WA 4AFQC 2KGWA 1I8FA 4M75F 2QWMA 4W5RA 1OH6A 2QW9A 3ATVA 3O5BA 2PVGB 3O8VA 3CD6Q 2I2LA 3SNNA 1VQ5Q 5L8RE 3TSPA 1XWLA 5AQFA 5LJ5j 4BC5A 4CZLA 4LF8K 5J39A 3HVTA 3CMET 1KSWA 1K76A 4CJVA 1RI9A 2E70A 3T9NA 4DSJA 3NVMA 4B5CA 4JZ4A 3OJUA 4BVPA 2BO1A 3R6OA 2HP0A 2A3LA 3OYYA 3EGXA 2YHXA 5JCOA 5C8YA 3CCRQ 1FXXA 5HY2A 1VQNQ 3VQAA 3VGKA 4GBQA 1BI3A 3MJXA 3C95A 3OVNA 5IN1A 3WEEA 3IQLA 4CESA 1M30A 4ME7A 2FBTA 5C15A 3OYBA 2F2WA 1X9MA 1VQVA 2P9PA 3CQXA 1T7PA 3G10A 4DCHA 5CA0A 2ZCFB 1B07A 1VQPT 2RF2A 2DETA 1GOAA 3U8XA 4LUEA 3HPHA 4FWLA 2ENMA 1K8AO 1FJGK 5JVDB 3K2PA 2MQEA 3AA2A 1MUZA 5KTQA 1J7HA 2HZYA 4U7BA 1CXQA 1NYFA 5GINC 2L26A 5J26A 3E22B 1NQ3A 3CBOA 3SPYA 4JJBA 1BK2A 4OMOA 3V1RA 1YTUA 1OVQA 4C81A 4M7DA 2MF2A 2HEQA 2M02A 2ZWHA 3V7RA 5KYXA 3DLKA 3SQ1A 3KK7A 3FLGA 4I4TA 3AY9A 3ZSZA 2GLZA 3V1QA 3V7QA 5HY0A 1TK0A 2UUAK 5I9EB 4RW6A 3CD6T 3AA3A 2ESWA 1ZX6A 2LJ1A 1VQ5T 3V9XA 3MO8A 4CCHA 1QCOA 4JJDA 1GL5A 3EL2A 5EX5A 3CCVF 3QBXA 4O4GA 3DOLA 1QD9A 4PJOF 1OQKA 4B9XA 4O4JB 3MEEA 3JARA 3ULEA 4H0YB 1I4K1 2M9UA 3HHTB 1IBLK 2VXYA 1XI1A 2PU9B 4CFCA 3VUZA 4CI6A 3IUCA 1WSEA 4A62A 1VQLF 3CCRT 3B6PA 3E19A 1VQNT 4JD2B 4BY6B 3FZMA 4EP4A 3V8LA 4M75G 2E6NA 1GBRA 1VQ4Q 3CQYA 4MFBA 4OKKA 4B9MA 3JCMM 3RMSA 1QSLA 3HKCB 2DL4A 1RT4A 2QM1A 4RW7A 1UI9A 3DLLA 4YJ3A 5DY9A 4NS5A 2K5FA 2VKNA 4B9WA 4JLGA 2UXBK 1H7MA 3OQ5A 5GANh 1UE9A 3JCMX 3M8RA 4TV9A 1ZHIA 4CJTA 3N4ZA 1BIBA 5F1XA 4FJIA 1IKXA 4NCAA 1U2VA 1UG1A 2P9NA 3L4QA 4R0KA 2ASPA 3MN6A 4B46A 4P5NA 4CGIA 3F73A 1IBKK 3J80M 4E7ZA 1SAZA 1E6GA 4M7AF 1VQKA 1CLQA 3VYTC 4DOVA 2ITMA 4Z0UA 3K12A 1VSEA 3AAPA 2LCAA 3N4YA 2HS0A 1W57A 2D0QB 2CZ7B 2E5QA 2D0OA 4PWTA 2WFBA 3RMQA 3VQ7A 3N2KB 2F9TA 4QVDA 4AT1B 1HX1A 3RMDA 3WNGA 1RDUA 1BIZA 2AHJB 1KG1A 4GVMA 1X69A 4E7LA 1WYXA 3INZA 5JVHL 2AMTA 4ID5A 3A2FA 2LT1A 2KI7A 3L0QA 3LX7A 4DV4K 2XK0A 3GOXA 2J4RA 4BT3A 4DV0K 5D6XA 2C06A 5G4VC 3PSIA 3PE0A 2ZAEA 4IXCA 1XRGA 3G71F 4NLBA 2XICA 1GFDA 5IH2A 2ROLA 1Q86C 3RR7A 4IKFA 1C1CA 4BROA 5HLFA 2IIMA 1VQ4T 1K8AR 4YOYA 3CMEN 2BIVA 5FPEA 4C92A 2BH1A 3K9JA 1MWKA 1VSKA 1VQKQ 3BF1A 4NL3A 3HZ6A 4DV3K 1Q86O 3SHWA 1G3WA 4PJMA 3M1FA 4B62A 2HF3A 3KK3A 1FWZA 4D6WA 4PJOG 4EPCA 2PYLA 2OANA 5LY3A 3I7TA 1ZXOA 4B1XB 3TSQA 4QCLA 4C0FA 5A0DA 1KCFA 3QDRB 2JWKA 4JAXA 3CFPA 5CR2A 3M84A 4B9LA 5JS1A 3GPLA 1TVKA 5EB0A 2RA2A 4XTZA 1M3BA 2D8HA 1VQPN 4XU1A 2F8TA 2E6LA 3QBWA 3ZSQA 3VYGA 3M8SA 3W3DA 3WXIA 2RHLA 2YX6A 4CERA 5GMKj 4CHOA 2A36A 2DL3A 1NJXA 4TUYA 4KHUA 3TQ7P 4GLKA 2HSTA 1K8AU 1T6DA 2HHXA 2K4YA 1VSMA 3L7QA 4M77A 4QVCA 1KQSA 1KFZA 3RE3A 3O6WA 3TCJA 3SZ2A 3LP3A 1HNVA 1T0AA 1KQSP 3X24B 1QHAA 2ZOVA 5KMGA 2NUPA 3K5NA 2BGGA 2FGYA 4ZOLB 3G4SN 3RRGA 3CD6N 1ZQ1A 4M7AG 4BRNA 4DR4K 3OYNA 4CF2A 3SUNA 2K5IA 5D3GA 1IV2A 4LH5A 1SHGA 5BPMA 2FC0A 3M54A 3LWLA 1EP4A 4JNEA 2ASOA 2KZMA 2COYA 4H5RA 1KFSA 4G4WA 4J9IA 4FOEA 4M3WA 2HRYA 1VQKT 1Q81O 2QGGA 1C6VX 1HYSA 2BZ8A 1WHKA 3DAWA 3G6EN 1Z5WA 4BW0B 5FNVB 3FEOA 3LWQC 5CKEA 4AG1C 3NH0A 2O8DB 1T05A 1PRMC 3KZBA 4DTUA 4KPYA 1VQ9N 4KULA 3REAB 4IHJB 1WAFA 4KH1B 1J6ZA 5A2QE 1QVFM 4O55A 3E9FA 4KB1A 2RI3A 3QDFA 1S1NA 4Z4EA 3FBAA 1A5VA 4XTXA 2R58A 1V4TA 4DTNA 3O8MA 1ZSZB 1ZWZA 1D0ZA 1C1BA 4FVMA 4D8KA 3TVTA 4LF7K 3M5RA 3T1AA 4GMJB 2YXYA 1XUPO 1NK4A 4B3TK 4Z02A 4X1YA 4R56A 2DD4A 5GAMe 1WHJA 1N32K 3JALA 4RCCA 3U9ZA 2FEIA 5GAN3 1JJ2A 4ZGJB 2I7NA 3C9SA 2JVVA 2DPPB 1BI4B 1SL0A 1PKTA 2L2PA 3JAKA 4MQ3A 2GQIA 3M0PA 4I6MB 1Y97A 3KJKA 6AT1B 1IKYA 1JJ2P 3MXIA 1XHOA 3M58A 2HRUA 2K7AA 2NZTA 5I42A 3THYA 1KD1C 3FLCO 5IYZA 4CGGA 2DBMA 1U5SA 4ZTJA 1ATNA 4PKCC 1YJWA 1KD1O 3NBPA 4K42A 1E7OA 4IG0A 2QXLA 3R9PA 5EYPB 2RJDA 2DTIA 2G8HA 1Q86R 2E88A 3SBGA 4HT8A 2CP6A 2E2OA 5KRSA 1K1ZA 4J9GA 1RT1A 2XDDA 5LL6Z 3J80O 1NNEA 2PUKB 4PLIA 4YOTA 2Y90A 2LCSA 3ESJA 5HK3A 4WFAL 2HHSA 1B34A 3DC2A 4F6RB 2QK0A 2Y4XA 3C4SA 4JKGA 2FYKA 2MYSA 1A5XA 3MHXA 3ZBDA 3OSSC 4FLYA 4X1IB 1RBVA 3JV3A 3OYCA 1D9DA 2M1HA 3MBMA 1VQ4N 4XEIA 2EIFA 3FZFA 3QUWA 2O4GA 3K5LA 4BRDA 2O9VA 4ZGEB 1K0XA 3VQEA 1NGAA 1JXOA 2B8AA 2P9KB 4CJSA 1G5VA 4I9LA 4QS8A 1Q86U 3HPOA 3KKSA 4F7UA 4M7DC 1UB4A 3CCMT 3QXEB 1YJWQ 4OB2B 3VEXA 4Y91A 3D7SB 5IAYA 2EFIA 4BC2A 3I8DA 2ZAUA 3CJCA 1MHNA 1QAHA 5M9OA 3JATA 3VQQA 4JI5K 1K8AH 3CCUN 2HVHA 1C0MA 5DMRA 4FYXB 1S72N 4J2BA 3RSEA 1HSQA 4AFZC 3MXJA 4CZMA 2DYBA 2QQ9A 2PFUA 4E19A 2DE0X 2CH4A 5EU7A 5H1SQ 3SUOA 3QIPA 2D5RA 4M78A 4E7IA 2RHZA 1HNWK 2MPXC 1BQMA 1A5WA 4FK4A 2QI2A 4IOAL 4PNOA 3ZOPA 1J54A 4B1WB 2Q1XA 3JCMg 1AZGB 1U06A 1T3VA 1Q81R 1J5EK 4Y92A 1NK6A 1G99A 1OH7A 1PSFA 3JASA 2LBTA 1LVKA 1J53A 3CCLF 2M16A 3EGDB 2DTHA 2DRMA 3GNFB 1YHQA 1CZ9A 3TAFA 2HX0A 3V7SA 4YOXA 4BUGA 4JKFA 5EY4A 1U1TA 5CYMA 3M0UA 3V8KA 1WPYA 1N8RO 1D1AA 4ZI7B 3OW2A 4XK8E 1YP5A 3SJJA 2OTJA 5GAMd 4M3RA 3K57A 4YNQA 2F1LA 4XU2A 4XAXB 1LPLA 4XTWA 3SAHA 5FU7C 3PAFA 5CA1B 2O8BB 3CMEF 2EYWA 2P0KA 3OYJA 3OW2P 3Q7CA 4R55A 2QTPA 2RB9A 5KPZA 3SLCA 1W4SA 3HK2A 2UYPA 4KGZB 4FJXA 3TANA 1S3XA 5MN4A 3KIZA 3JAWA 2JW4A 4DA4A 1Q81U 4K8ZA 5C2DA 3Q7BA 2ZPFB 4GW6A 3DOKA 2HQHA 2K3YA 2GZLA 1OI1A 4DTSA 4H0TB 3ULEB 4KHPK 1BI1A 3CPWS 2V7YA 1QKWA 2GFUA 3QHSA 2ZQBA 4H5NA 4B6MA 4UQGA 3RVCA 1YHQQ 1L3VA 1KAZA 4CBXA 4PJOA 2VXFA 1RACB 5LXTA 1W1FA 1Q9XA 3NK7A 4ANJA 4DHYA 2R7YA 5EIBC 1NOZA 3NPFA 3SD4A 1BGXT 4BT2A 5CHIA 1JLBA 4PJLA 1O75A 1H1VA 3QO9A 2OTJQ 4FM1A 1V76A 5CIUA 3JCMJ 2ABLA 2IVNA 2QXFA 4DRXB 3IKEA 4IJNA 3OYAA 1YITN 1SSFA 2IC3A 4ILHA 1D4XA 3JCMe 2QKKA 4OF1A 1RAEB 4RTWA 3T69A 4RQOA 2ED0A 3A1PA 3VS3A 3RNJA 4GLMA 4DOWA 4C92C 3CCEF 2P9SB 3G4SF 2L8DA 2RJEA 2YRDA 1HYVA 2R5AA 3VU3C 4FZXC 2D0PA 5C0YA 3LDTA 5FRNA 2O4XB 5MLCQ 1WLJA 1NPPA 4BREA 4CEFA 4C8QD 4PJJA 2LC4A 3KKRA 4FLXA 4O2AB 3HTRA 3UT5A 1TUGB 4TZZA 5CQYA 1VAZA 3VJPA 1WQ7A 3QYGB 1UJYA 1K73C 4OX9K 3CEYA 3FD6A 4KRTA 3G6EF 3TD3A 5E84A 5IHIA 5AQNA 5KYNA 5M1QA 2QWQA 1VQ9F 4OKJA 4BE2A 4LNUB 1Q86H 2YHTA 4OPKA 3V8JA 1M90C 4M7YA 1E3MA 2E3IA 2KVQG 3A5ZB 5L23A 4TV8A 3PLAA 2HBPA 1X7PA 2DFHA 4RMOA 1WSJA 2OCEA 3MEGA 1M90O 4M77C 2FBYA 3DXKA 4JUVA 1HKGA 1BA1A 3LDPA 2V1RA 1MNDA 2XO7A 1L5UA 4O8UA 3FR0A 1YHQT 2FC3A 3CCMN 2DAQA 3CXCP 5AYFA 4VUBA 4C0GA 4BVOA 3J7ZO 2EGEA 5GAN5 2IPOB 1KLMA 1ZA2B 3J8AA 4WYBA 4CD3A 1QSSA 3D54A 3RYFB 1KC8R 2CZ0B 3UF4A 2OTJT 4NB4A 4OMMA 1IG9A 1QU9A 2IAFA 3M4SA 2KRNA 3WNHA 3TAGA 2DL8A 1WGSA 4BD3A 3CC2A 4IIMA 1OPLA 4XTYA 3S3OA 1N8RR 5FW9A 1FK9A 3CMAT 1GLFO 4BRKA 4JK7A 1TSFA 4CHNA 2BE9B 2BTFA 3GL1A 2G8VA 4M8IA 2DD5A 4DWIA 3TU4K 1M4ZA 3CM6A 4NL2A 1JLAA 2QTXA 2HNZA 3ZX0A 2HNDA 2DJQA 2CKKA 2RMOA 1BL3A 5BREA 2EX3A 1SG5A 1KHCA 2VG5A 3SK3A 4FZYA 2KEAA 3VQ9A 3IEWA 1KC8U 1YJNN 3QWXX 3DLHA 2DERA 3DI6A 2RHXA 3HM8A 1COMA 3ZEUA 1EKEA 4M45A 4O2BA 4FJGA 2RHIA 5FRMA 3EZWA 5AQXA 1U3OA 1Q81H 1N8RU 4DSKA 3CCSA 1VQ4F 1RDAA 2K57A 2VYPA 3DRRA 2LNHB 5F2RA 1NLVA 4MDBA 4OPAA 4OVLA 4CZGA 2AKLA 2H8HA 1BKBA 3PUFA 3HKDB 3CC2Q 3AVLA 2FZGB 5HROA 1UOCA 1JL1A 4ISEA 3HO1A 3JCMd 3OYFA 2DYIA 2CGKA 1AD5A 2VQFK 4J2EA 1RL2A 5AQLA 1W7AA 3CCUF 1TOVA 3MP6A 1JCGA 2GBZA 3I35A 5CKHA 4CK3A 4E1NA 1S72F 3OMGA 5BRHA 4X20B 4XH1A 3FFKB 4FPBA 3HKBA 1NLPC 3SB2A 3F0GA 3VEWA 4HTUA 4FJ5A 1IB8A 3L42A 1NMUB 1YJ9T 4M75D 4HT9A 1VSIA 1SSHA 1HNIA 1RTJA 4O5VA 2FPDA 4RTXA 4YTLA 3UIQA 3E20B 2YDLA 5HCKA 4PFZA 1ABOA 4H0XB 2CSIA 4DU4A 2A41A 3VQCA 2BTUA 3WJRA 4QQDA 1FFXA 3ZL7C 3D2FA 2K79A 2O8EA 4OMLA 1O9SA 4RTYA 3CCSQ 1K9AA 2RNAA 1V4SA 1J5OA 1YI2T 3QYHB 4J9CA 4C8NA 2EW3A 4IUTA 3VTHA 3FE1A 4RUGA 3A5OC 1VYUA 1UTIA 3RDVA 4FJNA 4K25A 2A37A 1IRXA 3GOIA 4WF2A 4AHVA 5DM7L 2RI5A 5JH7A 3PIPL 1NBWA 1MGQA 3WVDB 1BWFO 2Q36A 4LF4K 3BDLA 2RH2A 3D01A 4NO7A 3LL3A 3CPWA 1NMDA 1MA9B 5BRFA 3T1HK 4ORZA 4NWOB 1IO6A 1YWOA 4BRGA 2LX7A 2FXUA 3GBTA 4PUOA 3E01A 4HUEA 1K8KA 2Z1JA 2LMJA 5AZIB 3M53A 4XU0A 4IJAA 1PCXA 4M75C 3DLRA 4H4MA 2LCCA 2QK9A 4FXDA 2CP0A 2ZF8A 5EXWA 2HP3A 3AO1A 4JHDA 3CC2T 3SWNB 1M2OA 3ZT3A 4Q0BA 3GF5A 1W5AA 4F2SA 2E64A 3RTVA 2WSFE 3MEVA 2AT1B 3WGNA 4CJPA 4ZK7A 1REVA 4BGAA 1N6QA 4LDYA 1R1MA 1HLUA 4DXDA 4NUTA 3GHZA 2QWRA 1NWKA 4CE9A 3HTVA 3ZSXA 4X3LA 4IUQA 3OONA 5IJ9A 2V8KA 1B34B 1YTAA 3KLGA 4LUDA 1I5LA 5KPTA 4HCZA 4BB7A 2GX9A 3PIOL 1YHQN 4FPAA 2Q0RA 4DTOA 1AWWA 4X62K 4G4VA 4EHUA 3ENHA 1Q82C 1TK8A 3D00A 1RTIA 4K41A 2JOYA 4BR9A 2OTJN 2F9WA 4DR3K 1Q82O 4FK0A 1U47A 4HXJA 3QB0A 1WX6A 3CCST 1YITF 1SUQA 1K9MO 4CFAA 4GV6A 1IH7A 3CMAN 3C7NA 1JLGA 2NRXA 3DMJA 4I2PA 4JKDA 4W5OA 3A8OB 3SBTA 3NTKA 4PL8A 1FMVA 2ZODA 1KC8H 4ZNXA 3L2RA 1S1TA 2KQ2A 3CETA 5AQUA 4BR0A 4IIJB 3RSEB 2CS7A 5A0LA 2X6SA 2P4RA 1N8RH 1NG2A 2EJFA 3C6HA 1X75C 2X6NA 5AQWA 4RWTA 4M78B 4C0DB 1RTHA 3LH0A 4B9TA 1C0UA 2DK3A 4IBNA 3RKYA 4AM6A 3O1BA 3I56F 1D1BA 5GANe 1VQ8N 1IXDA 1TUCA 2FF6A 3TEEA 1TKZA 4PJOC 3H8ZA 3EG9A 1SL1A 4RTUA 2JM9A 3CC7A 5JQGB 3D2EA 1U1SA 1TWBA 5FDLA 2KYMA 1S5JA 4M7AD 5HKCA 5B8FA 4A4KA 1QE1A 1QQCA 3CFOA 5J1EA 4E3SA 3QDKA 1WXUA 2M0OA 3OS5A 1WLPB 2HMPA 3CCMF 1HD3A 1WXTA 3CPWM 3CCLA 4FJKA 3MP8A 3U6FA 1N9RA 1PHTA 2RQRA 4O8KA 2HB5A 4DTMA 3NDKA 4O4HB 1NKBA 3HKEA 4RKUE 4E1JA 2UYNA 1EXQA 4DSEA 1YJ9N 1T6CA 4E0DA 1JLQA 4KH5A 1X2QA 3NMUA 4J8FA 2OX7A 2E8AA 2F8SA 4DR7K 1MDUB 1QKXA 4NOYA 9ATCB 5AZJB 3I0RA 4FWOA 4CC2A 1TXQA 3FFIA 4IEEA 1XQHA 5JLFA 4X65K 4C8KA 1T44A 1WAJA 3ZETB 5SWMA 2QA4A 2HKNA 1D09B 1YI2N 4GKKK 4EIKA 3CQ8A 3CC7Q 3PGGA 2QYZA 2RQWA 3QIOA 1B3QA 2JZ2A 2HOEA 4G88A 3V9WA 1M2VB 3TREA 1WHMA 4JKCA 1YJNF 3S02A 2HMIA 3A8HB 5BN8A 3C9TA 4GNIA 1YFNA 3NGIA 2M51A 3LFOA 5CK9A 2Y1IA 4KTZA 4JEPA 3VEVA 1RDBA 2HQEA 2OZSA 3MEWA 3KJVA 4YJ2B 1UFYA 4DQRA 3TAQA 2VAPA 1JCFA 3CG6A 4EB6A 2O8FB 1K4US 4DMNA 4AM7A 1Q82R 1Z25A 1H48A 2RJCA 1TAQA 1XNRK 3CCEA 3LM2A 3P10A 2ATCB 1K9MR 4ILGB 2AKKA 1GO0A 3OBWA 3SCXA 2GQVA 2QA4Q 3MQWA 4L8RB 2RQVA 4N56A 4U67L 5EB1B 2J7IA 1HK9A 3KLEA 4E7KA 2Q1NA 2PZSA 2YYEA 3QNNA 3EORA 4FJHA 4CJWA 3CPFA 4M7DE 1P8ZA 3VIUA 4PFOA 2E4HA 3CC4N 4FSVA 1DEJA 4XTVA 1UGRB 1TUBB 2BTQB 4U39A 5C0MA 5KX5B 1ESVA 1Q9YA 2NMUA 4EI7A 3J81O 3IMXA 5GANd 4JPBW 3GP8A 4BRMA 3DXKB 1HUXA 4O0IA 3CC7T 5EO3A 5LJ3h 4PKGA 3AGKA 1Q82U 2P5OA 3PX0A 5FU6B 1IREB 1K9MU 1RT2A 1KHIA 2KBTA 2V51B 4G4XA 3JB9I 3OS2A 4CJFA 2KY9A 4B8CA 3FJ5A 4B08A 4LDXA 3T80A 5M1PA 4KH6A 2H8EA 2HS4A 2KXDA 5C24A 1VQ6A 4DEYA 5KYWB 2WC9A 2D0NA 2NUTB 1FMKA 1K8AC 1HJRA 3TAEA 3CCQF 1S6PA 2AIZP 1QMCA 4F04B 4Y0WA 2BUDA 5KH6A 3JCMQ 3M59A 4NCBA 5IT9E 1PC0A 3RKXA 2IVOA 3CJ1A 4HWIA 1SZQA 1JFFA 1PSEA 5GAMf 5BMVB 3C65A 4BRIA 1AWXA 2DNUA 4QKUA 5GIPA 3O80A 4O4LB 5TKYA 5AQYA 2D8JA 1FSZA 1U43A 4EI8A 1WDXA 2JWLA 2QWOA 3N4PA 2GTJA 3BW1A 5DM7R 3F6MA 5J2UB 2G3RA 4KBMB 3S03A 1W0HA 2XY5A 2C0TA 4QT7A 3NFAA 4ICLA 1YIJN 3GLXA 1S22A 5IJ0A 5KYYA 4KBOA 1RA4A 3JCMc 1WA7A 2UUBK 4NQ3A 1DTTA 3BZKA 1LCUA 4MMKA 3VMFB 3S06A 1KSPA 4FL6A 4DU3A 3SDZA 1SQKA 4C82A 3R3LA 1VQ6Q 2CP5A 3GTZA 4DFKA 3QG1A 3THKA 2D1XA 4GKJK 1BQNA 4IOXA 4Q5VA 3GIBA 2KAFA 4FK2A 3LM9A 2V8IA 2P9UA 3NTIA 1SF9A 4H5TA 3CMAF 2VV5A 2QAZA 3LYBA 1KVBA 4H03B 3RYIA 4KKOA 5IWAK 1N5ZA 4HVJA 2XRIA 3A8LB 2QG9B 1NE8A 3NTHA 5KYUB 4RW4A 1Y64A 4DB3A 4KTQA 4JI0K 2A7YA 1VA7A 2EAYA 3PMTA 5J2TA 3MCAB 3AVIA 1TTHB 5AQRA 5GADP 1SA0A 1EFNA 3RYCA 1H641 3HSTB 4CZEA 2ZF5O 2LCLA 1H8KA 5CCAA 3LDSA 2FSKA 2KFZA 1ZUKA 5HXUA 2ZPIB 1HJOA 1PKSA 8AT1B 1G3YA 1LNXA 4C92E 4EMKA 3FFMA 1VQ8F 1HKBA 3U4LA 3O3HA 3N4QA 1ZBXA 4CBUA 3M8PA 1VIFA 4EMGA 3WGLA 1X1PA 2OTLF 1ZSGA 3TD4A 4L59A 3LWRC 5KGWA 3VOAA 4RW9A 3PO5A 4I50A 1C6VA 2MMPA 3BZCA 1R0BG 5GAMj 4NYFA 3THWB 2HMAA 2LQ8A 2HHTA 2CZ6B 2EPDA 1NK5A 4Y1CA 5ITZB 4II1A 3FZKA 3PVQA 2YRVA 2GFAA 4NXMK 1O1WA 1JBMA 4BE0A 2B6AA 4ELUA 1NGDA 4FWKA 2CSQA 2K3XA 1C0TA 4X66K 1U48A 2P6YA 1U6ZA 2P0QA 2LT4A 3IAYA 1G8XA 1QVFA 4AHUA 3Q8HA 1U3PA 1XOVA 1OZ3A 1GFCA 1PD1A 4H4OA 5I21A 4IG3A 4CBWA 1Z9ZA 3AA5X 5FWBA 3F0EA 1GCPA 3L2QA 1YBYA 5BPNA 4DTRA 3JS6A 3I55A 4NYNA 4V19S 4KAZA 3F0DA 4ZGDB 3RERA 3RRHA 4KREA 1Q82H 3H9NA 3TAMA 4F9OA 5GJWB 2MWOA 3CCJA 1K9MH 4BWJA 3NE6A 5LYJA 3ZSOA 4QOZB 4Z4GA 4Z88A 1RT3A 2ZJQL 4C8EA 4X3MA 2BUPA 1YI2F 1QVGF 2GBQA 2LDMA 3NF9A 3CXCF 4X1KB 1I81A 2CH5A 3NCIA 2EYQA 4JK8A 2HF4A 4HNAB 3HOSA 4EHTA 1Q8IA 2DF6A 5GMKi 2XHBA 2NUZA 3L2UA 3AT1B 2XY7A 5F0XA 4BRAA 1SKWA 3L4IA 4BDPA 4LN2A 1BBZA 3QWYA 3OBYA 3DDNA 3QSUA 1SRLA 1Y7XA 4JKBA 5GAMg 5DLQE 1WB9A 2DZCA 1W2BF 4ZN1A 3A0IX 4WFBL 4O44A 3OYDA 3VEYA 3VOVA 5HP8A 2X3WD 1KIKA 2E5KA 3HRUA 2UUCK 5GAOm 2YRCA 2JLEA 3BGRA 3JAWB 4BT6A 3I55Q 3WNEA 2IOCA 5JICA 2EVRA 4LD6A 4ID1A 4BC4A 3CCJQ 1BG3A 1TK5A 1FX7A 5EAZA 3NMUC 2F2VA 2COZA 3G7ZA 4BI8B 2KSSA 3VQ4A 2PHNA 3TD5A 1TGOA 5GMKm 1TYQB 5M1FA 1IV0A 5GIOA 1GLAG 2E2PA 4B9UA 1OOTA 3CYPB 2EWCA 2CWJA 5CAIA 4C8QA 2QEXF 1U40A 3JCMf 3JCMV 4XCQA 2V1QA 3DKMA 1T0HA 1P90A 1XMOK 1ATSA 3LYIA 4J83A 2NLXA 1VQ5N 1BB9A 4FWRA 4BI4A 1UGPB 3CC4F 3QZ9B 1IV1A 2W10A 2O8CA 3I56A 5J2PA 3QJYA 1TUUA 1Q81C 1Y07A 4E6RA 3NK6A 2HSEB 4H0VB 2YHAA 3MN9A 1MMAA 3SQ4A 4F3TA 2RHKA 4FOIA 2JNBA 4O4IA 3NHNA 4PHTX 1IO2A 4J7FA 2RF0A 2VC8A 3NAEA 3SJHA 3CCRN 2OAUA 2GNCA 1VQNN 2J05A 4B9SA 3D0PA 4Z4HA 1H47A 5EVZA 1EZZB 1S1VA 3R1XA 2DO3A 5J2NA 4OO1J 2YUQA 2G6FX 2G8KA 3EE8A 1Y96A 3JAME 1RLUA 4FWQA 1VQMA 2LVMA 5GANK 1EWQA 3PMIA 1X3NA 2MCNA 3R6MA 5AQMA 3I55T 5M1NA 4K8XA 2UXCK 1YAGA 1QQJA 1W42A 4FO0A 3CCJT 1PRLC 2RHJA 4RW8A 4U3JB 4DV2K 3THXA 3LWPC 4F7UE 1VQ7A 2P9IB 1J3TA 1N9SA 4XTUA 2ETJA 2ZD1A 1QLYA 4J6YA 4FIBA 1SL2A 1JXEA 1D3BA 5HY1A 2Q1YA 4FFBA 2HBLA 3MWTA 3J7YP 1YIJF 2NRWA 1C0FA 3EFOA 4M3ZA 2JTEA 3NFCA 2DJZA 5CR4A 4E7JA 4MDAA 1VQOA 2QKBA 5HY4A 4FJ7A 2HDAA 4LC9B 4A63B 3JB9F 2IQQA 1NJYA 4YDUA 3P39A 4M78E 5GAOl 4KTWA 3NVKA 2KNBB 2CYZB 1ZBLA 4WBNA 3NGZA 1MV3A 4CJRA 1NMNA 1OULA 2HD0A 4JKEA 1MNEA 5CB4A 4IURA 1WN7A 4KT0E 4DQ8A 5AQIA 1UJ0A 2CH6A 3DXMB 1VQMQ 2EQJA 3RR6A 4XH4A 5BN9A 4DV5K 3VS2A 2OA8A 3V81A 3E9GA 5GMKl 2HW3A 5LA6B 4EZ9A 4KI4A 4R40B 5LOVA 3AVCA 1A0NB 1QVGS 3UKUB 1WJQA 1WSFA 1LOJA 3JXUA 3CXCS 3ZT4A 4YOVA 2LX9A 2X35A 2YJEA 3AVFA 3H46O 4JKAA 3J7AR 2CP7A 3Q1JA 1VQ7Q 1VK0A 1JKHA 4R5PA 4ZHWA 2DZ9A 2VWFA 2CT3A 2Z0WA 3G25A 1Q8RA 5GIPC 4C23A 4DR2K 2V8JA 5A0GA 1YUWA 2KLAA 4NXNK 5HRNA 2JTMA 1TUYA 5CKBA 4B3OA 3QINA 5KI6A 4D8DA 3ATUA 2EKOA 3HOTA 1BIUA 4DFPA 1D9FA 4G4ZA 1W97L 1VQOQ 3RIRA 4EZ6A 4H0PA 2WALA 3SUQA 4M75A 3H08A 3PV8A 4LDUA 2J06A 1W2BS 4DQPA 2SRCA 4CEQA 4PLLA 3D7EO 2DY4A 1OAPA 2HL5C 2A1SA 3ULDA 1E6HA 4L5GA 1RQ7A 2HP0B 1EWRA 3EGXB 1B92A 4DG1A 3PFSA 4M7XA 4PWDA 3BFMA 4LF6K 1W40A 3WGJA 3E2UA 2HSPA 4YOUA 5C8YB 4QVZA 3WEEB 3KHNA 1UGSB 2CT4A 3JYTA 2P9PB 1KC8C 3ALYA 3ZP7A 1IJJA 5CA0B 3HRGA 4RTZA 1ZBFA 1DLOA 1WUAA 3KHYA 3J7AF 4AHCA 4BR4A 4CGHA 3LWMA 1TV6A 1KC8O 4CC3A 1N8RC 4CK2A 3LWVC 4LDWA 4CJEA 3X26B 2CH4W 2ZPBB 4BY9D 2CUDA 3CCQA 2DX1A 1VQMT 4E7SA 2X4XA 2D0BA 2NRZA 5AQJA 1FNJA 2B33A 2WOMA 3I0SA 2Z1FA 3KLIA 4FLVA 4K11A 3RMAA 4AF1A 1Z26A 2FO0A 2ZPHB 3MAQA 1U45A 2O01E 4EMKC 4M7DB 4A53A 1BISA 1T03A 4Z4FA 5KYXB 5GONA 3HI0A 3MN7A 4LD9K 5LJ5h 1VQKN 4I4TB 3JB9G 1Q7YO 3EFSA 3EKSA 2L3RA 3LAKA 3VTIA 2DTOA 4N0AA 1TS9A 3DRPA 4GV9A 1ZBIA 4A59A 2E6ZA 4FYWB 4C1NK 2HBWA 4N47A 1YJWT 5FPNA 1I39A 4QS9A 1VQOT 1G3SA 2KTQA 2RHHA 2ZVYA 3VQ6A 3VGMA 2LJ3A 1VRTA 3TSUA 3ZO8A 2P9UB 3JARB 2EKHA 1TUDA 2JXBA 3BDUA 4CF9A 1VQPF 1HNXK 4BWMA 1XTDA 3CPQA 1RDDA 4LNPA 3CCVA 2RD1A 3U9DA 4HA8A 4BRCA 3I55N 1N27A 4HVUA 2FSJA 4CIFA 2L3PA 5EG2A 4FWPA 2A0FB 4OPHA 5HOOA 3CCJN 1LJOA 5B8HA 1VH8A 4MMLA 1HR0K 3EH2A 3URGA 3VS0A 5CKDA 2H3JA 1KNKA 5LP6A 1SA0B 3LWHA 1HJDA 3W0LA 3CJ9A 3CYMA 3C12A 4EMHA 2HHVA 4YJ3B 3UPUA 1ILYA 1VQLA 5I11A 1K0SA 3LMEA 1XC3A 3ZCMA 3C8LA 5AQVA 1LW2A 2Z1UA 3ERNA 4TV9B 1NBEB 3GE1A 2FZKB 3HJWC 3O3FA 5FU7B 3NMZC 2H6LA 5A2QM 2P5GA 1U2VB 2P9NB 3NF8A 3IEQA 1JLFA 1YGYA 1VQ5F 3CD6F 1KAXA 1XQSC 2QDYB 4CEOA 3PIPA 1RDCA 1X52A 3TR8A 2CGJA 4JKHA 5FLXE 3HPGA 3VS6A 3A8YA 3QKJA 2XDBA 4IO9L 1QQMA 1YQNA 2YLBA 3JCMb 3CCVQ 1QSYA 3NH1A 4M7AA 2UYTA 4BR5A 1HNZK 1LWFA 5AQOA 3CCRF 1GCQA 2A42A 3QFPA 3DLBA 2VAWA 3LZJA 1VQNF 5GANf 3OYLA 3L6QA 4N76A 2K3BA 3QEWA 3RMCA 3O9RA 1PM3A 3TTFA 3MP1A 3ULRB 3HRSA 4KUIA 2YUOA 1VQLQ 3M9QA 3D6RA 4I2QA 4A4FA 2WONA 2L3SA 3ZSVA 4JS4A 4LF5K 1TG0A 3DRSA 4B3MK 3UKRA 5GIOC 3TSWA 3PIOA 3SIVA 1CKBA 4PFPA 4DSFA 4C8QC 5FWCA 4BRPA 2DLPA 2DPNA 5ECAA 2PY5A 1GRIA 2PZ1A 4OP0A 1ODEA 2VGMA 2P9LA 4AHRA 2DRKA 4C92B 3G71A 3M0QA 3F9MA 3A5MC 3CB2A 5HRSA 1KJWA 4CJ4A 4GY2B 3EGUA 2D0CA 4B9VA 1RBUA 3ELCA 3AVNA 3KWGA 3OB9A 4V2SA 3UA7A 4J6WA 2KRMA 3V9ZA 3VO8A 1TVKB 3C94A 2PBDA 1L3SA 4KRFA 4F17A 1H3ZA 1Q7YR 1R0CB 4F4KA 1X43A 1MMDA 3H45C 4TUYB 4LSNA 1NJWA 1GLLO 2BTTA 3WXKA 1GLBG 2ECZA 4DTJA 1BI0A 3C0CA 3P83D 3CCVT 2AJQA 1T0KB 2RQTA 3U3YA 3S3NA 3U3GA 4M77B 1NK7A 1YCYA 2NRHA 4K0KK 2RHOA 3CHWA 2HL3A 4CD1A 5GJVB 3OS0A 1SHFA 1KVCA 5JVDA 4DUZK 2CP3A 2VG7A 3G71Q 4DBFA 3EG0A 1NYGA 5IXBA 4LY7A 5KMGB 4M7DF 3KWIA 2NUPB 4CGDA 4GV3A 1W5EA 1RBTA 2QTDA 3SYZA 5GANj 3CG7A 3RWUA 3S3MA 1Q7YU 1Q95G 2JS2A 3OS1A 3QESA 1YJWN 3VRZA 5IHKA 4ZN3A 1JXBA 4ESRA 4IZ9A 1VQON 2KZZA 2QEXA 2QWLA 3CJAA 3VOBA 1NGHA 2GF7A 3O5ZA 3R8EA 1R0AA 1X25A 2IS3A 2KYBA 3T19A 5AR0A 2GEMA 3KLFA 1UEBA 4KGXB 4BDYA 1VOMA 3ZEHA 1FKPA 3K14A 4YDUC 4HUGA 5BPLA 3KK2A 4OJRA 4OMPA 3MK6A 5AJ3K 4JK9A 3HPWA 1WZOA 2PAVA 2CP2A 1CSKA 4CZHA 1XNIA 1OH5A 2NRVA 5GMKh 1SZ2A 2I6RA 3DYAA 4GY5A 3N2GB 4ZHRA 1QWEA 1WSGA 4YORA 2N48A 4X1YB 1M27C 5MN5A 4JN4A 2CGLA 3JALB 1DGKN 3O08A 4JD2A 2XY6A 2ZVZA 2IGIA 1X9SA 3RYHB 3WXLA 5LJ3e 4DQIA 2Q2RA 2YHYA 2C0IA 2WSCE 4NLCA 3WJQA 1WHLA 1N36K 3JAKB 3HKCA 5C25A 1Y71A 1ZA1B 2L3QA 3D45A 3CJBA 4DSIA 3TARA 1IBMK 2RQUA 4FM4B 3HP6A 3THYB 3O3GA 1OPKA 1CKAA 4FFBB 3G71T 4W5TA 1QVGM 5IYZB 1XV2A 1VQKF 4HCBA 4X64K 3CPWP 3CXCM 5GANg 1FMWA 1RAHB 4IFVA 2YT6A 3P8HA 3UATA 1M1KR 3AO2A 1NM7A 4G1QA 4CZJA 3EHQA 4EIAA 5A2QO 4AILC 2FVUA 4GVEA 2QASA 2RN8A 1OYXA 4KI6A 1N34K 4AH9A 2CGHA 2O9SA 3L3UA 1NG9A 5TKWA 2KTUA 2HAXA 2LNVA 2A3ZA 5FROA 4A57A 3J81M 1OKJA 4CJ3A 3C6TA 5AQTA 1IGUA 2D1KA 3E66A 3VEZA 4HHTA 2NYSA 3B6NA 4JKGB 3N2KA 3BY7A 2W6LA 1LWEA 3V4IA 1W2BM 2E2NA 3DWLA 5LOVB 1W70A 1H3HA 3QZ5B 4JZ3A 4M7DG 3BY5A 3TI0A 3EN9A 5EC7A 2EYYA 1K9MC 2I7PA 4MZPA 2HNIA 1FKOA 3V9UA 2BTOA 1C0GA 3WJPA 4PJNA 2FL7A 1M1KU 4RCHA 3CFRA 2OZMA 4JYAK 3FPIA 3S0YA 2LJ0A 3SFMA 4WQ4A 4C92F 3IR9A 1CLIA 4LD0A 2MIOA 4F3OA 4F7UB 4BVTA 2QGFB 1B7TA 2ATQA 3HRTA 3HYFA 4QQGA 3CBPA 1KK7A 4M75B 4RG2A 1ASUA 3QETA 3JATB 3VTIC 2GV9A 2LRQA 2VVKA 4CZKA 2JS0A 3AO5A 1WI7A 4BGBA 4N0AC 2OI3A 1NGJA 3AVKA 3T3FA 2XIDA 2E6MA 1HQUA 2CW4A 3BE3A 2ZJRL 2GELA 3V7CA 1UA1A 2Z1IA 4BRHA 3QIIA 4DLEA 1NOYA 4A5AA 3AVBA 2EQMA 3EH1A 1TL1A 4J9EA 1I94K 3QTYA 4KFBA 5CKFA 4Z89A 2UXDK 4C8OA 1IV3A 5KCOA 2X74A 1I1JA 2Q97A 5KCHA 2JUFA 1Q7YH 1BHLA 1KQSF 1I5OB 4N41A 3CYQA 1IGQA 1RFQA 5KGXA 2YV0X 4HTLA 1QQOA 4DR5K 3JASB 2VGNA 3EY1A 5M1KA 3TAPA 4IFYA 5LP6C 3I5SA 1M5Q1 2AK5A 3HM9A 4CW7B 4KGVB 2F7TA 4DF4A 5AQQA 1YXQA 1IPAA 4M3TA 2YSQA 1NZ9A 2QQAA 2XHCA 2EGAA 3GYQA 5LJ3d 1ZYQA 3M4GA 2B5JA 1NGBA 4ZOLA 1UWBA 4J2AA 8ATCB 1X7OA 4BG9A 1UA0A 1XHZA 2KKZA 1F1BB 5D6WA 1EO1A 2HKQB 1WSIA 2E65A 2YWWA 3KXTA 3CMEA 3NGPA 2AZSA 3QO3A 3WQTA 1N5YA 2G8WA 4WTOB 1H92A 3GBQA 3LPTA 3K0SA 4JI8K 3P4EA 2JGUA 2KDSA 3T1YK 4B1VA 3VQDA 5EZYA 3ER0A 1SKUB 3CPEA 4M7AC 2FG0A 1EQYA 1MU2A 2J6KA 5FNVA 1GCQC 4ELTA 4DEXA 2O8DA 3KJJA 4IHJA 3M5AA 2FRWA 1UGQB 3X25B 4M42A 1R8OB 2BANA 2DXCA 3AHUA 4PJOB 1RNHA 3E9OA 5HXZA 4TVRA 2VCPA 3KK1A 2CHTA 5LXTB 5LMNK 3ZT1A 1VQPA 2ZJPL 3WGKA 3EHRA 3P8BB 3OJSA 1NKCA 4DBRA 2V9YA 1JJ2F 2JNGA 2X4YA 4C92G 1ZSZA 1T3LA 3J80E 1UGVA 3CCLQ 1NLOC 3CI5A 2F4VK 3THVA 1X01A 3ZFJA 1HKCA 3VQ5A 2Z1EA 4BRFA 2F5TX 1WHGA 2VUBA 2E1ZA 2AZVA 3AO4A 4ISGA 3HJFA 5GAN6 2IG0A 3CC2N 1IHVA 5AQZA 3MCPA 1VK3A 1TKXA 1M1FA 3P4IA 4O5FA 3CMEQ 4I6MA 3LDNA 4RTTA 1X6OA 3PT9A 1BOTO 1YJWF 3ID8A 4MLHA 1JL2A 4CK1A 2DEQA 3O85A 3V4DA 1GLEG 3O9QA 4OLAA 1NEBA 1GO1A 1OFUA 1IV4A 2YLCA 2HNYA 2PMPA 3I3FA 3L2ZA 3UT5B 3C6AA 3EG2A 3G4SA 3AO3A 3G0ZA 3BP8A 3VERA 4MO5A 4E7HA 2FF3B 4JI7K 1PF5A 1S9EA 2YNHA 3WXJA 4FVUA 5GAN2 2QWNA 3SUPA 1M1KH 2GWJA 3MWPA 1UDLA 4FM2A 3OTOK 5EYPA 1QP3A 2ZPGB 2E20A 1G83A 4KV8A 4ELZC 2ASMA 4OVAA 3VCZA 3JCMP 3ME9A 4Y1DA 2JMAA 2JM8A 4DBQA 4BT7A 3G6EA 4TV8B 1FNKA 3VS1A 4F6RA 2RI2A 3M0SA 4F16A 2Q3SA 2YNIA 3G1JA 3CCSN 1VQ9A 1JN1A 1SKSA 3ZSYA 3EZ5A 4X1IA 3VUBA 3VPZA 4M63C 3PTAA 3UKRB 4MZTA 3IFRA 5GAHP 3JCMW 1PXWA 3LZIA 2IVPA 2W42A 3QPHA 2EYXA 1OVYA 4F7UF 2DFUA 1DKGD 3H6EA 3ZX3A 4FLZA 1WSHA 3ZLJA 4BDZA 4O6JA 3CCLT 2F96A 2Y4YA 1ASWA 3I33A 3R0PA 3WXMB 3CCEQ 2P9KA 5LJVA 5CZ1A 4AQYK 1JLCA 1KLNA 3G4SQ 3MMVA 1N6AA 1DJ7B 3SQ2A 1QQNA 1R77A 4FU6A 2LP5A 4PKHA 3VYUC 4M78F 4H5VA 1KQSS 2LQNA 3HWUA 5LMUK 2AIFA 1MWMA 1RAIB 4IEIA 1V1CA 4RCBA 1YNZA 3G6EQ 1S9GA 3V9SA 4IUPA 3VENA 1VQ9Q 2QA4T 2FPEA 3EEQA 4I7FA 1Z05A 4CHZA 1GZ0A 3IMPA 4M3YA 2P0PA 2OHWA 3LH5A 5I22A 3AARA 3BEXA 1YHQF 2W40A 2VWKA 2GUPA 2NNWA 2YUNA 4FWMA 1BIAA 4O5BA 4JJNK 2NRRA 1SS6A 3CJ7A 3MX2A 5EOYA 3ZEUB 4O2BB 4A4GA 1JRIA 1LCKA 3OW2F 2OPRA 4BY6C 4PY5A 3EGDA 3JB9D 2OTJF 3RR8A 4CC4B 1NJIC 4JJCA 5J2MA 1M8VA 3FB9A 2DL5A 1ABQA 2SEMA 3SAFA 4ZI7A 2L89A 1KFDA 2P1JA 3P1GA 1VQ4A 1NJIO 4A2AA 1JB0E 3FD5A 1CN7A 3DLGA 1RAGB 2E1HA 1NU0A 4DQQA 4ZTFA 1CXUA 5CA1A 4J8OA 3WUHA 2AP1A 2O8BA 3K58A 5AQHA 3O1WA 4DU1A 1GLCG 4JRQA 3F0FA 1B9FA 4HCCA 3VN5A 3CCET 3ENBA 2DVEA 3HKBB 2XDPA 3G4ST 5LJ5g 1SDSA 3DLMA 3LP0A 4K43A 1WJRA 2Q0UA 4N5SA 4C8IA 3AV9A 2XY8A 3CCUA 4C4WC 2DIQA 2RPIA 4IWVA 1JJ2S 5AT1B 3UT1A 4FCYA 3AVMA 1S72A 4OMFB 4LDVA 1KTQA 2P51A 1HXDA 1XMQK 4OB0B 4CJKA 4M3UA 1VHAA 1W6XA 4OKEA 1FFXB 3ISNC 3D2FB 2RHUA 2O8EB 2MI6A 2RM4A 5JVGL 4DKWA 3G6ET 1W9HA 1Z5VA 3HSCA 4R79A 1RI0A 4F7UG 2K2VA 3QLHA 4A2BA 1HPZA 3M55A 1VQ9T 1W581 1JCEA 1X9WA 4FLTA 3EG3A 2XU8A 2KT8A 5JH7B 1XBIA 3U23A 3SMSA 4FLWA 3HBTA 4I9QA 1BYMA 4WQ4C 2EJGA 4DRXA 3LLRA 4JDSA 1JLEA 3BDPA 3N2GA 2PNIA 2XG8D 3VA3A 2XKOC 3H0FA 4JRIA 2DEUA 3CIPA 1K8KB 3WQUA 4M78G 1VQ6T 2DMOA 3IS9A 2ZGZA 1RADB 3VRYA 2P9SA 3C9RA 2EQKA 4M77E 1NPRA 3C6UA 3K9KA 4JHDB 5HRPA 3MXMA 1WXBA 3CCUQ 2DL7A 1OZ2A 5C12A 1QVFP 2O4XA 2RJFA 4OPJA 1S72Q 4MZMA 1OU8A 3L1AA 4FYYB 4IDKA 2K6DA 1J9AA 4O2AA 2YKNA 2E41A 4C8QE 4JI6K 2X4JA 1WNSA 1NGCA 5E26A 3SMPA 4BRLA 5IJ9B 1WNLA 3CC7N 1X6BA 1ZLMA 3UWNA 3ASMA 4AG2C 4LNUA 5LL6S 2I5JA 2HQXA 5T7BA 4F2RA 2O4IA 1WQWA 3P8DA 3LANA 3QEVA 1DBFA 3KFVA 5LJ5e 3OYMA 2X3XD 2EWSA 4EAHD 4Z8AA 3CCLN 4L3QA 4CJUA 4DS5A 1U49A 3F2KA 3ASKA 4KUDK 4A61A 3O4QA 4FM0A 2CUBA 1VRUA 2A5XA 2RKIA 5FPMA 2CZWA 1OX8A 4HVVA 3C7NB 3IRXA 3QHDA 4CHYA 2OJ2A 3CC2F 3UB5A 4FT2A 4J9FA 1L3TA 3ZP4A 4Z4IA 1YITA 3RYFA 1VYVA 1U3LA 2A6AA 4C0ZA 1SEMA 3NH2A 3K5OA 3FJPA 4HCKA 4AHSA 4WF9L 5AVMA 4QS7A 1NJIR 3UDCA 4PA1A 2QA4N 3TTCA 2OYQA 4RTFD 1ZBHA 2ZPEB 1W5BA 1NKEA 3LGFA 4BI3A 3T7ZA 2X9HA 4FSXA 4RHAA 4BR7A 2DBKA 3QMLA 2KK4A 5ADXH 3RA6A 3CCUT 2DYYA 3OW2S 1IKVA 4JRKA 1KAYA 1Y57A 1S72T 5AQKA 3R6NA 3KUFA 3EG9B 2DFEA 2PYJA 1M1GA 3VKIA 3K59A 1Y0MA 4CIEA 2KG4A 3VF2A 1Z6RA 3D2EB 3CCSF 4WCIA 1YCSB 1YN8A 1ZC6A 2HBKA 5CE3A 2ZM6K 4WQ5C 1ZSZC 3VETA 1RCHA 5IT9M 2VASA 1UHCA 5E41A 2ED1A 1F21A 3AVGA 2OTMA 2KXCA 4C5GA 1JEGA 3SPZA 3ZX2A 3NVKE 3JRZA 3SAGA 1NJIU 3SI6A 1YITQ 4LFBK 4BVQA 2DXBA 3IG1A 4ZHQA 1MV0B 3WNFA 4CHQA 3HKDA 3M1XA 4XU3A 1WBBA 3CCMA 3CCEN 3CQTA 3O9SA 2HS3A 3HKEB 4CGJA 1W59A 3O9UA 2BKDN 5GAN4 1VSJA 4C5HA 1NK0A 1AWJA 4KHYA 5GAN7 2FZCB 3E9PA 3RA5A 4WE1A 2IVWA 2VXEA 2Z1HA 3AVJA 5G4UC 3OYHA 1QVPA 5DM6L 4JI4K 2YKMA 5EZYB 3P0ZA 1HPMA 4CJLA 3QEIA 3QBYA 2JTFA 4X20A 1YF5L 2LSNA 2KHOA 1E7KA 1ZUUA 3BUZB 3JB9J 3JSCA 3FC3A 3I56Q 3M6GA 1C1AA 4B1ZA 4CGFA 3TSZA 4M75E 2G9IA 2R6R1 2X78A 2EWNA 3VYSC 3DLLL 3C9UA 4QQ6A 3MPUB 3PNWC 2LZ6B 4JRPA 2J6OA 4DQ2A 1TKTA 1WIEA 3I5RA 1U4BA 3CERA 2NRTA 2KT1A 2IAJA 4CVNE 1KXPA 2E2QA 3VA0A 4FL9A 5CY4A 3ON1A 5LJ5d 1QS4A 3CPWF 3VGLA 1VQ6N 1YJNA 3CCMQ 3H1QA 4X9DA 3QICA 4LH4A 1FW6A 5CQXA 2DT4A 3H3NO 4JI2K 4H0OA 5HRRA 4EB6B 3RKWA 4ILJA 5C10A 4B9NA 3QERA 5BR8K 2RK1A 1KQ1A 5AFUH 2H3EB 1ARKA 1YITT 5AZIA 2YUPA 3P38A 4IIOA 4RG8A 1HQEA 1SV5A 3MCQA 1RABB 3E1SA 3VS7A 1HRHA 1T3SA 2QQRA 3SWNA 3HKSA 4CJ7A 2ZGWA 4M7DD 3REBB 3E1YA 3QUIA 2IDOA 3PY8A 5JCOC 4OLBA 3VESA 2DKGA 2ROTA 3FDRA 1RILA 5J3BA 2OAWA 2OPSA 3QEXA 4FYVB 1DTQA 1RT5A 3EAEA 3LWOC 3QFUA 1KQSM 1YJNQ 1RGIA 3KLHA 3I56T 4FJMA 1GBQA 3TU5A 4B1UB 4LFCK 2V26A 4B1YB 2HBJA 4DFJA 2BE7D 5KQDA 4BACA 1W41A 2EQUA 1NGFA 3DJCA 3PVLA 3HXMA 3HSBA 2OPPA 3LGLA 2RN2A 5C2FA 2B4JA 3JSMA 2WACA 1OH8A 1YJ9F 3EYZA 4CHPA 2FBXA 4I55A 1VSHA 4E1MA 2KFNA 4ELVA 3C0BA 4PJOE 2Z01A 5GMKe 1FYNA 2D0AA 4DBHA 2AA4A 1NEGA 5D7UA 1ATRA 1LW0A 1NGEA 3NHGA 3PO4A 2F69A 1GX1A 5IHNA 1AEYA 1BUPA 4FWSA 1U8RA 2GTOA 1JFFB 4FW2A 1GOBA 4IIJA 2GTDA 1SKRA 2D4WA 3OHRA 1CK2A 5LJ3f 4LF9K 2F9ZC 3P5JA 3F70A 1NJIH 3S9HA 1EX4A 5GAOq 3N5BB 1ITGA 3B8AX 1Q7YC 5HBMA 4IUVA 4CI0C 2ZZDA 1VIEA 4N4IA 3CC7F 3L2VA 2B86A 1VQ7T 2DIGA 2JT4A 3H0HA 3MEDA 5IJ0B 5KYYB 2RHYA 2RE2A 3LDOA 3CF5L 2DXUA 2KROA 2YCHA 1WBDA 4M3XA 2O88A 4PK4A 4DV6K 1OU9A 1TVRA 2O31A 2A1RA 5JQGA 1Q18A 3TWHA 3M4YA 1JJ2M 1CZAN 2HVIA 2JN0A 4Q5WA 2A08A 4M7AE 4CZIA 3FZLA 2LTOA 4JS5A 1QCFA 1TH7A 1YJNT 1RTDA 2G8UA 4BY9C 5IT9O 3V7EA 4CIGA 3RYIB 2W8BC 2KW4A 2A28A 1QTMA 4G9ZA 3LDQA 3JB9H 4LCKA 1X2KA 1ONIA 2MAMA 3H6ZA 1YVNA 5EIBD 4ZHVA 4O4HA 1MMNA 1S1UA 3CCQQ 2YNGA 5KPRA 1UHFA 4AFUC 3CMAA 1L3UA 5J2TB 1VHXA 1JXMA 3E9LA 2VWBA 2KTVA 4B3SK 4CRIA 4J9DA 3HL8A 2UZHA 4BVRA 4FW1A 3S0HA 4ATOA 3RYCB 2QA4F 1LV5A 5ADXA 4J9BA 3NGYA 4CFDA 4C92D 4OB1B 1BU1A 2GWKA 5ELZA 5AZJA 3LPUA 3TABA 1M8MA 3S6WA 4EMKB 2V52B 1RBSA 3ZETA 3ZT2A 3H1VX 2DFFA 3HT3A 2G8IA 1AHJB 4C5IA 3WPWA 1KD1R 3ITHA 4E47A 2HHWA 2HHHK 1JO8A 2KQWA 4L6V5 2XD0A 2GCXA 3PSFA 4B3RK 3F5TA 5GAOp 3MECA 1VQ8A 1O13A 2PQWA 3V1OA 4DV7K 4I50B 1M2VA 2FHDA 1BCOA 4BRQA 3JAMM 4CEBA 5LJ3j 1X3MA 4X34A 2OTLA 4C8MA 2X4WA 2MWPA 4JI1K 1W55A 2VAMA 2COWA 3MDQA 2R57A 3J81E 3CMAQ 3KE1A 2CVLA 4M77D 1PG5B 4YJ2A 1QZ5A 5IXFA 4KH4A 1BCMA 3EFRA 4DR6K 1M3CA 2O8FA 1AWOA 4BR2A 3SIUA 4FT4A 4J9HA 5I2MA 1KD1U 3O4WA 4A54A 4E6EA 2YXZA 3SV3A 1M1KC 1D1CA 3FRNA 1QCNA 3M56A 3OYKA 3CBMA 1I0CA 2EGCA 1GXIE 1UAXA 3GDQA 3WT0A 3I9QA 1GLDG 3VV0A 1S6QA 3CCQT 2CSLA 2K5LA 5HWEA 5LYJB 3DB4A 2F5KA 1YJ9A 3VQPA 1M1KO 1X9JA 2HVYD 4EI9A 4B45A 4E2FB 3MKDA 3LP1A 3O9TA 1BDGA 3I56N 2CDTA 4OGCA 5GAOn 4BQLA 2OPQA 1VQ8Q 3GNGA 4CFBA 4YOWA 1K73O 2UYNB 3EKUA 4IDHA 4JI3K 2K1SA 1UFFA 1MMGA 4CZFA 1PNJA 4EP5A 2K2MA 2OTLQ 2HHQA 4J2DA 1YI2A 1QVGA 3MDOA 2PUOB 5KX5A 3NVIB 3CXCA 1EETA 5DCVA 2UYJA 3JVHA 4KHSA 5GAMh 4AFSC 5KE2A
chains in the Genus database with same CATH topology
5D6YA 4B9QA 1R59O 3OW2M 1VQ6F 4MO4A 5M1OA 2IIRA 5LJ3g 1BU6O 4OGEA 3IDHA 3ENOA 5AFUA 1VQMN 3OYIA 1W2BA 4XQ3A 3X20B 3OY9A 4FWNA 2RO0A 2OZBA 1VQ7N 4EFHA 2KMTA 4C8QB 4MDXA 2YHWA 1VQLT 5KE3A 1V29B 2E1YA 5AQSA 2LBXA 5HY6A 2HBMA 3CC4A 1VQ8T 2E12A 5JLHA 2Q31A 1DT9A 4IUUA 3LDLA 2OTLT 3VYHB 1BO5O 3L2WA 4A5BA 3HP9A 3VF4A 5GAEP 4JLIA 3AGRA 3DB3A 1GLJO 1E4FT 4C5EA 5DCVA 2QQSA 1KQ2A 1Y96B 4EDUA 4A4EA 3A5NC 4QW2A 5I2SA 4XH5A 3P31A 3SWNC 3IKMA 2PVDB 4MLEA 4C1NI 5GINA 3M57A 1WJSA 3HAXD 1BA0A 2I6DA 2XI9A 3OA6A 1D3BB 2VYTA 1QP2A 2QQBA 1LOTB 1KD1H 2PVOB 4M78D 5AQGA 3RESA 3FGUA 5KQ8A 1YIJA 5GAGP 3OA9A 4WFNL 2L5QA 3MX5A 1QVFF 3LW5E 4BE1A 4HKEA 3I55F 3CCQN 1QZ6A 3OYGA 3CCJF 4UY8O 5FLXM 3A5LC 3X28B 3V3TA 2FB7A 2WSEE 4BG8A 2D9TA 4BQZA 4M78C 4C0DC 1NGIA 1K73U 3S41A 3META 1IZ6A 3LWIA 4Z94A 2DXTA 4IO8A 3EO3A 4IFEA 2NLUA 1M90U 4PL6A 2QEXT 2V7ZA 3CC4T 4J7IA 3I8BA 4MDWA 2H3GX 4A4HA 2W41A 4N4GA 4ISFA 3CCVN 4BC3A 4UC4A 3JCMh 2D6FA 2R5MA 4PJOD 3H3OB 2ZGYA 4N4HA 4M77F 1NM1A 2LBWA 3HFNA 3OSVA 3HFOA 1VQLN 3TTDA 5C6SA 3EE9A 3QJ6A 1P92A 3OMCA 4X9CA 4C8QF 4PL7A 5BRDA 1WOQA 5DLOA 1TYQA 5JMVA 5AQPA 2CZ1B 3RUXA 3A8GB 1RDWX 5HL7L 2FSNA 3TPQA 2OTLN 2YI1A 1QW1A 3MEUA 3FZHA 1BI2A 3AAQA 1EIFA 1IG8A 1NGGA 5GAN8 2RB6A 3ZYYX 4BVSA 2LQKA 4Y28E 1YIJT 1M9SA 1W3EX 4WCEL 3WVEB 5CVIA 3VI6A 2FLOA 5LJWA 1VQMF 3VF6A 3A8MB 5LJ5f 4WQ5A 5FPDA 4OB3B 5HK0A 3GG4A 2A40A 5GAPK 1VQ7F 3ID6A 3G71N 3VEOA 2YJFA 5FJ4C 3BF3A 5EWRA 3KVGA 2P4TA 2P9IA 4J6XA 1VQOF 3FIFA 1VUBA 2WUSA 1QVFS 3PLAC 1G3TA 3CD6A 1VQ5A 4ELYC 1ZBSA 3MEAA 1E4GT 3OYEA 5FU6C 4M77G 4M7AB 5BR9A 4H5WA 1K73H 5GAOr 2EJ9A 5CO7A 4J5YA 4IOCL 2WBNA 2QWPA 4C8QG 4PKIA 3MN5A 2ALEA 3DXMA 3CCRA 1M90H 1VQNA 3UE5A 3UKUA 3KBGA 2E10A 3M3ZA 2RK2A 2QEXN 2P9LB 1I8FA 4M75F 2QWMA 2QW9A 3ATVA 3O5BA 2PVGB 3O8VA 2I2LA 3TSPA 5L8RE 5AQFA 5LJ5j 4BC5A 4CZLA 5J39A 3CMET 2E70A 3T9NA 3NVMA 4BVPA 2BO1A 3R6OA 2A3LA 3OYYA 2YHXA 5HY2A 1FXXA 3VGKA 3WEEA 1BI3A 3C95A 5IN1A 4ME7A 5C15A 3OYBA 2P9PA 3CQXA 4DCHA 2ZCFB 1VQPT 3U8XA 4FWLA 1K8AO 4U7BA 5GINC 5J26A 3CBOA 4M7DA 2MF2A 2ZWHA 3V7RA 3KK7A 3FLGA 3AY9A 2GLZA 3V7QA 5HY0A 5I9EB 3CD6T 1VQ5T 3MO8A 3EL2A 3CCVF 5EX5A 3QBXA 4PJOF 4B9XA 3ULEA 4H0YB 1I4K1 2M9UA 3HHTB 2PU9B 3VUZA 4CI6A 3IUCA 4A62A 1VQLF 3CCRT 4JD2B 3E19A 1VQNT 4BY6B 3FZMA 3V8LA 4M75G 2E6NA 3CQYA 3JCMM 3RMSA 2QM1A 3DLLA 5DY9A 4NS5A 2K5FA 4B9WA 4JLGA 1H7MA 3OQ5A 5GANh 3JCMX 1ZHIA 3N4ZA 1BIBA 5F1XA 1U2VA 2P9NA 3L4QA 2ASPA 3MN6A 4P5NA 3J80M 1SAZA 4M7AF 1VQKA 4DOVA 2ITMA 3AAPA 3N4YA 2D0QB 2CZ7B 2E5QA 2D0OA 2WFBA 3RMQA 2F9TA 4QVDA 1HX1A 1RDUA 2AHJB 1KG1A 4E7LA 5JVHL 3INZA 2LT1A 3L0QA 3LX7A 2XK0A 3GOXA 2J4RA 5D6XA 2C06A 5G4VC 3G71F 4IXCA 4NLBA 2XICA 1Q86C 4IKFA 4BROA 3CMEN 1VQ4T 4YOYA 2BIVA 5FPEA 4C92A 2BH1A 3K9JA 1MWKA 3BF1A 1Q86O 4NL3A 3HZ6A 1G3WA 3M1FA 2HF3A 1FWZA 4D6WA 4PJOG 4EPCA 2OANA 5LY3A 1ZXOA 4B1XB 3TSQA 4C0FA 5A0DA 2JWKA 3QDRB 4JAXA 5CR2A 3GPLA 2RA2A 4XTZA 1VQPN 4XU1A 3QBWA 3VYGA 3W3DA 3WXIA 2YX6A 5GMKj 4GLKA 2HSTA 1K8AU 1T6DA 2K4YA 4M77A 4QVCA 1KQSA 3O6WA 3TCJA 3X24B 1QHAA 3G4SN 3CD6N 1ZQ1A 4M7AG 4BRNA 3OYNA 2K5IA 5BPMA 3M54A 4JNEA 2ASOA 4H5RA 4FOEA 1VQKT 1Q81O 3DAWA 3G6EN 4BW0B 3LWQC 3FEOA 5CKEA 3KZBA 1VQ9N 4KULA 1J6ZA 5A2QE 1QVFM 3E9FA 2RI3A 4XTXA 2R58A 1V4TA 3O8MA 1ZWZA 2FGYA 3M5RA 1XUPO 4Z02A 4R56A 2DD4A 5GAMe 4RCCA 3U9ZA 5GAN3 1JJ2A 4ZGJB 2I7NA 2JVVA 2DPPB 4I6MB 3M58A 2NZTA 1KD1C 3FLCO 1ATNA 4ZTJA 4PKCC 1YJWA 1KD1O 4K42A 2QXLA 3R9PA 2RJDA 2DTIA 2E88A 3SBGA 4HT8A 2E2OA 2XDDA 2PUKB 4PLIA 4YOTA 2Y90A 5HK3A 4WFAL 1B34A 2Y4XA 3C4SA 4JKGA 2FYKA 3MHXA 3ZBDA 3OSSC 3OYCA 2M1HA 1VQ4N 4XEIA 2EIFA 3FZFA 4BRDA 4ZGEB 1NGAA 2B8AA 2P9KB 1G5VA 4QS8A 1Q86U 4F7UA 4M7DC 1UB4A 3CCMT 3QXEB 3VEXA 4OB2B 4BC2A 4Y91A 5IAYA 2EFIA 3CJCA 1MHNA 5M9OA 1K8AH 3CCUN 1S72N 3RSEA 4CZMA 2QQ9A 2PFUA 5H1SQ 4M78A 4E7IA 2RHZA 2QI2A 4IOAL 4PNOA 4B1WB 3JCMg 1T3VA 1G99A 1PSFA 3CCLF 2M16A 1YHQA 2DTHA 3GNFB 3V7SA 4YOXA 4BUGA 4JKFA 5EY4A 1U1TA 3V8KA 1WPYA 1N8RO 3OW2A 4XK8E 2OTJA 5GAMd 4XU2A 4XAXB 4XTWA 3CMEF 3SAHA 5FU7C 3PAFA 2P0KA 3OYJA 3Q7CA 4R55A 5KPZA 3SLCA 1W4SA 1S3XA 4DA4A 1Q81U 5C2DA 3Q7BA 2ZPFB 2K3YA 1OI1A 4H0TB 3ULEB 1BI1A 3CPWS 2V7YA 2GFUA 3QHSA 4H5NA 3RVCA 1KAZA 4CBXA 4PJOA 2VXFA 3NK7A 4DHYA 3SD4A 5CHIA 1H1VA 1O75A 5CIUA 3JCMJ 2IVNA 2QXFA 4IJNA 3OYAA 1YITN 1SSFA 4ILHA 1D4XA 3JCMe 4OF1A 3T69A 3CCEF 4DOWA 4C92C 2P9SB 3G4SF 2L8DA 2RJEA 2R5AA 3VU3C 2D0PA 5C0YA 5FRNA 2O4XB 5MLCQ 1NPPA 4BREA 4C8QD 2LC4A 4TZZA 5CQYA 1VAZA 3VJPA 1WQ7A 3QYGB 1K73C 3CEYA 3G6EF 5E84A 5AQNA 5M1QA 2QWQA 1VQ9F 4BE2A 1Q86H 2YHTA 3V8JA 1M90C 4M7YA 3A5ZB 2KVQG 3PLAA 2HBPA 1X7PA 4RMOA 1M90O 4M77C 3DXKA 4JUVA 1HKGA 1BA1A 3LDPA 2FC3A 4O8UA 3FR0A 1YHQT 3CCMN 2DAQA 5AYFA 4VUBA 4C0GA 4BVOA 3J7ZO 5GAN5 3J8AA 4WYBA 4CD3A 2CZ0B 2OTJT 4NB4A 1WGSA 4BD3A 3CC2A 1GLFO 4XTYA 3S3OA 3CMAT 4BRKA 4JK7A 2BTFA 3GL1A 2DD5A 3TU4K 1M4ZA 4NL2A 2QTXA 3ZX0A 2CKKA 5BREA 1KHCA 3SK3A 1KC8U 1YJNN 3HM8A 2RHXA 3ZEUA 2RHIA 5FRMA 3EZWA 5AQXA 1Q81H 1N8RU 3CCSA 1VQ4F 2K57A 2VYPA 5F2RA 1NLVA 4MDBA 4OPAA 4CZGA 1BKBA 4ISEA 3JCMd 3OYFA 2CGKA 1RL2A 5AQLA 3CCUF 3MP6A 1JCGA 5CKHA 1S72F 3OMGA 5BRHA 4XH1A 3FFKB 4FPBA 3SB2A 3VEWA 1NMUB 3L42A 1YJ9T 4M75D 4HT9A 4O5VA 4YTLA 3E20B 4H0XB 2A41A 4QQDA 3D2FA 1O9SA 1V4SA 1YI2T 3QYHB 4IUTA 3VTHA 3FE1A 3A5OC 4K25A 3GOIA 5DM7L 4WF2A 2RI5A 3PIPL 1NBWA 1MGQA 3WVDB 1BWFO 2Q36A 3BDLA 2RH2A 4NO7A 3LL3A 3CPWA 1NMDA 1MA9B 5BRFA 4BRGA 2FXUA 3GBTA 1K8KA 5AZIB 3M53A 4XU0A 4IJAA 4M75C 2LCCA 5EXWA 4JHDA 3CC2T 3SWNB 3GF5A 2E64A 2WSFE 3MEVA 4BGAA 4LDYA 1HLUA 4NUTA 2QWRA 1NWKA 3HTVA 4X3LA 4IUQA 2V8KA 1B34B 1I5LA 5KPTA 4HCZA 4BB7A 2GX9A 3PIOL 1YHQN 4FPAA 2Q0RA 4EHUA 3ENHA 1Q82C 3D00A 4K41A 2JOYA 4BR9A 2OTJN 2F9WA 1Q82O 3QB0A 3CCST 1YITF 1K9MO 4GV6A 3CMAN 3C7NA 2NRXA 4JKDA 3A8OB 3SBTA 3NTKA 4PL8A 1KC8H 3L2RA 3CETA 5AQUA 4BR0A 3RSEB 2CS7A 5A0LA 1N8RH 2EJFA 3C6HA 1X75C 5AQWA 4RWTA 4M78B 4C0DB 3LH0A 2DK3A 3RKYA 4AM6A 3O1BA 3I56F 5GANe 1VQ8N 2FF6A 3TEEA 4PJOC 3H8ZA 3CC7A 3D2EA 1U1SA 4M7AD 5HKCA 4A4KA 3QDKA 3OS5A 2M0OA 2HMPA 3CCMF 3CPWM 3CCLA 3MP8A 1N9RA 4O8KA 4RKUE 4E1JA 1YJ9N 1T6CA 4KH5A 3NMUA 4J8FA 2E8AA 1MDUB 4NOYA 5AZJB 5JLFA 4FWOA 4IEEA 1XQHA 1T44A 3ZETB 2QA4A 1YI2N 3PGGA 2JZ2A 2HOEA 3TREA 4JKCA 1YJNF 3A8HB 5BN8A 4GNIA 3LFOA 5CK9A 4JEPA 3VEVA 2HQEA 3MEWA 1JCFA 3CG6A 4AM7A 2RJCA 3CCEA 3LM2A 4ILGB 1GO0A 3OBWA 2GQVA 4U67L 1HK9A 4E7KA 2Q1NA 3CPFA 4M7DE 1P8ZA 3CC4N 4FSVA 1DEJA 4XTVA 1UGRB 5C0MA 1ESVA 4EI7A 3IMXA 5GANd 3GP8A 4BRMA 3DXKB 1HUXA 3CC7T 5EO3A 5LJ3h 4PKGA 3AGKA 1Q82U 5FU6B 1IREB 1K9MU 1KHIA 2V51B 3JB9I 3OS2A 2KY9A 4LDXA 5M1PA 4KH6A 1VQ6A 2WC9A 1K8AC 3CCQF 4Y0WA 2BUDA 5KH6A 3JCMQ 3M59A 5IT9E 3RKXA 2IVOA 3CJ1A 4HWIA 1PSEA 5GAMf 3C65A 4BRIA 5GIPA 3O80A 5TKYA 5AQYA 4EI8A 2JWLA 2QWOA 3N4PA 3BW1A 5DM7R 2G3RA 4KBMB 1YIJN 3GLXA 1S22A 4KBOA 1RA4A 3JCMc 4NQ3A 1LCUA 4MMKA 3VMFB 4FL6A 3SDZA 1SQKA 3R3LA 3QG1A 4IOXA 3GIBA 2KAFA 3LM9A 2V8IA 2P9UA 3NTIA 4H5TA 3CMAF 2VV5A 4H03B 3A8LB 3NTHA 1NE8A 4DB3A 1Y64A 2A7YA 2EAYA 3PMTA 3MCAB 5AQRA 5GADP 1H641 4CZEA 2ZF5O 2LCLA 5CCAA 2FSKA 5HXUA 2ZPIB 1HJOA 1G3YA 1LNXA 4C92E 4EMKA 3FFMA 1VQ8F 1HKBA 3U4LA 3N4QA 1ZBXA 4CBUA 1VIFA 4EMGA 2OTLF 4L59A 3LWRC 2MMPA 5GAMj 2LQ8A 2CZ6B 4II1A 3FZKA 2YRVA 2GFAA 1JBMA 4BE0A 1NGDA 4FWKA 2K3XA 1U6ZA 2P0QA 2LT4A 1QVFA 1XOVA 1OZ3A 5I21A 4CBWA 3L2QA 1YBYA 5BPNA 1YJ9F 3JS6A 3I55A 4ZGDB 3RERA 1Q82H 4F9OA 3CCJA 2MWOA 1K9MH 2ZJQL 4X3MA 2BUPA 1YI2F 1QVGF 2LDMA 3CXCF 1I81A 2CH5A 2EYQA 4JK8A 2HF4A 3HOSA 4EHTA 5GMKi 3L2UA 5F0XA 4BRAA 3L4IA 3OBYA 3QSUA 1Y7XA 4JKBA 5GAMg 5DLQE 2DZCA 1W2BF 4ZN1A 3A0IX 4WFBL 3OYDA 3VEYA 3VOVA 3HRUA 5GAOm 5JICA 4LD6A 4BC4A 1BG3A 1FX7A 3NMUC 3G7ZA 4BI8B 2KSSA 1TYQB 5GMKm 5M1FA 5GIOA 1GLAG 2E2PA 5CAIA 4C8QA 2QEXF 3JCMf 3JCMV 4XCQA 3DKMA 1P90A 1ATSA 3LYIA 4J83A 2NLXA 1VQ5N 4FWRA 3CC4F 4BI4A 1UGPB 3QZ9B 3I56A 3QJYA 1TUUA 1Q81C 1Y07A 3NK6A 4H0VB 3MN9A 2RHKA 4FOIA 2JNBA 4PHTX 4J7FA 2VC8A 3SJHA 3CCRN 2OAUA 1VQNN 5EVZA 3R1XA 2DO3A 4OO1J 3EE8A 1Y96A 3JAME 4FWQA 1VQMA 2LVMA 5GANK 3PMIA 1X3NA 3R6MA 5AQMA 5M1NA 3I55T 1YAGA 1W42A 4FO0A 3CCJT 3LWPC 4F7UE 1VQ7A 2P9IB 1N9SA 4XTUA 4J6YA 4FIBA 5HY1A 1D3BA 2HBLA 3MWTA 1YIJF 2NRWA 1C0FA 3NFCA 2DJZA 5CR4A 4E7JA 4MDAA 1VQOA 5HY4A 4LC9B 3JB9F 4YDUA 3P39A 4M78E 5GAOl 3NVKA 2CYZB 2HD0A 4JKEA 4IURA 4DQ8A 4KT0E 5AQIA 3DXMB 2CH6A 2EQJA 4XH4A 5BN9A 3E9GA 5GMKl 3UKUB 1QVGS 1WJQA 3JXUA 1LOJA 4YOVA 3CXCS 2LX9A 2X35A 2YJEA 4JKAA 3H46O 3J7AR 3Q1JA 2DZ9A 3G25A 5GIPC 4C23A 2V8JA 5A0GA 1YUWA 2KLAA 2JTMA 1TUYA 5CKBA 3ATUA 2EKOA 3HOTA 1W97L 3RIRA 4H0PA 2WALA 4M75A 4LDUA 1W2BS 4PLLA 3D7EO 4L5GA 3PFSA 4M7XA 3BFMA 1W40A 4YOUA 4QVZA 3WEEB 1UGSB 2P9PB 1KC8C 1IJJA 3HRGA 1WUAA 3KHYA 3J7AF 4BR4A 1KC8O 1N8RC 3LWVC 4LDWA 3X26B 2ZPBB 4BY9D 3CCQA 1VQMT 5AQJA 2X4XA 2NRZA 4AF1A 2ZPHB 2O01E 4EMKC 4M7DB 4A53A 3HI0A 3MN7A 4LD9K 5LJ5h 1VQKN 3JB9G 1Q7YO